BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig11262
         (910 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY072344_1567161 Arabidopsis thaliana plastid ribosomal prote...   249   7e-65   
gb:AE005173_894105 Arabidopsis thaliana chromosome 1, bottom arm...   249   7e-65   
gb:AF250383_1780881 Spinacia oleracea plastid ribosomal protein ...   240   3e-62   
gb:AC092852_1735762 Oryza sativa chromosome 3 BAC OSJNBa0032G11 ...   180   4e-44   
sp|Q8YMX2|RS6_ANASP|RS6_ANASP 30S ribosomal protein S6.>pir|AB2406|AB2406 ...    66   1e-09   Anabaena sp.
sp|P73636|RS6_SYNY3|RS6_SYNY3 30S ribosomal protein S6.>pir|S77123|S77123 ...    62   1e-08   Synechocystis sp.
gb:AY673996_1621382 Gracilaria tenuistipitata var. liui chloropl...    60   8e-08   
sp|Q8R6M1|RS6_THETN|RS6_THETN 30S ribosomal protein S6.>gb:AE013215_290310...    59   2e-07   
gb:BX572094_797332 Prochlorococcus marinus MED4 complete genome;...    58   2e-07   
gb:BX572101_799600 Prochlorococcus marinus MIT9313 complete geno...    57   5e-07   
sp|Q8DJE6|RS6_SYNEL|RS6_SYNEL 30S ribosomal protein S6.>gb:BA000039_727063...    57   6e-07   Synechococcus elongatus
gb:BX569695_777413 Synechococcus sp. WH8102 complete genome; seg...    56   8e-07   
gb:BA000045_740509 Gloeobacter violaceus PCC 7421 DNA, complete ...    56   8e-07   
sp|P51359|RR6_PORPU|RR6_PORPU Chloroplast 30S ribosomal protein S6.>pir|S7...    56   8e-07   Porphyra purpurea
sp|Q8EKV4|RS6_OCEIH|RS6_OCEIH 30S ribosomal protein S6.>gb:BA000028_697866...    55   1e-06   Oceanobacillus iheyensis
sp|O78447|RR6_GUITH|RR6_GUITH Chloroplast 30S ribosomal protein S6.>gb:AF0...    53   7e-06   Guillardia theta
gb:BA000043_740059 Geobacillus kaustophilus HTA426 DNA, complete...    53   9e-06   
gb:AP006841_574381 Bacteroides fragilis YCH46 DNA, complete genome.    53   9e-06   
sp|Q8A5S5|RS6_BACTN|RS6_BACTN 30S ribosomal protein S6.>gb:AE016935_361531...    53   9e-06   Bacteroides thetaiotaomicron
gb:AE017174_396921 Porphyromonas gingivalis W83 section 3 of 8 o...    52   1e-05   
gb:AE017166_396329 Prochlorococcus marinus subsp. marinus str. C...    52   2e-05   
sp|P56013|RS6_HELPY|RS6_HELPY 30S ribosomal protein S6.>pir|F64675|F64675 ...    52   2e-05   Helicobacter pylori
sp|Q8G274|RS6_BRUSU|RS6_BRUSU 30S ribosomal protein S6.>gb:AE014291_307906...    52   2e-05   Brucella suis bv. 1
gb:AX044746_1457896 Sequence 207 from Patent WO0066722.                51   4e-05   
gb:BX571662_779138 Wolinella succinogenes, complete genome; segm...    50   5e-05   
gb:AE017333_450133 Bacillus licheniformis DSM 13, complete genom...    50   6e-05   
sp|Q8YAR9|RS6_LISMO|RS6_LISMO 30S ribosomal protein S6.>pir|AE1080|AE1080 ...    50   6e-05   
sp|Q9ZJY1|RS6_HELPJ|RS6_HELPJ 30S ribosomal protein S6.>pir|F71840|F71840 ...    50   6e-05   Helicobacter pylori
gb:AE017180_398968 Geobacter sulfurreducens PCA, complete genome.      50   8e-05   
sp|Q92FR6|RS6_LISIN|RS6_LISIN 30S ribosomal protein S6.>pir|AF1437|AF1437 ...    50   8e-05   
sp|Q8YFP0|RS6_BRUME|RS6_BRUME 30S ribosomal protein S6.>pir|AB3437|AB3437 ...    49   1e-04   
sp|P48134|RR6_CYAPA|RR6_CYAPA Cyanelle 30S ribosomal protein S6.>pir|T0695...    49   1e-04   Cyanophora paradoxa
sp|Q9X8U2|RS6_STRCO|RS6_STRCO 30S ribosomal protein S6.>pir|T36593|T36593 ...    49   1e-04   
gb:AE017145_390289 Helicobacter hepaticus ATCC 51449 section 2 o...    48   2e-04   
gb:CP000033_88330 Lactobacillus acidophilus NCFM, complete genome.     48   2e-04   
gb:AP008231_581180 Synechococcus elongatus PCC 6301 DNA, complet...    48   3e-04   
gb:AP006627_566421 Bacillus clausii KSM-K16 DNA, complete genome.      48   3e-04   
sp|Q97CX2|RS6_CLOAB|RS6_CLOAB 30S ribosomal protein S6.>pir|A97357|A97357 ...    47   4e-04   Clostridium acetobutylicum
gb:BA000030_702176 Streptomyces avermitilis MA-4680 genomic DNA,...    47   7e-04   
sp|O19917|RR6_CYACA|RR6_CYACA Chloroplast 30S ribosomal protein S6.>pir|T1...    46   9e-04   Cyanidium caldarium
sp|Q984T8|RS6_RHILO|RS6_RHILO 30S ribosomal protein S6.>gb:BA000012_672153...    45   0.002   Mesorhizobium loti
gb:BA000016_675682 Clostridium perfringens str. 13 DNA, complete...    45   0.003   
sp|Q8XH43|RS6_CLOPE|RS6_CLOPE 30S ribosomal protein S6.                          45   0.003   Clostridium perfringens
sp|O66474|RS6_AQUAE|RS6_AQUAE 30S ribosomal protein S6.>pir|G70305|G70305 ...    45   0.003   Aquifex aeolicus
gb:CP000009_862333 Gluconobacter oxydans 621H, complete genome.        44   0.003   
gb:AE017200_403376 Lactobacillus johnsonii NCC 533, section 1 of...    44   0.003   
sp|Q9ZAH3|RS6_CAMJE|RS6_CAMJE 30S ribosomal protein S6.>pir|A81310|A81310 ...    44   0.003   
gb:AP006840_570506 Symbiobacterium thermophilum DNA, complete ge...    44   0.004   
sp|P21468|RS6_BACSU|RS6_BACSU 30S ribosomal protein S6 (BS9).>pir|S66015|S...    44   0.004   Bacillus subtilis
gb:CJY17166_848450 Campylobacter jejuni lon, rpS18, ssb, rpS6 ge...    42   0.013   
sp|Q8K918|RS6_BUCAP|RS6_BUCAP 30S ribosomal protein S6.>gb:AE014128_303443...    42   0.013   
sp|Q8G756|RS6_BIFLO|RS6_BIFLO 30S ribosomal protein S6.>gb:AE014295_311800...    42   0.013   Bifidobacterium longum
gb:AE017283_431966 Propionibacterium acnes KPA171202, complete g...    42   0.016   
gb:AE017015_380286 Bacillus cereus ATCC 14579 section 18 of 18 o...    42   0.016   
sp|Q92QZ7|RS6_RHIME|RS6_RHIME 30S ribosomal protein S6.>gb:SME591786_18515...    42   0.016   Sinorhizobium meliloti
sp|O07813|RS6_NEIGO|RS6_NEIGO 30S ribosomal protein S6.>gb:AE004969_60341 ...    42   0.016   Neisseria gonorrhoeae
gb:AE017041_385597 Bacillus anthracis str. Ames section 18 of 18...    42   0.021   
sp|Q9JU24|RS6_NEIMA|RS6_NEIMA 30S ribosomal protein S6.>pir|D81845|D81845 ...    42   0.021   
gb:AE016947_364153 Enterococcus faecalis V583, section 1 of 11 o...    41   0.028   
sp|Q8CQP4|RS6_STAEP|RS6_STAEP 30S ribosomal protein S6.>gb:CP000029_80672 ...    41   0.028   Staphylococcus epidermidis
sp|Q9JZ29|RS6_NEIMB|RS6_NEIMB 30S ribosomal protein S6.>pir|B81097|B81097 ...    41   0.028   Neisseria meningitidis serogroup B
sp|Q9K5N8|RS6_BACHD|RS6_BACHD 30S ribosomal protein S6.>pir|B84156|B84156 ...    41   0.028   Bacillus halodurans
gb:AE017312_439209 Desulfovibrio vulgaris subsp. vulgaris str. H...    41   0.037   
sp|Q99WL2|RS6_STAAM|RS6_STAAM 30S ribosomal protein S6.>pir|F89802|F89802 ...    41   0.037   Staphylococcus aureus
sp|Q9CDM8|RS6_LACLA|RS6_LACLA 30S ribosomal protein S6.>pir|G86898|G86898 ...    40   0.062   Lactococcus lactis subsp. lactis
gb:AE016923_358601 Chromobacterium violaceum ATCC 12472 section ...    40   0.081   
gb:AE017340_457694 Idiomarina loihiensis L2TR, complete genome.        39   0.11    
sp|Q8UGE7|RS6_AGRT5|RS6_AGRT5 30S ribosomal protein S6.>pir|AB2711|AB2711 ...    39   0.11    Agrobacterium tumefaciens
gb:CP000027_80023 Dehalococcoides ethenogenes 195, complete genome.    39   0.18    
sp|O84807|RS6_CHLTR|RS6_CHLTR 30S ribosomal protein S6.>pir|G71469|G71469 ...    39   0.18    Chlamydia trachomatis
gb:BX842646_823083 Bdellovibrio bacteriovorus complete genome, s...    38   0.24    
gb:AJ749949_531519 Francisella tularensis subsp. tularensis comp...    38   0.31    
gb:CP000031_86303 Silicibacter pomeroyi DSS-3, complete genome.        38   0.31    
sp|Q99Y79|RS6_STRPY|RS6_STRPY 30S ribosomal protein S6.>gb:AE006609_220678...    38   0.31    Streptococcus pyogenes
sp|Q89A41|RS6_BUCBP|RS6_BUCBP 30S ribosomal protein S6.>gb:AE014017_302897...    38   0.31    
sp|P57627|RS6_BUCAI|RS6_BUCAI 30S ribosomal protein S6.>pir|F84995|F84995 ...    38   0.31    
sp|Q9PLC1|RS6_CHLMU|RS6_CHLMU 30S ribosomal protein S6.>pir|D81732|D81732 ...    37   0.40    Chlamydia muridarum [agent of mouse pneumonitis]
sp|Q9WZ72|RS6_THEMA|RS6_THEMA 30S ribosomal protein S6.>pir|G72354|G72354 ...    37   0.53    Thermotoga maritima
gb:BX248584_763710 Blochmannia floridanus complete genome; segme...    37   0.69    
sp|Q8DSD7|RS6_STRMU|RS6_STRMU 30S ribosomal protein S6.>gb:AE015012_314154...    36   0.90    Streptococcus mutans serotype C
sp|Q8XZT8|RS6_RALSO|RS6_RALSO 30S ribosomal protein S6.>gb:AL646063_546235...    36   0.90    Ralstonia solanacearum
gb:AY458636_619344 Uncultured bacterium 439 clone EBAC750-10B11 ...    36   1.2     
gb:CR555306_107720 Azoarcus sp. EbN1 complete genome.                  36   1.2     
sp|Q8ZB81|RS6_YERPE|RS6_YERPE 30S ribosomal protein S6.>pir|AD0430|AD0430 ...    36   1.2     Yersinia pestis
sp|Q8XG88|RS6_SALTY|RS6_SALTY 30S ribosomal protein S6.>pir|AG1052|AG1052 ...    36   1.2     Salmonella enterica subsp. enterica serovar Typhimurium
gb:BX950851_842348 Erwinia carotovora subsp. atroseptica SCRI104...    35   1.5     
gb:BX571965_791248 Burkholderia pseudomallei strain K96243, chro...    35   1.5     
sp|Q9VZD5|RT06_DROME|RT06_DROME Probable mitochondrial 28S ribosomal protei...    35   1.5     Drosophila melanogaster
sp|P02358|RS6_ECOLI|RS6_ECOLI 30S ribosomal protein S6.                          35   1.5     Escherichia coli [E. coli]
sp|Q8XDI1|RS6_ECOL6|RS6_ECOL6 30S ribosomal protein S6.>pir|C65231|R3EC6 r...    35   1.5     
sp|Q9A7Q1|RS6_CAUCR|RS6_CAUCR 30S ribosomal protein S6.>pir|C87456|C87456 ...    35   2.0     Caulobacter vibrioides
gb:AY773199_2148678 Synthetic construct 30S ribosomal RNA protei...    35   2.6     
gb:AB049942_1867794 Homo sapiens MRPS6 mRNA for mitochondrial ri...    35   2.6     
gb:CP000023_875601 Streptococcus thermophilus LMG 18311, complet...    34   3.4     
gb:BX908798_831148 Parachlamydia-related symbiont UWE25, complet...    34   3.4     
gb:BX571874_789428 Photorhabdus luminescens subsp. laumondii TTO...    34   3.4     
gb:BX640430_810713 Bordetella parapertussis strain 12822, comple...    34   4.5     
gb:CP000046_90607 Staphylococcus aureus subsp. aureus COL, compl...    34   4.5     
sp|Q97PR1|RS6_STRPN|RS6_STRPN 30S ribosomal protein S6.>pir|C98046|C98046 ...    34   4.5     
sp|Q8E3K0|RS6_STRA3|RS6_STRA3 30S ribosomal protein S6.>gb:SAG766853_17128...    33   5.8     
gb:BC083321_2108589 Mus musculus RIKEN cDNA 2700087H15 gene, mRN...    33   7.6     
gb:BC080757_2107829 Mus musculus RIKEN cDNA 2700087H15 gene, mRN...    33   7.6     
gb:BC067013_2105905 Mus musculus RIKEN cDNA 2700087H15 gene, mRN...    33   7.6     
gb:AC017117_1204175 Caenorhabditis elegans cosmid F43C11, comple...    33   10.0    
gb:BX321856_772526 Nitrosomonas europaea ATCC 19718, complete ge...    33   10.0    
gb:AE017153_392523 Haemophilus ducreyi strain 35000HP section 3 ...    33   10.0    


>gb:AY072344_1567161 Arabidopsis thaliana plastid ribosomal protein
           S6, putative (At1g64510) mRNA, complete
           cds.>gb:AY085527_1570596 Arabidopsis thaliana clone
           15602 mRNA, complete sequence.>gb:AY114581_1578623
           Arabidopsis thaliana plastid ribosomal protein S6,
           putative (At1g64510) mRNA, complete cds.
          Length = 207

 Score =  249 bits (635), Expect = 7e-65
 Identities = 121/170 (71%), Positives = 141/170 (82%), Gaps = 1/170 (0%)
 Frame = -3

Query: 725 SRPLLRHKKWNKHSEVVVKAETLEFSGSLFEGGIGEDDEPPSIPGWGISN-IEDKEEPQC 549
           S+P+    +    S+ VVK++ L+FSG+ FEGG G DD+P S  G G+S  +EDK EPQC
Sbjct: 37  SKPMCASIQKRDGSQFVVKSQALDFSGTFFEGGFGSDDDPTSPSGSGVSTALEDKPEPQC 96

Query: 548 PPGLRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNK 369
           PPGLRQYETMAVLRPD+SEDERL L  KYEELLVAGGGMYVEVFNRGVIPLAY+I+KKNK
Sbjct: 97  PPGLRQYETMAVLRPDMSEDERLGLTQKYEELLVAGGGMYVEVFNRGVIPLAYSIRKKNK 156

Query: 368 AGETNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRKRKF 219
           AGETNTY+DGIYLLFTYFTKPESI  LE  +  DDD+IRSSSFK++KRK+
Sbjct: 157 AGETNTYLDGIYLLFTYFTKPESIVPLETVLTADDDIIRSSSFKIKKRKY 206



>gb:AE005173_894105 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC009519_1536803 Genomic sequence
           for Arabidopsis thaliana BAC F1N19 from chromosome I,
           complete sequence.
          Length = 231

 Score =  249 bits (635), Expect = 7e-65
 Identities = 121/170 (71%), Positives = 141/170 (82%), Gaps = 1/170 (0%)
 Frame = -3

Query: 725 SRPLLRHKKWNKHSEVVVKAETLEFSGSLFEGGIGEDDEPPSIPGWGISN-IEDKEEPQC 549
           S+P+    +    S+ VVK++ L+FSG+ FEGG G DD+P S  G G+S  +EDK EPQC
Sbjct: 61  SKPMCASIQKRDGSQFVVKSQALDFSGTFFEGGFGSDDDPTSPSGSGVSTALEDKPEPQC 120

Query: 548 PPGLRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNK 369
           PPGLRQYETMAVLRPD+SEDERL L  KYEELLVAGGGMYVEVFNRGVIPLAY+I+KKNK
Sbjct: 121 PPGLRQYETMAVLRPDMSEDERLGLTQKYEELLVAGGGMYVEVFNRGVIPLAYSIRKKNK 180

Query: 368 AGETNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRKRKF 219
           AGETNTY+DGIYLLFTYFTKPESI  LE  +  DDD+IRSSSFK++KRK+
Sbjct: 181 AGETNTYLDGIYLLFTYFTKPESIVPLETVLTADDDIIRSSSFKIKKRKY 230



>gb:AF250383_1780881 Spinacia oleracea plastid ribosomal protein S6
           precursor (PrpS6) mRNA, partial cds; nuclear gene for
           chloroplast product.
          Length = 168

 Score =  240 bits (612), Expect = 3e-62
 Identities = 119/153 (77%), Positives = 135/153 (88%), Gaps = 1/153 (0%)
 Frame = -3

Query: 674 VKAETLEFSGSLFEGGIGE-DDEPPSIPGWGISNIEDKEEPQCPPGLRQYETMAVLRPDL 498
           VKA  L+FSGS FEGG G  D++PPS P  G++ +E+K EPQCPPGLRQYETMAVLRPD+
Sbjct: 17  VKAIALDFSGSFFEGGFGGLDEDPPSTPPAGLA-VEEKPEPQCPPGLRQYETMAVLRPDM 75

Query: 497 SEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGETNTYMDGIYLLFTY 318
           +EDERLTL  KYEELLVAGG MYVEVFNRGVIPLAY+IK+KNKAGETN Y+DGIYLLFTY
Sbjct: 76  TEDERLTLTQKYEELLVAGGAMYVEVFNRGVIPLAYSIKRKNKAGETNNYLDGIYLLFTY 135

Query: 317 FTKPESIAALEATMNTDDDVIRSSSFKLRKRKF 219
           FTKPESI+ LEA + TDDDVIRSSSFK+RKRK+
Sbjct: 136 FTKPESISPLEAALVTDDDVIRSSSFKIRKRKY 168



>gb:AC092852_1735762 Oryza sativa chromosome 3 BAC OSJNBa0032G11
           genomic sequence, complete sequence.
          Length = 219

 Score =  180 bits (456), Expect = 4e-44
 Identities = 86/119 (72%), Positives = 103/119 (86%), Gaps = 1/119 (0%)
 Frame = -3

Query: 575 IEDKEEPQCPPGLRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPL 396
           +E++E P CPPGLRQYETM VLRPD+SE+ERL L+ +YEELLVAGG MYVEVFNRGVIPL
Sbjct: 99  LEEREMPPCPPGLRQYETMVVLRPDMSEEERLALIQRYEELLVAGGAMYVEVFNRGVIPL 158

Query: 395 AYNIKKKN-KAGETNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRKRK 222
           AY+I+K+N + G  +TY DGIYLL TYFTKPES+ AL+  +N DDDVIRS+SFK+RKRK
Sbjct: 159 AYSIRKRNSRTGLPSTYYDGIYLLVTYFTKPESLDALQMRLNADDDVIRSTSFKVRKRK 217



>sp|Q8YMX2|RS6_ANASP 30S ribosomal protein S6.>pir|AB2406|AB2406 30S
           ribosomal protein S6 [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_685791 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 108

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 38/98 (38%), Positives = 55/98 (56%)
 Frame = -3

Query: 530 YETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGETNT 351
           YET+ +LRPDL++++    ++KY+ LL   G   +EV NRG   LAY IKK+        
Sbjct: 5   YETLYILRPDLTDEQVELAIAKYQNLLQEQGATDLEVQNRGKRRLAYEIKKQR------- 57

Query: 350 YMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFK 237
             DG Y+ F Y    ++IA LE  M   ++VIR  + K
Sbjct: 58  --DGFYVQFNYNAPGKAIAILERAMRLSEEVIRYLTVK 93



>sp|P73636|RS6_SYNY3 30S ribosomal protein S6.>pir|S77123|S77123
           ribosomal protein S6 - Synechocystis sp. (strain PCC
           6803)>gb:BA000022_688460 Synechocystis sp. PCC 6803 DNA,
           complete genome.
          Length = 113

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 39/106 (36%), Positives = 55/106 (51%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +  YE M +LRPDL+E+     V+KY+E L       V V   G   LAY I++ N    
Sbjct: 3   VNSYELMVILRPDLNEERVSQEVTKYQEFLTNNAAEEVSVKVWGKRRLAYQIRRFN---- 58

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRKRK 222
                DGIY+LF +  + + IA +E  M  +D+V+R  S KL   K
Sbjct: 59  -----DGIYVLFNFNGEGQQIALIERDMRLNDNVMRFLSIKLTPEK 99



>gb:AY673996_1621382 Gracilaria tenuistipitata var. liui
           chloroplast, complete genome.
          Length = 103

 Score = 59.7 bits (143), Expect = 8e-08
 Identities = 34/101 (33%), Positives = 53/101 (52%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           L +YET+ +L+P+++E E L L+++Y+ L+   GG  + V ++G   L YNIK       
Sbjct: 3   LNKYETIYILQPNITESENLILINEYKALIKKYGGNNIVVQHKGRRHLNYNIK------- 55

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFK 237
             +Y DGIY+   Y      +  LE  M     VIR  + K
Sbjct: 56  --SYYDGIYVQINYTASSNLVRILEKAMRLSQHVIRYMTIK 94



>sp|Q8R6M1|RS6_THETN 30S ribosomal protein S6.>gb:AE013215_290310
           Thermoanaerobacter tengcongensis MB4, section 242 of 244
           of the complete genome.>gb:AE008691_1112375
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 95

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 34/96 (35%), Positives = 50/96 (52%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YETM VL PDL+E+ER  L+ +++ L+V  GG        G   LAY I+KK+    
Sbjct: 1   MRSYETMYVLSPDLNEEERKGLIERFKNLIVERGGEITNFDEWGKRKLAYPIQKKS---- 56

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIR 252
                +G Y+L  + + P+    LE      D V+R
Sbjct: 57  -----EGYYVLMNFNSSPDVSRELERVYRITDGVLR 87



>gb:BX572094_797332 Prochlorococcus marinus MED4 complete genome;
           segment 5/5.
          Length = 154

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 35/98 (35%), Positives = 51/98 (52%)
 Frame = -3

Query: 530 YETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGETNT 351
           YETM +LRPD++EDE    + KY +LL   GG  ++   RG   LAY I K         
Sbjct: 7   YETMYILRPDIAEDEVTNHIDKYNKLLEESGGKILDSQMRGKRRLAYQIAK--------- 57

Query: 350 YMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFK 237
           + +GIY+  ++    + I  +E  M   +DVIR  + K
Sbjct: 58  HREGIYVQLSHQGDGQHIFKIEKAMRLSEDVIRYLTVK 95



>gb:BX572101_799600 Prochlorococcus marinus MIT9313 complete genome;
           segment 7/7.
          Length = 124

 Score = 57.0 bits (136), Expect = 5e-07
 Identities = 34/98 (34%), Positives = 52/98 (53%)
 Frame = -3

Query: 530 YETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGETNT 351
           YETM +LRPD+ E+E  T V+KY E++   G   ++   RG   LAY I         + 
Sbjct: 7   YETMYILRPDIPEEEVETHVTKYREMVTEAGAEVLDNQMRGKRRLAYPI---------SN 57

Query: 350 YMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFK 237
           + +GIY+  ++    + +A LE  M   +DVIR  + K
Sbjct: 58  HKEGIYVQLSHNGNGQQVAVLEKAMRLSEDVIRYLTVK 95



>sp|Q8DJE6|RS6_SYNEL 30S ribosomal protein S6.>gb:BA000039_727063
           Thermosynechococcus elongatus BP-1 DNA, complete genome.
          Length = 114

 Score = 56.6 bits (135), Expect = 6e-07
 Identities = 32/103 (31%), Positives = 53/103 (51%)
 Frame = -3

Query: 536 RQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGET 357
           R YET+ ++RPD+ E++    +S++   L   G   ++V NRG    AY IKK       
Sbjct: 4   RNYETLYIIRPDVGEEQLEQTISQFRTFLEEQGATKLKVQNRGKRRFAYPIKK------- 56

Query: 356 NTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRK 228
               +G Y+L TY     +IA LE  M  +++++R  +  L +
Sbjct: 57  --LREGYYILMTYTAPGTAIAPLERAMRLNENILRFMTIVLEE 97



>gb:BX569695_777413 Synechococcus sp. WH8102 complete genome;
           segment 7/7.
          Length = 127

 Score = 56.2 bits (134), Expect = 8e-07
 Identities = 34/98 (34%), Positives = 53/98 (54%)
 Frame = -3

Query: 530 YETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGETNT 351
           YETM +LRPD+ E+E  + ++KY ++LV  G   ++   RG   LAY I K         
Sbjct: 7   YETMYILRPDIPEEEVESHLTKYRDMLVEAGADVLDNQMRGKRRLAYPIDK--------- 57

Query: 350 YMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFK 237
           + +GIY+  ++    + +A LE  M   +DVIR  + K
Sbjct: 58  HKEGIYVQLSHNGDGQQVAVLEKAMRLSEDVIRYLTVK 95



>gb:BA000045_740509 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 96

 Score = 56.2 bits (134), Expect = 8e-07
 Identities = 32/94 (34%), Positives = 50/94 (53%)
 Frame = -3

Query: 533 QYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGETN 354
           +YETM +LRPDL+++     +++Y+ LL   G   VE  +RG   LAY +KK        
Sbjct: 4   KYETMYILRPDLTDEIIDQTITRYQTLLAEQGAAPVETQHRGKRRLAYELKK-------- 55

Query: 353 TYMDGIYLLFTYFTKPESIAALEATMNTDDDVIR 252
            + +GIY+   Y     ++A LE      ++VIR
Sbjct: 56  -FKEGIYVQMNYDAPTTAVAELEKAFRLSEEVIR 88



>sp|P51359|RR6_PORPU Chloroplast 30S ribosomal protein
           S6.>pir|S73280|S73280 ribosomal protein S6, chloroplast
           - red alga (Porphyra purpurea)
           chloroplast>gb:PPU38804_1701675 Porphyra purpurea
           chloroplast, complete genome.
          Length = 112

 Score = 56.2 bits (134), Expect = 8e-07
 Identities = 31/104 (29%), Positives = 57/104 (54%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           L  YET+ +++ DL+ED  L ++++Y+ +L  GG   + + +RG   L+Y+IK       
Sbjct: 12  LNWYETVYLIKSDLNEDRTLCIINEYKSMLTNGGAKNIILQHRGRRHLSYSIK------- 64

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRK 228
              Y DGIY+   Y    + + + E ++  D+++IR  + K  K
Sbjct: 65  --DYRDGIYVQVNYEGNGKLVQSFEKSLRFDENIIRYLTNKQNK 106



>sp|Q8EKV4|RS6_OCEIH 30S ribosomal protein S6.>gb:BA000028_697866
           Oceanobacillus iheyensis HTE831 DNA, complete genome.
          Length = 95

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 29/101 (28%), Positives = 50/101 (49%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R+YE M ++RPD+ E+ +  L+ ++  +L   G    +V  +G   LAY         E
Sbjct: 1   MRKYEIMYIIRPDIEEEAQTALIERFNTILTDNGAEIDKVDEKGKRRLAY---------E 51

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFK 237
            N Y DG Y++  +    E+I   +     +DD+IR  + K
Sbjct: 52  INDYRDGYYVIINFRGSEEAINEFDRLAKFNDDIIRHMAIK 92



>sp|O78447|RR6_GUITH Chloroplast 30S ribosomal protein
           S6.>gb:AF041468_1763503 Guillardia theta complete
           plastid genome.
          Length = 96

 Score = 53.1 bits (126), Expect = 7e-06
 Identities = 31/96 (32%), Positives = 46/96 (47%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           L  YET+ +++P+L+ED    L+  Y+ LL+  G   +   NRG   L Y IKK      
Sbjct: 4   LNSYETLYIVKPELTEDSLAKLIESYQGLLLERGAKNIITQNRGRRTLKYMIKK------ 57

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIR 252
              Y D  Y+   Y    E I  LE  M  ++ ++R
Sbjct: 58  ---YKDAHYVQMNYEGNGEVIQLLERAMKINESIVR 90



>gb:BA000043_740059 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 95

 Score = 52.8 bits (125), Expect = 9e-06
 Identities = 26/96 (27%), Positives = 49/96 (51%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R+YE M ++RP++ ++ R  LV ++  +L   G     V + G   LAY I+K      
Sbjct: 1   MRKYEIMYIIRPNMDDEARQALVERFNNVLKENGAEITNVTDWGKRRLAYEIQK------ 54

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIR 252
              Y DG Y++    ++P+++   +      +D+IR
Sbjct: 55  ---YRDGYYMIVNVVSEPKAVQEFDRLARISEDIIR 87



>gb:AP006841_574381 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 114

 Score = 52.8 bits (125), Expect = 9e-06
 Identities = 34/104 (32%), Positives = 52/104 (50%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           + QYET+ +L P LS+ +    V K++ +L A G   +   N G+  LAY I+KK+    
Sbjct: 1   MNQYETVFILTPVLSDVQMKEAVEKFKGILQAEGAEIINEENWGLKKLAYPIQKKST--- 57

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRK 228
                 G Y L  +  +P  I  LE     D+ VIR  +F++ K
Sbjct: 58  ------GFYQLIEFNAEPTVIDKLELNFRRDERVIRFLTFRMDK 95



>sp|Q8A5S5|RS6_BACTN 30S ribosomal protein S6.>gb:AE016935_361531
           Bacteroides thetaiotaomicron VPI-5482, section 10 of 21
           of the complete genome.>gb:AE015928_988019 Bacteroides
           thetaiotaomicron VPI-5482, complete genome.
          Length = 114

 Score = 52.8 bits (125), Expect = 9e-06
 Identities = 35/104 (33%), Positives = 51/104 (49%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           + QYET+ +L P LS+ +    V K++ +L A G   +   N G+  LAY I+KK+    
Sbjct: 1   MNQYETVFILTPVLSDVQMKEAVEKFKGILQAEGAEIINEENWGLKKLAYPIQKKST--- 57

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRK 228
                 G Y L  +   P  I  LE     D+ VIR  +FK+ K
Sbjct: 58  ------GFYQLVEFNADPTVIDKLELNFRRDERVIRFLTFKMDK 95



>gb:AE017174_396921 Porphyromonas gingivalis W83 section 3 of 8 of
           the complete genome.>gb:AE015924_1032532 Porphyromonas
           gingivalis W83 complete genome.
          Length = 117

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 35/104 (33%), Positives = 50/104 (48%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +  YET+ +L P LS+ +    V K+  LL   G + V   N G+  LAY I+KK+    
Sbjct: 1   MNNYETVFILTPVLSDAQMKEAVDKFTGLLKQEGAVIVNEENWGLRKLAYPIQKKST--- 57

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRK 228
                 G Y L  +   P+ IA LE     D+ VIR  +F+  K
Sbjct: 58  ------GFYQLVEFQANPDVIAKLETNFRRDERVIRFLTFRQDK 95



>gb:AE017166_396329 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 6 of 6 of the complete
           genome.>gb:AE017126_1031998 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 210

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 33/98 (33%), Positives = 49/98 (50%)
 Frame = -3

Query: 530 YETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGETNT 351
           YETM +LRPD+ EDE    + KY E+L       ++   RG   LAY I K         
Sbjct: 7   YETMYILRPDIPEDEVEGHLKKYSEVLEKAKAKIIDNQMRGKRRLAYTIGK--------- 57

Query: 350 YMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFK 237
           + +GIY+  ++    + +  LE +M   +DVIR  + K
Sbjct: 58  HKEGIYVQLSHTGNGKHVETLERSMRLSEDVIRYLTVK 95



>sp|P56013|RS6_HELPY 30S ribosomal protein S6.>pir|F64675|F64675
           ribosomal protein S6 - Helicobacter pylori (strain
           26695)>gb:AE000630_25410 Helicobacter pylori 26695
           section 108 of 134 of the complete
           genome.>gb:AE000511_880849 Helicobacter pylori 26695
           complete genome.
          Length = 142

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 31/106 (29%), Positives = 51/106 (48%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YETM +L+P L E+E  + +  Y+E++    G+     + G+  LAY IKK  +   
Sbjct: 1   MRHYETMFILKPTLVEEEIKSKIEFYKEVITKHHGVIETSLDMGMRNLAYEIKKHKR--- 57

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRKRK 222
                 G Y +  +  +P  I  LE     ++DV+R    K   +K
Sbjct: 58  ------GYYYVAYFKAEPSMIVELERLYRINEDVLRFIVIKYESKK 97



>sp|Q8G274|RS6_BRUSU 30S ribosomal protein S6.>gb:AE014291_307906
           Brucella suis 1330 chromosome I, complete sequence.
          Length = 148

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 32/111 (28%), Positives = 57/111 (51%)
 Frame = -3

Query: 530 YETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGETNT 351
           YE + + R D+S+ +   LV +++ +L A GG + +V N G+ PL Y IKK  KA     
Sbjct: 4   YEHVLLARQDISQQQVDALVEQFKGVLEANGGKFGKVENWGLRPLTYRIKKNRKA----- 58

Query: 350 YMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRKRKF*FACLLT 198
                Y L        ++A +E  M  ++DV+R  + ++ + +   + +LT
Sbjct: 59  ----YYTLVNIDAPAAAVAEMERQMRINEDVLRFLTVRVEEHEEGQSAMLT 105



>gb:AX044746_1457896 Sequence 207 from Patent WO0066722.
          Length = 141

 Score = 50.8 bits (120), Expect = 4e-05
 Identities = 31/105 (29%), Positives = 50/105 (47%)
 Frame = -3

Query: 536 RQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGET 357
           R YETM +L+P L E+E  + +  Y+E++    G+     + G+  LAY IKK  +    
Sbjct: 1   RHYETMFILKPTLVEEEIKSKIEFYKEVITKHHGVIETSLDMGMRNLAYEIKKHKR---- 56

Query: 356 NTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRKRK 222
                G Y +  +  +P  I  LE     ++DV+R    K   +K
Sbjct: 57  -----GYYYVAYFKAEPSMIVELERLYRINEDVLRFIVIKYESKK 96



>gb:BX571662_779138 Wolinella succinogenes, complete genome; segment
           6/7.
          Length = 137

 Score = 50.4 bits (119), Expect = 5e-05
 Identities = 27/106 (25%), Positives = 51/106 (48%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YETM +++P L+ +E +  ++ Y+E ++  GG      + G+  LAY I K  +   
Sbjct: 1   MRHYETMFIVKPTLTPEEIVEKINFYKEAIIKNGGEICATQDMGMRNLAYEINKNKR--- 57

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRKRK 222
                 G Y +  + + P  +  LE     ++D++R    K   +K
Sbjct: 58  ------GYYFVVYFKSAPSLVIELERLYRINEDILRFIVIKYESKK 97



>gb:AE017333_450133 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_859909 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 95

 Score = 50.1 bits (118), Expect = 6e-05
 Identities = 26/96 (27%), Positives = 44/96 (45%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R+YE M ++RPD+ E+ +  +V ++  +L   G    E  + G   LAY         E
Sbjct: 1   MRKYEIMYIIRPDVDEESKKAVVERFNNILTTNGAEITETKDWGKRRLAY---------E 51

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIR 252
            N + DG Y +       E++   +      DD+IR
Sbjct: 52  INDFRDGFYQILNVQAGAEAVQEFDRLAKISDDIIR 87



>sp|Q8YAR9|RS6_LISMO 30S ribosomal protein S6.>pir|AE1080|AE1080
           ribosomal protein S6 [imported] - Listeria monocytogenes
            (strain EGD-e)>gb:AE017322_442492 Listeria
           monocytogenes str. 4b F2365, section 1 of 10 of the
           complete genome.>gb:AL591973_534536 Listeria
           monocytogenes strain EGD, complete genome, segment
           1/12.>gb:AE017262_1074848 Listeria monocytogenes str. 4b
           F2365, complete genome.
          Length = 97

 Score = 50.1 bits (118), Expect = 6e-05
 Identities = 31/101 (30%), Positives = 48/101 (47%), Gaps = 1/101 (0%)
 Frame = -3

Query: 536 RQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGET 357
           R+YE M ++RP++ EDE+  +V +++ +L   G   +E    G   LAY         E 
Sbjct: 3   RKYEIMYIIRPNIEEDEKKAVVERFDGILTENGAEIIESKEWGKRRLAY---------EI 53

Query: 356 NTYMDGIY-LLFTYFTKPESIAALEATMNTDDDVIRSSSFK 237
           N Y DG Y ++     K +SI   +      DD+IR    K
Sbjct: 54  NDYRDGFYHIVKLNADKADSINEFDRLAKISDDIIRHMVIK 94



>sp|Q9ZJY1|RS6_HELPJ 30S ribosomal protein S6.>pir|F71840|F71840
           ribosomal protein S6 - Helicobacter pylori (strain
           J99)>gb:AE001544_36158 Helicobacter pylori, strain J99
           section 105 of 132 of the complete
           genome.>gb:AE001439_884928 Helicobacter pylori, strain
           J99 complete genome.
          Length = 142

 Score = 50.1 bits (118), Expect = 6e-05
 Identities = 31/106 (29%), Positives = 49/106 (46%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YETM +L+P L E+E  + +  Y E++    G+     + G+  LAY IKK  +   
Sbjct: 1   MRHYETMFILKPTLVEEEIKSKIEFYREVITKHHGVIETSLDMGMRNLAYEIKKHKR--- 57

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRKRK 222
                 G Y +  +   P  I  LE     ++DV+R    K   +K
Sbjct: 58  ------GYYYVAYFKADPSMILELERLYRINEDVLRFIVIKYESKK 97



>gb:AE017180_398968 Geobacter sulfurreducens PCA, complete genome.
          Length = 117

 Score = 49.7 bits (117), Expect = 8e-05
 Identities = 32/104 (30%), Positives = 52/104 (50%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YET+ +++P+L +DE   L +K  +++ +  G+   + + GV  LAY +KK      
Sbjct: 2   VRMYETIVIVQPELGDDELKGLTAKVTDIIGSFKGVLHRLEDWGVRKLAYPVKKS----- 56

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRK 228
               + G Y    +      IA LE  +  DD V+R  S KL K
Sbjct: 57  ----VRGRYYYVRFDGDAPLIAELERRLRLDDKVLRYQSVKLEK 96



>sp|Q92FR6|RS6_LISIN 30S ribosomal protein S6.>pir|AF1437|AF1437
           ribosomal protein S6 [imported] - Listeria innocua
           (strain Clip11262)>gb:AL596163_537384 Listeria innocua
           Clip11262 complete genome, segment 1/12.
          Length = 97

 Score = 49.7 bits (117), Expect = 8e-05
 Identities = 30/101 (29%), Positives = 48/101 (47%), Gaps = 1/101 (0%)
 Frame = -3

Query: 536 RQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGET 357
           R+YE M ++RP++ EDE+  +V +++ +L   G   +E    G   LAY         E 
Sbjct: 3   RKYEIMYIIRPNIEEDEKKAVVERFDGILTENGAEIIESKEWGKRRLAY---------EI 53

Query: 356 NTYMDGIY-LLFTYFTKPESIAALEATMNTDDDVIRSSSFK 237
           N Y DG Y ++     K +SI   +      DD++R    K
Sbjct: 54  NDYRDGFYHIVKLNADKADSINEFDRLAKISDDIVRHMVIK 94



>sp|Q8YFP0|RS6_BRUME 30S ribosomal protein S6.>pir|AB3437|AB3437 SSU
           ribosomal protein S6P [imported] - Brucella melitensis
           (strain 16M)>gb:AE009584_253398 Brucella melitensis 16M
           chromosome I, section 141 of 195 of the complete
           sequence.>gb:AE008917_979310 Brucella melitensis 16M
           chromosome I, complete sequence.
          Length = 148

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 31/111 (27%), Positives = 56/111 (50%)
 Frame = -3

Query: 530 YETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGETNT 351
           YE + + R D+S+ +   LV +++ +L A GG + +V N G+ PL Y IKK  KA     
Sbjct: 4   YEHVLLARQDISQQQVDALVEQFKGVLEANGGKFGKVENWGLRPLTYRIKKNRKA----- 58

Query: 350 YMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRKRKF*FACLLT 198
                Y L        ++A +E  M  ++DV+   + ++ + +   + +LT
Sbjct: 59  ----YYTLVNIDAPAAAVAEMERQMRINEDVLSFLTVRVEEHEEGQSAMLT 105



>sp|P48134|RR6_CYAPA Cyanelle 30S ribosomal protein
           S6.>pir|T06956|T06956 ribosomal protein S6 - Cyanophora
           paradoxa cyanelle>gb:CPU30821_1648867 Cyanophora
           paradoxa cyanelle, complete genome.
          Length = 104

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 30/99 (30%), Positives = 47/99 (47%)
 Frame = -3

Query: 530 YETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGETNT 351
           Y T  +L+P L+E+E    +  Y++LL+  G   + + N G   LAY I K+N       
Sbjct: 15  YRTTYILKPSLTEEEITKEIEDYQKLLIDNGAEDIIIENTGKCRLAYLINKQN------- 67

Query: 350 YMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKL 234
             DGIY   TY      +  L+  M    + +R  +FK+
Sbjct: 68  --DGIYFQITYRGANTLVNILQRRMRLSINTLRYQTFKV 104



>sp|Q9X8U2|RS6_STRCO 30S ribosomal protein S6.>pir|T36593|T36593
           probable ribosomal protein S6 - Streptomyces
           coelicolor>gb:SCO939118_177578 Streptomyces coelicolor
           A3(2) complete genome; segment 15/29.
          Length = 96

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 30/97 (30%), Positives = 47/97 (48%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YE M +L PDL E     L+  +  ++  GGG   +V   G   L+Y IKKK     
Sbjct: 1   MRHYEVMVILDPDLEERSVSPLIENFLSVVRDGGGKVEKVDTWGRRRLSYEIKKK----- 55

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRS 249
                +GIY +     +P  +  L+  MN ++ V+R+
Sbjct: 56  ----PEGIYSVIDLQAEPAVVKELDRQMNLNESVLRT 88



>gb:AE017145_390289 Helicobacter hepaticus ATCC 51449 section 2 of 6
           of the complete genome.>gb:AE017125_1024551 Helicobacter
           hepaticus ATCC 51449 complete genome.
          Length = 137

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 28/106 (26%), Positives = 50/106 (47%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           ++ YETM +L+P L E E    +  ++E+++  GG      + G+  LAY IKK  +   
Sbjct: 1   MKFYETMFILKPTLVEVEIKARLDFFKEVIIKNGGEIETCLDMGMRNLAYEIKKNKR--- 57

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRKRK 222
                 G Y +  +  +P  I  LE     +++++R    K   +K
Sbjct: 58  ------GYYFVIYFKAQPSLILELERNYRINEEILRFIVIKYESKK 97



>gb:CP000033_88330 Lactobacillus acidophilus NCFM, complete genome.
          Length = 98

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 28/103 (27%), Positives = 49/103 (47%), Gaps = 1/103 (0%)
 Frame = -3

Query: 533 QYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGETN 354
           +YE   +++PD+ ED +  LV  Y++++   GG  VE  + G    AY I K        
Sbjct: 5   KYEVTYIIKPDIDEDNKKALVENYDKVIADNGGTMVESKDWGKRRFAYEIDK-------- 56

Query: 353 TYMDGIYLLFTYFT-KPESIAALEATMNTDDDVIRSSSFKLRK 228
            Y +G Y + T+     +++         D+ ++RS + KL K
Sbjct: 57  -YREGTYHIMTFTADNADAVNEFSRLSKIDNAILRSMTVKLDK 98



>gb:AP008231_581180 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 107

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 31/102 (30%), Positives = 48/102 (47%)
 Frame = -3

Query: 530 YETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGETNT 351
           YET  +LR DL+E++    ++KY+  L   G    +  +RG   LAY I K+        
Sbjct: 6   YETTYILRADLTEEQVEQAIAKYQTPLTEAGAEVQDTQHRGKRRLAYLINKQR------- 58

Query: 350 YMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRKR 225
             +GIY+   Y      IA LE  +   ++V+R  + K   R
Sbjct: 59  --EGIYVQINYTGDGSQIAPLERALRLSEEVLRFLTVKQEVR 98



>gb:AP006627_566421 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 95

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 27/96 (28%), Positives = 46/96 (47%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R+YE M ++ P+L E     ++ +Y ++L   G   ++V   G         KK  A E
Sbjct: 1   MRKYEIMYIIAPNLEESANKEIIERYNKVLTDNGAEILKVDEIG---------KKRLAYE 51

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIR 252
            N + DG Y+L +     E+I      +  +D+VIR
Sbjct: 52  INDFKDGFYVLLSVQANTEAINEFNRLIKINDNVIR 87



>sp|Q97CX2|RS6_CLOAB 30S ribosomal protein S6.>pir|A97357|A97357
           ribosomal protein S6 [imported] - Clostridium
           acetobutylicum>gb:AE007867_231005 Clostridium
           acetobutylicum ATCC 824 section 355 of 356 of the
           complete genome.>gb:AE001437_1093960 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 95

 Score = 47.4 bits (111), Expect = 4e-04
 Identities = 31/104 (29%), Positives = 47/104 (45%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           + +YET+ +L P L E+   T V K++ ++  GGG    V   G   LAY I K N    
Sbjct: 1   MNKYETLFILNPSLDEEGINTNVEKFKSVITNGGGEVENVDLWGKRKLAYEIDKVN---- 56

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRK 228
                +GIY+L  + +  +    L+      D +IR     L K
Sbjct: 57  -----EGIYVLVNFQSDAQLPKELDRVFRISDSIIRHLIISLEK 95



>gb:BA000030_702176 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 96

 Score = 46.6 bits (109), Expect = 7e-04
 Identities = 29/97 (29%), Positives = 46/97 (47%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YE M +L PDL E     L+  +  ++  G G   +V   G   L+Y IKKK     
Sbjct: 1   MRHYEVMVILDPDLEERAVSPLIENFLSVVREGNGKVEKVDTWGRRRLSYEIKKK----- 55

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRS 249
                +GIY +     +P  +  L+  MN ++ V+R+
Sbjct: 56  ----PEGIYSVIDLQAEPAVVKELDRQMNLNESVLRT 88



>sp|O19917|RR6_CYACA Chloroplast 30S ribosomal protein
           S6.>pir|T11985|T11985 ribosomal protein S6 - red alga
           (Cyanidium caldarium) chloroplast>gb:AF022186_1761853
           Cyanidium caldarium strain RK1 chloroplast, complete
           genome.
          Length = 103

 Score = 46.2 bits (108), Expect = 9e-04
 Identities = 27/96 (28%), Positives = 48/96 (50%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           L QYE M ++RPDL E++ L  +S+ +E       +   + NRG   LAY ++K      
Sbjct: 11  LTQYEIMLIMRPDLPEEKFLKFLSEIKEHAKRNLALEFNLSNRGRRKLAYAMRK------ 64

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIR 252
              + DGIY+ F +      + +L   +  ++ ++R
Sbjct: 65  ---FQDGIYIQFNFLGSGYILNSLIKRLKLEESILR 97



>sp|Q984T8|RS6_RHILO 30S ribosomal protein S6.>gb:BA000012_672153
           Mesorhizobium loti MAFF303099 DNA, complete genome.
          Length = 166

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 29/99 (29%), Positives = 46/99 (46%)
 Frame = -3

Query: 530 YETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGETNT 351
           YE + + R DLS+ +   LV +Y+ ++ A GG    V N G+  L Y + K  KA     
Sbjct: 4   YEHVFLARQDLSQQQVDALVEQYKGVISANGGSVGRVENWGLKSLTYRVNKNRKA----- 58

Query: 350 YMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKL 234
                Y L      P ++  +E  M   +DV+R  + K+
Sbjct: 59  ----YYTLMDLNCPPAALNEMERQMGLSEDVLRFLTIKV 93



>gb:BA000016_675682 Clostridium perfringens str. 13 DNA, complete
           genome.
          Length = 96

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 29/96 (30%), Positives = 42/96 (43%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R+YET+ V  P L E+    L+ K++ ++  G G    V   G   LAY I K N    
Sbjct: 2   MRKYETIFVAHPSLDEEAVKALIEKFKGVIENGNGTVDNVDFWGKRKLAYEIAKVN---- 57

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIR 252
                +G Y L  +   PE    L+      D +IR
Sbjct: 58  -----EGYYTLINFTANPELPKELDRVFGITDGIIR 88



>sp|Q8XH43|RS6_CLOPE 30S ribosomal protein S6.
          Length = 95

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 29/96 (30%), Positives = 42/96 (43%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R+YET+ V  P L E+    L+ K++ ++  G G    V   G   LAY I K N    
Sbjct: 1   MRKYETIFVAHPSLDEEAVKALIEKFKGVIENGNGTVDNVDFWGKRKLAYEIAKVN---- 56

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIR 252
                +G Y L  +   PE    L+      D +IR
Sbjct: 57  -----EGYYTLINFTANPELPKELDRVFGITDGIIR 87



>sp|O66474|RS6_AQUAE 30S ribosomal protein S6.>pir|G70305|G70305
           ribosomal protein S06 - Aquifex
           aeolicus>gb:AE000672_25825 Aquifex aeolicus VF5 section
           4 of 109 of the complete genome.>gb:AE000657_976356
           Aquifex aeolicus VF5 complete genome.
          Length = 110

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 32/105 (30%), Positives = 54/105 (51%), Gaps = 1/105 (0%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           LR YET+  ++P LSE+E      + +E +   GG  +   + G+  LAY I+K N A  
Sbjct: 7   LRYYETVFAVKPTLSEEEMKKKFEQVKEFIKQKGGEILYEEDWGMRQLAYPIQKFNNAR- 65

Query: 359 TNTYMDGIYLLFTYFTK-PESIAALEATMNTDDDVIRSSSFKLRK 228
                   Y L  + T+ P+    L+  +  D+DVIR  +F++++
Sbjct: 66  --------YFLVQFKTENPQLPNELDFQLKIDEDVIRWLNFQIKE 102



>gb:CP000009_862333 Gluconobacter oxydans 621H, complete genome.
          Length = 160

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 30/93 (32%), Positives = 46/93 (49%)
 Frame = -3

Query: 530 YETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGETNT 351
           YE++ + R D+S+ +  TLV   E LL   GG   +    G+  LAY IKK  K      
Sbjct: 4   YESVLIARNDVSQAQVETLVETIETLLKDNGGSIQKREFWGLRSLAYRIKKNRK------ 57

Query: 350 YMDGIYLLFTYFTKPESIAALEATMNTDDDVIR 252
              G Y+L      P+++  LE  +  ++DV+R
Sbjct: 58  ---GHYVLLGLDCTPDTLRELERQLGLNEDVLR 87



>gb:AE017200_403376 Lactobacillus johnsonii NCC 533, section 1 of 7
           of the complete genome.>gb:AE017198_1121863
           Lactobacillus johnsonii NCC 533, complete genome.
          Length = 98

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 25/103 (24%), Positives = 50/103 (48%), Gaps = 1/103 (0%)
 Frame = -3

Query: 533 QYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGETN 354
           +YE   +++PD+ ED +  L+ ++++++   G   +E  + G    AY I+K        
Sbjct: 5   KYEVTYIIKPDIDEDSKKALIDRFDKVVTDNGAEELESKDWGKRRFAYEIEK-------- 56

Query: 353 TYMDGIYLLFTYFTK-PESIAALEATMNTDDDVIRSSSFKLRK 228
            Y +G Y + T+  +  E +         D+ ++RS + KL K
Sbjct: 57  -YREGTYHIMTFVAENSEPVDEFGRLSRIDNQILRSMTVKLDK 98



>sp|Q9ZAH3|RS6_CAMJE 30S ribosomal protein S6.>pir|A81310|A81310 30S
           ribosomal protein S6 Cj1070 [imported] - Campylobacter
           jejuni (strain NCTC 11168)>gb:CJ11168X4_847444
           Campylobacter jejuni subsp. jejuni NCTC 11168 complete
           genome; segment 4/6.
          Length = 125

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 30/106 (28%), Positives = 46/106 (43%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           ++ YE + +L+P L+E+E  T +   +E+L         V   G   LAY IKK      
Sbjct: 1   MKHYEVLFILKPTLTEEEVNTKLEFVKEVLTKNSAEIETVVPMGTRKLAYKIKK------ 54

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRKRK 222
              Y  G Y +  +      IA LE  +   ++VIR    K   +K
Sbjct: 55  ---YERGTYFVIYFKAPTNLIAELERVLRITEEVIRFLIVKYENKK 97



>gb:AP006840_570506 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 95

 Score = 43.9 bits (102), Expect = 0.004
 Identities = 27/96 (28%), Positives = 42/96 (43%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R+YE M + RPDL E     L  K  EL+ + G         G +      KK+  A E
Sbjct: 1   MRKYEMMVIARPDLDEAGLQALSDKIAELITSNG---------GTVESQDAWKKQRLAYE 51

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIR 252
                +G Y +F +  +P +   L   +   D+V+R
Sbjct: 52  IKHLREGFYSVFNFTGEPRTANELNRVLKITDEVVR 87



>sp|P21468|RS6_BACSU 30S ribosomal protein S6
           (BS9).>pir|S66015|S66015 ribosomal protein S6 (BS9) rpsF
           - Bacillus subtilis>gb:BAC180K_744605 B. subtilis DNA,
           180 kilobase region of replication
           origin.>gb:BSUB0021_756056 Bacillus subtilis complete
           genome (section 21 of 21): from 4010730 to 4214630.
          Length = 95

 Score = 43.9 bits (102), Expect = 0.004
 Identities = 22/96 (22%), Positives = 44/96 (45%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R+YE M ++RP++ E+ +  ++ ++  +L + G       + G   LAY         E
Sbjct: 1   MRKYEVMYIIRPNIDEESKKAVIERFNNVLTSNGAEITGTKDWGKRRLAY---------E 51

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIR 252
            N + DG Y +    +   ++   +      DD+IR
Sbjct: 52  INDFRDGFYQIVNVQSDAAAVQEFDRLAKISDDIIR 87



>gb:CJY17166_848450 Campylobacter jejuni lon, rpS18, ssb, rpS6 genes
           and partial comL gene.>gb:CP000025_878954 Campylobacter
           jejuni RM1221, complete genome.
          Length = 125

 Score = 42.4 bits (98), Expect = 0.013
 Identities = 29/106 (27%), Positives = 45/106 (42%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           ++ YE + +L+P L+E+E    +   +E+L         V   G   LAY IKK      
Sbjct: 1   MKHYEVLFILKPTLTEEEVNAKLEFVKEVLTKNSAEIETVVPMGTRKLAYKIKK------ 54

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRKRK 222
              Y  G Y +  +      IA LE  +   ++VIR    K   +K
Sbjct: 55  ---YERGTYFVIYFKAPTNLIAELERVLRITEEVIRFLIVKYENKK 97



>sp|Q8K918|RS6_BUCAP 30S ribosomal protein S6.>gb:AE014128_303443
           Buchnera aphidicola str. Sg (Schizaphis graminum)
           section 53 of 57 of the complete
           genome.>gb:AE013218_935421 Buchnera aphidicola str. Sg
           (Schizaphis graminum) complete genome.
          Length = 113

 Score = 42.4 bits (98), Expect = 0.013
 Identities = 29/104 (27%), Positives = 53/104 (50%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YE + ++ PD SE   + ++ KY++++    G+   + + G   LAY I K +KA  
Sbjct: 1   MRHYEIIFMIHPDYSEKVSV-IIEKYKKIIHHNSGIIHRLEDWGRRQLAYPINKLHKAH- 58

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRK 228
                   Y+L    T P++I+ LE     ++ VIR+    ++K
Sbjct: 59  --------YILLNIETFPKTISLLETDFRFNNAVIRNIIISVKK 94



>sp|Q8G756|RS6_BIFLO 30S ribosomal protein S6.>gb:AE014295_311800
           Bifidobacterium longum NCC2705, complete genome.
          Length = 97

 Score = 42.4 bits (98), Expect = 0.013
 Identities = 30/95 (31%), Positives = 47/95 (49%)
 Frame = -3

Query: 533 QYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGETN 354
           +YE M +  P+L E     L  +Y EL+   GG + E    G   LAY I     AG+T 
Sbjct: 6   KYELMFIADPELDERGLKKLTEQYLELVTKEGGSFDEPDYWGRRKLAYEI-----AGKT- 59

Query: 353 TYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRS 249
              +G Y++  Y  +P +   L+  +N ++ VIR+
Sbjct: 60  ---EGNYVVVKYTAEPATSDELDRVLNLNESVIRT 91



>gb:AE017283_431966 Propionibacterium acnes KPA171202, complete
           genome.
          Length = 96

 Score = 42.0 bits (97), Expect = 0.016
 Identities = 26/97 (26%), Positives = 51/97 (52%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R+YE M ++ P + E +  +L+ KY +++    G    V   G   LAY+I+KK+    
Sbjct: 1   MRKYEVMIIIDPTVEERQVDSLMEKYLKVITDEKGTVDNVDVWGKRRLAYDIQKKS---- 56

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRS 249
                +GIY++     +P +I  L+  +  D+ ++R+
Sbjct: 57  -----EGIYVVVNATCEPATIQELDRLLAIDEKIMRT 88



>gb:AE017015_380286 Bacillus cereus ATCC 14579 section 18 of 18 of
           the complete genome.>gb:AE017281_426824 Bacillus cereus
           ATCC 10987, section 18 of 18 of the complete
           genome.>gb:AE016877_1020536 Bacillus cereus ATCC 14579
           complete genome.>gb:AE017194_1065243 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 96

 Score = 42.0 bits (97), Expect = 0.016
 Identities = 23/96 (23%), Positives = 44/96 (45%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R+YE M ++RP + E+ +  LV ++  +L   G   +     G   LAY         E
Sbjct: 1   MRKYEIMYIIRPGVEEEAQKALVERFAGVLTNNGAEIINTKEWGKRRLAY---------E 51

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIR 252
            N   +G Y++    +  E+I   +     ++D++R
Sbjct: 52  INDLREGFYMILNVKSNAEAINEFDRLAKINEDILR 87



>sp|Q92QZ7|RS6_RHIME 30S ribosomal protein S6.>gb:SME591786_185156
           Sinorhizobium meliloti 1021 complete chromosome; segment
           5/12.
          Length = 149

 Score = 42.0 bits (97), Expect = 0.016
 Identities = 28/103 (27%), Positives = 48/103 (46%)
 Frame = -3

Query: 530 YETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGETNT 351
           YE + + R D++  +   LV +Y+ ++ A GG    V N G+  L Y IKK  KA     
Sbjct: 4   YEHVFLARQDITPQQVDALVEQYKGVIEANGGKVGRVENWGLKSLTYRIKKNRKAH---- 59

Query: 350 YMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRKRK 222
                Y+L        ++  +E  M  ++DV+R  +  + K +
Sbjct: 60  -----YVLMDIDAPAPAVHEVERQMRINEDVLRYMTIAVGKHE 97



>sp|O07813|RS6_NEIGO 30S ribosomal protein S6.>gb:AE004969_60341
           Neisseria gonorrhoeae FA 1090, complete
           genome.>gb:AF003196_467267 Neisseria gonorrhoeae strain
           FA19 ribosomal protein S6 (rpsF), ribosomal protein S18
           (rpsR) and ribosomal protein L9 (rplI) genes, complete
           cds.
          Length = 122

 Score = 42.0 bits (97), Expect = 0.016
 Identities = 29/103 (28%), Positives = 48/103 (46%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YE + ++ PD SE +   +V +Y+ ++    G    + + G   LAY I K +KA  
Sbjct: 1   MRHYEIVFIVHPDQSE-QVPAMVERYKTMITEANGKIHRLEDWGRRQLAYPINKIHKAH- 58

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLR 231
                   Y+L    T PE +  LE     +D V+R  + K +
Sbjct: 59  --------YVLMNIETTPEVVGELETAFRFNDAVLRHLTIKTK 93



>gb:AE017041_385597 Bacillus anthracis str. Ames section 18 of 18 of
           the complete genome.>gb:AE017225_410691 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_455444 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE017355_466440 Bacillus
           thuringiensis serovar konkukian str. 97-27, complete
           genome.>gb:CP000001_855759 Bacillus cereus ZK, complete
           genome.>gb:AE016879_1015302 Bacillus anthracis str. Ames
           complete genome.
          Length = 96

 Score = 41.6 bits (96), Expect = 0.021
 Identities = 23/96 (23%), Positives = 43/96 (44%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R+YE M ++RP + E+ +  LV ++  +L   G   +     G   LAY         E
Sbjct: 1   MRKYEIMYIIRPGVEEEAQKALVERFAGVLTNNGAEIINTKEWGKRRLAY---------E 51

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIR 252
            N   +G Y++       E+I   +     ++D++R
Sbjct: 52  INDLREGFYMILNVNANAEAINEFDRLAKINEDILR 87



>sp|Q9JU24|RS6_NEIMA 30S ribosomal protein S6.>pir|D81845|D81845 30S
           ribosomal protein S6 NMA1537 [imported] - Neisseria
           meningitidis (strain Z2491 serogroup
           A)>gb:NMA5Z2491_154420 Neisseria meningitidis serogroup
           A strain Z2491 complete genome; segment 5/7.
          Length = 122

 Score = 41.6 bits (96), Expect = 0.021
 Identities = 29/103 (28%), Positives = 48/103 (46%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YE + ++ PD SE +   +V +Y+ ++    G    + + G   LAY I K +KA  
Sbjct: 1   MRHYEIVFIVHPDQSE-QVPAMVERYKTMIAEANGKIHRLEDWGRRQLAYPINKIHKAH- 58

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLR 231
                   Y+L    T PE +  LE     +D V+R  + K +
Sbjct: 59  --------YVLMNIETTPEVVEELETAFRFNDAVLRHLTIKTK 93



>gb:AE016947_364153 Enterococcus faecalis V583, section 1 of 11 of
           the complete genome.>gb:AE016830_990641 Enterococcus
           faecalis V583, complete genome.
          Length = 100

 Score = 41.2 bits (95), Expect = 0.028
 Identities = 26/103 (25%), Positives = 51/103 (49%), Gaps = 3/103 (2%)
 Frame = -3

Query: 533 QYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGETN 354
           +YE M ++RP++ E+ +  LV +++ +L   G   +E         + + +K+  A E N
Sbjct: 6   KYEIMYIIRPNIDEEAKTALVERFDTILKDNGAEVIE---------SKDWEKRRLAYEMN 56

Query: 353 TYMDGIYLLFTYFTKPESIAAL---EATMNTDDDVIRSSSFKL 234
            + +GIY +    T P +  A+   +     +DD+IR    K+
Sbjct: 57  GFREGIYHIVN-VTSPSTAGAINEFDRLAKINDDIIRHMIVKV 98



>sp|Q8CQP4|RS6_STAEP 30S ribosomal protein S6.>gb:CP000029_80672
           Staphylococcus epidermidis RP62A, complete
           genome.>gb:AE016752_324022 Staphylococcus epidermidis
           ATCC 12228, section 9 of 9 of the complete
           genome.>gb:AE015929_1148691 Staphylococcus epidermidis
           ATCC 12228, complete genome.
          Length = 98

 Score = 41.2 bits (95), Expect = 0.028
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 1/97 (1%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YE M ++RP++ ED +  LV ++  +L + G   +E  + G   LAY         E
Sbjct: 1   MRTYEIMYIVRPNIEEDAKKALVERFNGILASEGSEVLEEKDWGKRRLAY---------E 51

Query: 359 TNTYMDGIYLLFTYFT-KPESIAALEATMNTDDDVIR 252
            N + +G Y +    T   +S    +     +DD+IR
Sbjct: 52  INDFKEGFYNIVRIKTDNNKSTDEFQRLAKINDDIIR 88



>sp|Q9JZ29|RS6_NEIMB 30S ribosomal protein S6.>pir|B81097|B81097 30S
           ribosomal protein S6 NMB1323 [imported] - Neisseria
           meningitidis (strain MC58 serogroup B)>gb:AE002480_46743
           Neisseria meningitidis serogroup B strain MC58 section
           122 of 206 of the complete genome.>gb:AE002098_896856
           Neisseria meningitidis serogroup B strain MC58 complete
           genome.>gb:AX565885_1470534 Sequence 119 from Patent
           WO02077648.
          Length = 122

 Score = 41.2 bits (95), Expect = 0.028
 Identities = 28/103 (27%), Positives = 48/103 (46%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YE + ++ PD SE +   +V +Y+ ++    G    + + G   LAY I K +KA  
Sbjct: 1   MRHYEIVFIVHPDQSE-QVPAMVERYKTMIAEANGKIHRLEDWGRRQLAYPINKIHKAH- 58

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLR 231
                   Y+L    T PE +  LE     +D ++R  + K +
Sbjct: 59  --------YVLMNIETTPEVVEELETAFRFNDAILRHLTIKTK 93



>sp|Q9K5N8|RS6_BACHD 30S ribosomal protein S6.>pir|B84156|B84156
           ribosomal protein S6 (BS9) rpsF [imported] - Bacillus
           halodurans (strain C-125)>gb:BA000004_657996 Bacillus
           halodurans C-125 DNA, complete genome.
          Length = 95

 Score = 41.2 bits (95), Expect = 0.028
 Identities = 25/96 (26%), Positives = 44/96 (45%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R+YE M ++ P+L E     ++ ++  +L   G    +V   G   LAY         E
Sbjct: 1   MRKYEIMYIIAPNLEEAANKEIIERFNGVLTNQGAEIEKVEEMGKRRLAY---------E 51

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIR 252
            N + +G Y+L       ++IA     +  +D+VIR
Sbjct: 52  INKFREGYYVLLNVKADADAIAEFNRLIKINDNVIR 87



>gb:AE017312_439209 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 4 of 12 of the complete
           genome.>gb:AE017285_1072370 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 101

 Score = 40.8 bits (94), Expect = 0.037
 Identities = 25/102 (24%), Positives = 49/102 (48%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R++ET+ +L P+L+ D R  L++    ++    G  +   + G+  LAY ++K+     
Sbjct: 1   MRKFETLLLLSPELAADAREALLTTLSGVVEREQGSMITADHWGMRDLAYPVRKQ----- 55

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKL 234
               M G Y+   Y     ++A LE  +   D + +  + KL
Sbjct: 56  ----MRGYYVRLEYTAPGATVAELERIIRISDGIFKFVTVKL 93



>sp|Q99WL2|RS6_STAAM 30S ribosomal protein S6.>pir|F89802|F89802 30S
           ribosomal protein S6 [imported] - Staphylococcus aureus 
           (strain N315)>gb:BA000017_676063 Staphylococcus aureus
           subsp. aureus Mu50 DNA, complete
           genome.>gb:BA000018_678759 Staphylococcus aureus subsp.
           aureus N315 genomic DNA, complete
           genome.>gb:BA000033_710633 Staphylococcus aureus subsp.
           aureus MW2 DNA, complete genome,
           strain:MW2.>gb:BX571856_779829 Staphylococcus aureus
           subsp. aureus strain MRSA252, complete
           genome.>gb:BX571857_782556 Staphylococcus aureus strain
           MSSA476, complete genome.
          Length = 98

 Score = 40.8 bits (94), Expect = 0.037
 Identities = 26/97 (26%), Positives = 44/97 (45%), Gaps = 1/97 (1%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YE M ++RP++ ED +  LV ++  +L   G   +E  + G   LAY         E
Sbjct: 1   MRTYEVMYIVRPNIEEDAKKALVERFNGILATEGAEVLEAKDWGKRRLAY---------E 51

Query: 359 TNTYMDGIY-LLFTYFTKPESIAALEATMNTDDDVIR 252
            N + DG Y ++       ++    +      DD+IR
Sbjct: 52  INDFKDGFYNIVRVKSDNNKATDEFQRLAKISDDIIR 88



>sp|Q9CDM8|RS6_LACLA 30S ribosomal protein S6.>pir|G86898|G86898 30S
           ribosomal protein S6 [imported] - Lactococcus lactis
           subsp. lactis (strain IL1403)>gb:AE006448_219093
           Lactococcus lactis subsp. lactis IL1403 section 210 of
           218 of the complete genome.>gb:AE005176_1096166
           Lactococcus lactis subsp. lactis IL1403, complete
           genome.
          Length = 97

 Score = 40.0 bits (92), Expect = 0.062
 Identities = 23/104 (22%), Positives = 53/104 (50%), Gaps = 2/104 (1%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           + +YE + ++RP++ E+ +  LV +++ +L   G   +E         + + +K+  A E
Sbjct: 1   MTKYEILYIIRPNIDEEAKAALVERFDGILTDNGAANLE---------SKDWEKRKLAYE 51

Query: 359 TNTYMDGIYLLFTY--FTKPESIAALEATMNTDDDVIRSSSFKL 234
            N + +GIY + T+   T  E+++  +     + D++R    K+
Sbjct: 52  INDFREGIYHIATFEAETTSEALSEFDRLAKINLDILRHMIVKV 95



>gb:AE016923_358601 Chromobacterium violaceum ATCC 12472 section 14
           of 16 of the complete genome.>gb:AE016825_1043755
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 124

 Score = 39.7 bits (91), Expect = 0.081
 Identities = 27/102 (26%), Positives = 52/102 (50%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YE + ++ PD SE +   ++ +Y+ +++A  G    + + G   LAY I+K +KA  
Sbjct: 1   MRHYEIVFIVHPDQSE-QVPAMIERYKGMVLAAEGKIHRLEDWGRRQLAYPIQKLHKAH- 58

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKL 234
                   Y+L     + E++A +E     +D V+R  + K+
Sbjct: 59  --------YVLMNVECQAETLAEIEHAFKFNDAVLRHLTIKM 92



>gb:AE017340_457694 Idiomarina loihiensis L2TR, complete genome.
          Length = 116

 Score = 39.3 bits (90), Expect = 0.11
 Identities = 28/97 (28%), Positives = 44/97 (45%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YE + ++ PD SE     ++ +Y E +  GGG    + + G   LAY I K +KA  
Sbjct: 1   MRHYEIVFMVHPDQSEQVP-GMIERYSETIKQGGGQIHRLEDWGRRQLAYPINKLHKAH- 58

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRS 249
                   Y+L       E +  LE     +D V+R+
Sbjct: 59  --------YVLLNIEASAEVVEELETAFRYNDAVLRN 87



>sp|Q8UGE7|RS6_AGRT5 30S ribosomal protein S6.>pir|AB2711|AB2711 30S
           ribosomal protein S6 [imported] - Agrobacterium
           tumefaciens (strain C58, Dupont)>gb:AE009072_248131
           Agrobacterium tumefaciens str. C58 circular chromosome,
           section 98 of 256 of the complete
           sequence.>gb:AE008688_1085974 Agrobacterium tumefaciens
           str. C58 circular chromosome, complete sequence.
          Length = 153

 Score = 39.3 bits (90), Expect = 0.11
 Identities = 27/93 (29%), Positives = 43/93 (46%)
 Frame = -3

Query: 530 YETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGETNT 351
           YE + + R D+S  +   LV +Y+ ++ + GG    V N G+  L Y IKK  KA     
Sbjct: 4   YEHIFLARQDISAQQVDALVEQYKGVIESFGGKVGRVENWGLKSLTYRIKKNRKAH---- 59

Query: 350 YMDGIYLLFTYFTKPESIAALEATMNTDDDVIR 252
                Y L        ++  +E  M  ++DV+R
Sbjct: 60  -----YALMDIDAPAAAVHEVERQMRINEDVLR 87



>gb:CP000027_80023 Dehalococcoides ethenogenes 195, complete genome.
          Length = 109

 Score = 38.5 bits (88), Expect = 0.18
 Identities = 25/102 (24%), Positives = 44/102 (43%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           LR YE + +L  D  +++   ++    + +    G + EV + G   LAY I +      
Sbjct: 14  LRDYELVVILTTDTPKEKVEAILEGISKTIAEKDGSFTEVNHWGKRKLAYLIGR------ 67

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKL 234
              Y +G Y+      KP SI  + A +   + VIR  +  +
Sbjct: 68  ---YGEGYYVFIKMKAKPSSIRKINADLRISEQVIRHMAINM 106



>sp|O84807|RS6_CHLTR 30S ribosomal protein S6.>pir|G71469|G71469
           probable S6 ribosomal protein - Chlamydia trachomatis
           (serotype D, strain UW3/Cx)>gb:AE001352_34743 Chlamydia
           trachomatis D/UW-3/CX section 79 of 87 of the complete
           genome.>gb:AE001273_1098769 Chlamydia trachomatis
           D/UW-3/CX, complete genome.
          Length = 112

 Score = 38.5 bits (88), Expect = 0.18
 Identities = 29/99 (29%), Positives = 45/99 (45%), Gaps = 1/99 (1%)
 Frame = -3

Query: 530 YETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGETNT 351
           YE   V    LSED R   + K    +   GG  +++ ++G   LAY I+   +      
Sbjct: 9   YEGAYVFSVTLSEDARRKALEKVTSGITNYGGEVLKIHDQGRKKLAYTIRGAREG----- 63

Query: 350 YMDGIYLLFTYFT-KPESIAALEATMNTDDDVIRSSSFK 237
                Y  F YFT  PE+IA L    + ++D++R  + K
Sbjct: 64  -----YYYFIYFTVAPEAIAELWREYHLNEDLLRFMTLK 97



>gb:BX842646_823083 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 1/11.
          Length = 152

 Score = 38.1 bits (87), Expect = 0.24
 Identities = 30/104 (28%), Positives = 47/104 (45%)
 Frame = -3

Query: 536 RQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGET 357
           + YE + ++ PD S +E+  L  K +  + +  G    +   G   LA  I K  KA   
Sbjct: 8   KPYEVVVLMHPDASLEEQKDLFKKNKATIESYKGSINSLETWGKRTLATPIGKLKKA--- 64

Query: 356 NTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRKR 225
                 IY   T+    ++IA LE TM  +D V+R    +L +R
Sbjct: 65  ------IYFHSTFEADTQAIAELERTMRINDKVLRFMHTRLDER 102



>gb:AJ749949_531519 Francisella tularensis subsp. tularensis
           complete genome.
          Length = 111

 Score = 37.7 bits (86), Expect = 0.31
 Identities = 26/96 (27%), Positives = 47/96 (48%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           ++ YE + ++ PD S D+   ++ KY  ++   GG      + G   LAY I+K +KA  
Sbjct: 1   MKHYEVVLMIHPDQS-DQLDAMLGKYRGIIEEKGGKIHRFEDWGRRQLAYPIEKLHKAH- 58

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIR 252
                   Y+LF      ES+  L+ ++  +D ++R
Sbjct: 59  --------YVLFNIECPTESLEKLQESLRYNDAILR 86



>gb:CP000031_86303 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 117

 Score = 37.7 bits (86), Expect = 0.31
 Identities = 27/99 (27%), Positives = 41/99 (41%)
 Frame = -3

Query: 530 YETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGETNT 351
           YE + + R DLS  +   L+  +  +L   GG  V+    GV  +AY I K  K      
Sbjct: 4   YEHVMIARQDLSNTQAEGLIEHFGAVLSDNGGSLVDHEYWGVKTMAYKINKNRK------ 57

Query: 350 YMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKL 234
              G Y          ++  +E  M   DDV+R  + K+
Sbjct: 58  ---GHYAFLRTDAPASAVQEMERLMRLHDDVMRVLTIKV 93



>sp|Q99Y79|RS6_STRPY 30S ribosomal protein S6.>gb:AE006609_220678
           Streptococcus pyogenes M1 GAS, section 138 of 167 of the
           complete genome.>gb:AE010095_259285 Streptococcus
           pyogenes strain MGAS8232, section 143 of 173 of the
           complete genome.>gb:AE014166_305059 Streptococcus
           pyogenes MGAS315, section 31 of 37 of the complete
           genome.>gb:BA000034_713209 Streptococcus pyogenes SSI-1
           DNA, complete genome.>gb:CP000003_861492 Streptococcus
           pyogenes MGAS10394, complete genome.>gb:AE009949_905667
           Streptococcus pyogenes strain MGAS8232, complete
           genome.>gb:AE014074_928238 Streptococcus pyogenes
           MGAS315, complete genome.>gb:AE004092_1106524
           Streptococcus pyogenes M1 GAS, complete genome.
          Length = 96

 Score = 37.7 bits (86), Expect = 0.31
 Identities = 22/103 (21%), Positives = 51/103 (49%), Gaps = 1/103 (0%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           + +YE + ++RP++ E+ +  LV++++ +L   G   VE         + + +K+  A E
Sbjct: 1   MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATVVE---------SKDWEKRRLAYE 51

Query: 359 TNTYMDGIY-LLFTYFTKPESIAALEATMNTDDDVIRSSSFKL 234
            N + +G+Y ++    T   ++   +     + D++R    KL
Sbjct: 52  INDFREGLYHIVNLEATDAAALNEFDRLSKINGDILRHMIVKL 94



>sp|Q89A41|RS6_BUCBP 30S ribosomal protein S6.>gb:AE014017_302897
           Buchnera aphidicola str. Bp (Baizongia pistaciae),
           section 2 of 2 of the complete
           genome.>gb:AE016826_981498 Buchnera aphidicola str. Bp
           (Baizongia pistaciae), complete genome.
          Length = 119

 Score = 37.7 bits (86), Expect = 0.31
 Identities = 29/104 (27%), Positives = 48/104 (46%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YE + ++ PD SE   + ++ K+++L++   G    + + G   LAY+I K +KA  
Sbjct: 1   MRHYEIILLIHPDCSEKLPI-MIEKFKKLVIGYKGRIHRLEDWGRRQLAYSINKLHKAH- 58

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRK 228
                   Y L         I  L  T   DD VIR+    ++K
Sbjct: 59  --------YFLMNIEVPSNCIQDLSNTFRYDDLVIRNIIMHVKK 94



>sp|P57627|RS6_BUCAI 30S ribosomal protein S6.>pir|F84995|F84995 30S
           ribosomal protein S6 [imported] - Buchnera sp. (strain
           APS)>gb:BA000003_653908 Buchnera aphidicola str. APS
           (Acyrthosiphon pisum) genomic DNA, complete sequence.
          Length = 113

 Score = 37.7 bits (86), Expect = 0.31
 Identities = 26/104 (25%), Positives = 51/104 (49%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YE + ++ PD S+   L L+ KY++++    G+   + + G   L+Y+I K  KA  
Sbjct: 1   MRHYEIIFMVHPDQSDKIPL-LIEKYKKIINDNNGIIHRLEDWGRRQLSYSINKLQKAH- 58

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRK 228
                   Y+L      P++I  LE     ++ ++R+    ++K
Sbjct: 59  --------YILMNIEVFPKTITLLETDFRFNNIILRNMIMSVKK 94



>sp|Q9PLC1|RS6_CHLMU 30S ribosomal protein S6.>pir|D81732|D81732
           ribosomal protein S6 TC0184 [imported] - Chlamydia
           muridarum (strain Nigg)>gb:AE002285_44775 Chlamydia
           muridarum Nigg section 17 of 85 of the complete
           genome.>gb:AE002160_1148915 Chlamydia muridarum Nigg,
           complete genome.
          Length = 112

 Score = 37.4 bits (85), Expect = 0.40
 Identities = 28/99 (28%), Positives = 45/99 (45%), Gaps = 1/99 (1%)
 Frame = -3

Query: 530 YETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGETNT 351
           YE   V    LSED R   + K    +   GG  +++ ++G   LAY I+   +      
Sbjct: 9   YEGAYVFSVTLSEDARRKALEKVTSGITNYGGEVLKIHDQGRKKLAYTIRGAREG----- 63

Query: 350 YMDGIYLLFTYFT-KPESIAALEATMNTDDDVIRSSSFK 237
                Y  F YFT  PE+I+ L    + ++D++R  + K
Sbjct: 64  -----YYYFIYFTVAPEAISELWREYHLNEDLLRFMTLK 97



>sp|Q9WZ72|RS6_THEMA 30S ribosomal protein S6.>pir|G72354|G72354
           ribosomal protein S6 - Thermotoga maritima (strain
           MSB8)>gb:AE001735_38516 Thermotoga maritima MSB8 section
           47 of 136 of the complete genome.>gb:AE000512_1112989
           Thermotoga maritima MSB8, complete genome.
          Length = 128

 Score = 37.0 bits (84), Expect = 0.53
 Identities = 26/101 (25%), Positives = 49/101 (48%), Gaps = 1/101 (0%)
 Frame = -3

Query: 536 RQYETMAVLRPDLSEDERLTLVSKYEELLVAG-GGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           R YE+M ++ P++ E+ER  LV + ++++     G   +V   G+   AY IKK N    
Sbjct: 7   RIYESMFIIAPNVPEEERENLVERVKKIIEERVKGKIDKVERMGMRKFAYEIKKFN---- 62

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFK 237
                +G Y +  +    +++  LE       ++IR  +F+
Sbjct: 63  -----EGDYTVIYFRCDGQNLQELENFYRVTPEIIRWQTFR 98



>gb:BX248584_763710 Blochmannia floridanus complete genome; segment
           1/3.
          Length = 120

 Score = 36.6 bits (83), Expect = 0.69
 Identities = 21/58 (36%), Positives = 33/58 (56%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKA 366
           +R YE + ++ PD S+++   LV+ Y E+++   G    + N G   LAY IK  NKA
Sbjct: 1   MRYYEIVLIIHPD-SDNQIDNLVNYYSEIIINSTGKIHRLENWGRRQLAYAIKNLNKA 57



>sp|Q8DSD7|RS6_STRMU 30S ribosomal protein S6.>gb:AE015012_314154
           Streptococcus mutans UA159 section 160 of 185 of the
           complete genome.>gb:AE014133_941155 Streptococcus mutans
           UA159 complete genome.
          Length = 96

 Score = 36.2 bits (82), Expect = 0.90
 Identities = 21/103 (20%), Positives = 51/103 (49%), Gaps = 1/103 (0%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           + +YE + ++RP++ E+ +  LV++++ +L   G   VE         + + +K+  A E
Sbjct: 1   MAKYEILYIIRPNIEEEAKNALVARFDAVLTDNGATIVE---------SKDWEKRRLAYE 51

Query: 359 TNTYMDGIYLLFTYFTK-PESIAALEATMNTDDDVIRSSSFKL 234
              + +G+Y +    T+   ++   +     ++D++R    KL
Sbjct: 52  IQDFREGLYHVINVETEDAHALNEFDRLSKINNDILRHMIVKL 94



>sp|Q8XZT8|RS6_RALSO 30S ribosomal protein S6.>gb:AL646063_546235
           Ralstonia solanacearum GMI1000 chromosome, complete
           sequence; segment 7/19.
          Length = 122

 Score = 36.2 bits (82), Expect = 0.90
 Identities = 28/104 (26%), Positives = 47/104 (45%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YE + ++ PD SE     ++ +Y+  + + GG    V + G   LAY I+K  KA  
Sbjct: 1   MRHYEIVFIVHPDQSEQVP-AMIERYKSTVTSQGGQVHRVEDWGRRQLAYMIQKLAKAH- 58

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRK 228
                   Y+        E++A LE     +D V+R    + +K
Sbjct: 59  --------YVCVNIECGKETLAELEHAFKFNDAVLRHLIVQTKK 94



>gb:AY458636_619344 Uncultured bacterium 439 clone EBAC750-10B11
           genomic sequence.
          Length = 117

 Score = 35.8 bits (81), Expect = 1.2
 Identities = 26/97 (26%), Positives = 43/97 (44%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YE   ++ PD S  +  T++ KY+E++   GG      + G   LAY I K  KA  
Sbjct: 1   MRHYEITLIVHPDQSS-QVTTMIEKYKEIITTSGGNVHREEDWGRKHLAYPINKIYKAH- 58

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRS 249
                   YL+       E++  L      +D ++R+
Sbjct: 59  --------YLMMNIECDQETLDKLNYNFRFNDAILRN 87



>gb:CR555306_107720 Azoarcus sp. EbN1 complete genome.
          Length = 128

 Score = 35.8 bits (81), Expect = 1.2
 Identities = 25/96 (26%), Positives = 46/96 (47%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YE + ++ PD SE +   ++ +Y+ ++ A  G    + + G   +AY I+K +KA  
Sbjct: 1   MRHYEVVFIVHPDQSE-QVPAMIERYKAIVTARNGQIHRLEDWGRRQMAYPIQKVHKAH- 58

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIR 252
                   Y+L       E++  LE     +D V+R
Sbjct: 59  --------YVLMNIECDGEALGELEHAFKFNDAVLR 86



>sp|Q8ZB81|RS6_YERPE 30S ribosomal protein S6.>pir|AD0430|AD0430 30S
           ribosomal protein S6 [imported] - Yersinia pestis
           (strain CO92)>gb:AE013667_298975 Yersinia pestis KIM
           section 67 of 415 of the complete
           genome.>gb:AE017129_386389 Yersinia pestis biovar
           Medievalis str. 91001 section 3 of 16 of the complete
           genome.>gb:AJ414157_525297 Yersinia pestis strain CO92
           complete genome; segment 17/20.>gb:BX936398_835083
           Yersinia pseudotuberculosis IP32953 genome, complete
           sequence.>gb:AE009952_929158 Yersinia pestis KIM
           complete genome.>gb:AE017042_1142955 Yersinia pestis
           biovar Medievalis str. 91001 complete genome.
          Length = 130

 Score = 35.8 bits (81), Expect = 1.2
 Identities = 28/103 (27%), Positives = 45/103 (43%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YE + ++ PD SE     ++ +Y   +    G    + + G   LAY I K +KA  
Sbjct: 1   MRHYEIVFMVHPDQSEQVP-GMIERYSATITNAAGTIHRLEDWGRRQLAYPINKLHKAH- 58

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLR 231
                   Y+L       E+I  LE     +D VIRS   +++
Sbjct: 59  --------YVLLNVEAPQEAIDELETNFRFNDAVIRSMVMRVK 93



>sp|Q8XG88|RS6_SALTY 30S ribosomal protein S6.>pir|AG1052|AG1052 30s
           ribosomal protein S6 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain
           CT18)>gb:CP000026_78829 Salmonella enterica subsp.
           enterica serovar Paratypi A str. ATCC
           9150.>gb:AE008906_245984 Salmonella typhimurium LT2,
           section 210 of 220 of the complete
           genome.>gb:AE016849_348345 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, section 16 of 16 of the
           complete genome.>gb:AL627283_544735 Salmonella enterica
           serovar Typhi (Salmonella typhi) strain CT18, complete
           chromosome; segment 19/20.>gb:AE014613_985677 Salmonella
           enterica subsp. enterica serovar Typhi Ty2, complete
           genome.>gb:AE006468_1003066 Salmonella typhimurium LT2,
           complete genome.
          Length = 131

 Score = 35.8 bits (81), Expect = 1.2
 Identities = 29/97 (29%), Positives = 42/97 (43%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YE + ++ PD SE     ++ +Y   +    G    + + G   LAY I K +KA  
Sbjct: 1   MRHYEIVFMVHPDQSEQVP-GMIERYSAAITGAEGKIHRLEDWGRRQLAYPINKLHKAH- 58

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRS 249
                   Y+L       E I  LE T   +D VIRS
Sbjct: 59  --------YVLMNVEAPQEVIDELETTFRFNDAVIRS 87



>gb:BX950851_842348 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 130

 Score = 35.4 bits (80), Expect = 1.5
 Identities = 28/103 (27%), Positives = 45/103 (43%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YE + ++ PD SE     ++ +Y   +    G    + + G   LAY I K +KA  
Sbjct: 1   MRHYEIVFMVHPDQSEQVP-GMIERYTATITGAQGTIHRLEDWGRRQLAYPINKLHKAH- 58

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLR 231
                   Y+L       E+I  LE     +D VIRS   +++
Sbjct: 59  --------YVLLNVEAPQEAIDELETNFRFNDAVIRSMVMRVK 93



>gb:BX571965_791248 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.>gb:CP000010_865674
           Burkholderia mallei ATCC 23344 chromosome 1, complete
           sequence.
          Length = 124

 Score = 35.4 bits (80), Expect = 1.5
 Identities = 27/104 (25%), Positives = 46/104 (44%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YE + ++ PD SE     ++ +Y+  + + GG    V + G   LAY I+K  KA  
Sbjct: 1   MRHYEIVFIVHPDQSEQVP-AMIERYKSTITSHGGQIHRVEDWGRRQLAYMIEKLAKAH- 58

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRK 228
                   Y+         ++  LE     +D V+R    K++K
Sbjct: 59  --------YVCMNIECDQTTLDELEHAFKFNDAVLRHLIVKMKK 94



>sp|Q9VZD5|RT06_DROME Probable mitochondrial 28S ribosomal protein
           S6 (MRP-S6).>gb:AE014296_1134734 Drosophila melanogaster
           chromosome 3L, complete sequence.>gb:AE003481_1212033
           Drosophila melanogaster chromosome 3L, section 15 of 83
           of the complete sequence.>gb:AY070674_1294819 Drosophila
           melanogaster RH10862 full length cDNA.
          Length = 147

 Score = 35.4 bits (80), Expect = 1.5
 Identities = 25/101 (24%), Positives = 46/101 (45%)
 Frame = -3

Query: 530 YETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGETNT 351
           YE   VLR  L   E ++++ +  E ++  GG+  ++ N G   L + + +         
Sbjct: 4   YELALVLR-QLPRPELISVIRRTAESILDKGGIIRKLENLGSRALPHKVSEHGVV----- 57

Query: 350 YMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRK 228
           + +G +    + T P  IA L+     D D+IR   FK+ +
Sbjct: 58  HREGTHFTIAFDTAPTKIADLKEEFGRDIDIIRRYIFKVEE 98



>sp|P02358|RS6_ECOLI 30S ribosomal protein S6.
          Length = 135

 Score = 35.4 bits (80), Expect = 1.5
 Identities = 29/97 (29%), Positives = 42/97 (43%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YE + ++ PD SE     ++ +Y   +    G    + + G   LAY I K +KA  
Sbjct: 1   MRHYEIVFMVHPDQSEQVP-GMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAH- 58

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRS 249
                   Y+L       E I  LE T   +D VIRS
Sbjct: 59  --------YVLMNVEAPQEVIDELETTFRFNDAVIRS 87



>sp|Q8XDI1|RS6_ECOL6 30S ribosomal protein S6.>pir|C65231|R3EC6
           ribosomal protein S6 [validated] - Escherichia coli
           (strain K-12)>pir|H91275|H91275 30S ribosomal subunit
           protein S6 [imported] - Escherichia coli (strain
           O157:H7, substrain RIMD 0509952)>pir|H86116|H86116 30S
           ribosomal subunit protein S6 [imported] - Escherichia
           coli (strain O157:H7, substrain
           EDL933)>gb:AE005174_69395 Escherichia coli O157:H7
           EDL933, complete genome.>gb:AE005674_73938 Shigella
           flexneri 2a str. 301, complete genome.>gb:ECOUW93_131730
           Escherichia coli K-12 chromosomal region from 92.8 to
           00.1 minutes.>gb:ECRPSFRI_132584 E. coli genes rpsF,
           rpsR and rplI for ribosomal proteins S6, S18,
           L9.>gb:U00096_203162 Escherichia coli K-12 MG1655
           complete genome.>gb:AE016771_329250 Escherichia coli
           CFT073 section 17 of 18 of the complete
           genome.>gb:AE016993_374000 Shigella flexneri 2a str.
           2457T section 16 of 16 of the complete
           genome.>gb:BA000007_663188 Escherichia coli O157:H7 DNA,
           complete genome.>gb:AE014075_959834 Escherichia coli
           CFT073 complete genome.>gb:AE014073_998750 Shigella
           flexneri 2a str. 2457T complete genome.
          Length = 131

 Score = 35.4 bits (80), Expect = 1.5
 Identities = 29/97 (29%), Positives = 42/97 (43%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YE + ++ PD SE     ++ +Y   +    G    + + G   LAY I K +KA  
Sbjct: 1   MRHYEIVFMVHPDQSEQVP-GMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAH- 58

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRS 249
                   Y+L       E I  LE T   +D VIRS
Sbjct: 59  --------YVLMNVEAPQEVIDELETTFRFNDAVIRS 87



>sp|Q9A7Q1|RS6_CAUCR 30S ribosomal protein S6.>pir|C87456|C87456
           ribosomal protein S6 [imported] - Caulobacter
           crescentus>gb:AE005841_212810 Caulobacter crescentus
           CB15 section 167 of 359 of the complete
           genome.>gb:AE005673_922709 Caulobacter crescentus CB15
           complete genome.
          Length = 126

 Score = 35.0 bits (79), Expect = 2.0
 Identities = 23/101 (22%), Positives = 44/101 (43%)
 Frame = -3

Query: 530 YETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGETNT 351
           YE + + R D+S  +   L  + + L+   GG   ++   G+  L Y IKK  K      
Sbjct: 4   YEHVVIARQDISPQQAEALNEQLKALIEENGGHIAKIEYWGLRNLTYRIKKNRK------ 57

Query: 350 YMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRK 228
              G Y L        ++  +E  +  ++DV+R  + ++ +
Sbjct: 58  ---GHYSLLAIDAPAPAVKEMERQLLINEDVLRFMTIRVEE 95



>gb:AY773199_2148678 Synthetic construct 30S ribosomal RNA protein
           operon, complete sequence.
          Length = 158

 Score = 34.7 bits (78), Expect = 2.6
 Identities = 29/96 (30%), Positives = 41/96 (42%)
 Frame = -3

Query: 536 RQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGET 357
           R YE + ++ PD SE     ++ +Y   +    G    + + G   LAY I K +KA   
Sbjct: 26  RHYEIVFMVHPDQSEQVP-GMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAH-- 82

Query: 356 NTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRS 249
                  Y+L       E I  LE T   +D VIRS
Sbjct: 83  -------YVLMNVEAPQEVIDELETTFRFNDAVIRS 111



>gb:AB049942_1867794 Homo sapiens MRPS6 mRNA for mitochondrial
           ribosomal protein S6, partial cds.
          Length = 166

 Score = 34.7 bits (78), Expect = 2.6
 Identities = 24/104 (23%), Positives = 47/104 (45%)
 Frame = -3

Query: 548 PPGLRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNK 369
           PPG+ +YE   +L+  +   E    + +  E L+  G +  ++ N G   L Y I     
Sbjct: 39  PPGMPRYELALILKA-MQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRI----- 92

Query: 368 AGETNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFK 237
           +  +  +  G Y L  ++    ++ ++   ++ D DVIR +  K
Sbjct: 93  SAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVK 136



>gb:CP000023_875601 Streptococcus thermophilus LMG 18311, complete
           genome.>gb:CP000024_877520 Streptococcus thermophilus
           CNRZ1066, complete genome.
          Length = 112

 Score = 34.3 bits (77), Expect = 3.4
 Identities = 16/69 (23%), Positives = 37/69 (53%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           + +YE + ++RP++ E+ +  LV++++ +L   G   VE         + + +K+  A E
Sbjct: 17  MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATVVE---------SKDWEKRRLAYE 67

Query: 359 TNTYMDGIY 333
              + +G+Y
Sbjct: 68  IQDFREGLY 76



>gb:BX908798_831148 Parachlamydia-related symbiont UWE25, complete
           genome.
          Length = 114

 Score = 34.3 bits (77), Expect = 3.4
 Identities = 28/94 (29%), Positives = 45/94 (47%), Gaps = 1/94 (1%)
 Frame = -3

Query: 530 YETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGETNT 351
           YE M V+   LS+D R   + + +  +   GG   ++  +G   LAY         E + 
Sbjct: 9   YEGMYVISATLSDDARHKALDRIQTGITGHGGEIKKLHEQGRRRLAY---------EIDG 59

Query: 350 YMDGIYLLFTYFTKPES-IAALEATMNTDDDVIR 252
           + +G Y L  YFT P S I+ L    + ++D+IR
Sbjct: 60  HREGYYYL-VYFTAPSSAISDLWQEYHLNEDLIR 92



>gb:BX571874_789428 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 16/17.
          Length = 131

 Score = 34.3 bits (77), Expect = 3.4
 Identities = 28/103 (27%), Positives = 44/103 (42%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YE + ++ PD SE     ++ +Y   +    G    + + G   LAY I K +KA  
Sbjct: 1   MRHYEIVFMVHPDQSEQVP-GMIERYSATITNAQGQIHRLEDWGRRQLAYPINKLHKAH- 58

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLR 231
                   Y+L       E I  LE     +D VIRS   +++
Sbjct: 59  --------YVLMNVEAPQEVIDELETNFRFNDAVIRSMIMRVK 93



>gb:BX640430_810713 Bordetella parapertussis strain 12822, complete
           genome; segment 8/14.>gb:BX640442_814565 Bordetella
           bronchiseptica strain RB50, complete genome; segment
           6/16.
          Length = 157

 Score = 33.9 bits (76), Expect = 4.5
 Identities = 28/106 (26%), Positives = 47/106 (44%)
 Frame = -3

Query: 545 PGLRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKA 366
           P +R YE + ++ PD SE +   +V +Y+ L+    G    + + G   LAY I+K  KA
Sbjct: 30  PYMRHYEVVFIVHPDQSE-QVPAMVERYQALVTGQSGTVHRLEDWGRRQLAYPIQKLVKA 88

Query: 365 GETNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRSSSFKLRK 228
                     Y+         ++  LE +   +D V+R    K +K
Sbjct: 89  H---------YVCMNIECGQATLDELEHSFRYNDAVLRHLVIKTKK 125



>gb:CP000046_90607 Staphylococcus aureus subsp. aureus COL, complete
           genome.
          Length = 92

 Score = 33.9 bits (76), Expect = 4.5
 Identities = 23/91 (25%), Positives = 40/91 (43%), Gaps = 1/91 (1%)
 Frame = -3

Query: 521 MAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGETNTYMD 342
           M ++RP++ ED +  LV ++  +L   G   +E  + G   LAY         E N + D
Sbjct: 1   MYIVRPNIEEDAKKALVERFNGILATEGAEVLEAKDWGKRRLAY---------EINDFKD 51

Query: 341 GIY-LLFTYFTKPESIAALEATMNTDDDVIR 252
           G Y ++       ++    +      DD+IR
Sbjct: 52  GFYNIVRVKSDNNKATDEFQRLAKISDDIIR 82



>sp|Q97PR1|RS6_STRPN 30S ribosomal protein S6.>pir|C98046|C98046 30S
           ribosomal protein S6 (S6) [imported] - Streptococcus
           pneumoniae (strain R6)>pir|D95179|D95179 ribosomal
           protein S6 [imported] - Streptococcus pneumoniae
           (strain TIGR4)>gb:AE007449_226690 Streptococcus
           pneumoniae TIGR4 section 132 of 194 of the complete
           genome.>gb:AE008509_237716 Streptococcus pneumoniae R6
           section 125 of 184 of the complete
           genome.>gb:AE007317_943874 Streptococcus pneumoniae R6,
           complete genome.>gb:AE005672_1104458 Streptococcus
           pneumoniae TIGR4, complete genome.
          Length = 96

 Score = 33.9 bits (76), Expect = 4.5
 Identities = 16/69 (23%), Positives = 36/69 (52%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           + +YE + ++RP++ E+ +  LV++++ +L   G   VE         +   +K+  A E
Sbjct: 1   MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATVVE---------SKTWEKRRLAYE 51

Query: 359 TNTYMDGIY 333
              + +G+Y
Sbjct: 52  IQDFREGLY 60



>sp|Q8E3K0|RS6_STRA3 30S ribosomal protein S6.>gb:SAG766853_171287
           Streptococcus agalactiae NEM316 complete genome, segment
           11.>gb:AE014269_307010 Streptococcus agalactiae 2603V/R
           section 79 of 100 of the complete
           genome.>gb:AE009948_937123 Streptococcus agalactiae
           2603V/R complete genome.
          Length = 95

 Score = 33.5 bits (75), Expect = 5.8
 Identities = 16/69 (23%), Positives = 37/69 (53%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           + +YE + ++RP++ E+ +  LV++++ +L   G   VE         + + +K+  A E
Sbjct: 1   MAKYEILYIIRPNIEEEAKNALVARFDSILSDNGATVVE---------SKDWEKRRLAYE 51

Query: 359 TNTYMDGIY 333
              + +G+Y
Sbjct: 52  IQDFTEGLY 60



>gb:BC083321_2108589 Mus musculus RIKEN cDNA 2700087H15 gene, mRNA
           (cDNA clone IMAGE:5687271), partial cds.
          Length = 249

 Score = 33.1 bits (74), Expect = 7.6
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 3/61 (4%)
 Frame = -3

Query: 689 HSEVVVKAETLEF---SGSLFEGGIGEDDEPPSIPGWGISNIEDKEEPQCPPGLRQYETM 519
           HSE  V  E L     +G L + G+G DD P S P  G    +  +EP   P L+Q  ++
Sbjct: 95  HSEAGVPVEPLNVDIEAGGLDQPGVGSDDLPSSEP--GPRPFQQLDEPPAVPSLQQPTSL 152

Query: 518 A 516
           A
Sbjct: 153 A 153



>gb:BC080757_2107829 Mus musculus RIKEN cDNA 2700087H15 gene, mRNA
           (cDNA clone IMAGE:5387732), partial cds.
          Length = 292

 Score = 33.1 bits (74), Expect = 7.6
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 3/61 (4%)
 Frame = -3

Query: 689 HSEVVVKAETLEF---SGSLFEGGIGEDDEPPSIPGWGISNIEDKEEPQCPPGLRQYETM 519
           HSE  V  E L     +G L + G+G DD P S P  G    +  +EP   P L+Q  ++
Sbjct: 138 HSEAGVPVEPLNVDIEAGGLDQPGVGSDDLPSSEP--GPRPFQQLDEPPAVPSLQQPTSL 195

Query: 518 A 516
           A
Sbjct: 196 A 196



>gb:BC067013_2105905 Mus musculus RIKEN cDNA 2700087H15 gene, mRNA
           (cDNA clone MGC:91322 IMAGE:6810181), complete cds.
          Length = 539

 Score = 33.1 bits (74), Expect = 7.6
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 3/61 (4%)
 Frame = -3

Query: 689 HSEVVVKAETLEF---SGSLFEGGIGEDDEPPSIPGWGISNIEDKEEPQCPPGLRQYETM 519
           HSE  V  E L     +G L + G+G DD P S P  G    +  +EP   P L+Q  ++
Sbjct: 385 HSEAGVPVEPLNVDIEAGGLDQPGVGSDDLPSSEP--GPRPFQQLDEPPAVPSLQQPTSL 442

Query: 518 A 516
           A
Sbjct: 443 A 443



>gb:AC017117_1204175 Caenorhabditis elegans cosmid F43C11, complete
           sequence.
          Length = 201

 Score = 32.7 bits (73), Expect = 10.0
 Identities = 33/130 (25%), Positives = 61/130 (46%)
 Frame = -3

Query: 701 KWNKHSEVVVKAETLEFSGSLFEGGIGEDDEPPSIPGWGISNIEDKEEPQCPPGLRQYET 522
           K++K S+ V +  T+E +G   E    ED  P  +  +  S+IE       PPG   + T
Sbjct: 87  KFSKISKFVSQMMTVEENGCT-EFVCPEDFVPRVVSTFSRSSIET------PPGFTDF-T 138

Query: 521 MAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGETNTYMD 342
             +++P    D  +  +  +   +V  G + V  + RG++PL  ++      G+  + +D
Sbjct: 139 SFIIQPPEPYDAGINTIDYFG--IVCDGSLAVSQYPRGIMPLGGDV-----IGDDGS-LD 190

Query: 341 GIYLLFTYFT 312
           G+Y + T  T
Sbjct: 191 GLYSVATMIT 200



>gb:BX321856_772526 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 1/10.
          Length = 146

 Score = 32.7 bits (73), Expect = 10.0
 Identities = 24/96 (25%), Positives = 43/96 (44%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YE + ++ PD SE +   +  +Y  ++    G    + + G   L Y I+K +KA  
Sbjct: 1   MRHYEIVFIVHPDQSE-QVSAMTERYSNIVTGRSGKIHRLEDWGRRQLTYPIQKLHKAH- 58

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIR 252
                   Y+L       ES+  LE +   +D ++R
Sbjct: 59  --------YVLMNIECDQESLNELEHSFKFNDAILR 86



>gb:AE017153_392523 Haemophilus ducreyi strain 35000HP section 3 of
           6 of the complete genome.>gb:AE017143_1026785
           Haemophilus ducreyi strain 35000HP complete genome.
          Length = 124

 Score = 32.7 bits (73), Expect = 10.0
 Identities = 26/97 (26%), Positives = 41/97 (42%)
 Frame = -3

Query: 539 LRQYETMAVLRPDLSEDERLTLVSKYEELLVAGGGMYVEVFNRGVIPLAYNIKKKNKAGE 360
           +R YE + ++ PD SE     ++ +Y   +   GG    + + G   LAY I K +KA  
Sbjct: 1   MRHYEIVFMVHPDQSEQVP-AMIERYTASVTEAGGQVHRLEDWGRRQLAYPINKLHKAH- 58

Query: 359 TNTYMDGIYLLFTYFTKPESIAALEATMNTDDDVIRS 249
                   Y+L         I  LE     +D V+R+
Sbjct: 59  --------YVLMNVEAPKSVIDELETNFRYNDAVLRN 87


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 902,054,589
Number of Sequences: 1806583
Number of extensions: 20000013
Number of successful extensions: 57837
Number of sequences better than 10.0: 106
Number of HSP's better than 10.0 without gapping: 56019
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 57779
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 63706499574
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)