BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig11148
         (931 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB010068_1510848 Arabidopsis thaliana genomic DNA, chromosome...   259   5e-68   
gb:AY088327_1573347 Arabidopsis thaliana clone 5684 mRNA, comple...   259   7e-68   
gb:OSJN00288_1698010 Oryza sativa genomic DNA, chromosome 4, BAC...   258   1e-67   
pir|T46233|T46233 hypothetical protein T9C5.150 - Arabidopsis th...   239   4e-62   Arabidopsis thaliana [mouse-ear cress]
gb:AP005175_1848779 Oryza sativa (japonica cultivar-group) genom...    43   0.008   
gb:BC056525_2551799 Danio rerio translocase of inner mitochondri...    42   0.017   
gb:AC120538_1739941 Oryza sativa chromosome 3 BAC OSJNBb0059G13 ...    42   0.022   
sp|Q12328|IM22_YEAST|IM22_YEAST Mitochondrial import inner membrane translo...    42   0.022   Saccharomyces cerevisiae [brewer's yeast]
gb:AJ720479_2502666 Gallus gallus mRNA for hypothetical protein,...    41   0.029   
gb:BT012594_1641664 Arabidopsis thaliana At5g55510 gene, complet...    41   0.038   
gb:AY088301_1573321 Arabidopsis thaliana clone 5367 mRNA, comple...    41   0.038   
gb:AB015479_1512678 Arabidopsis thaliana genomic DNA, chromosome...    41   0.038   
pir|T04790|T04790 hypothetical protein F10M23.10 - Arabidopsis t...    41   0.038   Arabidopsis thaliana [mouse-ear cress]
gb:AY463970_1607872 Arabidopsis thaliana mitochondrial inner mem...    40   0.065   
sp|Q9Z0V7|IM7B_MOUSE|IM7B_MOUSE Mitochondrial import inner membrane translo...    40   0.065   Mus musculus [mouse]
gb:CR382124_1656706 Kluyveromyces lactis strain NRRL Y-1140 chro...    40   0.085   
sp|O60830|IM7B_HUMAN|IM7B_HUMAN Mitochondrial import inner membrane translo...    40   0.085   Homo sapiens [man]
sp|Q99595|IM7A_HUMAN|IM7A_HUMAN Mitochondrial import inner membrane translo...    40   0.085   Homo sapiens [man]
sp|Q9SP35|IM17_ARATH|IM17_ARATH Mitochondrial import inner membrane translo...    40   0.085   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1022149 Oryza sativa (japonica cultivar-group) chrom...    39   0.14    
gb:AF186847_1775172 Arabidopsis thaliana TIM17 (TIM17) mRNA, com...    38   0.25    
gb:BC084641_2563942 Xenopus laevis hypothetical LOC495285, mRNA ...    38   0.32    
gb:BC086502_2564903 Xenopus tropicalis cDNA clone MGC:97574 IMAG...    37   0.55    
gb:AX885408_1480861 Sequence 1271 from Patent EP1033401.               37   0.55    
pir|C86337|C86337 hypothetical protein F14O10.5 - Arabidopsis th...    37   0.55    Arabidopsis thaliana [mouse-ear cress]
sp|O35092|IM7A_RAT|IM7A_RAT Mitochondrial import inner membrane transloca...    37   0.55    Rattus norvegicus [brown rat]
sp|Q9Z0V8|IM7A_MOUSE|IM7A_MOUSE Mitochondrial import inner membrane translo...    37   0.55    Mus musculus [mouse]
gb:AY065147_1566301 Arabidopsis thaliana unknown protein (At1g70...    35   1.6     
gb:AY206771_1589548 Chlamydomonas reinhardtii flagella membrane ...    35   2.1     
gb:AE014297_1141727 Drosophila melanogaster chromosome 3R, compl...    35   2.1     
gb:AF461353_1273264 Drosophila rufa hunchback (hb) gene, partial...    35   2.7     
gb:AF461348_1273259 Drosophila biauraria hunchback (hb) gene, pa...    35   2.7     
gb:AF461338_1273249 Drosophila auraria hunchback (hb) gene, part...    35   2.7     
gb:BA000031_705826 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    34   3.6     
gb:BC080060_2561494 Xenopus laevis MGC84026 protein, mRNA (cDNA ...    34   4.6     
gb:AP005651_1855498 Oryza sativa (japonica cultivar-group) genom...    34   4.6     
gb:NC99H12_1688824 Neurospora crassa DNA linkage group V Cosmid ...    34   4.6     
gb:CR380953_1650860 Candida glabrata strain CBS138 chromosome G ...    34   4.6     
gb:CFHEPABC_1646283 Cylindrotheca fusiformis hepA, hepB, hepC ge...    34   4.6     
gb:AY071656_1295740 Drosophila melanogaster RE73548 full insert ...    34   4.6     
gb:AF312367_1896330 Homo sapiens La binding protein 1 mRNA, comp...    33   6.1     
gb:OSJN00104_1694979 Oryza sativa genomic DNA, chromosome 4, BAC...    33   7.9     
gb:CR382136_1668764 Debaryomyces hansenii chromosome D of strain...    33   7.9     
gb:DMU42014_1380740 Drosophila melanogaster hemomucin mRNA, comp...    33   7.9     
gb:AY118372_1300094 Drosophila melanogaster RE16762 full insert ...    33   7.9     
gb:AE014297_1141713 Drosophila melanogaster chromosome 3R, compl...    33   7.9     
pir|T01456|T01456 extensin homolog F24O1.18 - Arabidopsis thalia...    33   7.9     Arabidopsis thaliana [mouse-ear cress]


>gb:AB010068_1510848 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K18P6.>gb:AY070735_1566886 Arabidopsis
           thaliana AT5g24650/K18P6_19 mRNA, complete
           cds.>gb:AY142048_1582885 Arabidopsis thaliana
           At5g24650/K18P6_19 mRNA, complete cds.
          Length = 259

 Score =  259 bits (662), Expect = 5e-68
 Identities = 137/257 (53%), Positives = 176/257 (68%), Gaps = 6/257 (2%)
 Frame = -3

Query: 845 GEGKQ-----GIMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEXXXXXXXXXAQ 681
           GEG +      +M++    QNPI+QFQ K+ E+ +G K+WLSKQ LPVE          Q
Sbjct: 5   GEGDKKRETMAVMSLMKDQQNPIQQFQVKFKEIETGFKSWLSKQKLPVEAAVVTAMGGVQ 64

Query: 680 GGVIGAILGNLSPDLQPTPPPGANLDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGI 501
           G  IG ++G LSP++     P A +DP AMA+  Q QAL GGPLVQARNFA +TGVNAGI
Sbjct: 65  GAFIGGLMGTLSPEM-----PQAGIDPQAMASLKQTQALVGGPLVQARNFAAITGVNAGI 119

Query: 500 SCVLKRVRGKEDVQSSMAAAFGSGVMYSLVS-GMGGPDVVPAALTSGVFFALVQGGLFKL 324
           +CV+KR+RGKED++S++ AAFGSGV YSLVS G+ G  +   A+T+   FA+ QG  FKL
Sbjct: 120 ACVMKRIRGKEDLESAVVAAFGSGVAYSLVSAGLQGQPM--NAITTAAGFAVFQGVFFKL 177

Query: 323 GQQFSQPPAEDMQYVKTRSLLSGLGLEKYEKNFKRGXXXXXXXXXXXDSALKDVSIPPGP 144
           G++FS+P  ED  Y + RS+L  LGLEKYEKNFK+G           DSAL+DVSIPPGP
Sbjct: 178 GERFSKPSVEDPYYTRGRSMLLKLGLEKYEKNFKKGLLADPTLPLLTDSALRDVSIPPGP 237

Query: 143 RLLILDQVHRNPDFRRK 93
           RLLILD + R+P+ + K
Sbjct: 238 RLLILDHIQRDPELKGK 254



>gb:AY088327_1573347 Arabidopsis thaliana clone 5684 mRNA, complete
           sequence.
          Length = 246

 Score =  259 bits (661), Expect = 7e-68
 Identities = 134/246 (54%), Positives = 172/246 (69%), Gaps = 1/246 (0%)
 Frame = -3

Query: 827 IMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEXXXXXXXXXAQGGVIGAILGNL 648
           +M++    QNPI+QFQ K+ E+ +G K+WLSKQ LPVE          QG  IG ++G L
Sbjct: 3   VMSLMKDQQNPIQQFQVKFKEIETGFKSWLSKQKLPVEAAVVTAMGGVQGAFIGGLMGTL 62

Query: 647 SPDLQPTPPPGANLDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKE 468
           SP++     P A +DP AMA+  Q QAL GGPLVQARNFA +TGVNAGI+CV+KR+RGKE
Sbjct: 63  SPEM-----PQAGIDPQAMASLKQTQALVGGPLVQARNFAAITGVNAGIACVMKRIRGKE 117

Query: 467 DVQSSMAAAFGSGVMYSLVS-GMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAED 291
           D++S++ AAFGSGV YSLVS G+ G  +   A+T+   FA+ QG  FKLG++FS+P  ED
Sbjct: 118 DLESAVVAAFGSGVAYSLVSAGLQGQPM--NAITTAAGFAVFQGVFFKLGERFSKPSVED 175

Query: 290 MQYVKTRSLLSGLGLEKYEKNFKRGXXXXXXXXXXXDSALKDVSIPPGPRLLILDQVHRN 111
             Y + RS+L  LGLEKYEKNFK+G           DSAL+DVSIPPGPRLLILD + R+
Sbjct: 176 PYYTRGRSMLLKLGLEKYEKNFKKGLLADPTLPLLTDSALRDVSIPPGPRLLILDHIQRD 235

Query: 110 PDFRRK 93
           P+ + K
Sbjct: 236 PELKGK 241



>gb:OSJN00288_1698010 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OJ000315_02, complete sequence.
          Length = 275

 Score =  258 bits (659), Expect = 1e-67
 Identities = 137/262 (52%), Positives = 175/262 (66%), Gaps = 17/262 (6%)
 Frame = -3

Query: 848 MGEGKQGIMAVQLPSQ-------NPIEQFQAKYNELASGVKAWLSKQSLPVEXXXXXXXX 690
           MG+ K+  + V   +Q       NP+ +   +   L +G++AWL+KQ   VE        
Sbjct: 4   MGQQKRRPLVVMASAQAAARGGANPLAELTDRVKTLEAGLRAWLAKQPTHVEAAVATAVG 63

Query: 689 XAQGGVIGAILGNLSPD-----LQPTPPPGANLDPNAMATFNQAQALTGGPLVQARNFAV 525
             QGG +G ++G L+PD       P PPPGA  DPNA+A+F QAQAL GGPLVQARNFAV
Sbjct: 64  AVQGGALGGLMGTLAPDGGSPFPVPQPPPGA--DPNALASFKQAQALAGGPLVQARNFAV 121

Query: 524 MTGVNAGISCVLKRVRGKEDVQSS-----MAAAFGSGVMYSLVSGMGGPDVVPAALTSGV 360
           MTG NAGISCV++R+RG EDVQ S     MAAAFGSG ++S+VSGMG P+ V  A+T+GV
Sbjct: 122 MTGANAGISCVMRRIRGVEDVQGSAHFDSMAAAFGSGALFSIVSGMGSPNPVANAITTGV 181

Query: 359 FFALVQGGLFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEKYEKNFKRGXXXXXXXXXXXD 180
            FA+ QGG F +GQ+FSQPP+ED+ Y + R++L  LGL+ YEKNFK+G           D
Sbjct: 182 AFAVFQGGFFMIGQKFSQPPSEDIYYSRGRNMLKQLGLQNYEKNFKKGLLTDQTLPLLND 241

Query: 179 SALKDVSIPPGPRLLILDQVHR 114
           SAL+DV IPPGPRLLILD + R
Sbjct: 242 SALRDVKIPPGPRLLILDHIQR 263



>pir|T46233|T46233 hypothetical protein T9C5.150 - Arabidopsis
           thaliana>gb:ATT9C5_1556601 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T9C5.>gb:AY085551_1570620
           Arabidopsis thaliana clone 15698 mRNA, complete
           sequence.>gb:BT001951_1635554 Arabidopsis thaliana clone
           U09144 unknown protein (At3g49560) mRNA, complete
           cds.>gb:AF360191_1791145 Arabidopsis thaliana unknown
           protein (At3g49560) mRNA, complete cds.
          Length = 261

 Score =  239 bits (611), Expect = 4e-62
 Identities = 129/261 (49%), Positives = 170/261 (65%), Gaps = 2/261 (0%)
 Frame = -3

Query: 869 GFTSDSQMGEGKQGIMAVQL-PSQNPIEQFQAKYNELASGVKAWLSKQSLPVEXXXXXXX 693
           G   D +   G+   MA      QNPI+QFQ K+ E+ +  K WLSKQS+PVE       
Sbjct: 6   GGEGDQKRSSGEMMAMASLFNDQQNPIQQFQVKFKEVETNFKTWLSKQSIPVEAAVVSTM 65

Query: 692 XXAQGGVIGAILGNLSPDLQPTPPPGANLDPNAMATFNQAQALTGGPLVQARNFAVMTGV 513
              QG  IG ++G LSP++     P A +DP A+A+  QAQAL GGP VQARNFA +TGV
Sbjct: 66  SGVQGAFIGGLMGTLSPEM-----PQAGVDPQAIASMKQAQALVGGPWVQARNFAAITGV 120

Query: 512 NAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVS-GMGGPDVVPAALTSGVFFALVQGG 336
           NAGI+ V+KR+RGKED++S++ AA GSG  YSLVS G+ G  +   A+T+   FA+ QG 
Sbjct: 121 NAGIASVMKRIRGKEDIESAVVAALGSGFAYSLVSQGLQGQPM--NAITTAAGFAVFQGV 178

Query: 335 LFKLGQQFSQPPAEDMQYVKTRSLLSGLGLEKYEKNFKRGXXXXXXXXXXXDSALKDVSI 156
            FKLG++FS+P  ED  + + R++L  LGLEKYEKNFK+G           DSALKD +I
Sbjct: 179 FFKLGERFSKPSTEDPFFTRGRTMLVKLGLEKYEKNFKKGLLTDPTLPLLTDSALKDANI 238

Query: 155 PPGPRLLILDQVHRNPDFRRK 93
           PPGPRL+ILD + R+P+ + K
Sbjct: 239 PPGPRLMILDHIQRDPEIKGK 259



>gb:AP005175_1848779 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OSJNBb0040H10.
          Length = 223

 Score = 43.1 bits (100), Expect = 0.008
 Identities = 37/126 (29%), Positives = 57/126 (45%), Gaps = 2/126 (1%)
 Frame = -3

Query: 671 IGAILGNLSPDLQPT--PPPGANLDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGIS 498
           +GA+ G+L   L+ T   P G  L   A A    A  + G       +FAV  G+ +   
Sbjct: 25  MGAVGGSLFHFLKGTYNSPNGERLVGGAQAVRMNAPRVGG-------SFAVWGGLFSAFD 77

Query: 497 CVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQ 318
           C +  +R KED  +S+ A   +G   S+  G G      +AL  G+  AL++G    L +
Sbjct: 78  CTMVFMRQKEDPWNSIIAGAATGGFLSMRQGPGAAG--RSALMGGMLLALIEGAGLMLNR 135

Query: 317 QFSQPP 300
             + PP
Sbjct: 136 VLATPP 141



>gb:BC056525_2551799 Danio rerio translocase of inner mitochondrial
           membrane 17 homolog A (yeast), mRNA (cDNA clone
           MGC:65946 IMAGE:6790965), complete
           cds.>gb:BC065901_2554191 Danio rerio translocase of
           inner mitochondrial membrane 17 homolog A (yeast), mRNA
           (cDNA clone MGC:77941 IMAGE:7000884), complete cds.
          Length = 166

 Score = 42.0 bits (97), Expect = 0.017
 Identities = 29/90 (32%), Positives = 46/90 (51%), Gaps = 10/90 (11%)
 Frame = -3

Query: 536 NFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPDVVPAALTSGVF 357
           +FAV  G+ + I C L +VRGKED  +S+ +   +G +  L +  G   +V +A   G+ 
Sbjct: 65  SFAVWGGLFSMIDCGLVKVRGKEDPWNSITSGAMTGAI--LAARNGPVAMVGSAAMGGIL 122

Query: 356 FALVQG----------GLFKLGQQFSQPPA 297
            AL++G            F  G QF++ PA
Sbjct: 123 LALIEGAGILLTRFASAQFPTGPQFAEEPA 152



>gb:AC120538_1739941 Oryza sativa chromosome 3 BAC OSJNBb0059G13
           genomic sequence, complete sequence.
          Length = 206

 Score = 41.6 bits (96), Expect = 0.022
 Identities = 32/112 (28%), Positives = 45/112 (40%)
 Frame = -3

Query: 617 GANLDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAF 438
           GA   PN       +QA+         NFA   G+ +   C +   R KED  +S+ A  
Sbjct: 36  GAYNSPNGHRLSGGSQAVRMSVPRTGGNFAAWGGLFSAFDCAMVHARQKEDPWNSILAGA 95

Query: 437 GSGVMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQFSQPPAEDMQY 282
            +G + SL  G        +AL      ALV+G    L +  +  P ED  Y
Sbjct: 96  ATGAVLSLRQGPRA--TATSALVGASLLALVEGAGILLTRTMATLPQEDHAY 145



>sp|Q12328|IM22_YEAST Mitochondrial import inner membrane
           translocase subunit TIM22.>pir|S67776|S67776 probable
           membrane protein YDL217c - yeast (Saccharomyces
           cerevisiae)>gb:AY558171_1614398 Saccharomyces cerevisiae
           clone FLH110984.01X YDL217C gene, complete
           cds.>gb:CS39KBCIV_1673772 S.cerevisiae 39kb DNA segment
           of chromosome IV.>gb:SCYDL217C_1711796 S.cerevisiae
           chromosome IV reading frame ORF YDL217c.
          Length = 207

 Score = 41.6 bits (96), Expect = 0.022
 Identities = 39/158 (24%), Positives = 63/158 (39%), Gaps = 26/158 (16%)
 Frame = -3

Query: 680 GGVIGAILGNLSPDLQPTPPPGANLDPNAMA-------TFNQAQALTGGPLVQ------- 543
           GGV+G  + +++ D     P  AN    A A            Q ++  P  Q       
Sbjct: 57  GGVLGLFMASMAYDTPLHTPTPANTAATATAGNIGVGGISRTVQQISDLPFRQQMKLQFT 116

Query: 542 ---------ARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAF--GSGVMYSLVSGMGG 396
                    A+NF  +  + AG+ CV++ +R K D+ + + A F  G+G+ Y       G
Sbjct: 117 DMGKKSYSSAKNFGYIGMIYAGVECVIESLRAKNDIYNGVTAGFFTGAGLAYK-----AG 171

Query: 395 PDVVPAALTSGVFFALVQGGL-FKLGQQFSQPPAEDMQ 285
           P    AAL  G  FA     +   +  +  +PP  D +
Sbjct: 172 PQ---AALMGGAGFAAFSAAIDLYMKSEDGRPPQNDFK 206



>gb:AJ720479_2502666 Gallus gallus mRNA for hypothetical protein,
           clone 18k10.
          Length = 166

 Score = 41.2 bits (95), Expect = 0.029
 Identities = 28/91 (30%), Positives = 47/91 (51%), Gaps = 10/91 (10%)
 Frame = -3

Query: 536 NFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPDVVPAALTSGVF 357
           +FAV  G+ + I C + R+RGKED  +S+ +   +G +  L +  G   +V +A   G+ 
Sbjct: 65  SFAVWGGLFSMIDCSMVRMRGKEDPWNSITSGALTGAI--LAARNGPVAMVGSAAMGGIL 122

Query: 356 FALVQG----------GLFKLGQQFSQPPAE 294
            AL++G            F+ G QFS  P++
Sbjct: 123 LALIEGAGILLTRFASAQFQNGPQFSDDPSQ 153



>gb:BT012594_1641664 Arabidopsis thaliana At5g55510 gene, complete
           cds.>gb:BT015156_1642126 Arabidopsis thaliana At5g55510
           gene, complete cds.
          Length = 214

 Score = 40.8 bits (94), Expect = 0.038
 Identities = 23/69 (33%), Positives = 42/69 (60%), Gaps = 1/69 (1%)
 Frame = -3

Query: 542 ARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPD-VVPAALTS 366
           A+ FAV++GV++ + C+LK++RGK+D  +   A   +G+  S     G P  ++ + LT 
Sbjct: 88  AKTFAVLSGVHSLVVCLLKQIRGKDDAINVGVAGCCTGLALSF---PGAPQAMLQSCLTF 144

Query: 365 GVFFALVQG 339
           G F  +++G
Sbjct: 145 GAFSFILEG 153



>gb:AY088301_1573321 Arabidopsis thaliana clone 5367 mRNA, complete
           sequence.>gb:AY102132_1577737 Arabidopsis thaliana
           AT4g26670/F10M23_10 mRNA, complete
           cds.>gb:AF410323_1797137 Arabidopsis thaliana
           AT4g26670/F10M23_10 mRNA, complete cds.
          Length = 210

 Score = 40.8 bits (94), Expect = 0.038
 Identities = 23/69 (33%), Positives = 42/69 (60%), Gaps = 1/69 (1%)
 Frame = -3

Query: 542 ARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPD-VVPAALTS 366
           A+ FAV++GV++ + C+LK++RGK+D  +   A   +G+  S     G P  ++ + LT 
Sbjct: 88  AKTFAVLSGVHSLVVCLLKQIRGKDDAINVGVAGCCTGLALSF---PGAPQALLQSCLTF 144

Query: 365 GVFFALVQG 339
           G F  +++G
Sbjct: 145 GAFSFILEG 153



>gb:AB015479_1512678 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MTE17.
          Length = 212

 Score = 40.8 bits (94), Expect = 0.038
 Identities = 23/69 (33%), Positives = 42/69 (60%), Gaps = 1/69 (1%)
 Frame = -3

Query: 542 ARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPD-VVPAALTS 366
           A+ FAV++GV++ + C+LK++RGK+D  +   A   +G+  S     G P  ++ + LT 
Sbjct: 86  AKTFAVLSGVHSLVVCLLKQIRGKDDAINVGVAGCCTGLALSF---PGAPQAMLQSCLTF 142

Query: 365 GVFFALVQG 339
           G F  +++G
Sbjct: 143 GAFSFILEG 151



>pir|T04790|T04790 hypothetical protein F10M23.10 - Arabidopsis
           thaliana>gb:ATCHRIV65_1546548 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           65.>gb:ATF10M23_1548148 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F10M23 (ESSA project).
          Length = 208

 Score = 40.8 bits (94), Expect = 0.038
 Identities = 23/69 (33%), Positives = 42/69 (60%), Gaps = 1/69 (1%)
 Frame = -3

Query: 542 ARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPD-VVPAALTS 366
           A+ FAV++GV++ + C+LK++RGK+D  +   A   +G+  S     G P  ++ + LT 
Sbjct: 86  AKTFAVLSGVHSLVVCLLKQIRGKDDAINVGVAGCCTGLALSF---PGAPQALLQSCLTF 142

Query: 365 GVFFALVQG 339
           G F  +++G
Sbjct: 143 GAFSFILEG 151



>gb:AY463970_1607872 Arabidopsis thaliana mitochondrial inner
           membrane translocase TM17-2 (At2g37410) mRNA, partial
           cds; nuclear gene for mitochondrial product.
          Length = 243

 Score = 40.0 bits (92), Expect = 0.065
 Identities = 24/78 (30%), Positives = 39/78 (50%)
 Frame = -3

Query: 536 NFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPDVVPAALTSGVF 357
           +FAV  G+ +   C +  +R KED  +S+ A   +G   S+  G G      +A+  GV 
Sbjct: 65  SFAVWGGLFSTFDCTMVYLRQKEDPWNSIIAGAATGGFLSMRQGAGAAS--RSAIFGGVL 122

Query: 356 FALVQGGLFKLGQQFSQP 303
            AL++G    L +  +QP
Sbjct: 123 LALIEGAGIMLNEVLAQP 140



>sp|Q9Z0V7|IM7B_MOUSE Mitochondrial import inner membrane
           translocase subunit Tim17 B.>gb:AK003204_1151719 Mus
           musculus 18-day embryo whole body cDNA, RIKEN
           full-length enriched library, clone:1110001B09
           product:translocator of inner mitochondrial membrane 17
           kDa, b, full insert sequence.>gb:AK009164_1154978 Mus
           musculus adult male tongue cDNA, RIKEN full-length
           enriched library, clone:2310005C24 product:translocator
           of inner mitochondrial membrane 17 kDa, b, full insert
           sequence.>gb:AK011830_1156614 Mus musculus 10 days
           embryo whole body cDNA, RIKEN full-length enriched
           library, clone:2610109E24 product:translocator of inner
           mitochondrial membrane 17 kDa, b, full insert
           sequence.>gb:AK049584_1168875 Mus musculus 7 days embryo
           whole body cDNA, RIKEN full-length enriched library,
           clone:C430046H16 product:translocator of inner
           mitochondrial membrane 17 kDa, b, full insert
           sequence.>gb:AF106621_2054683 Mus musculus mitochondrial
           inner membrane translocase component Tim17b mRNA,
           nuclear gene encoding mitochondrial protein, complete
           cds.>gb:BC008275_2090700 Mus musculus translocator of
           inner mitochondrial membrane 17b, mRNA (cDNA clone
           MGC:6564 IMAGE:2811777), complete cds.
          Length = 172

 Score = 40.0 bits (92), Expect = 0.065
 Identities = 28/83 (33%), Positives = 45/83 (54%), Gaps = 4/83 (4%)
 Frame = -3

Query: 536 NFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPDVVPAALTSGVF 357
           +FAV  G+ + I C L R+RGKED  +S+++   +G +  L +  G   +V +A+  G+ 
Sbjct: 65  SFAVWGGLFSTIDCGLVRLRGKEDPWNSISSGALTGAV--LAARSGPLAMVGSAMMGGIL 122

Query: 356 FALVQGGLFKL----GQQFSQPP 300
            AL++G    L     QQF   P
Sbjct: 123 LALIEGVGILLTRYTAQQFRNAP 145



>gb:CR382124_1656706 Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 196

 Score = 39.7 bits (91), Expect = 0.085
 Identities = 47/200 (23%), Positives = 74/200 (37%), Gaps = 20/200 (10%)
 Frame = -3

Query: 830 GIMAVQLPSQNPIEQFQAKYNELASGVKAWLSKQSLPVEXXXXXXXXXAQGGVIGAILGN 651
           G+  V  P   P +Q   +               S P +         A GGV G  + +
Sbjct: 7   GLDQVSPPENKPFDQLSPEEQGEKGAQMMVEFMTSCPGKAAISGVTGFALGGVFGLFMAS 66

Query: 650 LSPDLQ-PTPPPGANLDPNAMATFNQAQALTGGPLVQ----------------ARNFAVM 522
           ++ D    TP P      NA    N+ + L   PL Q                A+NF  +
Sbjct: 67  MAYDTPLHTPAP-----TNAPGLPNKVKELADLPLKQQIKIQFSDMGKRSYSSAKNFGYI 121

Query: 521 TGVNAGISCVLKRVRGKEDVQSSMAAA--FGSGVMYSLVSGMGGPDVVPAALTSGVFFAL 348
             + +G+ CV++ +R K D+ + +AA    G G+ Y       GP    AAL     FA 
Sbjct: 122 GMIYSGVECVVESLRAKNDIYNGVAAGCLTGGGLAYK-----SGPQ---AALVGCAGFAA 173

Query: 347 VQGGL-FKLGQQFSQPPAED 291
               +   +  +  +PP +D
Sbjct: 174 FSTAIDLYMRNENKKPPKDD 193



>sp|O60830|IM7B_HUMAN Mitochondrial import inner membrane
           translocase subunit Tim17 B (JM3).>gb:AF077039_1149723
           Homo sapiens inner mitochondrial membrane translocase
           TIM17 homolog mRNA, nuclear gene encoding mitochondrial
           protein, complete cds.>gb:AF034790_1877849 Homo sapiens
           inner mitochondrial membrane translocase Tim17b mRNA,
           nuclear gene encoding mitochondrial protein, complete
           cds.>gb:BC010142_1972515 Homo sapiens translocase of
           inner mitochondrial membrane 17 homolog B (yeast), mRNA
           (cDNA clone MGC:19550 IMAGE:4300787), complete
           cds.>gb:HSA005895_1999922 Homo sapiens mRNA for (JM3)
           preprotein translocase, complete CDS (clone IMAGE 345224
           and LLOXNC01U138D3 (Baylor College)).
          Length = 172

 Score = 39.7 bits (91), Expect = 0.085
 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 4/83 (4%)
 Frame = -3

Query: 536 NFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPDVVPAALTSGVF 357
           +FAV  G+ + I C L R+RGKED  +S+ +   +G +  L +  G   +V +A+  G+ 
Sbjct: 65  SFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAV--LAARSGPLAMVGSAMMGGIL 122

Query: 356 FALVQGGLFKL----GQQFSQPP 300
            AL++G    L     QQF   P
Sbjct: 123 LALIEGVGILLTRYTAQQFRNAP 145



>sp|Q99595|IM7A_HUMAN Mitochondrial import inner membrane
           translocase subunit Tim17 A (Inner membrane preprotein
           translocase Tim17a).>gb:AF106622_1884015 Homo sapiens
           mitochondrial inner membrane preprotein translocase
           Tim17a mRNA, nuclear gene encoding mitochondrial
           protein, complete cds.>gb:BC000294_1966587 Homo sapiens
           translocase of inner mitochondrial membrane 17 homolog A
           (yeast), mRNA (cDNA clone MGC:8336 IMAGE:2819455),
           complete cds.>gb:BC004439_1969276 Homo sapiens
           translocase of inner mitochondrial membrane 17 homolog A
           (yeast), mRNA (cDNA clone MGC:4031 IMAGE:2819455),
           complete cds.>gb:BC007106_1970527 Homo sapiens
           translocase of inner mitochondrial membrane 17 homolog A
           (yeast), mRNA (cDNA clone MGC:14756 IMAGE:4284092),
           complete cds.>gb:BC009784_1972256 Homo sapiens
           translocase of inner mitochondrial membrane 17 homolog A
           (yeast), mRNA (cDNA clone MGC:13516 IMAGE:3683125),
           complete cds.>gb:BC015098_1974949 Homo sapiens
           translocase of inner mitochondrial membrane 17 homolog A
           (yeast), mRNA (cDNA clone MGC:22820 IMAGE:3686369),
           complete cds.>gb:BC020833_1977240 Homo sapiens
           translocase of inner mitochondrial membrane 17 homolog A
           (yeast), mRNA (cDNA clone MGC:23921 IMAGE:4773149),
           complete cds.>gb:HSTIM17_2021085 H.sapiens mRNA for
           TIM17 preprotein translocase.
          Length = 171

 Score = 39.7 bits (91), Expect = 0.085
 Identities = 27/91 (29%), Positives = 47/91 (51%), Gaps = 10/91 (10%)
 Frame = -3

Query: 536 NFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPDVVPAALTSGVF 357
           +FAV  G+ + I C + +VRGKED  +S+ +   +G +  L +  G   +V +A   G+ 
Sbjct: 65  SFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAI--LAARNGPVAMVGSAAMGGIL 122

Query: 356 FALVQG----------GLFKLGQQFSQPPAE 294
            AL++G            F  G QF++ P++
Sbjct: 123 LALIEGAGILLTRFASAQFPNGPQFAEDPSQ 153



>sp|Q9SP35|IM17_ARATH Mitochondrial import inner membrane
           translocase subunit Tim17.>pir|D84792|D84792 probable
           protein translocase [imported] - Arabidopsis
           thaliana>gb:AC005896_1533156 Arabidopsis thaliana
           chromosome 2 clone F3G5 map ve018, complete
           sequence.>gb:AY040072_1560569 Arabidopsis thaliana
           putative protein translocase (At2g37410) mRNA, complete
           cds.>gb:AY056107_1563444 Arabidopsis thaliana
           At2g37410/F3G5.20 mRNA, complete
           cds.>gb:AF360258_1791207 Arabidopsis thaliana putative
           protein translocase (At2g37410) mRNA, complete cds.
          Length = 243

 Score = 39.7 bits (91), Expect = 0.085
 Identities = 24/78 (30%), Positives = 39/78 (50%)
 Frame = -3

Query: 536 NFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPDVVPAALTSGVF 357
           +FAV  G+ +   C +  +R KED  +S+ A   +G   S+  G G      +A+  GV 
Sbjct: 65  SFAVWGGLFSTFDCTMVYLRQKEDPWNSIIAGAATGGFLSMRQGAGAAS--RSAIFGGVL 122

Query: 356 FALVQGGLFKLGQQFSQP 303
            AL++G    L +  +QP
Sbjct: 123 LALIEGAGIMLNKVLAQP 140



>gb:AE016959_1022149 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC093181_1735952
           Oryza sativa chromosome 10 BAC OSJNBb0089F16 genomic
           sequence, complete sequence.>gb:AE017083_1751968 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           37 of 77 of the complete sequence.
          Length = 194

 Score = 38.9 bits (89), Expect = 0.14
 Identities = 22/72 (30%), Positives = 40/72 (55%)
 Frame = -3

Query: 542 ARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPDVVPAALTSG 363
           A+ FA ++GV + I C+L+R+RGK+D+ ++  A   +G+  S     G P  +  +  + 
Sbjct: 75  AKTFAALSGVQSFILCLLRRLRGKDDMINAGVAGCCTGLALSF---PGAPQAMFHSCVTF 131

Query: 362 VFFALVQGGLFK 327
             F+ +  GL K
Sbjct: 132 AAFSCIMDGLNK 143



>gb:AF186847_1775172 Arabidopsis thaliana TIM17 (TIM17) mRNA,
           complete cds.
          Length = 243

 Score = 38.1 bits (87), Expect = 0.25
 Identities = 23/78 (29%), Positives = 38/78 (48%)
 Frame = -3

Query: 536 NFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPDVVPAALTSGVF 357
           +FAV  G+ +   C +  +R KED  +S+ A   +G   S+  G G      + +  GV 
Sbjct: 65  SFAVWGGLFSTFDCTMVYLRQKEDPWNSIIAGAATGGFLSMRQGAGAAS--RSTIFGGVL 122

Query: 356 FALVQGGLFKLGQQFSQP 303
            AL++G    L +  +QP
Sbjct: 123 LALIEGAGIMLNKVLAQP 140



>gb:BC084641_2563942 Xenopus laevis hypothetical LOC495285, mRNA
           (cDNA clone IMAGE:4970860), partial cds.
          Length = 163

 Score = 37.7 bits (86), Expect = 0.32
 Identities = 21/66 (31%), Positives = 38/66 (57%)
 Frame = -3

Query: 536 NFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPDVVPAALTSGVF 357
           +FAV  G+ + I C + ++RGKED  +S+ +   +G +  L +  G   +V +A   G+ 
Sbjct: 61  SFAVWGGLFSMIDCSMVKIRGKEDPWNSITSGALTGAI--LAARNGAVAMVGSAAMGGIL 118

Query: 356 FALVQG 339
            AL++G
Sbjct: 119 LALIEG 124



>gb:BC086502_2564903 Xenopus tropicalis cDNA clone MGC:97574
           IMAGE:6976910, complete cds.
          Length = 167

 Score = 37.0 bits (84), Expect = 0.55
 Identities = 21/66 (31%), Positives = 38/66 (57%)
 Frame = -3

Query: 536 NFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPDVVPAALTSGVF 357
           +FAV  G+ + I C + ++RGKED  +S+ +   +G +  L +  G   +V +A   G+ 
Sbjct: 65  SFAVWGGLFSMIDCSMVKMRGKEDPWNSITSGALTGAI--LAARNGAVAMVGSAAMGGIL 122

Query: 356 FALVQG 339
            AL++G
Sbjct: 123 LALIEG 128



>gb:AX885408_1480861 Sequence 1271 from Patent EP1033401.
          Length = 138

 Score = 37.0 bits (84), Expect = 0.55
 Identities = 22/66 (33%), Positives = 38/66 (57%)
 Frame = -3

Query: 536 NFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPDVVPAALTSGVF 357
           +FAV  G+ + I C + +VRGKED  +S+ +   +G +  L +  G   +V +A   G+ 
Sbjct: 65  SFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAI--LAARNGPVAMVGSAAMGGIL 122

Query: 356 FALVQG 339
            AL++G
Sbjct: 123 LALIEG 128



>pir|C86337|C86337 hypothetical protein F14O10.5 - Arabidopsis
           thaliana>gb:AE005172_890991 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AY463969_1607871 Arabidopsis thaliana
           mitochondrial inner membrane translocase TM17-1
           (At1g20350) mRNA, complete cds; nuclear gene for
           mitochondrial product.>gb:BT005239_1638179 Arabidopsis
           thaliana At1g20350 mRNA, complete cds.>gb:F14O10_1677479
           Sequence of BAC F14O10 from Arabidopsis thaliana
           chromosome 1, complete sequence.>gb:AK118449_1816427
           Arabidopsis thaliana At1g20350 mRNA for unknown protein,
           complete cds, clone: RAFL19-69-E10.
          Length = 218

 Score = 37.0 bits (84), Expect = 0.55
 Identities = 28/95 (29%), Positives = 43/95 (45%)
 Frame = -3

Query: 623 PPGANLDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAA 444
           P GA L     A    +   +GG      +F+V  G+ +   C L   R KED  +S+ +
Sbjct: 43  PGGARLSGGVQA-LRMSGPRSGG------SFSVWGGLYSTFDCALVYARQKEDPWNSILS 95

Query: 443 AFGSGVMYSLVSGMGGPDVVPAALTSGVFFALVQG 339
              +G   SL  G+G      +AL  GV  A+++G
Sbjct: 96  GAATGGFLSLRQGLGAS--ARSALVGGVLLAMIEG 128



>sp|O35092|IM7A_RAT Mitochondrial import inner membrane translocase
           subunit Tim17 A (Inner membrane preprotein translocase
           Tim17a).>pir|JE0153|JE0153 mitochondrial inner membrane
           translocating protein, rTIM17 - rat>gb:AB006450_2043329
           Rattus norvegicus mRNA for Tim17, complete cds.
          Length = 171

 Score = 37.0 bits (84), Expect = 0.55
 Identities = 30/99 (30%), Positives = 49/99 (49%), Gaps = 6/99 (6%)
 Frame = -3

Query: 536 NFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPDVVPAALTSGVF 357
           +FAV  G+ + I C + ++RGKED  +S+ +   +G +  L +  G   +V +A   G+ 
Sbjct: 65  SFAVWGGLFSTIDCGMVQIRGKEDPWNSITSGALTGAI--LAARNGPVAMVGSAAMGGIL 122

Query: 356 FALVQGGLFKL----GQQFSQPP--AEDMQYVKTRSLLS 258
            AL++G    L      QF   P  AED   + +  L S
Sbjct: 123 LALIEGAGILLTRFASAQFPNGPQFAEDHSQLPSSQLPS 161



>sp|Q9Z0V8|IM7A_MOUSE Mitochondrial import inner membrane
           translocase subunit Tim17 A (Inner membrane preprotein
           translocase Tim17a).>gb:AK003114_1151653 Mus musculus
           adult male heart cDNA, RIKEN full-length enriched
           library, clone:1010001E09 product:translocator of inner
           mitochondrial membrane 17 kDa, a, full insert
           sequence.>gb:AK003129_1151667 Mus musculus adult male
           heart cDNA, RIKEN full-length enriched library,
           clone:1010001L13 product:translocator of inner
           mitochondrial membrane 17 kDa, a, full insert
           sequence.>gb:AF106620_2054682 Mus musculus mitochondrial
           inner membrane translocase component Tim17a mRNA,
           nuclear gene encoding mitochondrial protein, complete
           cds.>gb:BC010830_2091162 Mus musculus translocator of
           inner mitochondrial membrane 17a, mRNA (cDNA clone
           MGC:19157 IMAGE:4220707), complete cds.
          Length = 171

 Score = 37.0 bits (84), Expect = 0.55
 Identities = 21/66 (31%), Positives = 38/66 (57%)
 Frame = -3

Query: 536 NFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPDVVPAALTSGVF 357
           +FAV  G+ + I C + ++RGKED  +S+ +   +G +  L +  G   +V +A   G+ 
Sbjct: 65  SFAVWGGLFSTIDCSMVQIRGKEDPWNSITSGALTGAI--LAARNGPVAMVGSAAMGGIL 122

Query: 356 FALVQG 339
            AL++G
Sbjct: 123 LALIEG 128



>gb:AY065147_1566301 Arabidopsis thaliana unknown protein
           (At1g70180; F20P5.10) mRNA, complete
           cds.>gb:BT009660_1640121 Arabidopsis thaliana At1g70180
           mRNA, complete cds.
          Length = 460

 Score = 35.4 bits (80), Expect = 1.6
 Identities = 23/73 (31%), Positives = 30/73 (41%)
 Frame = -3

Query: 326 LGQQFSQPPAEDMQYVKTRSLLSGLGLEKYEKNFKRGXXXXXXXXXXXDSALKDVSIPPG 147
           LG      P    + +     L+ +GL KY   FKR            +S LKD+ IP G
Sbjct: 386 LGSIMQNSPFSVDEPLSVDGFLNSIGLGKYSLAFKREEVDMTTIKQMKESDLKDLIIPMG 445

Query: 146 PRLLILDQVHRNP 108
           PR  IL  +   P
Sbjct: 446 PRKKILQAIASLP 458



>gb:AY206771_1589548 Chlamydomonas reinhardtii flagella membrane
            glycoprotein 1A gene, complete cds.
          Length = 3873

 Score = 35.0 bits (79), Expect = 2.1
 Identities = 29/91 (31%), Positives = 41/91 (45%)
 Frame = -3

Query: 638  LQPTPPPGANLDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCVLKRVRGKEDVQ 459
            LQ  P P   L   A AT   A A     LV A+   ++T +NAG S     +    +  
Sbjct: 3704 LQTAPAPFTQLQ--AQATALAAAAAGSNALVAAQQARLITAINAGTSISAAELTNIINEA 3761

Query: 458  SSMAAAFGSGVMYSLVSGMGGPDVVPAALTS 366
            S +  A  S V+ +  SG+G   + PA+ TS
Sbjct: 3762 SKVIVA-QSTVIATAASGLGSGAISPASFTS 3791



>gb:AE014297_1141727 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003761_1223720 Drosophila melanogaster
           chromosome 3R, section 99 of 118 of the complete
           sequence.
          Length = 788

 Score = 35.0 bits (79), Expect = 2.1
 Identities = 48/201 (23%), Positives = 75/201 (37%), Gaps = 12/201 (5%)
 Frame = -3

Query: 815 QLPSQNPIEQFQAKYNELASGVKAWLSKQSLPV-------EXXXXXXXXXAQGGVIG--- 666
           Q   Q P   F+A + EL     +W S Q  P        +           G  +G   
Sbjct: 297 QQQHQQPSHDFEAYFGELKIDESSWQSGQPTPTPAPSGHEDKRPLNVRSSESGSGVGAGS 356

Query: 665 AILGN--LSPDLQPTPPPGANLDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCV 492
           A+ GN  +S DL             A A  ++ Q   G  L    +    TGV+  I  +
Sbjct: 357 AVSGNVGISNDLLDEVKASRAALERAAAAVDE-QLARGNQLSPPSSQDPKTGVS--IENI 413

Query: 491 LKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQF 312
              + G+   + + AA  G+G+  + V+G+  P+ + AA T G F  L      +  Q+ 
Sbjct: 414 ENAIYGE---RLTGAAGAGAGLPAAAVAGVASPEAMAAAPTKGFFDNLAANPSPEEHQEV 470

Query: 311 SQPPAEDMQYVKTRSLLSGLG 249
            Q   +     +    LSG G
Sbjct: 471 EQQQQQQQSTQQVEPELSGYG 491



>gb:AF461353_1273264 Drosophila rufa hunchback (hb) gene, partial
           cds.
          Length = 165

 Score = 34.7 bits (78), Expect = 2.7
 Identities = 17/32 (53%), Positives = 20/32 (62%)
 Frame = -3

Query: 656 GNLSPDLQPTPPPGANLDPNAMATFNQAQALT 561
           GNL P  QPTP  G  + P A+AT  + QALT
Sbjct: 120 GNLRPSPQPTPTTGVAVAPVAVATSEKLQALT 151



>gb:AF461348_1273259 Drosophila biauraria hunchback (hb) gene,
           partial cds.
          Length = 166

 Score = 34.7 bits (78), Expect = 2.7
 Identities = 17/32 (53%), Positives = 20/32 (62%)
 Frame = -3

Query: 656 GNLSPDLQPTPPPGANLDPNAMATFNQAQALT 561
           GNL P  QPTP  G  + P A+AT  + QALT
Sbjct: 121 GNLRPSPQPTPTTGVAVAPVAVATSEKLQALT 152



>gb:AF461338_1273249 Drosophila auraria hunchback (hb) gene, partial
           cds.>gb:AF461343_1273254 Drosophila quadraria hunchback
           (hb) gene, partial cds.>gb:AF461345_1273256 Drosophila
           triauraria hunchback (hb) gene, partial cds.
          Length = 165

 Score = 34.7 bits (78), Expect = 2.7
 Identities = 17/32 (53%), Positives = 20/32 (62%)
 Frame = -3

Query: 656 GNLSPDLQPTPPPGANLDPNAMATFNQAQALT 561
           GNL P  QPTP  G  + P A+AT  + QALT
Sbjct: 120 GNLRPSPQPTPTTGVAVAPVAVATSEKLQALT 151



>gb:BA000031_705826 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 1, complete sequence.
          Length = 538

 Score = 34.3 bits (77), Expect = 3.6
 Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 4/74 (5%)
 Frame = -3

Query: 458 SSMAAAFGSGVMYSLVSGMGGPDVVPAALTSGVFFALVQG-GLFK---LGQQFSQPPAED 291
           +  AAA   GV   + + +GGP  +  ALTSG      +G GLF+   L Q   + P E+
Sbjct: 254 AQQAAATCDGVHIPVFANIGGPKDIDDALTSG-----AEGVGLFRTEFLFQNSDELPTEE 308

Query: 290 MQYVKTRSLLSGLG 249
            QY   R + + LG
Sbjct: 309 AQYQVYRDIAAALG 322



>gb:BC080060_2561494 Xenopus laevis MGC84026 protein, mRNA (cDNA
           clone MGC:84026 IMAGE:6947072), complete cds.
          Length = 550

 Score = 33.9 bits (76), Expect = 4.6
 Identities = 23/62 (37%), Positives = 29/62 (46%), Gaps = 11/62 (17%)
 Frame = +1

Query: 289 MSSAGGCENCCPSLKRPP*TSAKKTPDVK----------AAGTTS-GPPMPLTNEYMTPD 435
           MS  GG  +  PS KRPP T + K+   K           +GT+  GPP P TN    P+
Sbjct: 264 MSPKGGPSDVKPSNKRPPNTDSPKSSSKKPKKGISKGFPVSGTSPRGPPNPTTNSSSYPE 323

Query: 436 PK 441
            K
Sbjct: 324 KK 325



>gb:AP005651_1855498 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0086N11.
          Length = 309

 Score = 33.9 bits (76), Expect = 4.6
 Identities = 23/63 (36%), Positives = 27/63 (42%)
 Frame = -2

Query: 570 GSYRWSLGTSSKFCCHDWGECWHFLCLEKGERQGGCSVKYGSCFWVWSHVFIS*RHGWPR 391
           G  RW +      C    G C      EKGE  GGC    G   W W    ++ RHGWPR
Sbjct: 160 GWRRWLMVVGG--CMWGLGRC---RAAEKGESGGGCG--RGVDDWKW----VTARHGWPR 208

Query: 390 CSS 382
            +S
Sbjct: 209 AAS 211



>gb:NC99H12_1688824 Neurospora crassa DNA linkage group V Cosmid
           contig 99H12.
          Length = 194

 Score = 33.9 bits (76), Expect = 4.6
 Identities = 31/118 (26%), Positives = 54/118 (45%), Gaps = 22/118 (18%)
 Frame = -3

Query: 680 GGVIGAILGNLSPDL---QPTPP---PGANLDPNAMATFNQAQALTGGPLVQ-------- 543
           GGV G  + +++ D     PT P   PGAN     +  +     L+  PL +        
Sbjct: 53  GGVFGMFMASMAYDTPYHSPTTPGTGPGANPAAAGIPGYKPVD-LSSMPLKEQLKHGFKD 111

Query: 542 --------ARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGP 393
                   A+NFA +  + +GI C ++ +R K D+ + +AA   +G   ++++  GGP
Sbjct: 112 MGQRSYSTAKNFAKVGALFSGIECGIEGLRAKNDLGNGVAAGCLTG---AILAKNGGP 166



>gb:CR380953_1650860 Candida glabrata strain CBS138 chromosome G
           complete sequence.
          Length = 193

 Score = 33.9 bits (76), Expect = 4.6
 Identities = 38/160 (23%), Positives = 63/160 (39%), Gaps = 12/160 (7%)
 Frame = -3

Query: 728 SLPVEXXXXXXXXXAQGGVIGAILGNLSPDLQ-PTPPPGAN---LDPNAMATFNQAQALT 561
           S P +         A GGV+G  + +++ D    TP PG     +   A     Q   L 
Sbjct: 41  SCPGKSVISGATGFALGGVLGLFMASMAYDTPLHTPVPGGMSGAVQQMADLPLRQQVKLQ 100

Query: 560 GGPLVQ-----ARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAA--FGSGVMYSLVSGM 402
              + +     A+NF  +  + AG+ C ++ +R K D+ + + A    G G+ Y      
Sbjct: 101 FADMGKRAYSSAKNFGYIGMIYAGVECAVESLRAKNDIYNGITAGCITGGGLAYK----- 155

Query: 401 GGPDVVPAALTSGVFFALVQGGL-FKLGQQFSQPPAEDMQ 285
            GP    AAL     FA     +   +  +  +PP  D +
Sbjct: 156 SGPQ---AALVGCAGFAAFSAAIDMYMKSEDGRPPENDFK 192



>gb:CFHEPABC_1646283 Cylindrotheca fusiformis hepA, hepB, hepC
           genes.
          Length = 780

 Score = 33.9 bits (76), Expect = 4.6
 Identities = 25/76 (32%), Positives = 34/76 (44%), Gaps = 3/76 (3%)
 Frame = +1

Query: 232 FSYFSRPS-PDNSDLVLTYC--MSSAGGCENCCPSLKRPP*TSAKKTPDVKAAGTTSGPP 402
           F  F  PS P N D+V   C  + +  GC  CCP+  RP       +PD        G P
Sbjct: 350 FLPFDDPSRPQNCDIVAPACDVLPTPAGCPVCCPAECRPDNPMFTPSPD--------GSP 401

Query: 403 MPLTNEYMTPDPKAAA 450
            P+ +  M P P+ +A
Sbjct: 402 -PVCSPTMMPSPQPSA 416



>gb:AY071656_1295740 Drosophila melanogaster RE73548 full insert
           cDNA.
          Length = 788

 Score = 33.9 bits (76), Expect = 4.6
 Identities = 48/201 (23%), Positives = 74/201 (36%), Gaps = 12/201 (5%)
 Frame = -3

Query: 815 QLPSQNPIEQFQAKYNELASGVKAWLSKQSLPV-------EXXXXXXXXXAQGGVIG--- 666
           Q   Q P   F+A + EL     +W S Q  P        +           G  +G   
Sbjct: 297 QQQHQQPSHDFEAYFGELKIDESSWQSGQPTPTPAPSGHEDKRPLNVRSSESGSGVGAGS 356

Query: 665 AILGN--LSPDLQPTPPPGANLDPNAMATFNQAQALTGGPLVQARNFAVMTGVNAGISCV 492
           A+ GN  +S DL             A A  ++ Q   G  L    +    TGV+  I  +
Sbjct: 357 AVSGNVGISNDLLDEVKASRAALERAAAAVDE-QLARGNQLSPPSSQDPKTGVS--IENI 413

Query: 491 LKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPDVVPAALTSGVFFALVQGGLFKLGQQF 312
              + G+   + + AA  G+G+  + V+G+  P  + AA T G F  L      +  Q+ 
Sbjct: 414 ENAIYGE---RLTGAAGAGAGLPAAAVAGVASPGAMAAAPTKGFFDNLAANPSPEEHQEV 470

Query: 311 SQPPAEDMQYVKTRSLLSGLG 249
            Q   +     +    LSG G
Sbjct: 471 EQQQQQQQSTQQVEPELSGYG 491



>gb:AF312367_1896330 Homo sapiens La binding protein 1 mRNA,
           complete cds.
          Length = 708

 Score = 33.5 bits (75), Expect = 6.1
 Identities = 28/99 (28%), Positives = 43/99 (43%), Gaps = 1/99 (1%)
 Frame = -3

Query: 683 QGGVIGAILGNLSPDLQPTPPPGANLDPNAMATFNQAQALTG-GPLVQARNFAVMTGVNA 507
           +GG        L P+L+P P PG+ L+P           L G G L  A       G +A
Sbjct: 5   EGGCAAGRGRELEPELEPGPGPGSALEPGEEFEIVDRSQLPGPGDLRSATRPRAAEGWSA 64

Query: 506 GISCVLKRVRGKEDVQSSMAAAFGSGVMYSLVSGMGGPD 390
            I  + +R  G      +++A+ GS +     +G+GG D
Sbjct: 65  PILTLARRATG------NLSASCGSAL--RAAAGLGGGD 95



>gb:OSJN00104_1694979 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0048E02, complete
           sequence.>gb:OSJN00149_1695691 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0060P14, complete
           sequence.
          Length = 346

 Score = 33.1 bits (74), Expect = 7.9
 Identities = 20/49 (40%), Positives = 24/49 (48%)
 Frame = -3

Query: 266 LLSGLGLEKYEKNFKRGXXXXXXXXXXXDSALKDVSIPPGPRLLILDQV 120
           LL+ LGLEKY   F              DS LK++ +P GPR  IL  V
Sbjct: 290 LLNSLGLEKYVFLFHAEEVDMAALSQMGDSDLKEIGVPMGPRKKILQAV 338



>gb:CR382136_1668764 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 182

 Score = 33.1 bits (74), Expect = 7.9
 Identities = 26/107 (24%), Positives = 45/107 (42%), Gaps = 6/107 (5%)
 Frame = -3

Query: 731 QSLPVEXXXXXXXXXAQGGVIGAILGNLSPDLQPTPPPGANLDPNAM-ATFNQAQALTGG 555
           QS P +           GG  G  + ++S D+    P G N   N     F Q   L   
Sbjct: 36  QSCPGKTVMAGVSGFFLGGFFGLFMASMSYDV----PIGTNAVSNIRDLPFKQQMKLQFS 91

Query: 554 PLVQ-----ARNFAVMTGVNAGISCVLKRVRGKEDVQSSMAAAFGSG 429
            + +     A+NF  +  V +G+ C ++ +R K D+ + ++A   +G
Sbjct: 92  DMGKRTYSSAKNFGYIGMVYSGVECAIESLRAKHDIYNGVSAGCITG 138



>gb:DMU42014_1380740 Drosophila melanogaster hemomucin mRNA,
           complete cds.
          Length = 582

 Score = 33.1 bits (74), Expect = 7.9
 Identities = 24/79 (30%), Positives = 32/79 (40%)
 Frame = +1

Query: 325 SLKRPP*TSAKKTPDVKAAGTTSGPPMPLTNEYMTPDPKAAAILD*TSSLPLTLFKTQEM 504
           S+  PP   +K TP  KAA +T+ P    T    TP P        T+  P T   T++ 
Sbjct: 431 SIGVPP---SKATPKPKAAPSTTTPKPTTTTTTTTPKPTTKTTTTTTTPKPTTTTTTKKP 487

Query: 505 PAFTPVMTAKFRACTKGPP 561
              T   T   +  T  PP
Sbjct: 488 TTTTTTTTTTPKPTTTKPP 506



>gb:AY118372_1300094 Drosophila melanogaster RE16762 full insert
           cDNA.
          Length = 579

 Score = 33.1 bits (74), Expect = 7.9
 Identities = 24/79 (30%), Positives = 32/79 (40%)
 Frame = +1

Query: 325 SLKRPP*TSAKKTPDVKAAGTTSGPPMPLTNEYMTPDPKAAAILD*TSSLPLTLFKTQEM 504
           S+  PP   +K TP  KAA +T+ P    T    TP P        T+  P T   T++ 
Sbjct: 431 SIGVPP---SKATPKPKAAPSTTTPKPTTTTTTTTPKPTTKTTTTTTTPKPTTTTTTKKP 487

Query: 505 PAFTPVMTAKFRACTKGPP 561
              T   T   +  T  PP
Sbjct: 488 TTTTTTTTTTPKPTTTKPP 506



>gb:AE014297_1141713 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003760_1223706 Drosophila melanogaster
           chromosome 3R, section 98 of 118 of the complete
           sequence.
          Length = 579

 Score = 33.1 bits (74), Expect = 7.9
 Identities = 24/79 (30%), Positives = 32/79 (40%)
 Frame = +1

Query: 325 SLKRPP*TSAKKTPDVKAAGTTSGPPMPLTNEYMTPDPKAAAILD*TSSLPLTLFKTQEM 504
           S+  PP   +K TP  KAA +T+ P    T    TP P        T+  P T   T++ 
Sbjct: 431 SIGVPP---SKATPKPKAAPSTTTPKPTTTTTTTTPKPTTKTTTTTTTPKPTTTTTTKKP 487

Query: 505 PAFTPVMTAKFRACTKGPP 561
              T   T   +  T  PP
Sbjct: 488 TTTTTTTTTTPKPTTTKPP 506



>pir|T01456|T01456 extensin homolog F24O1.18 - Arabidopsis
           thaliana>gb:AE005173_893914 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC003113_1531113 Genomic sequence for
           Arabidopsis thaliana BAC F24O1 from chromosome I,
           complete sequence.>gb:AC005698_1532897 Genomic sequence
           for Arabidopsis thaliana BAC T3P18 from Chromosome 1,
           complete sequence.
          Length = 786

 Score = 33.1 bits (74), Expect = 7.9
 Identities = 29/110 (26%), Positives = 40/110 (36%), Gaps = 2/110 (1%)
 Frame = +1

Query: 241 FSRPSPDNSDLVLTYCMSSAGGCENCCPSLKRPP*TSAKKTPDVKAAGTTSGPPMPLTNE 420
           +S P P +      Y  SS     NC P+ + PP    ++TP  +    +  PP     +
Sbjct: 506 YSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPPY---YQ 562

Query: 421 YMT--PDPKAAAILD*TSSLPLTLFKTQEMPAFTPVMTAKFRACTKGPPV 564
           Y +  P P   A        P T +  Q  P   PV      A    PPV
Sbjct: 563 YTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPV 612


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 930,295,204
Number of Sequences: 1806583
Number of extensions: 19319391
Number of successful extensions: 55201
Number of sequences better than 10.0: 47
Number of HSP's better than 10.0 without gapping: 51519
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 55085
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 66211811355
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)