BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig11282
         (768 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T51951|T51951 gamma-adaptin 1 [imported] - Arabidopsis thali...   185   9e-46   Arabidopsis thaliana [mouse-ear cress]
gb:BT004307_1637383 Arabidopsis thaliana clone RAFL16-01-N23 (R5...   182   6e-45   
gb:ATH133777_1552023 Arabidopsis thaliana mRNA for gamma-adaptin 2.   182   6e-45   
gb:AE005172_891343 Arabidopsis thaliana chromosome 1, top arm co...   182   6e-45   
pir|B96625|B96625 hypothetical protein T2K10.12 [imported] - Ara...   171   1e-41   Arabidopsis thaliana [mouse-ear cress]
gb:AB023482_1515598 Oryza sativa (japonica cultivar-group) genom...   165   1e-39   
gb:AC069158_1540669 Genomic Sequence for Oryza sativa, Nipponbar...   140   3e-32   
gb:BC047823_2549909 Danio rerio adaptor-related protein complex ...    91   2e-17   
gb:AB070228_2047301 Rattus norvegicus mRNA for gamma-adaptin, pa...    88   2e-16   
gb:AK036387_1164451 Mus musculus adult male bone cDNA, RIKEN ful...    88   2e-16   
gb:AK034198_1163674 Mus musculus adult male diencephalon cDNA, R...    88   2e-16   
gb:AK028360_1160947 Mus musculus 18 days pregnant adult female p...    88   2e-16   
pir|A36680|A36680 gamma-adaptin precursor - mouse>gb:MMADAPG_211...    88   2e-16   Mus musculus [mouse]
sp|P22892|A1G1_MOUSE|A1G1_MOUSE Adapter-related protein complex 1 gamma 1 s...    88   2e-16   Mus musculus [mouse]
gb:HSADTG_2010042 H.sapiens mRNA for gamma-adaptin.                    87   3e-16   
gb:BC036283_1981886 Homo sapiens adaptor-related protein complex...    87   3e-16   
gb:AB015317_1864693 Homo sapiens mRNA for gamma1-adaptin, comple...    87   3e-16   
gb:HSM800849_1185957 Homo sapiens mRNA; cDNA DKFZp586B1622 (from...    87   3e-16   
gb:CR860835_1184883 Pongo pygmaeus mRNA; cDNA DKFZp469F1514 (fro...    87   3e-16   
pir|T14753|T14753 hypothetical protein DKFZp586B1622.1 - human (...    87   3e-16   Homo sapiens [man]
sp|O43747|A1G1_HUMAN|A1G1_HUMAN Adapter-related protein complex 1 gamma 1 s...    87   3e-16   Homo sapiens [man]
gb:AJ720551_2502738 Gallus gallus mRNA for hypothetical protein,...    86   1e-15   
gb:BC073198_2557053 Xenopus laevis similar to adaptor protein co...    85   2e-15   
gb:BC045070_2549022 Xenopus laevis similar to adaptor protein co...    85   2e-15   
gb:BC044052_2548457 Xenopus laevis similar to adaptor-related pr...    83   5e-15   
gb:BC051833_1984690 Homo sapiens adaptor-related protein complex...    77   5e-13   
gb:CNSLT1I7F_1180570 human full-length cDNA clone CS0DI003YF22 o...    77   5e-13   
sp|O75843|A1G2_HUMAN|A1G2_HUMAN Adapter-related protein complex 1 gamma 2 s...    77   5e-13   Homo sapiens [man]
gb:AY144597_1303445 Dictyostelium discoideum clathrin-adaptor ga...    73   7e-12   
gb:AE014187_938995 Plasmodium falciparum 3D7 chromosome 14 compl...    72   9e-12   
sp|O88512|A1G2_MOUSE|A1G2_MOUSE Adapter-related protein complex 1 gamma 2 s...    72   1e-11   Mus musculus [mouse]
gb:AE016818_1748388 Ashbya gossypii (= Eremothecium gossypii) AT...    61   2e-08   
gb:AE014298_1124901 Drosophila melanogaster chromosome X, comple...    57   5e-07   
gb:AE014298_1124899 Drosophila melanogaster chromosome X, comple...    57   5e-07   
gb:AE014298_1124898 Drosophila melanogaster chromosome X, comple...    57   5e-07   
gb:AE014298_1124897 Drosophila melanogaster chromosome X, comple...    57   5e-07   
gb:AF190863_1889022 Homo sapiens ADP-ribosylation factor binding...    56   8e-07   
gb:AB029003_1865859 Homo sapiens mRNA for KIAA1080 protein, part...    56   8e-07   
pir|T00744|T00744 KIAA0154 protein homolog A-735G6.4 - human>gb:...    56   8e-07   Homo sapiens [man]
sp|Q9UJY4|GGA2_HUMAN|GGA2_HUMAN ADP-ribosylation factor binding protein GGA...    56   8e-07   Homo sapiens [man]
gb:BC062933_2105078 Mus musculus golgi associated, gamma adaptin...    54   4e-06   
gb:BC057377_2102746 Mus musculus golgi associated, gamma adaptin...    54   4e-06   
gb:AK129280_2069511 Mus musculus mRNA for mKIAA1080 protein.           54   4e-06   
gb:AK034612_1163814 Mus musculus 12 days embryo embryonic body b...    54   4e-06   
gb:HS37E16_1998359 Human DNA sequence from clone RP1-37E16 on ch...    53   5e-06   
gb:CR456493_1992784 Homo sapiens GGA1 full length open reading f...    53   5e-06   
gb:BC044629_1983504 Homo sapiens golgi associated, gamma adaptin...    53   5e-06   
gb:BC000538_1966812 Homo sapiens golgi associated, gamma adaptin...    53   5e-06   
gb:HSM800873_1185961 Homo sapiens mRNA; cDNA DKFZp434A033 (from ...    53   5e-06   
pir|T14759|T14759 hypothetical protein DKFZp434A033.1 - human (f...    53   5e-06   Homo sapiens [man]
sp|Q9UJY5|GGA1_HUMAN|GGA1_HUMAN ADP-ribosylation factor binding protein GGA...    53   5e-06   Homo sapiens [man]
gb:BC080229_2561616 Danio rerio zgc:101044, mRNA (cDNA clone MGC...    53   7e-06   
gb:BC090031_2111191 Rattus norvegicus golgi associated, gamma ad...    52   9e-06   
gb:AK080881_1173109 Mus musculus 4 days neonate male adipose cDN...    52   9e-06   
gb:BC073000_2556915 Xenopus laevis MGC82581 protein, mRNA (cDNA ...    52   1e-05   
gb:AK122212_2068877 Mus musculus mRNA for mKIAA0154 protein.           52   1e-05   
gb:AK031086_1162289 Mus musculus 13 days embryo forelimb cDNA, R...    52   1e-05   
gb:D63876_1994839 Human mRNA for KIAA0154 gene, partial cds.           52   2e-05   
gb:BC070044_1988394 Homo sapiens golgi associated, gamma adaptin...    52   2e-05   
gb:AF190864_1889023 Homo sapiens ADP-ribosylation factor binding...    52   2e-05   
gb:CR382130_1663448 Yarrowia lipolytica chromosome D of strain C...    52   2e-05   
gb:CR859188_1183321 Pongo pygmaeus mRNA; cDNA DKFZp459F1725 (fro...    52   2e-05   
sp|Q9NZ52|GGA3_HUMAN|GGA3_HUMAN ADP-ribosylation factor binding protein GGA...    52   2e-05   Homo sapiens [man]
gb:AK004632_1152471 Mus musculus adult male lung cDNA, RIKEN ful...    50   3e-05   
gb:CR382128_1661227 Yarrowia lipolytica chromosome B of strain C...    50   6e-05   
gb:CR382125_1658185 Kluyveromyces lactis strain NRRL Y-1140 chro...    48   2e-04   
gb:CR380947_1649098 Candida glabrata strain CBS138 chromosome A ...    47   4e-04   
gb:AE017341_1754029 Cryptococcus neoformans var. neoformans JEC2...    47   5e-04   
sp|P38817|GGA2_YEAST|GGA2_YEAST ADP-ribosylation factor binding protein GGA...    47   5e-04   Saccharomyces cerevisiae [brewer's yeast]
gb:AL772295_2504513 Zebrafish DNA sequence from clone CH211-14A1...    43   0.007   
gb:CR382139_1672712 Debaryomyces hansenii chromosome G of strain...    41   0.021   
gb:CEY105E8A_1369203 Caenorhabditis elegans YAC Y105E8A, complet...    39   0.080   
sp|Q99128|ADG_USTMA|ADG_USTMA Gamma-adaptin (Golgi adaptor HA1/AP1 adaptin...    38   0.18    Ustilago maydis


>pir|T51951|T51951 gamma-adaptin 1 [imported] - Arabidopsis
            thaliana>gb:AF061286_1765209 Arabidopsis thaliana
            gamma-adaptin 1 mRNA, complete cds.>gb:AF124524_1770249
            Arabidopsis thaliana gamma-adaptin 1 gene, complete cds.
          Length = 876

 Score =  185 bits (469), Expect = 9e-46
 Identities = 90/114 (78%), Positives = 102/114 (89%)
 Frame = -2

Query: 752  AFESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSN 573
            A+ESSS+K+ F FSK PGN QTT V+A FTN S N FTDFIFQAAVPKFLQLHLDPA+SN
Sbjct: 763  AYESSSLKIEFTFSKTPGNLQTTNVQATFTNLSPNTFTDFIFQAAVPKFLQLHLDPANSN 822

Query: 572  TLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFPRGL 411
            TLPA+G+G+ITQ LRV NSQ GKKSLVMR+RIGYK+NGKDVLEEGQ++NFPRGL
Sbjct: 823  TLPASGSGAITQNLRVTNSQQGKKSLVMRMRIGYKLNGKDVLEEGQVSNFPRGL 876



>gb:BT004307_1637383 Arabidopsis thaliana clone RAFL16-01-N23 (R50014)
            putative gamma-adaptin (At1g23900) mRNA, complete
            cds.>gb:BT005557_1638497 Arabidopsis thaliana clone
            U50014 putative gamma-adaptin (At1g23900) mRNA, complete
            cds.
          Length = 876

 Score =  182 bits (462), Expect = 6e-45
 Identities = 90/114 (78%), Positives = 101/114 (88%)
 Frame = -2

Query: 752  AFESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSN 573
            A+ESSS+K+ F FSK PGN QTT V+A FTN S N FTDFIFQAAVPKFLQLHLDPASSN
Sbjct: 763  AYESSSLKIEFTFSKTPGNLQTTNVQATFTNLSPNTFTDFIFQAAVPKFLQLHLDPASSN 822

Query: 572  TLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFPRGL 411
            TL A+G+G+ITQ LRV NSQ GKKSLVMR+RIGYK+NGKDVLEEGQ++NFPRGL
Sbjct: 823  TLLASGSGAITQNLRVTNSQQGKKSLVMRMRIGYKLNGKDVLEEGQVSNFPRGL 876



>gb:ATH133777_1552023 Arabidopsis thaliana mRNA for gamma-adaptin 2.
          Length = 876

 Score =  182 bits (462), Expect = 6e-45
 Identities = 90/114 (78%), Positives = 101/114 (88%)
 Frame = -2

Query: 752  AFESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSN 573
            A+ESSS+K+ F FSK PGN QTT V+A FTN S N FTDFIFQAAVPKFLQLHLDPASSN
Sbjct: 763  AYESSSLKIEFTFSKTPGNLQTTNVQATFTNLSPNTFTDFIFQAAVPKFLQLHLDPASSN 822

Query: 572  TLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFPRGL 411
            TL A+G+G+ITQ LRV NSQ GKKSLVMR+RIGYK+NGKDVLEEGQ++NFPRGL
Sbjct: 823  TLLASGSGAITQNLRVTNSQQGKKSLVMRMRIGYKLNGKDVLEEGQVSNFPRGL 876



>gb:AE005172_891343 Arabidopsis thaliana chromosome 1, top arm
            complete sequence.>gb:AC002423_1530724 Genomic sequence
            for Arabidopsis thaliana BAC T23E23, complete sequence.
          Length = 910

 Score =  182 bits (462), Expect = 6e-45
 Identities = 90/114 (78%), Positives = 101/114 (88%)
 Frame = -2

Query: 752  AFESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSN 573
            A+ESSS+K+ F FSK PGN QTT V+A FTN S N FTDFIFQAAVPKFLQLHLDPASSN
Sbjct: 797  AYESSSLKIEFTFSKTPGNLQTTNVQATFTNLSPNTFTDFIFQAAVPKFLQLHLDPASSN 856

Query: 572  TLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFPRGL 411
            TL A+G+G+ITQ LRV NSQ GKKSLVMR+RIGYK+NGKDVLEEGQ++NFPRGL
Sbjct: 857  TLLASGSGAITQNLRVTNSQQGKKSLVMRMRIGYKLNGKDVLEEGQVSNFPRGL 910



>pir|B96625|B96625 hypothetical protein T2K10.12 [imported] -
            Arabidopsis thaliana>gb:AE005173_893688 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:T2K10_1723974 Arabidopsis thaliana
            chromosome 1 BAC T2K10 sequence, complete sequence.
          Length = 867

 Score =  171 bits (433), Expect = 1e-41
 Identities = 84/114 (73%), Positives = 99/114 (86%)
 Frame = -2

Query: 752  AFESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSN 573
            AFESSS+K+ FNF+KQ  NPQTT + ANF N + NV+T+F+FQAAVPKFLQLHLDPASSN
Sbjct: 756  AFESSSLKIEFNFTKQSENPQTTDIVANFINLTPNVYTEFLFQAAVPKFLQLHLDPASSN 815

Query: 572  TLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFPRGL 411
            +LPA  NG+I Q +RV NSQ GKK +VMR+R+GYK+NGKDVLEEGQINNFPRGL
Sbjct: 816  SLPA--NGNIKQTMRVTNSQKGKKPIVMRMRVGYKINGKDVLEEGQINNFPRGL 867



>gb:AB023482_1515598 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, clone P0680A03.
          Length = 870

 Score =  165 bits (417), Expect = 1e-39
 Identities = 77/114 (67%), Positives = 94/114 (82%)
 Frame = -2

Query: 752  AFESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSN 573
            AF+S+++K+ FNF KQ G PQ T + A+FTN + N FTDFIFQAAVPKF+QL LDPASSN
Sbjct: 757  AFQSAALKITFNFKKQSGKPQETTIHASFTNLTSNTFTDFIFQAAVPKFIQLRLDPASSN 816

Query: 572  TLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFPRGL 411
            TLPA+GN S+TQ L V N+QHG+K L MR+RI YK+NG+D LE+GQINNFP GL
Sbjct: 817  TLPASGNDSVTQSLSVTNNQHGQKPLAMRIRITYKVNGEDRLEQGQINNFPAGL 870



>gb:AC069158_1540669 Genomic Sequence for Oryza sativa, Nipponbare
            strain, clone OSJNBa0049O12, from chromosome 2, complete
            sequence.
          Length = 1354

 Score =  140 bits (352), Expect = 3e-32
 Identities = 64/108 (59%), Positives = 84/108 (77%)
 Frame = -2

Query: 752  AFESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSN 573
            AF+S+++K+ FNF KQP  P  T V A FTN + + +TDF+FQAAVPKF+QL LDPAS N
Sbjct: 808  AFQSATLKINFNFKKQPEKPHETTVHATFTNLTSSSYTDFVFQAAVPKFIQLRLDPASGN 867

Query: 572  TLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQIN 429
             +PA+GNGS+TQ   V N+QHG+K L MR+R+ YK+NG+D LE+GQ N
Sbjct: 868  IVPASGNGSVTQGFSVTNNQHGQKPLAMRIRMSYKVNGEDRLEQGQEN 915



>gb:BC047823_2549909 Danio rerio adaptor-related protein complex 1,
            gamma 1 subunit, mRNA (cDNA clone MGC:56079
            IMAGE:5410195), complete cds.
          Length = 819

 Score = 90.9 bits (224), Expect = 2e-17
 Identities = 46/111 (41%), Positives = 67/111 (60%)
 Frame = -2

Query: 752  AFESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSN 573
            A+  + +K+ F F +   NP   V+  + TN +E   T+F+FQAAVPK  QL L   SSN
Sbjct: 706  AYNKNGLKIEFTFERSNPNPNIAVITIHATNTTEVDMTEFVFQAAVPKTFQLQLLSPSSN 765

Query: 572  TLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
             +PA   GS+TQ +RV+N Q  K+ L MR+++ Y   G  V +  ++NNFP
Sbjct: 766  VVPALNQGSVTQVIRVLNPQ--KQQLRMRIKLTYTHKGSPVQDLAEVNNFP 814



>gb:AB070228_2047301 Rattus norvegicus mRNA for gamma-adaptin,
           partial cds.
          Length = 310

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 44/111 (39%), Positives = 67/111 (60%)
 Frame = -2

Query: 752 AFESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSN 573
           A+  + +K+ F F +   NP  TV+    +N +E   TDF+FQAAVPK  QL L   +S+
Sbjct: 197 AYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPNSS 256

Query: 572 TLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
            +PA   G+ITQ ++V+N Q  K+ L MR+++ Y   G  + +  Q+NNFP
Sbjct: 257 VVPAFNTGTITQVIKVLNPQ--KQQLRMRIKLTYNHKGSAMQDLAQVNNFP 305



>gb:AK036387_1164451 Mus musculus adult male bone cDNA, RIKEN
            full-length enriched library, clone:9830004A01
            product:adaptor protein complex AP-1, gamma 1 subunit,
            full insert sequence.>gb:BC052703_2101224 Mus musculus
            adaptor protein complex AP-1, gamma 1 subunit, mRNA (cDNA
            clone MGC:64704 IMAGE:5698075), complete
            cds.>gb:BC054535_2101743 Mus musculus adaptor protein
            complex AP-1, gamma 1 subunit, mRNA (cDNA clone MGC:62316
            IMAGE:5698075), complete cds.
          Length = 825

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 44/111 (39%), Positives = 67/111 (60%)
 Frame = -2

Query: 752  AFESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSN 573
            A+  + +K+ F F +   NP  TV+    +N +E   TDF+FQAAVPK  QL L   SS+
Sbjct: 712  AYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSS 771

Query: 572  TLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
             +PA   G+ITQ ++V+N Q  K+ L MR+++ Y   G  + +  ++NNFP
Sbjct: 772  VVPAFNTGTITQVIKVLNPQ--KQQLRMRIKLTYNHKGSAMQDLAEVNNFP 820



>gb:AK034198_1163674 Mus musculus adult male diencephalon cDNA,
           RIKEN full-length enriched library, clone:9330162M04
           product:adaptor protein complex AP-1, gamma 1 subunit,
           full insert sequence.
          Length = 695

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 44/111 (39%), Positives = 67/111 (60%)
 Frame = -2

Query: 752 AFESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSN 573
           A+  + +K+ F F +   NP  TV+    +N +E   TDF+FQAAVPK  QL L   SS+
Sbjct: 582 AYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSS 641

Query: 572 TLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
            +PA   G+ITQ ++V+N Q  K+ L MR+++ Y   G  + +  ++NNFP
Sbjct: 642 VVPAFNTGTITQVIKVLNPQ--KQQLRMRIKLTYNHKGSAMQDLAEVNNFP 690



>gb:AK028360_1160947 Mus musculus 18 days pregnant adult female
           placenta and extra embryonic tissue cDNA, RIKEN
           full-length enriched library, clone:3830422K12
           product:adaptor protein complex AP-1, gamma 1 subunit,
           full insert sequence.
          Length = 421

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 44/111 (39%), Positives = 67/111 (60%)
 Frame = -2

Query: 752 AFESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSN 573
           A+  + +K+ F F +   NP  TV+    +N +E   TDF+FQAAVPK  QL L   SS+
Sbjct: 308 AYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSS 367

Query: 572 TLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
            +PA   G+ITQ ++V+N Q  K+ L MR+++ Y   G  + +  ++NNFP
Sbjct: 368 VVPAFNTGTITQVIKVLNPQ--KQQLRMRIKLTYNHKGSAMQDLAEVNNFP 416



>pir|A36680|A36680 gamma-adaptin precursor - mouse>gb:MMADAPG_2113892
            Mouse mRNA for gamma adaptin.
          Length = 822

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 44/111 (39%), Positives = 67/111 (60%)
 Frame = -2

Query: 752  AFESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSN 573
            A+  + +K+ F F +   NP  TV+    +N +E   TDF+FQAAVPK  QL L   SS+
Sbjct: 709  AYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSS 768

Query: 572  TLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
             +PA   G+ITQ ++V+N Q  K+ L MR+++ Y   G  + +  ++NNFP
Sbjct: 769  VVPAFNTGTITQVIKVLNPQ--KQQLRMRIKLTYNHKGSAMQDLAEVNNFP 817



>sp|P22892|A1G1_MOUSE Adapter-related protein complex 1 gamma 1
            subunit (Gamma-adaptin) (Adaptor protein complex AP-1
            gamma-1 subunit) (Golgi adaptor HA1/AP1 adaptin gamma-1
            subunit) (Clathrin assembly protein complex 1 gamma-1
            large chain).
          Length = 821

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 44/111 (39%), Positives = 67/111 (60%)
 Frame = -2

Query: 752  AFESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSN 573
            A+  + +K+ F F +   NP  TV+    +N +E   TDF+FQAAVPK  QL L   SS+
Sbjct: 708  AYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSS 767

Query: 572  TLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
             +PA   G+ITQ ++V+N Q  K+ L MR+++ Y   G  + +  ++NNFP
Sbjct: 768  VVPAFNTGTITQVIKVLNPQ--KQQLRMRIKLTYNHKGSAMQDLAEVNNFP 816



>gb:HSADTG_2010042 H.sapiens mRNA for gamma-adaptin.
          Length = 825

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 44/111 (39%), Positives = 67/111 (60%)
 Frame = -2

Query: 752  AFESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSN 573
            A+  + +K+ F F +   NP  TV+    +N +E   TDF+FQAAVPK  QL L   SS+
Sbjct: 712  AYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSS 771

Query: 572  TLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
             +PA   G+ITQ ++V+N Q  K+ L MR+++ Y   G  + +  ++NNFP
Sbjct: 772  IVPAFNTGTITQVIKVLNPQ--KQQLRMRIKLTYNHKGSAMQDLAEVNNFP 820



>gb:BC036283_1981886 Homo sapiens adaptor-related protein complex 1,
            gamma 1 subunit, mRNA (cDNA clone MGC:18255
            IMAGE:4158263), complete cds.
          Length = 825

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 44/111 (39%), Positives = 67/111 (60%)
 Frame = -2

Query: 752  AFESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSN 573
            A+  + +K+ F F +   NP  TV+    +N +E   TDF+FQAAVPK  QL L   SS+
Sbjct: 712  AYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSS 771

Query: 572  TLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
             +PA   G+ITQ ++V+N Q  K+ L MR+++ Y   G  + +  ++NNFP
Sbjct: 772  IVPAFNTGTITQVIKVLNPQ--KQQLRMRIKLTYNHKGSAMQDLAEVNNFP 820



>gb:AB015317_1864693 Homo sapiens mRNA for gamma1-adaptin, complete
            cds.
          Length = 822

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 44/111 (39%), Positives = 67/111 (60%)
 Frame = -2

Query: 752  AFESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSN 573
            A+  + +K+ F F +   NP  TV+    +N +E   TDF+FQAAVPK  QL L   SS+
Sbjct: 709  AYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSS 768

Query: 572  TLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
             +PA   G+ITQ ++V+N Q  K+ L MR+++ Y   G  + +  ++NNFP
Sbjct: 769  IVPAFNTGTITQVIKVLNPQ--KQQLRMRIKLTYNHKGSAMQDLAEVNNFP 817



>gb:HSM800849_1185957 Homo sapiens mRNA; cDNA DKFZp586B1622 (from
           clone DKFZp586B1622).
          Length = 284

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 44/111 (39%), Positives = 67/111 (60%)
 Frame = -2

Query: 752 AFESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSN 573
           A+  + +K+ F F +   NP  TV+    +N +E   TDF+FQAAVPK  QL L   SS+
Sbjct: 171 AYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSS 230

Query: 572 TLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
            +PA   G+ITQ ++V+N Q  K+ L MR+++ Y   G  + +  ++NNFP
Sbjct: 231 IVPAFNTGTITQVIKVLNPQ--KQQLRMRIKLTYNHKGSAMQDLAEVNNFP 279



>gb:CR860835_1184883 Pongo pygmaeus mRNA; cDNA DKFZp469F1514 (from
            clone DKFZp469F1514).
          Length = 822

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 44/111 (39%), Positives = 67/111 (60%)
 Frame = -2

Query: 752  AFESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSN 573
            A+  + +K+ F F +   NP  TV+    +N +E   TDF+FQAAVPK  QL L   SS+
Sbjct: 709  AYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSS 768

Query: 572  TLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
             +PA   G+ITQ ++V+N Q  K+ L MR+++ Y   G  + +  ++NNFP
Sbjct: 769  IVPAFNTGTITQVIKVLNPQ--KQQLRMRIKLTYNHKGSAMQDLAEVNNFP 817



>pir|T14753|T14753 hypothetical protein DKFZp586B1622.1 - human
           (fragment)
          Length = 284

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 44/111 (39%), Positives = 67/111 (60%)
 Frame = -2

Query: 752 AFESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSN 573
           A+  + +K+ F F +   NP  TV+    +N +E   TDF+FQAAVPK  QL L   SS+
Sbjct: 171 AYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSS 230

Query: 572 TLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
            +PA   G+ITQ ++V+N Q  K+ L MR+++ Y   G  + +  ++NNFP
Sbjct: 231 IVPAFNTGTITQVIKVLNPQ--KQQLRMRIKLTYNHKGSAMQDLAEVNNFP 279



>sp|O43747|A1G1_HUMAN Adapter-related protein complex 1 gamma 1
            subunit (Gamma-adaptin) (Adaptor protein complex AP-1
            gamma-1 subunit) (Golgi adaptor HA1/AP1 adaptin gamma-1
            subunit) (Clathrin assembly protein complex 1 gamma-1
            large chain).
          Length = 821

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 44/111 (39%), Positives = 67/111 (60%)
 Frame = -2

Query: 752  AFESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSN 573
            A+  + +K+ F F +   NP  TV+    +N +E   TDF+FQAAVPK  QL L   SS+
Sbjct: 708  AYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSS 767

Query: 572  TLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
             +PA   G+ITQ ++V+N Q  K+ L MR+++ Y   G  + +  ++NNFP
Sbjct: 768  IVPAFNTGTITQVIKVLNPQ--KQQLRMRIKLTYNHKGSAMQDLAEVNNFP 816



>gb:AJ720551_2502738 Gallus gallus mRNA for hypothetical protein,
            clone 20c5.
          Length = 821

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 43/111 (38%), Positives = 68/111 (61%)
 Frame = -2

Query: 752  AFESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSN 573
            A+  + +K+ F+F +    P  TV+    +N +E   TDF+FQAAVPK  QL L   SS+
Sbjct: 708  AYNKNGLKIDFSFERSNTYPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSS 767

Query: 572  TLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
             +PA  +G+ITQ ++V+N Q  K+ L MR+++ Y   G  + +  ++NNFP
Sbjct: 768  VIPAFNSGTITQVIKVLNPQ--KQQLRMRIKLTYNHKGSAMQDLAEVNNFP 816



>gb:BC073198_2557053 Xenopus laevis similar to adaptor protein complex
            AP-1, gamma 1 subunit, mRNA (cDNA clone MGC:80452
            IMAGE:5155966), complete cds.
          Length = 812

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 43/111 (38%), Positives = 68/111 (61%)
 Frame = -2

Query: 752  AFESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSN 573
            A+  + +K+ F+F +   N   TV+    +N +++  T+F+FQAAVPK  QL L   SSN
Sbjct: 699  AYNKNGLKIDFSFERSSTNASITVITTQASNCTDSDMTEFVFQAAVPKTFQLQLLSPSSN 758

Query: 572  TLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
             LPA   GSITQ ++V+N Q  K+ L MR+++ Y   G  + +  +++NFP
Sbjct: 759  VLPAFNAGSITQVIKVLNPQ--KQQLRMRVKLTYNHKGSAIQDLAEVSNFP 807



>gb:BC045070_2549022 Xenopus laevis similar to adaptor protein complex
            AP-1, gamma 1 subunit, mRNA (cDNA clone IMAGE:5542066),
            partial cds.
          Length = 821

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 43/111 (38%), Positives = 68/111 (61%)
 Frame = -2

Query: 752  AFESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSN 573
            A+  + +K+ F+F +   N   TV+    +N +++  T+F+FQAAVPK  QL L   SSN
Sbjct: 708  AYNKNGLKIDFSFERSSTNASITVITTQASNCTDSDMTEFVFQAAVPKTFQLQLLSPSSN 767

Query: 572  TLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
             LPA   GSITQ ++V+N Q  K+ L MR+++ Y   G  + +  +++NFP
Sbjct: 768  VLPAFNAGSITQVIKVLNPQ--KQQLRMRVKLTYNHKGSAIQDLAEVSNFP 816



>gb:BC044052_2548457 Xenopus laevis similar to adaptor-related
           protein complex 1, gamma 1 subunit, mRNA (cDNA clone
           MGC:53527 IMAGE:5572696), complete cds.
          Length = 787

 Score = 83.2 bits (204), Expect = 5e-15
 Identities = 42/110 (38%), Positives = 65/110 (59%)
 Frame = -2

Query: 749 FESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSNT 570
           +    +++ F+F + P NP   V+ ++ T+ S +   DF  QAAVPK +Q+ L   S + 
Sbjct: 675 YSKDGLQVEFSFMRPPSNPALLVITSSATSSSSSTVADFQLQAAVPKNIQIQLQAPSGSL 734

Query: 569 LPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
           +PA+  GS+TQ +RV+N Q  K  L MRLR  +  NG  V E  +++NFP
Sbjct: 735 VPASDGGSVTQCIRVLNPQ--KVPLKMRLRFSFLHNGNSVQEMCEVSNFP 782



>gb:BC051833_1984690 Homo sapiens adaptor-related protein complex 1,
           gamma 2 subunit, mRNA (cDNA clone MGC:60125
           IMAGE:5589077), complete cds.
          Length = 640

 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 45/110 (40%), Positives = 60/110 (54%)
 Frame = -2

Query: 749 FESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSNT 570
           FE   ++L  +F + P NP   ++    TN SE   T FI QAAVPK LQL L   S NT
Sbjct: 528 FEREGVQLNLSFIRPPENPALLLITITATNFSEGDVTHFICQAAVPKSLQLQLQAPSGNT 587

Query: 569 LPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
           +PA G   ITQ  R++N    K  L ++LR+ Y    + V E  ++NN P
Sbjct: 588 VPARGGLPITQLFRILNP--NKAPLRLKLRLTYDHFHQSVQEIFEVNNLP 635



>gb:CNSLT1I7F_1180570 human full-length cDNA clone CS0DI003YF22 of
           Placenta of Homo sapiens (human).
          Length = 404

 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 45/110 (40%), Positives = 60/110 (54%)
 Frame = -2

Query: 749 FESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSNT 570
           FE   ++L  +F + P NP   ++    TN SE   T FI QAAVPK LQL L   S NT
Sbjct: 292 FEREGVQLNLSFIRPPENPALLLITITATNFSEGDVTHFICQAAVPKSLQLQLQAPSGNT 351

Query: 569 LPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
           +PA G   ITQ  R++N    K  L ++LR+ Y    + V E  ++NN P
Sbjct: 352 VPARGGLPITQLFRILNP--NKAPLRLKLRLTYDHFHQSVQEIFEVNNLP 399



>sp|O75843|A1G2_HUMAN Adapter-related protein complex 1 gamma 2
           subunit (Gamma2-adaptin) (Adaptor protein complex AP-1
           gamma-2 subunit) (G2ad).>gb:AB015318_1864694 Homo
           sapiens mRNA for gamma2-adaptin, complete cds.
          Length = 785

 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 45/110 (40%), Positives = 60/110 (54%)
 Frame = -2

Query: 749 FESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSNT 570
           FE   ++L  +F + P NP   ++    TN SE   T FI QAAVPK LQL L   S NT
Sbjct: 673 FEREGVQLNLSFIRPPENPALLLITITATNFSEGDVTHFICQAAVPKSLQLQLQAPSGNT 732

Query: 569 LPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
           +PA G   ITQ  R++N    K  L ++LR+ Y    + V E  ++NN P
Sbjct: 733 VPARGGLPITQLFRILNP--NKAPLRLKLRLTYDHFHQSVQEIFEVNNLP 780



>gb:AY144597_1303445 Dictyostelium discoideum clathrin-adaptor gamma
            chain Ap1g1 (ap1g1) mRNA, complete cds.
          Length = 895

 Score = 72.8 bits (177), Expect = 7e-12
 Identities = 34/99 (34%), Positives = 60/99 (60%), Gaps = 1/99 (1%)
 Frame = -2

Query: 749  FESSSIKLMFNFSK-QPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSN 573
            ++   + + +  SK QP N   T +    TN   +  T+F  QAAVPK+L++ L   SS 
Sbjct: 783  YQKHGLNISYECSKPQPNNLSLTNINMVITNTGSSPITNFSLQAAVPKYLKIQLLAPSST 842

Query: 572  TLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGK 456
             +P   +G +TQ  +V+NSQ G+K +++RL++ +++NG+
Sbjct: 843  VIPPNNSGEVTQVSKVLNSQQGQKPILLRLKLDFQINGQ 881



>gb:AE014187_938995 Plasmodium falciparum 3D7 chromosome 14 complete
            sequence.>gb:AE014825_1228071 Plasmodium falciparum 3D7
            chromosome 14 section 10 of 13 of the complete sequence.
          Length = 1081

 Score = 72.4 bits (176), Expect = 9e-12
 Identities = 34/113 (30%), Positives = 66/113 (58%)
 Frame = -2

Query: 749  FESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSNT 570
            ++ + I ++FNF K+  + + T+++A ++NKS  + + F+F+A VP +++L +  AS   
Sbjct: 969  YDKNDIVIVFNFEKEYIDSEVTMIKAVYSNKSSILISSFVFEAVVPNYVKLEIFSASDKQ 1028

Query: 569  LPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFPRGL 411
            L  +   +I Q L++ N    KK ++M++R+ Y  N +   +   I NFP  L
Sbjct: 1029 LLPSEGNTIKQNLKIWNKLFKKKPVLMKVRLSYVKNNESFQDFINIGNFPNDL 1081



>sp|O88512|A1G2_MOUSE Adapter-related protein complex 1 gamma 2
            subunit (Gamma2-adaptin) (Adaptor protein complex AP-1
            gamma-2 subunit) (G2ad).>gb:AF068707_2053240 Mus musculus
            gamma2-adaptin (G2ad) mRNA, complete cds.
          Length = 791

 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 41/110 (37%), Positives = 60/110 (54%)
 Frame = -2

Query: 749  FESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSNT 570
            FE   ++L  +F +    P   +V A  TN S+   T F+ QAAVPK  QL L   S NT
Sbjct: 679  FEREGLQLDLSFMRPLETPALLLVTATTTNSSKEDVTHFVCQAAVPKSFQLQLQAPSGNT 738

Query: 569  LPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
            +PA G   ITQ  R++N    +  L ++LR+ Y  +G+ V E  +++N P
Sbjct: 739  IPAQGGLPITQVFRILNP--NQAPLRLKLRLTYNHSGQPVQEIFEVDNLP 786



>gb:AE016818_1748388 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 582

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 39/110 (35%), Positives = 58/110 (52%)
 Frame = -2

Query: 746 ESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSNTL 567
           ES ++KL F  SK   N     V + F+N S++   D  F  AVPK   L+L P S NT+
Sbjct: 475 ESQNLKLEFEISKI--NASKIRVTSYFSNMSDSRLDDLSFLVAVPKSCALNLLPQSDNTI 532

Query: 566 PATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFPR 417
           PA     ITQ+  ++  +   K L ++ ++ YKMN   + EEG +   P+
Sbjct: 533 PAKTADGITQEGHIVIPEGFSKPLKVKWKVTYKMNAVPI-EEGAVFTLPK 581



>gb:AE014298_1124901 Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE003446_1210083 Drosophila melanogaster
            chromosome X, section 30 of 74 of the complete sequence.
          Length = 963

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 33/92 (35%), Positives = 53/92 (57%)
 Frame = -2

Query: 665  TNKSENVFTDFIFQAAVPKFLQLHLDPASSNTLPATGNGSITQKLRVINSQHGKKSLVMR 486
            TN S+N    ++ QAAV +  QL +   S + LP    G ITQ++RV+ + +   +L MR
Sbjct: 876  TNNSDNTLDQYLLQAAVQRSFQLQMLTPSGSVLPP--GGVITQEMRVVATSNA--TLRMR 931

Query: 485  LRIGYKMNGKDVLEEGQINNFPRGL*GSTAAE 390
            LRI Y ++G+  +E+ +++ FP       AAE
Sbjct: 932  LRIQYVLDGQQQVEQTEVSGFPEQQPAPAAAE 963



>gb:AE014298_1124899 Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE014298_1124900 Drosophila melanogaster
            chromosome X, complete sequence.>gb:AE003446_1210081
            Drosophila melanogaster chromosome X, section 30 of 74 of
            the complete sequence.>gb:AE003446_1210082 Drosophila
            melanogaster chromosome X, section 30 of 74 of the
            complete sequence.
          Length = 969

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 33/92 (35%), Positives = 53/92 (57%)
 Frame = -2

Query: 665  TNKSENVFTDFIFQAAVPKFLQLHLDPASSNTLPATGNGSITQKLRVINSQHGKKSLVMR 486
            TN S+N    ++ QAAV +  QL +   S + LP    G ITQ++RV+ + +   +L MR
Sbjct: 882  TNNSDNTLDQYLLQAAVQRSFQLQMLTPSGSVLPP--GGVITQEMRVVATSNA--TLRMR 937

Query: 485  LRIGYKMNGKDVLEEGQINNFPRGL*GSTAAE 390
            LRI Y ++G+  +E+ +++ FP       AAE
Sbjct: 938  LRIQYVLDGQQQVEQTEVSGFPEQQPAPAAAE 969



>gb:AE014298_1124898 Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE003446_1210080 Drosophila melanogaster
            chromosome X, section 30 of 74 of the complete sequence.
          Length = 976

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 33/92 (35%), Positives = 53/92 (57%)
 Frame = -2

Query: 665  TNKSENVFTDFIFQAAVPKFLQLHLDPASSNTLPATGNGSITQKLRVINSQHGKKSLVMR 486
            TN S+N    ++ QAAV +  QL +   S + LP    G ITQ++RV+ + +   +L MR
Sbjct: 889  TNNSDNTLDQYLLQAAVQRSFQLQMLTPSGSVLPP--GGVITQEMRVVATSNA--TLRMR 944

Query: 485  LRIGYKMNGKDVLEEGQINNFPRGL*GSTAAE 390
            LRI Y ++G+  +E+ +++ FP       AAE
Sbjct: 945  LRIQYVLDGQQQVEQTEVSGFPEQQPAPAAAE 976



>gb:AE014298_1124897 Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE003446_1210079 Drosophila melanogaster
            chromosome X, section 30 of 74 of the complete sequence.
          Length = 982

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 33/92 (35%), Positives = 53/92 (57%)
 Frame = -2

Query: 665  TNKSENVFTDFIFQAAVPKFLQLHLDPASSNTLPATGNGSITQKLRVINSQHGKKSLVMR 486
            TN S+N    ++ QAAV +  QL +   S + LP    G ITQ++RV+ + +   +L MR
Sbjct: 895  TNNSDNTLDQYLLQAAVQRSFQLQMLTPSGSVLPP--GGVITQEMRVVATSNA--TLRMR 950

Query: 485  LRIGYKMNGKDVLEEGQINNFPRGL*GSTAAE 390
            LRI Y ++G+  +E+ +++ FP       AAE
Sbjct: 951  LRIQYVLDGQQQVEQTEVSGFPEQQPAPAAAE 982



>gb:AF190863_1889022 Homo sapiens ADP-ribosylation factor binding
           protein GGA2 (GGA2) mRNA, complete cds.
          Length = 613

 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 29/115 (25%), Positives = 65/115 (56%), Gaps = 5/115 (4%)
 Frame = -2

Query: 749 FESSSIKLMFNFSKQ--PGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASS 576
           ++ +  +++ +FS+   PG+P+  V+     + +     D +FQ AVPK +++ L PASS
Sbjct: 492 YDRNGFRILLHFSQTGAPGHPEVQVLLLTMMSTAPQPVWDIMFQVAVPKSMRVKLQPASS 551

Query: 575 NTLPATG---NGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
           + LPA       ++  ++ ++++ H K+ + +R ++ +   G+   E G++ +FP
Sbjct: 552 SKLPAFSPLMPPAVISQMLLLDNPH-KEPIRLRYKLTFNQGGQPFSEVGEVKDFP 605



>gb:AB029003_1865859 Homo sapiens mRNA for KIAA1080 protein, partial
           cds.
          Length = 517

 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 29/115 (25%), Positives = 65/115 (56%), Gaps = 5/115 (4%)
 Frame = -2

Query: 749 FESSSIKLMFNFSKQ--PGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASS 576
           ++ +  +++ +FS+   PG+P+  V+     + +     D +FQ AVPK +++ L PASS
Sbjct: 396 YDRNGFRILLHFSQTGAPGHPEVQVLLLTMMSTAPQPVWDIMFQVAVPKSMRVKLQPASS 455

Query: 575 NTLPATG---NGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
           + LPA       ++  ++ ++++ H K+ + +R ++ +   G+   E G++ +FP
Sbjct: 456 SKLPAFSPLMPPAVISQMLLLDNPH-KEPIRLRYKLTFNQGGQPFSEVGEVKDFP 509



>pir|T00744|T00744 KIAA0154 protein homolog A-735G6.4 -
           human>gb:AF165531_1887264 Homo sapiens VEAR protein
           mRNA, complete cds.>gb:HUAC002400_2028676 Human
           Chromosome 16 BAC clone CIT987SK-A-735G6, complete
           sequence.
          Length = 613

 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 29/115 (25%), Positives = 65/115 (56%), Gaps = 5/115 (4%)
 Frame = -2

Query: 749 FESSSIKLMFNFSKQ--PGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASS 576
           ++ +  +++ +FS+   PG+P+  V+     + +     D +FQ AVPK +++ L PASS
Sbjct: 492 YDRNGFRILLHFSQTGAPGHPEVQVLLLTMMSTAPQPVWDIMFQVAVPKSMRVKLQPASS 551

Query: 575 NTLPATG---NGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
           + LPA       ++  ++ ++++ H K+ + +R ++ +   G+   E G++ +FP
Sbjct: 552 SKLPAFSPLMPPAVISQMLLLDNPH-KEPIRLRYKLTFNQGGQPFSEVGEVKDFP 605



>sp|Q9UJY4|GGA2_HUMAN ADP-ribosylation factor binding protein GGA2
           (Golgi-localized, gamma ear-containing, ARF-binding
           protein 2) (Gamma-adaptin related protein 2) (Vear) (VHS
           domain and ear domain of
           gamma-adaptin).>gb:AF233522_1891820 Homo sapiens
           Golgi-associated, gamma-adaptin ear containing,
           ARF-binding protein 2 (GGA2) gene, complete
           cds.>gb:BC000284_1966578 Homo sapiens golgi associated,
           gamma adaptin ear containing, ARF binding protein 2,
           mRNA (cDNA clone MGC:1002 IMAGE:3356490), complete cds.
          Length = 613

 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 29/115 (25%), Positives = 65/115 (56%), Gaps = 5/115 (4%)
 Frame = -2

Query: 749 FESSSIKLMFNFSKQ--PGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASS 576
           ++ +  +++ +FS+   PG+P+  V+     + +     D +FQ AVPK +++ L PASS
Sbjct: 492 YDRNGFRILLHFSQTGAPGHPEVQVLLLTMMSTAPQPVWDIMFQVAVPKSMRVKLQPASS 551

Query: 575 NTLPATG---NGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
           + LPA       ++  ++ ++++ H K+ + +R ++ +   G+   E G++ +FP
Sbjct: 552 SKLPAFSPLMPPAVISQMLLLDNPH-KEPIRLRYKLTFNQGGQPFSEVGEVKDFP 605



>gb:BC062933_2105078 Mus musculus golgi associated, gamma adaptin
           ear containing, ARF binding protein 2, mRNA (cDNA clone
           MGC:86177 IMAGE:30356060), complete cds.
          Length = 603

 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 29/115 (25%), Positives = 63/115 (54%), Gaps = 5/115 (4%)
 Frame = -2

Query: 749 FESSSIKLMFNFSKQ--PGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASS 576
           ++ +  +++ +FS+   PG+P   V+     + +     D +FQ AVPK +++ L PASS
Sbjct: 482 YDRNGFRILLHFSQTGAPGHPDVKVLLLTMMSTATQPVWDVMFQVAVPKSMRVKLQPASS 541

Query: 575 NTLPATG---NGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
           + LPA       ++  +  ++++ H K+ + +R ++ +   G+   E G++ +FP
Sbjct: 542 SKLPAFSPLMPPAVISQTLLLDNPH-KEPIRLRYKLTFNQGGQPFSEVGEVKDFP 595



>gb:BC057377_2102746 Mus musculus golgi associated, gamma adaptin
           ear containing, ARF binding protein 2, mRNA (cDNA clone
           MGC:67474 IMAGE:5698559), complete cds.
          Length = 354

 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 29/115 (25%), Positives = 63/115 (54%), Gaps = 5/115 (4%)
 Frame = -2

Query: 749 FESSSIKLMFNFSKQ--PGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASS 576
           ++ +  +++ +FS+   PG+P   V+     + +     D +FQ AVPK +++ L PASS
Sbjct: 233 YDRNGFRILLHFSQTGAPGHPDVKVLLLTMMSTATQPVWDVMFQVAVPKSMRVKLQPASS 292

Query: 575 NTLPATG---NGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
           + LPA       ++  +  ++++ H K+ + +R ++ +   G+   E G++ +FP
Sbjct: 293 SKLPAFSPLMPPAVISQTLLLDNPH-KEPIRLRYKLTFNQGGQPFSEVGEVKDFP 346



>gb:AK129280_2069511 Mus musculus mRNA for mKIAA1080 protein.
          Length = 612

 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 29/115 (25%), Positives = 63/115 (54%), Gaps = 5/115 (4%)
 Frame = -2

Query: 749 FESSSIKLMFNFSKQ--PGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASS 576
           ++ +  +++ +FS+   PG+P   V+     + +     D +FQ AVPK +++ L PASS
Sbjct: 491 YDRNGFRILLHFSQTGAPGHPDVKVLLLTMMSTATQPVWDVMFQVAVPKSMRVKLQPASS 550

Query: 575 NTLPATG---NGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
           + LPA       ++  +  ++++ H K+ + +R ++ +   G+   E G++ +FP
Sbjct: 551 SKLPAFSPLMPPAVISQTLLLDNPH-KEPIRLRYKLTFNQGGQPFSEVGEVKDFP 604



>gb:AK034612_1163814 Mus musculus 12 days embryo embryonic body
           between diaphragm region and neck cDNA, RIKEN
           full-length enriched library, clone:9430014N07
           product:similar to ADP-RIBOSYLATION FACTOR BINDING
           PROTEIN GGA2 (GOLGI-LOCALIZED, GAMMA EAR-CONTAINING,
           ARF-BINDING PROTEIN 2) (GAMMA-ADAPTIN RELATED PROTEIN 2)
           (VEAR) (VHS DOMAIN AND EAR DOMAIN OF GAMMA-ADAPTIN)
           [Homo sapiens], full insert sequence.
          Length = 511

 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 29/115 (25%), Positives = 63/115 (54%), Gaps = 5/115 (4%)
 Frame = -2

Query: 749 FESSSIKLMFNFSKQ--PGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASS 576
           ++ +  +++ +FS+   PG+P   V+     + +     D +FQ AVPK +++ L PASS
Sbjct: 390 YDRNGFRILLHFSQTGAPGHPDVKVLLLTMMSTATQPVWDVMFQVAVPKSMRVKLQPASS 449

Query: 575 NTLPATG---NGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
           + LPA       ++  +  ++++ H K+ + +R ++ +   G+   E G++ +FP
Sbjct: 450 SKLPAFSPLMPPAVISQTLLLDNPH-KEPIRLRYKLTFNQGGQPFSEVGEVKDFP 503



>gb:HS37E16_1998359 Human DNA sequence from clone RP1-37E16 on
           chromosome 22 Contains the 3' part of the gene for a
           novel VHS domain containing protein similar to predicted
           worm and human proteins, the SH3BP1 gene for SH3-domain
           binding protein 1, the gene for a novel protein similar
           to nitrophenylphosphatases from various organisms, the
           LGALS1 gene for soluble galactoside-binding lectin 1, a
           novel gene and the gene for a novel protein similar to
           mouse RIP3 (P116 Rho-interacting protein) and rat RB109,
           complete sequence.
          Length = 274

 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 31/116 (26%), Positives = 59/116 (50%), Gaps = 6/116 (5%)
 Frame = -2

Query: 749 FESSSIKLMFNFSKQP--GNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASS 576
           ++    +++F+F++ P  G     VV  +  + +     + +FQ+AVPK +++ L P S 
Sbjct: 153 YDQHGFRILFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSG 212

Query: 575 NTLPA----TGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
             LPA        +ITQ L + N Q  K+ + +R ++ + M  +   E G ++ FP
Sbjct: 213 TELPAFNPIVHPSAITQVLLLANPQ--KEKVRLRYKLTFTMGDQTYNEMGDVDQFP 266



>gb:CR456493_1992784 Homo sapiens GGA1 full length open reading
           frame (ORF) cDNA clone (cDNA clone C22ORF:pGEM.GGA1).
          Length = 656

 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 31/116 (26%), Positives = 59/116 (50%), Gaps = 6/116 (5%)
 Frame = -2

Query: 749 FESSSIKLMFNFSKQP--GNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASS 576
           ++    +++F+F++ P  G     VV  +  + +     + +FQ+AVPK +++ L P S 
Sbjct: 535 YDQHGFRILFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSG 594

Query: 575 NTLPA----TGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
             LPA        +ITQ L + N Q  K+ + +R ++ + M  +   E G ++ FP
Sbjct: 595 TELPAFNPIVHPSAITQVLLLANPQ--KEKVRLRYKLTFTMGDQTYNEMGDVDQFP 648



>gb:BC044629_1983504 Homo sapiens golgi associated, gamma adaptin
           ear containing, ARF binding protein 1, transcript
           variant 2, mRNA (cDNA clone MGC:52130 IMAGE:5796877),
           complete cds.
          Length = 552

 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 31/116 (26%), Positives = 59/116 (50%), Gaps = 6/116 (5%)
 Frame = -2

Query: 749 FESSSIKLMFNFSKQP--GNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASS 576
           ++    +++F+F++ P  G     VV  +  + +     + +FQ+AVPK +++ L P S 
Sbjct: 431 YDQHGFRILFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSG 490

Query: 575 NTLPA----TGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
             LPA        +ITQ L + N Q  K+ + +R ++ + M  +   E G ++ FP
Sbjct: 491 TELPAFNPIVHPSAITQVLLLANPQ--KEKVRLRYKLTFTMGDQTYNEMGDVDQFP 544



>gb:BC000538_1966812 Homo sapiens golgi associated, gamma adaptin
           ear containing, ARF binding protein 1, mRNA (cDNA clone
           IMAGE:3162847), partial cds.
          Length = 365

 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 31/116 (26%), Positives = 59/116 (50%), Gaps = 6/116 (5%)
 Frame = -2

Query: 749 FESSSIKLMFNFSKQP--GNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASS 576
           ++    +++F+F++ P  G     VV  +  + +     + +FQ+AVPK +++ L P S 
Sbjct: 244 YDQHGFRILFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSG 303

Query: 575 NTLPA----TGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
             LPA        +ITQ L + N Q  K+ + +R ++ + M  +   E G ++ FP
Sbjct: 304 TELPAFNPIVHPSAITQVLLLANPQ--KEKVRLRYKLTFTMGDQTYNEMGDVDQFP 357



>gb:HSM800873_1185961 Homo sapiens mRNA; cDNA DKFZp434A033 (from
           clone DKFZp434A033).
          Length = 609

 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 31/116 (26%), Positives = 59/116 (50%), Gaps = 6/116 (5%)
 Frame = -2

Query: 749 FESSSIKLMFNFSKQP--GNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASS 576
           ++    +++F+F++ P  G     VV  +  + +     + +FQ+AVPK +++ L P S 
Sbjct: 488 YDQHGFRILFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSG 547

Query: 575 NTLPA----TGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
             LPA        +ITQ L + N Q  K+ + +R ++ + M  +   E G ++ FP
Sbjct: 548 TELPAFNPIVHPSAITQVLLLANPQ--KEKVRLRYKLTFTMGDQTYNEMGDVDQFP 601



>pir|T14759|T14759 hypothetical protein DKFZp434A033.1 - human
           (fragment)
          Length = 609

 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 31/116 (26%), Positives = 59/116 (50%), Gaps = 6/116 (5%)
 Frame = -2

Query: 749 FESSSIKLMFNFSKQP--GNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASS 576
           ++    +++F+F++ P  G     VV  +  + +     + +FQ+AVPK +++ L P S 
Sbjct: 488 YDQHGFRILFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSG 547

Query: 575 NTLPA----TGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
             LPA        +ITQ L + N Q  K+ + +R ++ + M  +   E G ++ FP
Sbjct: 548 TELPAFNPIVHPSAITQVLLLANPQ--KEKVRLRYKLTFTMGDQTYNEMGDVDQFP 601



>sp|Q9UJY5|GGA1_HUMAN ADP-ribosylation factor binding protein GGA1
           (Golgi-localized, gamma ear-containing, ARF-binding
           protein 1) (Gamma-adaptin related protein
           1).>gb:CQ783371_1452432 Sequence 3511 from Patent
           EP1396543.>gb:AF190862_1889021 Homo sapiens
           ADP-ribosylation factor binding protein GGA1 (GGA1)
           mRNA, complete cds.>gb:AF218584_1890666 Homo sapiens
           GGA1 mRNA, complete cds.>gb:AF233521_1891819 Homo
           sapiens Golgi-associated, gamma-adaptin ear containing,
           ARF-binding protein 1 (GGA1) gene, complete
           cds.>gb:AK075256_1912987 Homo sapiens cDNA FLJ90775 fis,
           clone THYRO1001071, weakly similar to
           GAMMA-ADAPTIN.>gb:HS37E16_1998358 Human DNA sequence
           from clone RP1-37E16 on chromosome 22 Contains the 3'
           part of the gene for a novel VHS domain containing
           protein similar to predicted worm and human proteins,
           the SH3BP1 gene for SH3-domain binding protein 1, the
           gene for a novel protein similar to
           nitrophenylphosphatases from various organisms, the
           LGALS1 gene for soluble galactoside-binding lectin 1, a
           novel gene and the gene for a novel protein similar to
           mouse RIP3 (P116 Rho-interacting protein) and rat RB109,
           complete sequence.>gb:HS437O22_1998644 Human DNA
           sequence from clone RP3-437O22 on chromosome
           22q12.2-13.1, complete sequence.
          Length = 639

 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 31/116 (26%), Positives = 59/116 (50%), Gaps = 6/116 (5%)
 Frame = -2

Query: 749 FESSSIKLMFNFSKQP--GNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASS 576
           ++    +++F+F++ P  G     VV  +  + +     + +FQ+AVPK +++ L P S 
Sbjct: 518 YDQHGFRILFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSG 577

Query: 575 NTLPA----TGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
             LPA        +ITQ L + N Q  K+ + +R ++ + M  +   E G ++ FP
Sbjct: 578 TELPAFNPIVHPSAITQVLLLANPQ--KEKVRLRYKLTFTMGDQTYNEMGDVDQFP 631



>gb:BC080229_2561616 Danio rerio zgc:101044, mRNA (cDNA clone
           MGC:101044 IMAGE:7151888), complete cds.
          Length = 635

 Score = 52.8 bits (125), Expect = 7e-06
 Identities = 34/116 (29%), Positives = 60/116 (51%), Gaps = 6/116 (5%)
 Frame = -2

Query: 749 FESSSIKLMFNFSKQP--GNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASS 576
           F+  S++++F+F+K P    P   VV  +  + +    T+  FQAAVPK +++ L P S 
Sbjct: 514 FDKHSLRVLFHFAKDPPPARPDVLVVIISMLSSAPLPITNVRFQAAVPKNMRVKLQPPSG 573

Query: 575 NTLPATG----NGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
           + LPA        +ITQ L + N    K+ + +R ++ + +  +   E G +  FP
Sbjct: 574 SDLPAFNPVLPPAAITQVLLLANPH--KEKVRLRYKLTFDIGEESHDESGDVEQFP 627



>gb:BC090031_2111191 Rattus norvegicus golgi associated, gamma
           adaptin ear containing, ARF binding protein 1
           (predicted), mRNA (cDNA clone MGC:109601 IMAGE:7366311),
           complete cds.
          Length = 562

 Score = 52.4 bits (124), Expect = 9e-06
 Identities = 31/116 (26%), Positives = 59/116 (50%), Gaps = 6/116 (5%)
 Frame = -2

Query: 749 FESSSIKLMFNFSKQP--GNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASS 576
           ++    +++F+F++ P  G     VV  +  + +     + +FQ+AVPK +++ L P S 
Sbjct: 441 YDQHGFRVLFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVFQSAVPKVMKVRLQPPSG 500

Query: 575 NTLPA----TGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
             LPA        +ITQ L + N Q  K+ + +R ++ + M  +   E G ++ FP
Sbjct: 501 TELPAFNPIVHPSAITQVLLLANPQ--KEKVRLRYKLIFTMGDQTYNEMGDVDQFP 554



>gb:AK080881_1173109 Mus musculus 4 days neonate male adipose cDNA,
           RIKEN full-length enriched library, clone:B430116A10
           product:ADP-RIBOSYLATION FACTOR BINDING PROTEIN GGA1
           (GOLGI-LOCALIZED, GAMMA EAR-CONTAINING, ARF-BINDING
           PROTEIN 1) (GAMMA-ADAPTIN RELATED PROTEIN 1) homolog
           [Homo sapiens], full insert
           sequence.>gb:BC026802_2095561 Mus musculus golgi
           associated, gamma adaptin ear containing, ARF binding
           protein 1, mRNA (cDNA clone MGC:28948 IMAGE:4223300),
           complete cds.
          Length = 635

 Score = 52.4 bits (124), Expect = 9e-06
 Identities = 31/116 (26%), Positives = 59/116 (50%), Gaps = 6/116 (5%)
 Frame = -2

Query: 749 FESSSIKLMFNFSKQP--GNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASS 576
           ++    +++F+F++ P  G     VV  +  + +     + +FQ+AVPK +++ L P S 
Sbjct: 514 YDQHGFRVLFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVFQSAVPKVMKVRLQPPSG 573

Query: 575 NTLPA----TGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
             LPA        +ITQ L + N Q  K+ + +R ++ + M  +   E G ++ FP
Sbjct: 574 TELPAFNPIVHPSAITQVLLLANPQ--KEKVRLRYKLIFTMGDQTYNEMGDVDQFP 627



>gb:BC073000_2556915 Xenopus laevis MGC82581 protein, mRNA (cDNA
           clone MGC:82581 IMAGE:4970486), complete cds.
          Length = 625

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 35/116 (30%), Positives = 56/116 (48%), Gaps = 6/116 (5%)
 Frame = -2

Query: 749 FESSSIKLMFNFSKQP--GNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASS 576
           ++  S +++ +F+K P  G P   VV  +  + +    T   FQAAVPK +++ L PA+ 
Sbjct: 504 YDQQSFRVLLHFAKDPPPGRPDVLVVVISMLSTAPLPVTGISFQAAVPKTMKVKLQPATG 563

Query: 575 NTLPATG----NGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
           + LP         S+TQ L + N    K  L  R R+ Y    +   E G + +FP
Sbjct: 564 SELPPFNPILPPSSVTQVLLLANPTQDKVRL--RYRLTYIQGDQHFDEMGDVEDFP 617



>gb:AK122212_2068877 Mus musculus mRNA for mKIAA0154 protein.
          Length = 724

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 31/117 (26%), Positives = 60/117 (51%), Gaps = 6/117 (5%)
 Frame = -2

Query: 752 AFESSSIKLMFNFSKQ--PGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPAS 579
           A++ +  +++F+F+K+  PG P   VV  +  N +       + QAAVPK +++ L P S
Sbjct: 602 AYDKNGFRILFHFAKECPPGRPDVLVVVVSMLNTAPLPVKSIVLQAAVPKSMKVKLQPPS 661

Query: 578 SNTL----PATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
              L    P     +ITQ + + N    K+ + +R ++ + +  +   E G+++ FP
Sbjct: 662 GTELSPFSPIQPPAAITQVMLLANPM--KEKVRLRYKLTFALGEQLSTELGEVDQFP 716



>gb:AK031086_1162289 Mus musculus 13 days embryo forelimb cDNA,
           RIKEN full-length enriched library, clone:5930403M04
           product:similar to ADP-RIBOSYLATION FACTOR BINDING
           PROTEIN GGA3 (GOLGI-LOCALIZED, GAMMA EAR-CONTAINING,
           ARF-BINDING PROTEIN 3) [Homo sapiens], full insert
           sequence.
          Length = 718

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 31/117 (26%), Positives = 60/117 (51%), Gaps = 6/117 (5%)
 Frame = -2

Query: 752 AFESSSIKLMFNFSKQ--PGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPAS 579
           A++ +  +++F+F+K+  PG P   VV  +  N +       + QAAVPK +++ L P S
Sbjct: 596 AYDKNGFRILFHFAKECPPGRPDVLVVVVSMLNTAPLPVKSIVLQAAVPKSMKVKLQPPS 655

Query: 578 SNTL----PATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
              L    P     +ITQ + + N    K+ + +R ++ + +  +   E G+++ FP
Sbjct: 656 GTELSPFSPIQPPAAITQVMLLANPM--KEKVRLRYKLTFALGEQLSTELGEVDQFP 710



>gb:D63876_1994839 Human mRNA for KIAA0154 gene, partial cds.
          Length = 692

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 31/117 (26%), Positives = 60/117 (51%), Gaps = 6/117 (5%)
 Frame = -2

Query: 752 AFESSSIKLMFNFSKQ--PGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPAS 579
           A++ +  +++F+F+K+  PG P   VV  +  N +       + QAAVPK +++ L P S
Sbjct: 570 AYDKNGFRILFHFAKECPPGRPDVLVVVVSMLNTAPLPVKSIVLQAAVPKSMKVKLQPPS 629

Query: 578 SNTL----PATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
              L    P     +ITQ + + N    K+ + +R ++ + +  +   E G+++ FP
Sbjct: 630 GTELSPFSPIQPPAAITQVMLLANPL--KEKVRLRYKLTFALGEQLSTEVGEVDQFP 684



>gb:BC070044_1988394 Homo sapiens golgi associated, gamma adaptin
           ear containing, ARF binding protein 3, transcript
           variant short, mRNA (cDNA clone MGC:87095
           IMAGE:4814878), complete cds.
          Length = 690

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 31/117 (26%), Positives = 60/117 (51%), Gaps = 6/117 (5%)
 Frame = -2

Query: 752 AFESSSIKLMFNFSKQ--PGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPAS 579
           A++ +  +++F+F+K+  PG P   VV  +  N +       + QAAVPK +++ L P S
Sbjct: 568 AYDKNGFRILFHFAKECPPGRPDVLVVVVSMLNTAPLPVKSIVLQAAVPKSMKVKLQPPS 627

Query: 578 SNTL----PATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
              L    P     +ITQ + + N    K+ + +R ++ + +  +   E G+++ FP
Sbjct: 628 GTELSPFSPIQPPAAITQVMLLANPL--KEKVRLRYKLTFALGEQLSTEVGEVDQFP 682



>gb:AF190864_1889023 Homo sapiens ADP-ribosylation factor binding
           protein GGA3 (GGA3) mRNA, complete
           cds.>gb:AF219139_1890685 Homo sapiens GGA3 short isoform
           mRNA, alternatively spliced, complete cds.
          Length = 690

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 31/117 (26%), Positives = 60/117 (51%), Gaps = 6/117 (5%)
 Frame = -2

Query: 752 AFESSSIKLMFNFSKQ--PGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPAS 579
           A++ +  +++F+F+K+  PG P   VV  +  N +       + QAAVPK +++ L P S
Sbjct: 568 AYDKNGFRILFHFAKECPPGRPDVLVVVVSMLNTAPLPVKSIVLQAAVPKSMKVKLQPPS 627

Query: 578 SNTL----PATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
              L    P     +ITQ + + N    K+ + +R ++ + +  +   E G+++ FP
Sbjct: 628 GTELSPFSPIQPPAAITQVMLLANPL--KEKVRLRYKLTFALGEQLSTEVGEVDQFP 682



>gb:CR382130_1663448 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 616

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 40/111 (36%), Positives = 60/111 (54%), Gaps = 4/111 (3%)
 Frame = -2

Query: 746 ESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFI----FQAAVPKFLQLHLDPAS 579
           ++  IK+    S+   N + T+    F+NKS   FTD I    F+ A PK + L LDPAS
Sbjct: 514 QTGDIKVSGLVSRSGSNVEITL---QFSNKS---FTDNITALDFKIAAPKSVTLKLDPAS 567

Query: 578 SNTLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINN 426
           S+TL A     +TQ+  V N+  G K L +R ++ + + GK V E G + +
Sbjct: 568 SDTLGAASINGVTQEAHVGNA--GDK-LKLRFKLNFNIGGKAVEEVGTVED 615



>gb:CR859188_1183321 Pongo pygmaeus mRNA; cDNA DKFZp459F1725 (from
           clone DKFZp459F1725).
          Length = 723

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 31/117 (26%), Positives = 60/117 (51%), Gaps = 6/117 (5%)
 Frame = -2

Query: 752 AFESSSIKLMFNFSKQ--PGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPAS 579
           A++ +  +++F+F+K+  PG P   VV  +  N +       + QAAVPK +++ L P S
Sbjct: 601 AYDKNGFRILFHFAKECPPGRPDVLVVVVSMLNTAPLPVKSIVLQAAVPKSMKVKLQPPS 660

Query: 578 SNTL----PATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
              L    P     +ITQ + + N    K+ + +R ++ + +  +   E G+++ FP
Sbjct: 661 GTELSPFSPIQPPAAITQVMLLANPL--KEKVRLRYKLTFALGEQLSTEVGEVDQFP 715



>sp|Q9NZ52|GGA3_HUMAN ADP-ribosylation factor binding protein GGA3
           (Golgi-localized, gamma ear-containing, ARF-binding
           protein 3).>gb:AF219138_1890684 Homo sapiens GGA3 long
           isoform mRNA, alternatively spliced, complete cds.
          Length = 723

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 31/117 (26%), Positives = 60/117 (51%), Gaps = 6/117 (5%)
 Frame = -2

Query: 752 AFESSSIKLMFNFSKQ--PGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPAS 579
           A++ +  +++F+F+K+  PG P   VV  +  N +       + QAAVPK +++ L P S
Sbjct: 601 AYDKNGFRILFHFAKECPPGRPDVLVVVVSMLNTAPLPVKSIVLQAAVPKSMKVKLQPPS 660

Query: 578 SNTL----PATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
              L    P     +ITQ + + N    K+ + +R ++ + +  +   E G+++ FP
Sbjct: 661 GTELSPFSPIQPPAAITQVMLLANPL--KEKVRLRYKLTFALGEQLSTEVGEVDQFP 715



>gb:AK004632_1152471 Mus musculus adult male lung cDNA, RIKEN
           full-length enriched library, clone:1200007E24
           product:similar to ADP-RIBOSYLATION FACTOR BINDING
           PROTEIN GGA2 (GOLGI-LOCALIZED, GAMMA EAR-CONTAINING,
           ARF-BINDING PROTEIN 2) (GAMMA-ADAPTIN RELATED PROTEIN 2)
           (VEAR) (VHS DOMAIN AND EAR DOMAIN OF GAMMA-ADAPTIN)
           [Homo sapiens], full insert sequence.
          Length = 603

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 28/115 (24%), Positives = 62/115 (53%), Gaps = 5/115 (4%)
 Frame = -2

Query: 749 FESSSIKLMFNFSKQ--PGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASS 576
           ++ +  +++ +FS+    G+P   V+     + +     D +FQ AVPK +++ L PASS
Sbjct: 482 YDRNGFRILLHFSQTGAAGHPDVKVLLLTMMSTATQPVWDVMFQVAVPKSMRVKLQPASS 541

Query: 575 NTLPATG---NGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
           + LPA       ++  +  ++++ H K+ + +R ++ +   G+   E G++ +FP
Sbjct: 542 SKLPAFSPLMPPAVISQTLLLDNPH-KEPIRLRYKLTFNQGGQPFSEVGEVKDFP 595



>gb:CR382128_1661227 Yarrowia lipolytica chromosome B of strain CLIB99
            of Yarrowia lipolytica.
          Length = 806

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 30/102 (29%), Positives = 51/102 (50%)
 Frame = -2

Query: 728  LMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSNTLPATGNG 549
            L   FS       T  + A+F+N   +  +    QAAVPK  +L L P +S ++   G G
Sbjct: 704  LSLGFSAGTAQGLTVPITAHFSNTGGSPISSISLQAAVPKTQKLALQPPASQSI---GPG 760

Query: 548  SITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNF 423
            S T +   +  Q    ++ +R+R+G+ +NG+ V E+   + F
Sbjct: 761  STTTQQLRVTVQGAGAAVKLRVRLGFSVNGQQVQEQFTFDKF 802



>gb:CR382125_1658185 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 581

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 34/104 (32%), Positives = 50/104 (48%), Gaps = 1/104 (0%)
 Frame = -2

Query: 728 LMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSNTLPATGNG 549
           L F F+    +  T  V + F+N S +  TD     AVPK  QL L P S+  L +    
Sbjct: 477 LKFEFAISRESESTIKVTSFFSNVSISQLTDLTLMLAVPKAQQLRLLPQSNTVLSSYAKD 536

Query: 548 SITQKLRVINS-QHGKKSLVMRLRIGYKMNGKDVLEEGQINNFP 420
            I QK  + N+ ++  K L ++ ++ YK NG    EE  +  FP
Sbjct: 537 GIHQKSWIDNAVKNAPKPLRVKWKVSYKANGVP-KEESAVYTFP 579



>gb:CR380947_1649098 Candida glabrata strain CBS138 chromosome A
           complete sequence.
          Length = 588

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 30/112 (26%), Positives = 54/112 (48%), Gaps = 1/112 (0%)
 Frame = -2

Query: 749 FESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSNT 570
           F+S  I++  + +++  +  T  ++  F N +     + +F  A PK +QL L+P S N 
Sbjct: 479 FKSGDIEIELDLARE--SDSTLKLKVFFNNLTFQTINNLVFSIATPKSVQLRLEPQSGNL 536

Query: 569 LPATGNGSITQKLRVINSQHG-KKSLVMRLRIGYKMNGKDVLEEGQINNFPR 417
           L A   G ITQ   + N+     K L ++ ++ Y  N  +  EE  +   P+
Sbjct: 537 LLANSKGGITQNAWIDNAPTTLTKPLKLKWKVSYTYNSSN-KEETAVYTLPK 587



>gb:AE017341_1754029 Cryptococcus neoformans var. neoformans JEC21
            chromosome 1, complete sequence.
          Length = 854

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 31/117 (26%), Positives = 51/117 (43%)
 Frame = -2

Query: 752  AFESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSN 573
            A++ +S+K+       P  P    + A FT            Q AVPK  QL +   SS 
Sbjct: 741  AYDKNSLKITLTPKVSPAQPGVVQILARFTTNGTEKIEGVNLQVAVPKTQQLQMQAMSSQ 800

Query: 572  TLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEGQINNFPRGL*GS 402
             +     G  TQ++R+        ++ +R+RI +   G+ + ++     FP GL GS
Sbjct: 801  EIAP--GGVETQQMRI--HVPAGATIRLRMRISFTRAGQSLTDQQDFAGFPAGLTGS 853



>sp|P38817|GGA2_YEAST ADP-ribosylation factor binding protein GGA2
           (Golgi-localized, gamma ear-containing, ARF-binding
           protein 2).>pir|S48950|S48950 hypothetical protein
           YHR108w - yeast (Saccharomyces
           cerevisiae)>gb:YSCH8263_1729090 Saccharomyces cerevisiae
           chromosome VIII cosmid 8263.
          Length = 585

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 27/102 (26%), Positives = 54/102 (52%), Gaps = 1/102 (0%)
 Frame = -2

Query: 746 ESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSNTL 567
           +S ++K+ F  S++  +     +++ FTN S +  ++ +F  AVPK + L L P SSN +
Sbjct: 477 QSPNLKIEFEISRESNS--VIRIKSFFTNLSSSPISNLVFLLAVPKSMSLKLQPQSSNFM 534

Query: 566 PATGNGSITQKLRVINS-QHGKKSLVMRLRIGYKMNGKDVLE 444
                  I+Q+  + N+  +  K+L ++ ++ Y +N     E
Sbjct: 535 IGNAKDGISQEGTIENAPANPSKALKVKWKVNYSVNSTQAEE 576



>gb:AL772295_2504513 Zebrafish DNA sequence from clone CH211-14A17
           in linkage group 2 Contains a novel gene for a protein
           similar to apoptotic chromatin condensation inducer in
           the nucleus (ACINUS), two novel genes, a novel gene for
           a protein with a short chain dehydrogenase domain, a
           novel homeodomain gene, two novel genes for proteins
           with a zona pellucida-like domain, a novel
           ubiquitin-like gene, a novel gene similar to AP1G2
           (adaptor-related protein complex 1, gamma 2 subunit), a
           novel gene similar to SLC7A8 (solute carrier family 7
           (cationic amino acid transporter, y+ system), member 8),
           a novel gene similar to human and mouse SKB1 homolog (S.
           pombe), a gene for a novel proteasome, the psmb5 gene
           for proteasome (prosome, macropain) subunit, beta type,
           5 and two CpG islands, complete sequence.
          Length = 754

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 24/77 (31%), Positives = 39/77 (50%)
 Frame = -2

Query: 749 FESSSIKLMFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSNT 570
           +E + + L      Q     T  + A+  N ++N  ++F  QAAVPK +QL +   S N 
Sbjct: 676 YEKNGVSLKIQCDSQTDTDITVTLIAS--NSTQNDISNFTLQAAVPKSVQLQMKAPSGNV 733

Query: 569 LPATGNGSITQKLRVIN 519
           + A G G +TQ + + N
Sbjct: 734 IAAHGLGQVTQTVLLNN 750



>gb:CR382139_1672712 Debaryomyces hansenii chromosome G of strain
           CBS767 of Debaryomyces hansenii.
          Length = 573

 Score = 41.2 bits (95), Expect = 0.021
 Identities = 31/112 (27%), Positives = 53/112 (47%), Gaps = 3/112 (2%)
 Frame = -2

Query: 764 SINYAFESSSIKL---MFNFSKQPGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLH 594
           S N   +SS++K+   +FN S         +    F+N      T+F F  AVPK  +L+
Sbjct: 462 STNLINQSSALKIETGIFNSSTSTNLSGKLL----FSNLQSTALTNFKFMLAVPKSCKLN 517

Query: 593 LDPASSNTLPATGNGSITQKLRVINSQHGKKSLVMRLRIGYKMNGKDVLEEG 438
           L P SS+ +      S+TQ+  + N+ +  K L ++ +  Y +  +   E G
Sbjct: 518 LKPQSSDVIHGNNKQSVTQEFSIENNMN--KQLRVKWKAEYNIGNEHREETG 567



>gb:CEY105E8A_1369203 Caenorhabditis elegans YAC Y105E8A, complete
           sequence.
          Length = 829

 Score = 39.3 bits (90), Expect = 0.080
 Identities = 24/81 (29%), Positives = 40/81 (49%)
 Frame = -2

Query: 662 NKSENVFTDFIFQAAVPKFLQLHLDPASSNTLPATGNGSITQKLRVINSQHGKKSLVMRL 483
           N +    +++ F AAV K  ++ L+PASS   P       T +   I  +    +  MR 
Sbjct: 750 NYTPRTLSNYNFFAAVTKTFEIALEPASS---PNIDPNEHTTQFMTITRKAPNTTARMRT 806

Query: 482 RIGYKMNGKDVLEEGQINNFP 420
           +I Y ++G + + EG +N FP
Sbjct: 807 KISYIVDGTEQVGEGVVNEFP 827



>sp|Q99128|ADG_USTMA Gamma-adaptin (Golgi adaptor HA1/AP1 adaptin
            gamma subunit) (Clathrin assembly protein complex 1 gamma
            large chain) (Gamma-ADA).>pir|S49876|S49876 gamma-adaptin
            - smut fungus (Ustilago maydis)>gb:UMGADAPTN_1726841
            U.maydis gene for gamma-adaptin.
          Length = 853

 Score = 38.1 bits (87), Expect = 0.18
 Identities = 26/88 (29%), Positives = 50/88 (56%)
 Frame = -2

Query: 704  PGNPQTTVVEANFTNKSENVFTDFIFQAAVPKFLQLHLDPASSNTLPATGNGSITQKLRV 525
            P  P+   + A FT+ +  + ++  FQAAVPK  +L +   S++T+    + + TQ LRV
Sbjct: 763  PARPEIVHITARFTSATSAI-SNINFQAAVPKTHKLQMQAISNSTVHP--DSTETQPLRV 819

Query: 524  INSQHGKKSLVMRLRIGYKMNGKDVLEE 441
            +       ++ +RLRI ++++G  V ++
Sbjct: 820  MVPPGA--AVRLRLRIAFQVDGHSVQDQ 845


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 800,821,528
Number of Sequences: 1806583
Number of extensions: 15817398
Number of successful extensions: 36865
Number of sequences better than 10.0: 73
Number of HSP's better than 10.0 without gapping: 36064
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36839
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 48081474917
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)