BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig11109
         (945 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AF110226_1768767 Nicotiana tabacum nuclear RNA binding protei...   216   4e-55   
gb:BVU313093_1643197 Beta vulgaris mRNA for salt tolerance prote...   211   2e-53   
gb:AF110228_1768769 Spinacia oleracea nuclear RNA binding protei...   188   2e-46   
gb:BVU313092_1643196 Beta vulgaris mRNA for salt tolerance prote...   178   2e-43   
gb:AF110229_1768770 Spinacia oleracea nuclear RNA binding protei...   177   3e-43   
pir|T12180|T12180 probable transcription factor - fava bean>gb:V...   176   8e-43   Vicia faba var. minor [tick bean]
pir|F71435|F71435 probable nuclear antigen - Arabidopsis thalian...   162   7e-39   Arabidopsis thaliana [mouse-ear cress]
gb:AP003292_1827445 Oryza sativa (japonica cultivar-group) genom...   162   1e-38   
gb:AF110230_1768771 Spinacia oleracea nuclear RNA binding protei...   161   2e-38   
gb:AY084828_1569911 Arabidopsis thaliana clone 118826 mRNA, comp...   158   1e-37   
gb:AC105260_1737884 Oryza sativa (japonica cultivar-group) chrom...   158   2e-37   
gb:AP003022_1824290 Oryza sativa (japonica cultivar-group) genom...   156   5e-37   
gb:AY085859_1570923 Arabidopsis thaliana clone 19104 mRNA, compl...   152   9e-36   
gb:AB018117_1513849 Arabidopsis thaliana genomic DNA, chromosome...   152   9e-36   
gb:AY087413_1572444 Arabidopsis thaliana clone 35156 mRNA, compl...   147   4e-34   
gb:AC121365_1740192 Oryza sativa (japonica cultivar-group) chrom...   144   2e-33   
pir|G71444|G71444 hypothetical protein - Arabidopsis thaliana>gb...   144   3e-33   Arabidopsis thaliana [mouse-ear cress]
gb:AY560385_1614903 Tagetes minuta thermoinhibition-associated T...    80   6e-14   
gb:AC092852_1735785 Oryza sativa chromosome 3 BAC OSJNBa0032G11 ...    61   3e-08   
gb:AP003292_1827446 Oryza sativa (japonica cultivar-group) genom...    52   2e-05   
gb:BC067912_2554898 Xenopus tropicalis hypothetical protein MGC6...    50   6e-05   
gb:AE014297_1141336 Drosophila melanogaster chromosome 3R, compl...    49   1e-04   
gb:AE014297_1141335 Drosophila melanogaster chromosome 3R, compl...    49   1e-04   
gb:FRU90880_2572185 Takifugu rubripes isotocin and vasotocin locus.    47   7e-04   
gb:BC013665_2091879 Mus musculus RIKEN cDNA 1200009K13 gene, mRN...    46   0.001   
gb:AK088278_1175304 Mus musculus 2 days neonate thymus thymic ce...    46   0.001   
gb:BC079337_2107458 Rattus norvegicus PAI-1 mRNA-binding protein...    46   0.001   
gb:AF388527_2064691 Rattus norvegicus hypothetical RNA binding p...    46   0.001   
gb:AK010860_1156036 Mus musculus 13 days embryo liver cDNA, RIKE...    45   0.002   
gb:BC083399_2563226 Danio rerio zgc:103482, mRNA (cDNA clone MGC...    44   0.004   
gb:BC059961_2552741 Xenopus laevis hypothetical protein MGC68500...    44   0.005   
gb:BC046574_2549633 Xenopus laevis hypothetical protein MGC53445...    44   0.005   
gb:BC046876_2549775 Danio rerio zgc:55489, mRNA (cDNA clone MGC:...    44   0.006   
gb:HSM807283_1187834 Homo sapiens mRNA; cDNA DKFZp686P17171 (fro...    42   0.018   
pir|T12456|T12456 hypothetical protein DKFZp564M2423.1 - human>g...    42   0.018   Homo sapiens [man]
pir|D88042|D88042 protein F56D12.5 [imported] - Caenorhabditis e...    42   0.023   Caenorhabditis elegans [roundworm]
gb:AY032853_1934539 Homo sapiens CGI-55 mRNA, partial cds.             41   0.030   
gb:AL590559_1929700 Human DNA sequence from clone RP11-393N21 on...    41   0.030   
gb:AF151813_1886299 Homo sapiens CGI-55 protein mRNA, complete cds.    41   0.030   
gb:BC070578_2555557 Xenopus laevis hypothetical protein MGC81067...    41   0.039   
gb:AE014134_1129244 Drosophila melanogaster chromosome 2L, compl...    41   0.039   
gb:CR380952_1650599 Candida glabrata strain CBS138 chromosome F ...    40   0.087   
gb:AY672709_1345509 Strongyloides ratti ALT-1 mRNA, complete cds...    39   0.11    
gb:BC002488_1968154 Homo sapiens PAI-1 mRNA-binding protein, mRN...    39   0.19    
gb:AL590559_1929699 Human DNA sequence from clone RP11-393N21 on...    39   0.19    
gb:AC092263_1735265 Oryza sativa chromosome 3 BAC OSJNBa0033P04 ...    39   0.19    
pir|T02367|T02367 hypothetical protein T8F5.22 - Arabidopsis tha...    38   0.25    Arabidopsis thaliana [mouse-ear cress]
gb:AL590559_1929701 Human DNA sequence from clone RP11-393N21 on...    38   0.33    
gb:CQ783786_1452629 Sequence 3926 from Patent EP1396543.>gb:AK07...    38   0.33    
gb:AK045190_1167301 Mus musculus 9.5 days embryo parthenogenote ...    37   0.56    
gb:AK004678_1152503 Mus musculus adult male lung cDNA, RIKEN ful...    37   0.56    
gb:AE016819_1749340 Ashbya gossypii (= Eremothecium gossypii) AT...    36   0.96    
gb:YSCECT1_1728844 Yeast DNA for CTP: phosphoethanolamine cytidy...    36   1.3     
gb:AC003680_1531194 Arabidopsis thaliana chromosome 2 BAC F17K2 ...    36   1.3     
pir|T00875|T00875 hypothetical protein At2g45620 [imported] - Ar...    36   1.3     Arabidopsis thaliana [mouse-ear cress]
pir|S12201|S12201 ATP synthase regulatory factor, 15K - yeast (S...    36   1.3     Saccharomyces cerevisiae [brewer's yeast]
sp|P16965|STF2_YEAST|STF2_YEAST ATPase stabilizing factor 15 kDa protein.         36   1.3     Saccharomyces cerevisiae [brewer's yeast]
gb:AE016818_1748261 Ashbya gossypii (= Eremothecium gossypii) AT...    35   1.6     
gb:HS1LATA_2437070 Herpes simplex virus type one (HSV-1) latency...    35   2.1     
gb:AP005678_1855846 Oryza sativa (japonica cultivar-group) genom...    35   2.1     
gb:AE017351_1759534 Cryptococcus neoformans var. neoformans JEC2...    35   2.1     
gb:AY054208_1563030 Arabidopsis thaliana At1g76010/T4O12_22 mRNA...    35   2.1     
pir|F96788|F96788 protein T4O12.22 [imported] - Arabidopsis thal...    35   2.1     Arabidopsis thaliana [mouse-ear cress]
gb:AF232689_2218917 Rat cytomegalovirus Maastricht, complete gen...    35   2.8     
gb:NCB9B11_1690394 Neurospora crassa DNA linkage group II BAC cl...    35   2.8     
sp|P17588|LRP1_HHV1F|LRP1_HHV1F Latency-related protein 1.>pir|A33337|WMBEL...    35   2.8     Human alphaherpesvirus 1
gb:HS1LSSDS_2437074 Herpes simplex virus type 1 latency-associat...    34   3.7     
gb:CR382130_1662862 Yarrowia lipolytica chromosome D of strain C...    34   3.7     
gb:AF066072_1237812 Dictyostelium discoideum SP85 (pspB) gene, p...    34   3.7     
gb:BC068016_2554985 Danio rerio zgc:76890, mRNA (cDNA clone MGC:...    34   4.8     
gb:AP002855_1823203 Oryza sativa (japonica cultivar-group) genom...    34   4.8     
gb:AF318582_1785616 Oryza sativa putative transcription factor O...    34   4.8     
gb:AF066073_1237813 Dictyostelium discoideum SP85 (pspB) gene, p...    34   4.8     
gb:BC067982_2554966 Xenopus tropicalis hypothetical protein MGC6...    33   6.2     
gb:BC048225_2550038 Xenopus laevis programmed cell death 4, mRNA...    33   6.2     
gb:AF410847_2252072 Ovine herpesvirus 2 latency associated antig...    33   6.2     
gb:AF232689_2218895 Rat cytomegalovirus Maastricht, complete gen...    33   6.2     
pir|S53404|S53404 ATP synthase regulatory factor homolog YLR327c...    33   6.2     Saccharomyces cerevisiae [brewer's yeast]
sp|Q06177|STFL_YEAST|STFL_YEAST STF2-like protein YLR327c.                        33   6.2     Saccharomyces cerevisiae [brewer's yeast]
gb:ATMAJ23_1553715 Arabidopsis thaliana DNA chromosome 5, P1 clo...    33   8.1     
gb:SDMA3APOP_1397385 Suberites domuncula mRNA for apoptosis gene...    33   8.1     


>gb:AF110226_1768767 Nicotiana tabacum nuclear RNA binding protein
           (RggA) mRNA, partial cds.
          Length = 299

 Score =  216 bits (551), Expect = 4e-55
 Identities = 125/235 (53%), Positives = 146/235 (62%), Gaps = 3/235 (1%)
 Frame = -3

Query: 937 NGDRRGGLSNGENADGE--YPRRAYERRSGTGRGSE-IKREGSGRGNWGSPTDEIAPEAE 767
           +G RRGG +NG+ A+GE   PRR ++RRSGTGRG+E IKREGSGRGNWG+P D+IA E E
Sbjct: 70  HGGRRGGFNNGDAAEGEGERPRRVFDRRSGTGRGNEYIKREGSGRGNWGTPADDIAQETE 129

Query: 766 EPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLLEEKR 587
            P    VNDG      EK+ GQE+A D  KDS             EMTL+EYEKL+EEKR
Sbjct: 130 VP----VNDGEKIVEAEKEAGQEEAEDTNKDSTAAEPEEKEPEEKEMTLEEYEKLMEEKR 185

Query: 586 KAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSXXXXXXXXXXXXXXXXKSIN 407
           KA+LA +PEERKV LDKE ESM LL+NKKNDDE+F+KLGS                +SIN
Sbjct: 186 KALLALKPEERKVNLDKELESMQLLSNKKNDDEIFIKLGS-EKEKRKEAVEKARKTQSIN 244

Query: 406 EFLKPAEGETXXXXXXXXXXXXXXXXXXXXXGNNTSSFETPSIEDVGQFPTLGSK 242
           EFLKPAEGE                           SF  PSIEDVGQFP+L +K
Sbjct: 245 EFLKPAEGENYSRRGGRGRGPGRGRGGFGGGVGGNKSFSAPSIEDVGQFPSLVAK 299



>gb:BVU313093_1643197 Beta vulgaris mRNA for salt tolerance protein
           2 (sato2 gene).
          Length = 356

 Score =  211 bits (536), Expect = 2e-53
 Identities = 124/232 (53%), Positives = 144/232 (62%), Gaps = 2/232 (0%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN 755
           G RRGG  NGE A+GE PRR YERRSGTGRG EIKREGSGRGNWGSPTDEIAPE EEP+ 
Sbjct: 131 GGRRGGYDNGEAAEGERPRRMYERRSGTGRGGEIKREGSGRGNWGSPTDEIAPETEEPV- 189

Query: 754 GVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLLEEKRKAIL 575
            V N+     A +K  G+ +  DA+K+S             EMTL+EYEK+LEEKRKA+L
Sbjct: 190 -VENEA--AVAADKPAGEGENVDAEKESQEKEVVEAEPEEKEMTLEEYEKVLEEKRKALL 246

Query: 574 ASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS--XXXXXXXXXXXXXXXXKSINEF 401
           + + EERKV LDKEFESM L++ KKNDDEVF+KLGS                   SINEF
Sbjct: 247 SLKGEERKVDLDKEFESMQLVSKKKNDDEVFIKLGSDKDKRKEAAEREERSKKSVSINEF 306

Query: 400 LKPAEGETXXXXXXXXXXXXXXXXXXXXXGNNTSSFETPSIEDVGQFPTLGS 245
           LKPAEG+                       NN S+   PSIED  QFP+LG+
Sbjct: 307 LKPAEGDGYHRRGRGRGRGGRGGYGGGYGMNNASA---PSIEDPNQFPSLGA 355



>gb:AF110228_1768769 Spinacia oleracea nuclear RNA binding protein A
           (RggA) mRNA, complete cds.
          Length = 356

 Score =  188 bits (477), Expect = 2e-46
 Identities = 115/234 (49%), Positives = 134/234 (57%), Gaps = 3/234 (1%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN 755
           G RRGG  NGE A+GE PRR YERRSGTGRG ++KREGSGRGNWG+P DEIA E EEP  
Sbjct: 126 GGRRGGFENGEAAEGERPRRTYERRSGTGRGGDVKREGSGRGNWGTPADEIAQETEEP-- 183

Query: 754 GVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLLEEKRKAIL 575
             V +     A EK  G+E A DA K++P            +MTL+EYEK+LEEKRKA+L
Sbjct: 184 -AVVENEAVVAAEKPAGEEVA-DAGKENPEKEAEEVEPEEKQMTLEEYEKVLEEKRKALL 241

Query: 574 ASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS--XXXXXXXXXXXXXXXXKSINEF 401
           A + EERKV +DK+FESM L   KK DDEVF++L S                   SINEF
Sbjct: 242 ALKAEERKVDVDKDFESMQLKTKKKVDDEVFIQLNSDKDKKKEAAEKEEKAKKSVSINEF 301

Query: 400 LKPAEGETXXXXXXXXXXXXXXXXXXXXXGNNTSSFET-PSIEDVGQFPTLGSK 242
           L+PAEG                       G    +  T P IED  QFPTLG K
Sbjct: 302 LRPAEGGDQYQRRGGRGRGGRGGRGGNGGGGYGMNHATAPKIEDPNQFPTLGGK 355



>gb:BVU313092_1643196 Beta vulgaris mRNA for salt tolerance protein
           1 (sato1 gene).
          Length = 356

 Score =  178 bits (451), Expect = 2e-43
 Identities = 114/233 (48%), Positives = 130/233 (55%), Gaps = 2/233 (0%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN 755
           G RR G +N E  DGE PRR YERRSGTGRGSEIKREG+GRGNWG+ +DE+AP  EE   
Sbjct: 130 GGRRDGFNNEEGRDGERPRRTYERRSGTGRGSEIKREGAGRGNWGAESDEVAPVTEEA-- 187

Query: 754 GVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLLEEKRKAIL 575
           G  N+       E     EDA D  K+              EMTL+EYEKLLEEKRKA+ 
Sbjct: 188 GEQNEKKLNP--ENLPAVEDAADGIKEGQPDETEEKEPEEKEMTLEEYEKLLEEKRKALS 245

Query: 574 ASRPEERKVCLDKEFESMALLANKKND-DEVFVKLGS-XXXXXXXXXXXXXXXXKSINEF 401
           A + EERKV +DK+FESM  L NKK D D VF+KLGS                  SINEF
Sbjct: 246 ALKAEERKVEVDKDFESMQQLINKKKDEDSVFIKLGSDKDKKKEAAEKEKVKKSVSINEF 305

Query: 400 LKPAEGETXXXXXXXXXXXXXXXXXXXXXGNNTSSFETPSIEDVGQFPTLGSK 242
           LKPAEG+                      GN   S   P+IED G+FPTLG K
Sbjct: 306 LKPAEGD--RYGGRGRGRGRGPRGGGYGGGNRMFSTSAPAIEDPGEFPTLGGK 356



>gb:AF110229_1768770 Spinacia oleracea nuclear RNA binding protein B
           (RggB) mRNA, partial cds.
          Length = 240

 Score =  177 bits (449), Expect = 3e-43
 Identities = 110/233 (47%), Positives = 131/233 (56%), Gaps = 2/233 (0%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN 755
           G RRGG +N E  DGE PRR +ERRSGTGRGSE+KREGSGRGNWG+ ++E+AP  EE   
Sbjct: 12  GGRRGGFNNEEGRDGERPRRTFERRSGTGRGSEVKREGSGRGNWGAESEEVAPVNEE--- 68

Query: 754 GVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLLEEKRKAIL 575
           GV     N ++ E     EDA    K+              EMTL+EYEKLLEEKRKA+L
Sbjct: 69  GVEQTEKNVNS-ENLTAVEDAAVGNKEGQPEEAEEKEPEEKEMTLEEYEKLLEEKRKALL 127

Query: 574 ASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS-XXXXXXXXXXXXXXXXKSINEFL 398
           A + EE KV +DKE ESM  L+ +++D  VF+KLGS                  SINEFL
Sbjct: 128 ALKSEEPKVVVDKELESMQQLSKQQDDSSVFIKLGSDKDKKKEALEKEKVKKSVSINEFL 187

Query: 397 KPAEGET-XXXXXXXXXXXXXXXXXXXXXGNNTSSFETPSIEDVGQFPTLGSK 242
           KPAEGE                       GN T S   P+I D G+FPTLG K
Sbjct: 188 KPAEGERFGGRGRGRGGRGSRGGEYGGGGGNRTYSAPAPAIGDPGEFPTLGGK 240



>pir|T12180|T12180 probable transcription factor - fava
           bean>gb:VFPTF1_1727183 V.faba mRNA for putative
           transciption factor (1556bp).
          Length = 370

 Score =  176 bits (445), Expect = 8e-43
 Identities = 108/236 (45%), Positives = 130/236 (55%), Gaps = 5/236 (2%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN 755
           G RRGG SNGE  +   PRRA+ER SGTGRGSE KR+G+GRGNWG+  DE+    +E   
Sbjct: 140 GGRRGGFSNGEGGEEGRPRRAFERHSGTGRGSEFKRDGAGRGNWGTEADEVTQVTDE--- 196

Query: 754 GVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLLEEKRKAIL 575
            VVN+       EK   + D  +  KD+P            EMTL+EYEKLLEEKRKA+ 
Sbjct: 197 -VVNEAEKNFGDEKPAAENDVAEGNKDTPANEAEEKEPEDKEMTLEEYEKLLEEKRKALQ 255

Query: 574 ASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS--XXXXXXXXXXXXXXXXKSINEF 401
           A + EERKV   KEFE+M  L+ KK++ E+F KLGS                   SINEF
Sbjct: 256 ALKTEERKVD-TKEFETMQALSCKKDNFEIFAKLGSDKDKRKEAFDKEEKAKKSVSINEF 314

Query: 400 LKPAEGE---TXXXXXXXXXXXXXXXXXXXXXGNNTSSFETPSIEDVGQFPTLGSK 242
           LKPAEGE                         GN+TS+   PSIED G FPTLG+K
Sbjct: 315 LKPAEGEGYYNQGGRGGRGRGRGTRGGFGGFRGNSTSNVPAPSIEDPGHFPTLGAK 370



>pir|F71435|F71435 probable nuclear antigen - Arabidopsis
           thaliana>gb:ATCHRIV45_1545485 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 45.>gb:ATFCA7_1551733
           Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
           fragment No. 7.>gb:AY063896_1565843 Arabidopsis thaliana
           putative nuclear antigen homolog (At4g16830) mRNA,
           complete cds.>gb:AY096500_1576042 Arabidopsis thaliana
           putative nuclear antigen-like protein (At4g16830) mRNA,
           complete cds.>gb:AY127018_1580472 Arabidopsis thaliana
           AT4g16830/dl4440w mRNA, complete
           cds.>gb:BT000559_1634837 Arabidopsis thaliana nuclear
           antigen homolog (At4g16830/dl4440w) mRNA, complete
           cds.>gb:AF110227_1768768 Arabidopsis thaliana nuclear
           RNA binding protein (RGGA) gene, complete cds.
          Length = 355

 Score =  162 bits (411), Expect = 7e-39
 Identities = 105/233 (45%), Positives = 126/233 (54%), Gaps = 2/233 (0%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN 755
           G RRGG SN E  DGE PRRA+ERRSGTGRGS+ KR+GSGRGNWG+P +EIA E E    
Sbjct: 131 GGRRGGFSN-EGGDGERPRRAFERRSGTGRGSDFKRDGSGRGNWGTPGEEIAAETE---- 185

Query: 754 GVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLLEEKRKAIL 575
            V       D  EK    + A DA K+  +           EMTLDEYEK+LEEK+KA+ 
Sbjct: 186 AVAGVETEKDVGEKPAVDDVAADANKEDTV--VEEKEPEDKEMTLDEYEKILEEKKKALQ 243

Query: 574 ASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSXXXXXXXXXXXXXXXXKSINEFLK 395
           +    ERKV   K FESM  L+NKK++DE+F+KLGS                 SINEFLK
Sbjct: 244 SLTTSERKVD-TKVFESMQQLSNKKSNDEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLK 302

Query: 394 PAEGETXXXXXXXXXXXXXXXXXXXXXGNNTS--SFETPSIEDVGQFPTLGSK 242
           PAEG                       G +    +   P+I D  QFP+LG K
Sbjct: 303 PAEGGNYYRGGRGGRGRGGRGRGGVSSGESGGYRNEAAPAIGDAAQFPSLGGK 355



>gb:AP003292_1827445 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0690B02.
          Length = 380

 Score =  162 bits (409), Expect = 1e-38
 Identities = 108/241 (44%), Positives = 132/241 (54%), Gaps = 9/241 (3%)
 Frame = -3

Query: 937 NGDRRGGLSNGENADGEY--PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAE 767
           +G RRGG  NGE  D     PRR YER SGTGRG E+KR+G+GRGNWG+ TDE +A E E
Sbjct: 141 HGGRRGGYRNGEYGDDSERPPRRNYERHSGTGRGYEMKRDGAGRGNWGTATDEALAQETE 200

Query: 766 EPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSP--LXXXXXXXXXXXEMTLDEYEKLLEE 593
           E +   V +  +    EKQ  Q+DA   +KD+               EMTL+E+EKL EE
Sbjct: 201 EALK--VEE--SAPIAEKQGEQDDAPTGEKDNKEGAANEEEEKEEDKEMTLEEFEKLREE 256

Query: 592 KRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS--XXXXXXXXXXXXXXXX 419
           KRKA+LA + EERKV +DK+ +SM  L+ KK +DE+F+KLGS                  
Sbjct: 257 KRKALLAFKAEERKVEVDKDLQSMQPLSTKKGNDEIFIKLGSDKDKKKENAERDERAKKS 316

Query: 418 KSINEFLKPAEGETXXXXXXXXXXXXXXXXXXXXXGNNTSSFET--PSIEDVGQFPTLGS 245
            SINEFLKPAEGE                      G     + T  PSIED  QFPTLG 
Sbjct: 317 VSINEFLKPAEGERYYGGRGRGRGRGDRGGRGYGGGYQRGPYSTSAPSIEDQAQFPTLGG 376

Query: 244 K 242
           K
Sbjct: 377 K 377



>gb:AF110230_1768771 Spinacia oleracea nuclear RNA binding protein C
           (RggC) mRNA, partial cds.
          Length = 247

 Score =  161 bits (407), Expect = 2e-38
 Identities = 95/186 (51%), Positives = 112/186 (60%), Gaps = 1/186 (0%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN 755
           G RRGG +N E  DGE PRR +ERRSGTGRGSE+K    G GNWG+ ++E+AP  EE   
Sbjct: 23  GGRRGGFNNEEGRDGERPRRTFERRSGTGRGSEVKHRVLGAGNWGAESEEVAPVNEE--- 79

Query: 754 GVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLLEEKRKAIL 575
           GV     N ++ E     EDA    K+              EMTL+EYEKLLEEKRKA+L
Sbjct: 80  GVEQTEKNVNS-ENLTAVEDAAVGNKEGQPEEAEEKEPEEKEMTLEEYEKLLEEKRKALL 138

Query: 574 ASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS-XXXXXXXXXXXXXXXXKSINEFL 398
           A + EE KV +DKE ESM  L+NKK+DD VF+KLGS                  SINEFL
Sbjct: 139 ALKSEEPKVVVDKELESMQQLSNKKDDDSVFIKLGSDKDKKKEALEKEKVKKSVSINEFL 198

Query: 397 KPAEGE 380
           KPAEGE
Sbjct: 199 KPAEGE 204



>gb:AY084828_1569911 Arabidopsis thaliana clone 118826 mRNA,
           complete sequence.
          Length = 354

 Score =  158 bits (400), Expect = 1e-37
 Identities = 103/233 (44%), Positives = 125/233 (53%), Gaps = 2/233 (0%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN 755
           G RRGG SN E  +GE PRR YERRSGTGRGS+ KR+GSGRGNWG+P +EIA E E    
Sbjct: 130 GGRRGGFSN-EGGEGERPRRTYERRSGTGRGSDFKRDGSGRGNWGTPGEEIAAETE---- 184

Query: 754 GVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLLEEKRKAIL 575
            V       D  EK    + A DA K++ +           EMTLDEYEK+LEEK+KA+ 
Sbjct: 185 AVAGVETQKDVGEKPAVDDVAADANKENTV--VEEKEPEDKEMTLDEYEKILEEKKKALQ 242

Query: 574 ASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSXXXXXXXXXXXXXXXXKSINEFLK 395
           +    ERKV   K FESM  L+NKK++DE+F+KLGS                 SINEFLK
Sbjct: 243 SLTTSERKVD-TKVFESMQQLSNKKSNDEIFIKLGSDKDKRKDDKEEKAKKAVSINEFLK 301

Query: 394 PAEGETXXXXXXXXXXXXXXXXXXXXXGNNTS--SFETPSIEDVGQFPTLGSK 242
           PA G                       G +    +   P+I D  QFP+LG K
Sbjct: 302 PAGGGDYYRGGRGGRGRGGRGRGGVSSGESGGYRNEAAPAIGDAAQFPSLGGK 354



>gb:AC105260_1737884 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1115_D04, complete
           sequence.>gb:AC136216_1742992 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBa0022J22,
           complete sequence.
          Length = 383

 Score =  158 bits (399), Expect = 2e-37
 Identities = 104/242 (42%), Positives = 128/242 (52%), Gaps = 11/242 (4%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEY--PRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEE 764
           G RRGG S+G++ D +Y  PRRAYER SGTGRG E+KREGSGRGNWG+ TDE +A E  E
Sbjct: 143 GGRRGGYSDGQSGD-DYGRPRRAYERHSGTGRGYELKREGSGRGNWGTVTDEGLAQEVAE 201

Query: 763 PINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLLEEKRK 584
            +N         D  + +   +   D  K+SP            EMTL+EYEK+LEEKRK
Sbjct: 202 AVNTEEAPATAEDEKKPEDVPQSEVDKDKESPENEEEEKEPEDKEMTLEEYEKVLEEKRK 261

Query: 583 AILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS---XXXXXXXXXXXXXXXXKS 413
           A+LA + EERKV +DKE ++M  L+ KK ++EVF+KLGS                    S
Sbjct: 262 ALLALKAEERKVEVDKELQAMQQLSVKKANEEVFIKLGSDKDLKKKEKDEKDERTKKSLS 321

Query: 412 INEFLKPAEGET-----XXXXXXXXXXXXXXXXXXXXXGNNTSSFETPSIEDVGQFPTLG 248
           INEFLKPAEGE                                    P IED  QFP+LG
Sbjct: 322 INEFLKPAEGERYYNPGRGRGRGRGRGDRGGFYGGYNGNGGRRQAAAPVIEDQAQFPSLG 381

Query: 247 SK 242
            K
Sbjct: 382 GK 383



>gb:AP003022_1824290 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0681B11.>gb:AP003330_1828026 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:B1085F01.
          Length = 378

 Score =  156 bits (395), Expect = 5e-37
 Identities = 102/239 (42%), Positives = 128/239 (53%), Gaps = 8/239 (3%)
 Frame = -3

Query: 934 GDRRGGLSNGENAD--GEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE-IAPEAEE 764
           G RRGG + GE  D  G  P RAYERRSGTGRG  +KREG+GRGNWG+ TDE +A E+ E
Sbjct: 137 GGRRGGYTGGEAGDESGRAPHRAYERRSGTGRGYGMKREGAGRGNWGTVTDEALAQESGE 196

Query: 763 PINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLLEEKRK 584
            ++  V+  V  +  ++   Q D  +  K+              EMTL+EYEK+LEEKRK
Sbjct: 197 AVSIEVSVTVTEENKQEDVPQSDEVEKHKEGESNEEEEKEPEDKEMTLEEYEKVLEEKRK 256

Query: 583 AILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS--XXXXXXXXXXXXXXXXKSI 410
           A+L+ + EERKV +DKE +SM  L+ KK+ DEVF+KLGS                   SI
Sbjct: 257 ALLSLKVEERKVVVDKELQSMQQLSVKKDSDEVFIKLGSDKDKKKENVERDERTRKSLSI 316

Query: 409 NEFLKPAEGETXXXXXXXXXXXXXXXXXXXXXGNNTSS---FETPSIEDVGQFPTLGSK 242
           NEFLKPAEGE                       +  SS      P IED  QFP L  +
Sbjct: 317 NEFLKPAEGERYYSPGGRGRGRGRGRGDRGGFRDGYSSRGPVAAPRIEDQAQFPGLAGR 375



>gb:AY085859_1570923 Arabidopsis thaliana clone 19104 mRNA, complete
           sequence.
          Length = 357

 Score =  152 bits (384), Expect = 9e-36
 Identities = 97/234 (41%), Positives = 125/234 (53%), Gaps = 5/234 (2%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN 755
           G RRGG++NGE+ D E P R Y+R S TG G+ +KR G GRGNWG+  D+I P +EEP  
Sbjct: 130 GPRRGGVANGESGDVERPPRNYDRHSRTGHGTGMKRNGGGRGNWGTTEDDIPPTSEEPTT 189

Query: 754 GVVNDGVNTDAFEKQHGQEDAGDAKKD---SPLXXXXXXXXXXXEMTLDEYEKLLEEKRK 584
            V    V     EKQ G+++  +AKK+                 EMTL+EYEK+LEEK+K
Sbjct: 190 EVEKSPV----AEKQGGEDETPEAKKELTAEEKAQKEAEEAEAREMTLEEYEKILEEKKK 245

Query: 583 AILASRPEERKVCLDKEFESMALLANKKN-DDEVFVKLGSXXXXXXXXXXXXXXXXKSIN 407
           A+ A++ EERKV   K FESM  L+NKKN D+E+F+KLGS                 SIN
Sbjct: 246 ALQATKVEERKVD-TKVFESMQQLSNKKNTDEEIFIKLGS-DKEKRKDATEKAKKSLSIN 303

Query: 406 EFLKPAEGETXXXXXXXXXXXXXXXXXXXXXGNN-TSSFETPSIEDVGQFPTLG 248
           EFLKPA+G+                                P+I D  QFP+LG
Sbjct: 304 EFLKPADGKRYNGRGGGSRGRGGRGGRGEGGNQRYAKEAAAPAIGDTAQFPSLG 357



>gb:AB018117_1513849 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MQL5.>gb:AY140040_1582480 Arabidopsis thaliana
           putative protein (At5g47210) mRNA, complete
           cds.>gb:BT010371_1640317 Arabidopsis thaliana At5g47210
           mRNA, complete cds.
          Length = 357

 Score =  152 bits (384), Expect = 9e-36
 Identities = 97/234 (41%), Positives = 125/234 (53%), Gaps = 5/234 (2%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN 755
           G RRGG++NGE+ D E P R Y+R S TG G+ +KR G GRGNWG+  D+I P +EEP  
Sbjct: 130 GPRRGGVANGESGDVERPPRNYDRHSRTGHGTGMKRNGGGRGNWGTTEDDIPPTSEEPTT 189

Query: 754 GVVNDGVNTDAFEKQHGQEDAGDAKKD---SPLXXXXXXXXXXXEMTLDEYEKLLEEKRK 584
            V    V     EKQ G+++  +AKK+                 EMTL+EYEK+LEEK+K
Sbjct: 190 EVEKSPV----AEKQGGEDETPEAKKELTAEEKAQKEAEEAEAREMTLEEYEKILEEKKK 245

Query: 583 AILASRPEERKVCLDKEFESMALLANKKN-DDEVFVKLGSXXXXXXXXXXXXXXXXKSIN 407
           A+ A++ EERKV   K FESM  L+NKKN D+E+F+KLGS                 SIN
Sbjct: 246 ALQATKVEERKVD-TKVFESMQQLSNKKNTDEEIFIKLGS-DKEKRKDATEKAKKSLSIN 303

Query: 406 EFLKPAEGETXXXXXXXXXXXXXXXXXXXXXGNN-TSSFETPSIEDVGQFPTLG 248
           EFLKPA+G+                                P+I D  QFP+LG
Sbjct: 304 EFLKPADGKRYNGRGGGSRGRGGRGGRGEGGNQRYAKEAAAPAIGDTAQFPSLG 357



>gb:AY087413_1572444 Arabidopsis thaliana clone 35156 mRNA, complete
           sequence.
          Length = 360

 Score =  147 bits (370), Expect = 4e-34
 Identities = 88/188 (46%), Positives = 118/188 (62%), Gaps = 2/188 (1%)
 Frame = -3

Query: 934 GDRRGGLSNG-ENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPI 758
           GDRRG  SNG ++ D E PR+ Y+R S T  G+E KR+G+GR NWG+P D+I P  EE  
Sbjct: 118 GDRRGSYSNGGDSGDSERPRKNYDRHSRTAYGNEEKRDGAGRANWGTPQDDITPVTEES- 176

Query: 757 NGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLLEEKRKAI 578
             VV+  +     EKQ G+ +A DAK ++P            EMTL+EYEK+LEEK+KA+
Sbjct: 177 TAVVDKNLTV---EKQDGEGEATDAKNETP-AEKAEEKPEDKEMTLEEYEKVLEEKKKAL 232

Query: 577 LASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSXXXXXXXXXXXXXXXXKSINEF 401
            A++ EERKV   K FE+M  L++KK N+DEVF+KLG+                 SINEF
Sbjct: 233 QATKVEERKVDT-KAFEAMQQLSSKKSNNDEVFIKLGTEKDKRITEREEKTRKSLSINEF 291

Query: 400 LKPAEGET 377
           LKPA+G++
Sbjct: 292 LKPADGKS 299



>gb:AC121365_1740192 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0053E05, complete sequence.
          Length = 390

 Score =  144 bits (364), Expect = 2e-33
 Identities = 96/237 (40%), Positives = 124/237 (52%), Gaps = 6/237 (2%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN 755
           G RRGG   G++++    RR YER SGTGRG E+KREGSGRGNWG+ TDEI  +      
Sbjct: 157 GGRRGGY--GDDSE-RMSRRPYERHSGTGRGYEMKREGSGRGNWGTTTDEILAQETGEAL 213

Query: 754 GVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLLEEKRKAIL 575
            +      T+      G   A + K +  +           EMTL+E+EKL EEKRKA+L
Sbjct: 214 KLDEKAPVTEKQGAPEGAPQADENKDNKDVTPNEEEKEEDKEMTLEEFEKLREEKRKALL 273

Query: 574 ASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGSXXXX----XXXXXXXXXXXXKSIN 407
           + + EERKV +DK+ +SM  L+NKK +DEVF+KLGS                     SIN
Sbjct: 274 SLKTEERKVEIDKDLKSMQPLSNKKENDEVFIKLGSDKDALKKKENAERDERAKKSVSIN 333

Query: 406 EFLKPAEGET--XXXXXXXXXXXXXXXXXXXXXGNNTSSFETPSIEDVGQFPTLGSK 242
           EFLKPAEGE                        G+ +++   P I+D  QFPTLG K
Sbjct: 334 EFLKPAEGERYYGGRGRGRGRGDRGGFRGGYGEGHRSAAPPAPEIKDQSQFPTLGRK 390



>pir|G71444|G71444 hypothetical protein - Arabidopsis
           thaliana>gb:ATCHRIV46_1545554 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 46.>gb:ATFCA8_1551802
           Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
           fragment No. 8.>gb:AY057494_1563913 Arabidopsis thaliana
           AT4g17520/dl4795w mRNA, complete
           cds.>gb:AY081262_1568608 Arabidopsis thaliana unknown
           protein (At4g17520) mRNA, complete
           cds.>gb:BT001153_1635408 Arabidopsis thaliana unknown
           protein (At4g17520) mRNA, complete cds.
          Length = 360

 Score =  144 bits (362), Expect = 3e-33
 Identities = 87/188 (46%), Positives = 117/188 (62%), Gaps = 2/188 (1%)
 Frame = -3

Query: 934 GDRRGGLSNG-ENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPI 758
           GDRRG  SNG ++ D E PR+ Y+R S T  G+E KR+G+GR NWG+  D+I P  EE  
Sbjct: 118 GDRRGSYSNGGDSGDSERPRKNYDRHSRTAYGNEDKRDGAGRANWGTTQDDITPVTEES- 176

Query: 757 NGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLLEEKRKAI 578
             VV+  +     EKQ G+ +A DAK ++P            EMTL+EYEK+LEEK+KA+
Sbjct: 177 TAVVDKNLTV---EKQDGEGEATDAKNETP-AEKAEEKPEDKEMTLEEYEKVLEEKKKAL 232

Query: 577 LASRPEERKVCLDKEFESMALLANKK-NDDEVFVKLGSXXXXXXXXXXXXXXXXKSINEF 401
            A++ EERKV   K FE+M  L++KK N+DEVF+KLG+                 SINEF
Sbjct: 233 QATKVEERKVDT-KAFEAMQQLSSKKSNNDEVFIKLGTEKDKRITEREEKTRKSLSINEF 291

Query: 400 LKPAEGET 377
           LKPA+G++
Sbjct: 292 LKPADGKS 299



>gb:AY560385_1614903 Tagetes minuta thermoinhibition-associated
           THB-4 protein mRNA, partial cds.
          Length = 115

 Score = 80.1 bits (196), Expect = 6e-14
 Identities = 44/85 (51%), Positives = 55/85 (64%), Gaps = 2/85 (2%)
 Frame = -3

Query: 628 MTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDEVFVKLGS--XXXX 455
           MTL+EY+K+LEEKRKA+   + EERKV +DKE  SM  L+NKK++DE+F KLG+      
Sbjct: 17  MTLEEYQKVLEEKRKALETLKTEERKVEVDKELASMQQLSNKKSNDEIFAKLGTDKDKRK 76

Query: 454 XXXXXXXXXXXXKSINEFLKPAEGE 380
                        SINEFLKPA GE
Sbjct: 77  ELAEKEERAKKSLSINEFLKPAAGE 101



>gb:AC092852_1735785 Oryza sativa chromosome 3 BAC OSJNBa0032G11
           genomic sequence, complete sequence.
          Length = 642

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 40/113 (35%), Positives = 58/113 (51%)
 Frame = -3

Query: 718 EKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLLEEKRKAILASRPEERKVCLD 539
           +K+H  + +G  +K++             +MTL+EYEK+LEEKRKA+  S+ E RKV  +
Sbjct: 246 KKKHDSKVSGKTEKEAE-KAEVLKEEERKDMTLEEYEKVLEEKRKALEDSKSEGRKVTAE 304

Query: 538 KEFESMALLANKKNDDEVFVKLGSXXXXXXXXXXXXXXXXKSINEFLKPAEGE 380
             FE M LL  KK DDE   K                    ++N+ LKPA+G+
Sbjct: 305 -VFEGMQLLEKKKLDDENASKKAENEQRKEPAKQVKAPKAINLNDLLKPADGQ 356



>gb:AP003292_1827446 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0690B02.
          Length = 101

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 37/98 (37%), Positives = 42/98 (42%), Gaps = 4/98 (4%)
 Frame = -3

Query: 523 MALLANKKNDDEVFVKLGSXXXXXXXXXXXXXXX--XKSINEFLKPAEGETXXXXXXXXX 350
           M  L+ KK +DE+F+KLGS                   SINEFLKPAEGE          
Sbjct: 1   MQPLSTKKGNDEIFIKLGSDKDKKKENAERDERAKKSVSINEFLKPAEGERYYGGRGRGR 60

Query: 349 XXXXXXXXXXXXGNNTSSFET--PSIEDVGQFPTLGSK 242
                       G     + T  PSIED  QFPTLG K
Sbjct: 61  GRGDRGGRGYGGGYQRGPYSTSAPSIEDQAQFPTLGGK 98



>gb:BC067912_2554898 Xenopus tropicalis hypothetical protein
           MGC69561, mRNA (cDNA clone MGC:69561 IMAGE:5379016),
           complete cds.
          Length = 406

 Score = 50.1 bits (118), Expect = 6e-05
 Identities = 34/127 (26%), Positives = 60/127 (47%), Gaps = 8/127 (6%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGS--------EIKREGSGRGNWGSPTDEIA 779
           G R  GL  G+  D    +R ++R SG+ R S        E KR GSG  NWG+  DE++
Sbjct: 188 GGRGRGLGRGDGFDSR-GKREFDRHSGSDRASSHFSGPKHEDKRGGSGSHNWGTVKDELS 246

Query: 778 PEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLL 599
              +  +     +     A + ++ + +A + K++ P            EMTLDE++ + 
Sbjct: 247 ELDQSAVTEETPETEEHPAVDSENKENEAEEVKEEGP-----------KEMTLDEWKAMQ 295

Query: 598 EEKRKAI 578
           +++R  +
Sbjct: 296 DKERSKV 302



>gb:AE014297_1141336 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE014297_1141337 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE003750_1223329
           Drosophila melanogaster chromosome 3R, section 88 of 118
           of the complete sequence.>gb:AE003750_1223330 Drosophila
           melanogaster chromosome 3R, section 88 of 118 of the
           complete sequence.>gb:AY052117_1290711 Drosophila
           melanogaster SD06613 full length cDNA.
          Length = 412

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 43/155 (27%), Positives = 68/155 (43%), Gaps = 5/155 (3%)
 Frame = -3

Query: 940 SNGDRRGG--LSNGENADGEYPRRAYERRSG---TGRGSEIKREGSGRGNWGSPTDEIAP 776
           +N D RG   +  GE    ++ +R ++R+SG   TG  S  KREG G  NWGSP  +I  
Sbjct: 127 NNRDNRGPPRVRTGE----KFGKREFDRQSGSDRTGVKSIDKREGGGAHNWGSPKQDI-- 180

Query: 775 EAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLLE 596
                      D   T     Q  +ED+ + +   P            +MTLDE++ L +
Sbjct: 181 ----------EDLKTTGETSPQAEKEDSANEQSADP--AVAAEEDESKQMTLDEWKALRD 228

Query: 595 EKRKAILASRPEERKVCLDKEFESMALLANKKNDD 491
           ++ K     R        + E++ M +L+ KK  +
Sbjct: 229 QRAKPNYNLRKAGEGAADNAEWKKMIVLSKKKESN 263



>gb:AE014297_1141335 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003750_1223328 Drosophila melanogaster
           chromosome 3R, section 88 of 118 of the complete
           sequence.
          Length = 443

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 43/155 (27%), Positives = 68/155 (43%), Gaps = 5/155 (3%)
 Frame = -3

Query: 940 SNGDRRGG--LSNGENADGEYPRRAYERRSG---TGRGSEIKREGSGRGNWGSPTDEIAP 776
           +N D RG   +  GE    ++ +R ++R+SG   TG  S  KREG G  NWGSP  +I  
Sbjct: 158 NNRDNRGPPRVRTGE----KFGKREFDRQSGSDRTGVKSIDKREGGGAHNWGSPKQDI-- 211

Query: 775 EAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLLE 596
                      D   T     Q  +ED+ + +   P            +MTLDE++ L +
Sbjct: 212 ----------EDLKTTGETSPQAEKEDSANEQSADP--AVAAEEDESKQMTLDEWKALRD 259

Query: 595 EKRKAILASRPEERKVCLDKEFESMALLANKKNDD 491
           ++ K     R        + E++ M +L+ KK  +
Sbjct: 260 QRAKPNYNLRKAGEGAADNAEWKKMIVLSKKKESN 294



>gb:FRU90880_2572185 Takifugu rubripes isotocin and vasotocin locus.
          Length = 361

 Score = 46.6 bits (109), Expect = 7e-04
 Identities = 45/155 (29%), Positives = 65/155 (41%), Gaps = 2/155 (1%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN 755
           G RRGG +   +      +R Y+R +GTG   + KR G G  NWG   DE A E  E   
Sbjct: 142 GGRRGGNARSSDNFNIRGKREYDRHNGTGISPDEKRGGRGPWNWGC-VDEAASELME--- 197

Query: 754 GVVNDGVNTDAFEKQHGQEDAGDAKKDSPL-XXXXXXXXXXXEMTLDEYEKLLEEKR-KA 581
                 V +D  + +  Q    D  ++  +            EM+LDE++ L E  R KA
Sbjct: 198 ------VTSDVLKSEEPQVPVEDGTQNQSVEEDGEMVVQVAMEMSLDEWKALQEMSRPKA 251

Query: 580 ILASRPEERKVCLDKEFESMALLANKKNDDEVFVK 476
               R  E K+       S A + ++    E FV+
Sbjct: 252 EFNIRKAENKI------PSKAKVIHQSRQPEKFVE 280



>gb:BC013665_2091879 Mus musculus RIKEN cDNA 1200009K13 gene, mRNA
           (cDNA clone MGC:18794 IMAGE:4193513), complete
           cds.>gb:BC030502_2096836 Mus musculus RIKEN cDNA
           1200009K13 gene, mRNA (cDNA clone MGC:40621
           IMAGE:5401573), complete cds.
          Length = 386

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 31/122 (25%), Positives = 55/122 (45%), Gaps = 3/122 (2%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGS---EIKREGSGRGNWGSPTDEIAPEAEE 764
           G R  G+  G+  D    +R ++R SG+ R     E KR GSG  NWG+  DE+    + 
Sbjct: 173 GGRGRGMGRGDGFDSR-GKREFDRHSGSDRSGLKHEDKRGGSGSHNWGTVKDELTDLDQS 231

Query: 763 PINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLLEEKRK 584
            +     +G      + ++ + +  + K++ P            EMTLDE++ +  + R 
Sbjct: 232 NVTEETPEGEEHPVADTENKENEVEEVKEEGP-----------KEMTLDEWKAIQNKDRA 280

Query: 583 AI 578
            +
Sbjct: 281 KV 282



>gb:AK088278_1175304 Mus musculus 2 days neonate thymus thymic cells
           cDNA, RIKEN full-length enriched library,
           clone:E430009L23 product:HYPOTHETICAL RNA BINDING
           PROTEIN RDA288 homolog [Rattus norvegicus], full insert
           sequence.
          Length = 386

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 31/122 (25%), Positives = 55/122 (45%), Gaps = 3/122 (2%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGS---EIKREGSGRGNWGSPTDEIAPEAEE 764
           G R  G+  G+  D    +R ++R SG+ R     E KR GSG  NWG+  DE+    + 
Sbjct: 173 GGRGRGMGRGDGFDSR-GKREFDRHSGSDRSGLKHEDKRGGSGSHNWGTVKDELTDLDQS 231

Query: 763 PINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLLEEKRK 584
            +     +G      + ++ + +  + K++ P            EMTLDE++ +  + R 
Sbjct: 232 NVTEETPEGEEHPVADTENKENEVEEVKEEGP-----------KEMTLDEWKAIQNKDRA 280

Query: 583 AI 578
            +
Sbjct: 281 KV 282



>gb:BC079337_2107458 Rattus norvegicus PAI-1 mRNA-binding protein,
           mRNA (cDNA clone MGC:94773 IMAGE:7106027), complete cds.
          Length = 392

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 32/128 (25%), Positives = 56/128 (43%), Gaps = 9/128 (7%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGS---------EIKREGSGRGNWGSPTDEI 782
           G R  G+  G+  D    +R ++R SG+ R S         E KR GSG  NWG+  DE+
Sbjct: 173 GGRGRGMGRGDGFDSR-GKREFDRHSGSDRSSFSHYSGLKHEDKRGGSGSHNWGTVKDEL 231

Query: 781 APEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKL 602
               +  +     +G      + ++ + +  + K++ P            EMTLDE++ +
Sbjct: 232 TDLEQSNVTEETPEGEEHPVADTENKENEVEEVKEEGP-----------KEMTLDEWKAI 280

Query: 601 LEEKRKAI 578
             + R  +
Sbjct: 281 QNKDRAKV 288



>gb:AF388527_2064691 Rattus norvegicus hypothetical RNA binding
           protein RDA288 mRNA, complete cds.
          Length = 392

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 32/128 (25%), Positives = 56/128 (43%), Gaps = 9/128 (7%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGS---------EIKREGSGRGNWGSPTDEI 782
           G R  G+  G+  D    +R ++R SG+ R S         E KR GSG  NWG+  DE+
Sbjct: 173 GGRGRGMGRGDGFDSR-GKREFDRHSGSDRSSFSHYSGLKHEDKRGGSGSHNWGTVKDEL 231

Query: 781 APEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKL 602
               +  +     +G      + ++ + +  + K++ P            EMTLDE++ +
Sbjct: 232 TDLEQSNVTEETPEGEEHPVADTENKENEVEEVKEEGP-----------KEMTLDEWKAI 280

Query: 601 LEEKRKAI 578
             + R  +
Sbjct: 281 QNKDRAKV 288



>gb:AK010860_1156036 Mus musculus 13 days embryo liver cDNA, RIKEN
           full-length enriched library, clone:2500003B06
           product:HYPOTHETICAL RNA BINDING PROTEIN RDA288 homolog
           [Rattus norvegicus], full insert
           sequence.>gb:BC086209_2564789 Xenopus laevis
           hypothetical LOC495657, mRNA (cDNA clone MGC:98687
           IMAGE:7200835), complete cds.
          Length = 392

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 32/128 (25%), Positives = 56/128 (43%), Gaps = 9/128 (7%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGS---------EIKREGSGRGNWGSPTDEI 782
           G R  G+  G+  D    +R ++R SG+ R S         E KR GSG  NWG+  DE+
Sbjct: 173 GGRGRGMGRGDGFDSR-GKREFDRHSGSDRSSFSHYSGLKHEDKRGGSGSHNWGTVKDEL 231

Query: 781 APEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKL 602
               +  +     +G      + ++ + +  + K++ P            EMTLDE++ +
Sbjct: 232 TDLDQSNVTEETPEGEEHPVADTENKENEVEEVKEEGP-----------KEMTLDEWKAI 280

Query: 601 LEEKRKAI 578
             + R  +
Sbjct: 281 QNKDRAKV 288



>gb:BC083399_2563226 Danio rerio zgc:103482, mRNA (cDNA clone
           MGC:103482 IMAGE:7237781), complete cds.
          Length = 347

 Score = 44.3 bits (103), Expect = 0.004
 Identities = 33/110 (30%), Positives = 47/110 (42%), Gaps = 9/110 (8%)
 Frame = -3

Query: 880 RRAYERRSGTGRGS---EIKREGSGRGNWGSPTDEI------APEAEEPINGVVNDGVNT 728
           +R +ER SG+ R S   E KR GSG  NWGS  D +      +P  E   N    + V T
Sbjct: 153 KREFERHSGSDRSSVRSEEKRSGSGSRNWGSVRDHMSVIEVASPSEEVTENEETQEAVET 212

Query: 727 DAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLLEEKRKAI 578
           D   +    E+  +   +               MTLDE++ L E+ R  +
Sbjct: 213 DGENRPSETEEVIEVAME---------------MTLDEWKALQEQSRPKV 247



>gb:BC059961_2552741 Xenopus laevis hypothetical protein MGC68500,
           mRNA (cDNA clone MGC:68500 IMAGE:4030568), complete cds.
          Length = 404

 Score = 43.9 bits (102), Expect = 0.005
 Identities = 33/118 (27%), Positives = 51/118 (43%), Gaps = 2/118 (1%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRG--SEIKREGSGRGNWGSPTDEIAPEAEEP 761
           G  RGG       D    +R ++R SG+ R    E KR GSG  NWGS  +  +     P
Sbjct: 195 GRGRGGFPRNTENDNLRGKREFDRHSGSDRAIRPEDKRGGSGPRNWGSIKEAFSEIEAIP 254

Query: 760 INGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLLEEKR 587
           +   +     T+A E++H +    + K +              EM+LDE+  L ++ R
Sbjct: 255 VEEQIETTETTEATEEEHAK--VPEEKNEG----------FSQEMSLDEWRSLQDQNR 300



>gb:BC046574_2549633 Xenopus laevis hypothetical protein MGC53445,
           mRNA (cDNA clone MGC:53445 IMAGE:5571963), complete cds.
          Length = 392

 Score = 43.9 bits (102), Expect = 0.005
 Identities = 37/140 (26%), Positives = 62/140 (44%), Gaps = 19/140 (13%)
 Frame = -3

Query: 940 SNGDRRGGLSNGENADGEYPRRAYERRSGTGRGS--------EIKREGSGRGNWGSPTDE 785
           + G R  GL  G+  D    +R ++R SG+ R S        E KR GSG  NWG+  DE
Sbjct: 173 ARGGRGRGLGRGDGFDSR-GKREFDRHSGSDRVSSHFSGPKHEDKRGGSGPHNWGNVKDE 231

Query: 784 I-----------APEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXX 638
           +           APE E+P            A + ++ + ++ + K++            
Sbjct: 232 LSELDQSAVTEEAPETEQP------------AVDSENKENESEEVKEEG----------- 268

Query: 637 XXEMTLDEYEKLLEEKRKAI 578
             EMTLDE++ + +++R  +
Sbjct: 269 AKEMTLDEWKAMQDKERSKV 288



>gb:BC046876_2549775 Danio rerio zgc:55489, mRNA (cDNA clone
           MGC:55489 IMAGE:2640661), complete
           cds.>gb:BC068350_2555038 Danio rerio zgc:55489, mRNA
           (cDNA clone MGC:85661 IMAGE:6960084), complete cds.
          Length = 391

 Score = 43.5 bits (101), Expect = 0.006
 Identities = 30/121 (24%), Positives = 58/121 (47%), Gaps = 2/121 (1%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRG--SEIKREGSGRGNWGSPTDEIAPEAEEP 761
           G R  G+   +  D    +R ++R SG+ R   +E KR GSG  NWG+  DE++   +  
Sbjct: 175 GGRGRGVGRTDGFDSR-GKREFDRHSGSDRSLKAEEKRGGSGSHNWGTVKDELSELDQSN 233

Query: 760 INGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLLEEKRKA 581
           +     +G      + ++ + +  +AK++ P            EM+LDE++   +++R  
Sbjct: 234 VTEDTPEGEEHPPADSENKENEVEEAKEEGP-----------KEMSLDEWKAQQDKERAK 282

Query: 580 I 578
           +
Sbjct: 283 V 283



>gb:HSM807283_1187834 Homo sapiens mRNA; cDNA DKFZp686P17171 (from
           clone DKFZp686P17171).
          Length = 387

 Score = 42.0 bits (97), Expect = 0.018
 Identities = 31/123 (25%), Positives = 56/123 (45%), Gaps = 4/123 (3%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGS---EIKREGSGRGNWGSPTDEIAPEAEE 764
           G R  G+  G+  D    +R ++R SG+ R     E KR GSG  NWG+  DE+    + 
Sbjct: 173 GGRGRGMGRGDGFDSR-GKREFDRHSGSDRSGLKHEDKRGGSGSHNWGTVKDELTDLDQS 231

Query: 763 PINGVVNDG-VNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLLEEKR 587
            +     +G  +    + ++ + +  + K++ P            EMTLDE++ +  + R
Sbjct: 232 NVTEETPEGEEHHPVADTENKENEVEEVKEEGP-----------KEMTLDEWKAIQNKDR 280

Query: 586 KAI 578
             +
Sbjct: 281 AKV 283



>pir|T12456|T12456 hypothetical protein DKFZp564M2423.1 -
           human>gb:HSM800628_1185885 Homo sapiens mRNA; cDNA
           DKFZp564M2423 (from clone
           DKFZp564M2423).>gb:AL590559_1929698 Human DNA sequence
           from clone RP11-393N21 on chromosome 1 Contains the 5'
           end of the gene for PAI-1 mRNA-binding protein
           (PAI-RBP1), a poly(A) binding protein, cytoplasmic 4
           (PABPC4) pseudogene, a novel gene and a CpG island,
           complete sequence.>gb:BC017449_1976120 Homo sapiens
           PAI-1 mRNA-binding protein, mRNA (cDNA clone MGC:15923
           IMAGE:3535655), complete cds.>gb:CR457383_1993590 Homo
           sapiens full open reading frame cDNA clone
           RZPDo834C0614D for gene PAI-RBP1, PAI-1 mRNA-binding
           protein; complete cds, incl. stopcodon.
          Length = 387

 Score = 42.0 bits (97), Expect = 0.018
 Identities = 31/123 (25%), Positives = 56/123 (45%), Gaps = 4/123 (3%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGS---EIKREGSGRGNWGSPTDEIAPEAEE 764
           G R  G+  G+  D    +R ++R SG+ R     E KR GSG  NWG+  DE+    + 
Sbjct: 173 GGRGRGMGRGDGFDSR-GKREFDRHSGSDRSGLKHEDKRGGSGSHNWGTVKDELTDLDQS 231

Query: 763 PINGVVNDG-VNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLLEEKR 587
            +     +G  +    + ++ + +  + K++ P            EMTLDE++ +  + R
Sbjct: 232 NVTEETPEGEEHHPVADTENKENEVEEVKEEGP-----------KEMTLDEWKAIQNKDR 280

Query: 586 KAI 578
             +
Sbjct: 281 AKV 283



>pir|D88042|D88042 protein F56D12.5 [imported] - Caenorhabditis
           elegans>gb:AF016672_1232685 Caenorhabditis elegans
           cosmid F56D12, complete sequence.
          Length = 378

 Score = 41.6 bits (96), Expect = 0.023
 Identities = 23/55 (41%), Positives = 30/55 (54%), Gaps = 3/55 (5%)
 Frame = -3

Query: 922 GGLSNGENADGEYPRRAYERRSG---TGRGSEIKREGSGRGNWGSPTDEIAPEAE 767
           GG S G         R ++R+SG   TG  S  K++G G+GNWG   DE+A E E
Sbjct: 163 GGPSGGRGGGRGGRGRQFDRQSGSDRTGVRSFDKKDGHGKGNWGDQKDELAGETE 217



>gb:AY032853_1934539 Homo sapiens CGI-55 mRNA, partial cds.
          Length = 309

 Score = 41.2 bits (95), Expect = 0.030
 Identities = 32/129 (24%), Positives = 57/129 (44%), Gaps = 10/129 (7%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGS---------EIKREGSGRGNWGSPTDEI 782
           G R  G+  G+  D    +R ++R SG+ R S         E KR GSG  NWG+  DE+
Sbjct: 89  GGRGRGMGRGDGFDSR-GKREFDRHSGSDRSSFSHYSGLKHEDKRGGSGSHNWGTVKDEL 147

Query: 781 APEAEEPINGVVNDG-VNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEK 605
               +  +     +G  +    + ++ + +  + K++ P            EMTLDE++ 
Sbjct: 148 TDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGP-----------KEMTLDEWKA 196

Query: 604 LLEEKRKAI 578
           +  + R  +
Sbjct: 197 IQNKDRAKV 205



>gb:AL590559_1929700 Human DNA sequence from clone RP11-393N21 on
           chromosome 1 Contains the 5' end of the gene for PAI-1
           mRNA-binding protein (PAI-RBP1), a poly(A) binding
           protein, cytoplasmic 4 (PABPC4) pseudogene, a novel gene
           and a CpG island, complete sequence.
          Length = 393

 Score = 41.2 bits (95), Expect = 0.030
 Identities = 32/129 (24%), Positives = 57/129 (44%), Gaps = 10/129 (7%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGS---------EIKREGSGRGNWGSPTDEI 782
           G R  G+  G+  D    +R ++R SG+ R S         E KR GSG  NWG+  DE+
Sbjct: 173 GGRGRGMGRGDGFDSR-GKREFDRHSGSDRSSFSHYSGLKHEDKRGGSGSHNWGTVKDEL 231

Query: 781 APEAEEPINGVVNDG-VNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEK 605
               +  +     +G  +    + ++ + +  + K++ P            EMTLDE++ 
Sbjct: 232 TDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGP-----------KEMTLDEWKA 280

Query: 604 LLEEKRKAI 578
           +  + R  +
Sbjct: 281 IQNKDRAKV 289



>gb:AF151813_1886299 Homo sapiens CGI-55 protein mRNA, complete cds.
          Length = 393

 Score = 41.2 bits (95), Expect = 0.030
 Identities = 32/129 (24%), Positives = 57/129 (44%), Gaps = 10/129 (7%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGS---------EIKREGSGRGNWGSPTDEI 782
           G R  G+  G+  D    +R ++R SG+ R S         E KR GSG  NWG+  DE+
Sbjct: 173 GGRGRGMGRGDGFDSR-GKREFDRHSGSDRSSFSHYSGLKHEDKRGGSGSHNWGTVKDEL 231

Query: 781 APEAEEPINGVVNDG-VNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEK 605
               +  +     +G  +    + ++ + +  + K++ P            EMTLDE++ 
Sbjct: 232 TDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGP-----------KEMTLDEWKA 280

Query: 604 LLEEKRKAI 578
           +  + R  +
Sbjct: 281 IQNKDRAKV 289



>gb:BC070578_2555557 Xenopus laevis hypothetical protein MGC81067,
           mRNA (cDNA clone MGC:81067 IMAGE:6316528), complete cds.
          Length = 379

 Score = 40.8 bits (94), Expect = 0.039
 Identities = 41/135 (30%), Positives = 59/135 (43%), Gaps = 6/135 (4%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGS---EIKREGSGRGNWGSPTDEIAPEAEE 764
           G  RGG      +D    +R ++R SG+ R     E KR GSG  NWGS  +  +     
Sbjct: 169 GRGRGGFPRNTESDNLRGKREFDRHSGSDRARMRPEDKRGGSGPRNWGSIKEAFSEIEAV 228

Query: 763 PINGVVNDGVNTDAFEKQHGQ--EDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLLEEK 590
           P+   V +   T+A E +HG+  E+  D                  EM+LDE++ L ++ 
Sbjct: 229 PVEEQV-ETTETEATE-EHGKVSEETND-------------DGFSQEMSLDEWKLLQDQN 273

Query: 589 R-KAILASRPEERKV 548
           R K  L  R  E  V
Sbjct: 274 RSKTELNLRKPETSV 288



>gb:AE014134_1129244 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE014134_1129245 Drosophila melanogaster
           chromosome 2L, complete sequence.>gb:AE014134_1129246
           Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE014134_1129247 Drosophila melanogaster
           chromosome 2L, complete sequence.>gb:AE003646_1219351
           Drosophila melanogaster chromosome 2L, section 55 of 83
           of the complete sequence.>gb:AE003646_1219352 Drosophila
           melanogaster chromosome 2L, section 55 of 83 of the
           complete sequence.>gb:AE003646_1219353 Drosophila
           melanogaster chromosome 2L, section 55 of 83 of the
           complete sequence.>gb:AE003646_1219354 Drosophila
           melanogaster chromosome 2L, section 55 of 83 of the
           complete sequence.>gb:AY119578_1301147 Drosophila
           melanogaster LD07162 full insert
           cDNA.>gb:DROSADH06_1382797 Drosophila melanogaster,
           chromosome 2L, region 34C4-36A7 (Adh region), section 6
           of 10 of the complete sequence.
          Length = 490

 Score = 40.8 bits (94), Expect = 0.039
 Identities = 36/141 (25%), Positives = 61/141 (43%), Gaps = 3/141 (2%)
 Frame = -3

Query: 901 NADGEYPRRAYERRSG---TGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVN 731
           N DG+  +R ++R+SG   TG  S  KR+G+G  NWGS         +E I+ V  +   
Sbjct: 211 NYDGQNRKREFDRQSGSDRTGVKSIDKRDGAGSHNWGS--------VKEAIDDVNKNESE 262

Query: 730 TDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLLEEKRKAILASRPEERK 551
           T+    + G +   D     P            E+TLDE++    ++ K     R     
Sbjct: 263 TNVTNAEGGAK--ADESGTEPQNEQATAEEEAKELTLDEWKAQQGQRIKPTFNIRKAGEG 320

Query: 550 VCLDKEFESMALLANKKNDDE 488
               +  + + L +NKK +++
Sbjct: 321 EDTTQWKKMVVLTSNKKKEND 341



>gb:CR380952_1650599 Candida glabrata strain CBS138 chromosome F
           complete sequence.
          Length = 86

 Score = 39.7 bits (91), Expect = 0.087
 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 1/57 (1%)
 Frame = -3

Query: 877 RAYERRSGTGRG-SEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQ 710
           R + R    G   + +KREGSG+GNWG P DE        IN +++ G     F KQ
Sbjct: 17  RYFTRNGNFGESPNSVKREGSGKGNWGKPGDE--------INDLIDAGEIPPIFNKQ 65



>gb:AY672709_1345509 Strongyloides ratti ALT-1 mRNA, complete
           cds.>gb:AY672710_1345510 Strongyloides ratti ALT-1 gene,
           complete cds.
          Length = 331

 Score = 39.3 bits (90), Expect = 0.11
 Identities = 31/122 (25%), Positives = 51/122 (41%)
 Frame = -3

Query: 853 TGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKD 674
           TG  S  KR+G G+GNWG+  DE+  E E      V++  N     K +   +  + +K 
Sbjct: 163 TGVRSMPKRDGFGKGNWGTQKDELTGETEPLNQTAVDESENVAPGIKNNNTAEVPEEEK- 221

Query: 673 SPLXXXXXXXXXXXEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKND 494
                          +TL+EY+  L   +K      P   +   ++EF+ + L+   K  
Sbjct: 222 --------------TLTLEEYKAQLAAAKK---DETPFNIRQISEQEFKKLNLIPIPKKK 264

Query: 493 DE 488
            E
Sbjct: 265 VE 266



>gb:BC002488_1968154 Homo sapiens PAI-1 mRNA-binding protein, mRNA
           (cDNA clone MGC:1357 IMAGE:3051198), complete cds.
          Length = 402

 Score = 38.5 bits (88), Expect = 0.19
 Identities = 33/130 (25%), Positives = 54/130 (41%), Gaps = 11/130 (8%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGS---EIKREGSGRGNWGSPTDEIAPEAEE 764
           G R  G+  G+  D    +R ++R SG+ R     E KR GSG  NWG+  DE+    E 
Sbjct: 173 GGRGRGMGRGDGFDSR-GKREFDRHSGSDRSGLKHEDKRGGSGSHNWGTVKDEL---TES 228

Query: 763 PINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXX--------XEMTLDEYE 608
           P         N    ++ +  E+  + ++  P+                   EMTLDE++
Sbjct: 229 PKYIQKQISYNYSDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGPKEMTLDEWK 288

Query: 607 KLLEEKRKAI 578
            +  + R  +
Sbjct: 289 AIQNKDRAKV 298



>gb:AL590559_1929699 Human DNA sequence from clone RP11-393N21 on
           chromosome 1 Contains the 5' end of the gene for PAI-1
           mRNA-binding protein (PAI-RBP1), a poly(A) binding
           protein, cytoplasmic 4 (PABPC4) pseudogene, a novel gene
           and a CpG island, complete sequence.>gb:BC020555_1977057
           Homo sapiens PAI-1 mRNA-binding protein, mRNA (cDNA
           clone MGC:21447 IMAGE:3446543), complete cds.
          Length = 402

 Score = 38.5 bits (88), Expect = 0.19
 Identities = 33/130 (25%), Positives = 54/130 (41%), Gaps = 11/130 (8%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGS---EIKREGSGRGNWGSPTDEIAPEAEE 764
           G R  G+  G+  D    +R ++R SG+ R     E KR GSG  NWG+  DE+    E 
Sbjct: 173 GGRGRGMGRGDGFDSR-GKREFDRHSGSDRSGLKHEDKRGGSGSHNWGTVKDEL---TES 228

Query: 763 PINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXX--------XEMTLDEYE 608
           P         N    ++ +  E+  + ++  P+                   EMTLDE++
Sbjct: 229 PKYIQKQISYNYSDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGPKEMTLDEWK 288

Query: 607 KLLEEKRKAI 578
            +  + R  +
Sbjct: 289 AIQNKDRAKV 298



>gb:AC092263_1735265 Oryza sativa chromosome 3 BAC OSJNBa0033P04
           genomic sequence, complete sequence.
          Length = 383

 Score = 38.5 bits (88), Expect = 0.19
 Identities = 30/98 (30%), Positives = 40/98 (40%), Gaps = 4/98 (4%)
 Frame = +1

Query: 430 PFLRPLSFYLLFQIPT*QRPHHHSSYLPTVPWIQILCLSKPFFPQALMPE*PFS----SP 597
           P LRP +  LLF         HH    P  P   I  +  P  P+AL P  PF     +P
Sbjct: 160 PPLRPFAAPLLF---------HHDMASPVSPVSPIYYVGPPPPPEALRPLPPFPPTMLAP 210

Query: 598 PTISHTHPESSPYPQVPLLLVHPMENPSWHLQHLLAHV 711
           P   + HP+  P P+       P  +P  H  +LL  +
Sbjct: 211 PAYPYYHPQPQPDPE-----PEPDADPQQHRANLLKQI 243



>pir|T02367|T02367 hypothetical protein T8F5.22 - Arabidopsis
           thaliana>gb:AE005173_894197 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:T8F5_1724157 Arabidopsis thaliana
           chromosome 1 BAC T8F5 sequence, complete sequence.
          Length = 1684

 Score = 38.1 bits (87), Expect = 0.25
 Identities = 39/160 (24%), Positives = 65/160 (40%), Gaps = 7/160 (4%)
 Frame = -3

Query: 943 LSNGDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPE--- 773
           L    R  G   GE++D E+  R   RRS      +IK       +   P D++  E   
Sbjct: 166 LKKAQREQGNGQGESSDDEFDSRGGTRRSAE---DKIKDRLFDDVDVDDPPDDVGDEEDL 222

Query: 772 -AEEPINGVVNDGVNTDAFE-KQHGQEDAGDAKKDSPLXXXXXXXXXXXEMTLDEYEKLL 599
             EE + G  ++  +    E  +HG    G++KK                    + ++LL
Sbjct: 223 VVEEDVVGSEDEMADFIVDEDDEHGPPKRGNSKKKKYRQGSDITAMRDANEIFGDVDELL 282

Query: 598 EEKRKAILASRPEERKVCLDKEFESMALLAN--KKNDDEV 485
             ++K + +++  ER+  L+ EFE   L       NDDE+
Sbjct: 283 TIRKKGLASNQRMERR--LEDEFEPTVLSEKYMTGNDDEI 320



>gb:AL590559_1929701 Human DNA sequence from clone RP11-393N21 on
           chromosome 1 Contains the 5' end of the gene for PAI-1
           mRNA-binding protein (PAI-RBP1), a poly(A) binding
           protein, cytoplasmic 4 (PABPC4) pseudogene, a novel gene
           and a CpG island, complete sequence.>gb:BC003049_1968643
           Homo sapiens PAI-1 mRNA-binding protein, mRNA (cDNA
           clone MGC:684 IMAGE:3547236), complete
           cds.>gb:BC008045_1971180 Homo sapiens PAI-1 mRNA-binding
           protein, mRNA (cDNA clone MGC:16069 IMAGE:3615828),
           complete cds.>gb:BC019273_1976788 Homo sapiens PAI-1
           mRNA-binding protein, mRNA (cDNA clone MGC:3552
           IMAGE:2823760), complete cds.>gb:BC026916_1978848 Homo
           sapiens PAI-1 mRNA-binding protein, mRNA (cDNA clone
           MGC:25048 IMAGE:4477452), complete cds.
          Length = 408

 Score = 37.7 bits (86), Expect = 0.33
 Identities = 34/136 (25%), Positives = 55/136 (40%), Gaps = 17/136 (12%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGS---------EIKREGSGRGNWGSPTDEI 782
           G R  G+  G+  D    +R ++R SG+ R S         E KR GSG  NWG+  DE+
Sbjct: 173 GGRGRGMGRGDGFDSR-GKREFDRHSGSDRSSFSHYSGLKHEDKRGGSGSHNWGTVKDEL 231

Query: 781 APEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXX--------XEM 626
               E P         N    ++ +  E+  + ++  P+                   EM
Sbjct: 232 ---TESPKYIQKQISYNYSDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGPKEM 288

Query: 625 TLDEYEKLLEEKRKAI 578
           TLDE++ +  + R  +
Sbjct: 289 TLDEWKAIQNKDRAKV 304



>gb:CQ783786_1452629 Sequence 3926 from Patent
           EP1396543.>gb:AK074970_1912810 Homo sapiens cDNA
           FLJ90489 fis, clone NT2RP3003473.
          Length = 408

 Score = 37.7 bits (86), Expect = 0.33
 Identities = 34/136 (25%), Positives = 55/136 (40%), Gaps = 17/136 (12%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGS---------EIKREGSGRGNWGSPTDEI 782
           G R  G+  G+  D    +R ++R SG+ R S         E KR GSG  NWG+  DE+
Sbjct: 173 GGRGRGMGRGDGFDSR-GKREFDRHSGSDRSSFSHYSGLKHEDKRGGSGSHNWGTVKDEL 231

Query: 781 APEAEEPINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLXXXXXXXXXX--------XEM 626
               E P         N    ++ +  E+  + ++  P+                   EM
Sbjct: 232 ---TESPKYIQKQISYNYSDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGPKEM 288

Query: 625 TLDEYEKLLEEKRKAI 578
           TLDE++ +  + R  +
Sbjct: 289 TLDEWKAIQNKDRAKV 304



>gb:AK045190_1167301 Mus musculus 9.5 days embryo parthenogenote
           cDNA, RIKEN full-length enriched library,
           clone:B130045C05 product:HYPOTHETICAL RNA BINDING
           PROTEIN RDA288 homolog [Rattus norvegicus], full insert
           sequence.
          Length = 235

 Score = 37.0 bits (84), Expect = 0.56
 Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 9/60 (15%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGS---------EIKREGSGRGNWGSPTDEI 782
           G R  G+  G+  D    +R ++R SG+ R S         E KR GSG  NWG+  DE+
Sbjct: 173 GGRGRGMGRGDGFDSR-GKREFDRHSGSDRSSFSHYSGLKHEDKRGGSGSHNWGTVKDEL 231



>gb:AK004678_1152503 Mus musculus adult male lung cDNA, RIKEN
           full-length enriched library, clone:1200009K13
           product:HYPOTHETICAL RNA BINDING PROTEIN RDA288 homolog
           [Rattus norvegicus], full insert sequence.
          Length = 407

 Score = 37.0 bits (84), Expect = 0.56
 Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 9/60 (15%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGS---------EIKREGSGRGNWGSPTDEI 782
           G R  G+  G+  D    +R ++R SG+ R S         E KR GSG  NWG+  DE+
Sbjct: 173 GGRGRGMGRGDGFDSR-GKREFDRHSGSDRSSFSHYSGLKHEDKRGGSGSHNWGTVKDEL 231



>gb:AE016819_1749340 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 86

 Score = 36.2 bits (82), Expect = 0.96
 Identities = 13/18 (72%), Positives = 16/18 (88%)
 Frame = -3

Query: 835 IKREGSGRGNWGSPTDEI 782
           +K++GSGRGNWG P DEI
Sbjct: 32  VKKDGSGRGNWGKPGDEI 49



>gb:YSCECT1_1728844 Yeast DNA for CTP: phosphoethanolamine
           cytidylyltransferase and ORFs, complete cds.
          Length = 65

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 13/20 (65%), Positives = 17/20 (85%)
 Frame = -3

Query: 841 SEIKREGSGRGNWGSPTDEI 782
           + IK++GSG+GNWG P DEI
Sbjct: 30  NHIKKQGSGKGNWGKPGDEI 49



>gb:AC003680_1531194 Arabidopsis thaliana chromosome 2 BAC F17K2
           genomic sequence, complete sequence.>gb:AY039997_1560500
           Arabidopsis thaliana unknown protein (At2g45620) mRNA,
           complete cds.>gb:AF360181_1791136 Arabidopsis thaliana
           unknown protein (At2g45620) mRNA, complete cds.
          Length = 764

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 24/70 (34%), Positives = 35/70 (50%)
 Frame = -3

Query: 880 RRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQ 701
           RR  ERR   G+ S+ KREG+        +DEI    E+ +  ++         E + G+
Sbjct: 341 RRGGERREELGQLSKAKREGNAN------SDEIEDFGEDIVKSLL--------LEDETGE 386

Query: 700 EDAGDAKKDS 671
           +DA D KKDS
Sbjct: 387 KDANDGKKDS 396



>pir|T00875|T00875 hypothetical protein At2g45620 [imported] -
           Arabidopsis thaliana
          Length = 759

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 24/70 (34%), Positives = 35/70 (50%)
 Frame = -3

Query: 880 RRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEKQHGQ 701
           RR  ERR   G+ S+ KREG+        +DEI    E+ +  ++         E + G+
Sbjct: 341 RRGGERREELGQLSKAKREGNAN------SDEIEDFGEDIVKSLL--------LEDETGE 386

Query: 700 EDAGDAKKDS 671
           +DA D KKDS
Sbjct: 387 KDANDGKKDS 396



>pir|S12201|S12201 ATP synthase regulatory factor, 15K - yeast
           (Saccharomyces cerevisiae)>gb:AY558270_1614497
           Saccharomyces cerevisiae clone FLH111200.01X YGR008C
           gene, complete cds.>gb:SCYGR008C_1712208 S.cerevisiae
           chromosome VII reading frame ORF
           YGR008c.>gb:YSCSTF2_1730720 Saccharomyces cerevisiae
           STF2 gene for 15K protein, complete cds.
          Length = 84

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 13/20 (65%), Positives = 17/20 (85%)
 Frame = -3

Query: 841 SEIKREGSGRGNWGSPTDEI 782
           + IK++GSG+GNWG P DEI
Sbjct: 30  NHIKKQGSGKGNWGKPGDEI 49



>sp|P16965|STF2_YEAST ATPase stabilizing factor 15 kDa protein.
          Length = 83

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 13/20 (65%), Positives = 17/20 (85%)
 Frame = -3

Query: 841 SEIKREGSGRGNWGSPTDEI 782
           + IK++GSG+GNWG P DEI
Sbjct: 29  NHIKKQGSGKGNWGKPGDEI 48



>gb:AE016818_1748261 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 665

 Score = 35.4 bits (80), Expect = 1.6
 Identities = 27/79 (34%), Positives = 36/79 (45%)
 Frame = -3

Query: 937 NGDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPI 758
           NG  RGGL+ G+ A       A  RRSG GRG      GSGR     P  +    AE+ +
Sbjct: 65  NGAARGGLNEGQRATHAPAAGAARRRSGRGRGG----YGSGRRRGERPA-QSQGAAEDDL 119

Query: 757 NGVVNDGVNTDAFEKQHGQ 701
              +   +   AF + HG+
Sbjct: 120 EARIQGELQKGAF-RAHGR 137



>gb:HS1LATA_2437070 Herpes simplex virus type one (HSV-1) latency
           associated transcript (LAT).
          Length = 305

 Score = 35.0 bits (79), Expect = 2.1
 Identities = 21/67 (31%), Positives = 28/67 (41%)
 Frame = +1

Query: 472 PT*QRPHHHSSYLPTVPWIQILCLSKPFFPQALMPE*PFSSPPTISHTHPESSPYPQVPL 651
           PT   PH H+  LP  P         P  P +  P  P    PT +H H  + P P+ P 
Sbjct: 59  PTPTHPHSHAPPLPRTP--------TPTHPHSHAP--PLPRTPTPTHPHSHAPPLPRTP- 107

Query: 652 LLVHPME 672
             +HP +
Sbjct: 108 -AIHPTQ 113



 Score = 33.1 bits (74), Expect = 8.1
 Identities = 19/59 (32%), Positives = 24/59 (40%)
 Frame = +1

Query: 472 PT*QRPHHHSSYLPTVPWIQILCLSKPFFPQALMPE*PFSSPPTISHTHPESSPYPQVP 648
           PT   PH H+  LP  P         P  P +  P  P    PT +H H  + P P+ P
Sbjct: 27  PTPTHPHSHAPPLPRTP--------TPTHPHSHAP--PLPRTPTPTHPHSHAPPLPRTP 75



>gb:AP005678_1855846 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC
           clone:OJ1116_F08.>gb:AP005704_1856384 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, PAC
           clone:P0448B03.
          Length = 177

 Score = 35.0 bits (79), Expect = 2.1
 Identities = 19/50 (38%), Positives = 22/50 (44%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE 785
           G RRGG  +    DG   RR+ E     G G    REG+  G W   T E
Sbjct: 121 GRRRGGGCDARGGDGATGRRSGEEGEAAGGGRRHGREGTTAGRWLGTTGE 170



>gb:AE017351_1759534 Cryptococcus neoformans var. neoformans JEC21
           chromosome 11, complete sequence.
          Length = 1049

 Score = 35.0 bits (79), Expect = 2.1
 Identities = 33/157 (21%), Positives = 64/157 (40%), Gaps = 7/157 (4%)
 Frame = -3

Query: 937 NGDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEE-- 764
           +GD++      + A+G   +   ++ S +    E KR   G         E   + +E  
Sbjct: 289 DGDKKSDPKKDDKAEGLEKKDVKKKSSSSDDKKEDKRGSGGEKKEERNKKEERNKEDENK 348

Query: 763 PINGVVNDGVNTDAFEKQHGQEDAGDAKKDSPLX--XXXXXXXXXXEMTLDEYEKLLEEK 590
              G   +  N+++ EK+  ++ AGD K+D                    D+ +    EK
Sbjct: 349 ASRGEKKEDKNSNSREKKDDKKAAGDKKEDKKATGEKKDEKKAAGASRNKDDKKSATGEK 408

Query: 589 R---KAILASRPEERKVCLDKEFESMALLANKKNDDE 488
           R   +A+ A + +++KV    + +  A   N+K+D E
Sbjct: 409 RDEKRAVGAEKKDDKKVAAADKDDKKAAGGNRKDDKE 445



>gb:AY054208_1563030 Arabidopsis thaliana At1g76010/T4O12_22 mRNA,
           complete cds.>gb:AY124847_1580212 Arabidopsis thaliana
           At1g76010/T4O12_22 mRNA, complete
           cds.>gb:AF412102_1797355 Arabidopsis thaliana
           At1g76010/T4O12_22 mRNA, complete
           cds.>gb:AF428441_1799371 Arabidopsis thaliana
           At1g76010/T4O12_22 mRNA, complete cds.
          Length = 350

 Score = 35.0 bits (79), Expect = 2.1
 Identities = 27/83 (32%), Positives = 38/83 (45%), Gaps = 1/83 (1%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPR-RAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPI 758
           G R     N E+ DG + R ++Y R  G GRG   +  G GRG +  P +E     + P 
Sbjct: 166 GGRGNAYVNVEHEDGGWEREQSYGRGRGRGRGRSSR--GRGRGGYNGPPNEY----DAPQ 219

Query: 757 NGVVNDGVNTDAFEKQHGQEDAG 689
           +G    G   DA  +  G +D G
Sbjct: 220 DG----GYGYDAPHEHRGYDDRG 238



>pir|F96788|F96788 protein T4O12.22 [imported] - Arabidopsis
           thaliana>gb:AE005173_895135 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC007396_1535840 Genomic sequence for
           Arabidopsis thaliana BAC T4O12 from chromosome I,
           complete sequence.
          Length = 369

 Score = 35.0 bits (79), Expect = 2.1
 Identities = 27/83 (32%), Positives = 38/83 (45%), Gaps = 1/83 (1%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPR-RAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPI 758
           G R     N E+ DG + R ++Y R  G GRG   +  G GRG +  P +E     + P 
Sbjct: 185 GGRGNAYVNVEHEDGGWEREQSYGRGRGRGRGRSSR--GRGRGGYNGPPNEY----DAPQ 238

Query: 757 NGVVNDGVNTDAFEKQHGQEDAG 689
           +G    G   DA  +  G +D G
Sbjct: 239 DG----GYGYDAPHEHRGYDDRG 257



>gb:AF232689_2218917 Rat cytomegalovirus Maastricht, complete
           genome.
          Length = 667

 Score = 34.7 bits (78), Expect = 2.8
 Identities = 18/56 (32%), Positives = 27/56 (48%)
 Frame = -3

Query: 919 GLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPING 752
           GL  G++   E P R+  R    GRG  ++ +  GR +W S TD    + E   +G
Sbjct: 339 GLGRGDDRGKETPGRSASR----GRGGSVREDDGGRSSWRSATDGELSDGERSWSG 390



>gb:NCB9B11_1690394 Neurospora crassa DNA linkage group II BAC clone
           B9B11.
          Length = 717

 Score = 34.7 bits (78), Expect = 2.8
 Identities = 26/90 (28%), Positives = 37/90 (41%), Gaps = 4/90 (4%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDE----IAPEAE 767
           G  RGG   G    G + ++    R G G G        GRG +GS   +    I  E E
Sbjct: 613 GRGRGGSRGGRGGRGNFQQQRGGGRGGQGHG--------GRGGFGSGQQQQQQRIKQETE 664

Query: 766 EPINGVVNDGVNTDAFEKQHGQEDAGDAKK 677
            P +  VN  ++    E+Q G E+    K+
Sbjct: 665 APTHMDVNMEIDAPRQEQQRGVEEQPQQKR 694



>sp|P17588|LRP1_HHV1F Latency-related protein 1.>pir|A33337|WMBEL1
           latency-related protein 1 - human herpesvirus 1 (strain
           F)>gb:HS1LATRA_2437072 Herpes simplex type 1 (HSV-1)
           gene encoding two latency-related proteins, complete
           cds.
          Length = 340

 Score = 34.7 bits (78), Expect = 2.8
 Identities = 21/67 (31%), Positives = 28/67 (41%)
 Frame = +1

Query: 472 PT*QRPHHHSSYLPTVPWIQILCLSKPFFPQALMPE*PFSSPPTISHTHPESSPYPQVPL 651
           PT   PH H+  LP  P         P  P +  P  P    PT +H H  + P P+ P 
Sbjct: 27  PTPTHPHSHAPPLPRTP--------TPSHPHSRAP--PLPRAPTPTHPHSHAPPLPRTP- 75

Query: 652 LLVHPME 672
             +HP +
Sbjct: 76  -EIHPTQ 81



>gb:HS1LSSDS_2437074 Herpes simplex virus type 1 latency-associated
           transcript mRNA.
          Length = 272

 Score = 34.3 bits (77), Expect = 3.7
 Identities = 21/67 (31%), Positives = 28/67 (41%)
 Frame = +1

Query: 472 PT*QRPHHHSSYLPTVPWIQILCLSKPFFPQALMPE*PFSSPPTISHTHPESSPYPQVPL 651
           PT   PH H+  LP  P         P  P +  P  P    PT +H H  + P P+ P 
Sbjct: 27  PTPTHPHSHAPPLPRTP--------TPTHPHSHAP--PLPRTPTPTHPHSHAPPLPRTP- 75

Query: 652 LLVHPME 672
             +HP +
Sbjct: 76  -EIHPTQ 81



>gb:CR382130_1662862 Yarrowia lipolytica chromosome D of strain CLIB99
            of Yarrowia lipolytica.
          Length = 913

 Score = 34.3 bits (77), Expect = 3.7
 Identities = 24/90 (26%), Positives = 37/90 (41%)
 Frame = -3

Query: 940  SNGDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEP 761
            S GD      +G   D      + +  SG+G GS+   + S  G+ GS T   A ++E  
Sbjct: 759  SRGDSDSKGDSGSQGDSSKDDSSSKSDSGSGTGSD---KSSNSGSSGSGTSSDAGKSENS 815

Query: 760  INGVVNDGVNTDAFEKQHGQEDAGDAKKDS 671
             NG  + G +T    K  G  +  +    S
Sbjct: 816  SNGSNSSGSSTSGSGKSDGSSNKSNGSSGS 845



>gb:AF066072_1237812 Dictyostelium discoideum SP85 (pspB) gene,
           partial cds.
          Length = 135

 Score = 34.3 bits (77), Expect = 3.7
 Identities = 25/74 (33%), Positives = 34/74 (45%)
 Frame = +1

Query: 457 LLFQIPT*QRPHHHSSYLPTVPWIQILCLSKPFFPQALMPE*PFSSPPTISHTHPESSPY 636
           ++ Q PT Q P    +Y PT P  Q      P +P +  P  P + PPT   T+P S P 
Sbjct: 10  IITQSPT-QPPTQPPTYPPTQPPTQ-----PPTYPPSYPPSYPPTYPPTHPPTYPPSCPP 63

Query: 637 PQVPLLLVHPMENP 678
            Q P+     +E P
Sbjct: 64  TQPPVQDCSTLECP 77



>gb:BC068016_2554985 Danio rerio zgc:76890, mRNA (cDNA clone
           MGC:76890 IMAGE:6520167), complete cds.
          Length = 711

 Score = 33.9 bits (76), Expect = 4.8
 Identities = 20/67 (29%), Positives = 29/67 (43%), Gaps = 1/67 (1%)
 Frame = +1

Query: 487 PHHHSSYLPTVPWIQILCLSKPFFPQALMPE*PFSSPPTISHTHPESSP-YPQVPLLLVH 663
           PH  + Y P + +  +LC   P+      P  P++     +H+H  S P  P VP     
Sbjct: 345 PHSKALYPPVLQYPPLLCQPSPYQHPPSQPSPPYTPAGAHAHSHTHSQPSSPYVPPGAYP 404

Query: 664 PMENPSW 684
           P   PSW
Sbjct: 405 P---PSW 408



>gb:AP002855_1823203 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBa0086P08.
          Length = 539

 Score = 33.9 bits (76), Expect = 4.8
 Identities = 19/63 (30%), Positives = 27/63 (42%)
 Frame = +1

Query: 490 HHHSSYLPTVPWIQILCLSKPFFPQALMPE*PFSSPPTISHTHPESSPYPQVPLLLVHPM 669
           H  +   P   W Q    ++ + PQA+ P  P   PP       +  P P VP ++ HPM
Sbjct: 401 HQPAPVDPAAYWQQQYNAARKWGPQAVTPGTPCMPPPLPPAAMLQRFPVPPVPGMVPHPM 460

Query: 670 ENP 678
             P
Sbjct: 461 YRP 463



>gb:AF318582_1785616 Oryza sativa putative transcription factor
           OsGLK2 (Glk2) mRNA, partial cds.
          Length = 430

 Score = 33.9 bits (76), Expect = 4.8
 Identities = 19/63 (30%), Positives = 27/63 (42%)
 Frame = +1

Query: 490 HHHSSYLPTVPWIQILCLSKPFFPQALMPE*PFSSPPTISHTHPESSPYPQVPLLLVHPM 669
           H  +   P   W Q    ++ + PQA+ P  P   PP       +  P P VP ++ HPM
Sbjct: 292 HQPAPVDPAAYWQQQYNAARKWGPQAVTPGTPCMPPPLPPAAMLQRFPVPPVPGMVPHPM 351

Query: 670 ENP 678
             P
Sbjct: 352 YRP 354



>gb:AF066073_1237813 Dictyostelium discoideum SP85 (pspB) gene,
           partial cds.
          Length = 139

 Score = 33.9 bits (76), Expect = 4.8
 Identities = 24/64 (37%), Positives = 31/64 (48%)
 Frame = +1

Query: 457 LLFQIPT*QRPHHHSSYLPTVPWIQILCLSKPFFPQALMPE*PFSSPPTISHTHPESSPY 636
           ++ Q PT Q P    +Y PT P  Q      P +P +  P  P + PPT   T+P S  Y
Sbjct: 10  IITQSPT-QPPTQPPTYPPTQPPTQ-----PPTYPPSYPPSYPPTYPPTHPPTYPRS--Y 61

Query: 637 PQVP 648
           PQ P
Sbjct: 62  PQTP 65



>gb:BC067982_2554966 Xenopus tropicalis hypothetical protein
           MGC69337, mRNA (cDNA clone MGC:69337 IMAGE:5309034),
           complete cds.
          Length = 458

 Score = 33.5 bits (75), Expect = 6.2
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 9/59 (15%)
 Frame = -3

Query: 910 NGENADGEYPR----RAYERRSGTGRGSEIKREGS--GRGNWGSP---TDEIAPEAEEP 761
           NGE+A G  P     +  +R+S TG+G  + ++G   G+G WG+P    DE   + ++P
Sbjct: 71  NGESARGVLPTSPKAKLMDRKSRTGKGRGLPKKGGAGGKGVWGTPGQIYDEEVVDIKDP 129



>gb:BC048225_2550038 Xenopus laevis programmed cell death 4, mRNA
           (cDNA clone MGC:53295 IMAGE:5570381), complete cds.
          Length = 455

 Score = 33.5 bits (75), Expect = 6.2
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 6/45 (13%)
 Frame = -3

Query: 910 NGENADGEYPR----RAYERRSGTGRGSEIKREGS--GRGNWGSP 794
           NGEN  G  P     +  +R+S TG+G  + ++G   G+G WG+P
Sbjct: 69  NGENTRGVVPTSPKSKLMDRKSRTGKGRGLPKKGGAGGKGVWGTP 113



>gb:AF410847_2252072 Ovine herpesvirus 2 latency associated antigen
           (orf73) gene, complete cds.
          Length = 495

 Score = 33.5 bits (75), Expect = 6.2
 Identities = 22/66 (33%), Positives = 27/66 (40%)
 Frame = -3

Query: 934 GDRRGGLSNGENADGEYPRRAYERRSGTGRGSEIKREGSGRGNWGSPTDEIAPEAEEPIN 755
           G+  GG   G   +GE P    E   G G G E + EG G    G   +E  P  EE   
Sbjct: 131 GEGPGGEVEGPGGEGEGPGGEVEGPGGEGEGPEGEGEGPGGEGEGPGGEEEGPGGEEEGP 190

Query: 754 GVVNDG 737
           G   +G
Sbjct: 191 GGEEEG 196



>gb:AF232689_2218895 Rat cytomegalovirus Maastricht, complete
           genome.
          Length = 218

 Score = 33.5 bits (75), Expect = 6.2
 Identities = 25/82 (30%), Positives = 36/82 (43%), Gaps = 8/82 (9%)
 Frame = -3

Query: 907 GENADGEYPRRAYERRSGTG-------RGSEIKREGSGRGNWGSPTDEIAPEAE-EPING 752
           G   +G   RR  ER  G         RG    RE SGR + G   +E   E   +P++G
Sbjct: 63  GAEREGGRARRGEERGGGRETEQRQKKRGEREAREESGRRSRGRRREERGEEERGDPLSG 122

Query: 751 VVNDGVNTDAFEKQHGQEDAGD 686
              +  + D F  + G+E +GD
Sbjct: 123 RRGEEKSGDLFSGRRGEEKSGD 144



>pir|S53404|S53404 ATP synthase regulatory factor homolog YLR327c -
           yeast  (Saccharomyces cerevisiae)>gb:YSCL8543_1729595
           Saccharomyces cerevisiae chromosome XII cosmid 8543.
          Length = 86

 Score = 33.5 bits (75), Expect = 6.2
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 1/60 (1%)
 Frame = -3

Query: 841 SEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEK-QHGQEDAGDAKKDSPL 665
           + +KR G G+GNWG P DE        IN +++ G     F K + G     + ++ S L
Sbjct: 30  NHVKRGGYGKGNWGKPGDE--------INDLIDSGEIKTVFNKTRRGSNSQNNERRLSDL 81



>sp|Q06177|STFL_YEAST STF2-like protein YLR327c.
          Length = 85

 Score = 33.5 bits (75), Expect = 6.2
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 1/60 (1%)
 Frame = -3

Query: 841 SEIKREGSGRGNWGSPTDEIAPEAEEPINGVVNDGVNTDAFEK-QHGQEDAGDAKKDSPL 665
           + +KR G G+GNWG P DE        IN +++ G     F K + G     + ++ S L
Sbjct: 29  NHVKRGGYGKGNWGKPGDE--------INDLIDSGEIKTVFNKTRRGSNSQNNERRLSDL 80



>gb:ATMAJ23_1553715 Arabidopsis thaliana DNA chromosome 5, P1 clone
           MAJ23 (ESSA project).>gb:BT015827_1642445 Arabidopsis
           thaliana At5g10660 gene, complete
           cds.>gb:BT020212_1642607 Arabidopsis thaliana At5g10660
           mRNA, complete cds.
          Length = 407

 Score = 33.1 bits (74), Expect = 8.1
 Identities = 40/175 (22%), Positives = 66/175 (37%), Gaps = 25/175 (14%)
 Frame = -3

Query: 937 NGDRRGGLSNGENADGEYPRRAYERRSGTGRG-------SEIKREGSGRGNWGSPTDEIA 779
           +G  RGGL          P  A    SG  +        S+ K+EGSG     S   EI+
Sbjct: 136 HGSSRGGLRGSSTVKS--PPVASRGSSGVKKSGLSGNSSSKSKKEGSGNVPKKSSGKEIS 193

Query: 778 PEAEEPINGVVND-----GVNTDAFEKQHGQE-------------DAGDAKKDSPLXXXX 653
           P++  P+     D      V TD     HG+E             ++G+ K+ SP+    
Sbjct: 194 PDS-SPLASAHEDEEEIVKVETDVHISDHGEEPKEEDKDQFAQPDESGEEKETSPVAAS- 251

Query: 652 XXXXXXXEMTLDEYEKLLEEKRKAILASRPEERKVCLDKEFESMALLANKKNDDE 488
                    T ++  +L++E +       P+E +   +   E    +  K +D+E
Sbjct: 252 ---------TEEQKGELIDEDKSTEQIEEPKEPENIEENNSEEEEEVKKKSDDEE 297



>gb:SDMA3APOP_1397385 Suberites domuncula mRNA for apoptosis gene
           MA3.
          Length = 463

 Score = 33.1 bits (74), Expect = 8.1
 Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 1/33 (3%)
 Frame = -3

Query: 868 ERRSGTGR-GSEIKREGSGRGNWGSPTDEIAPE 773
           ERRS +GR G   K  G G+G WG+ TDE+  E
Sbjct: 92  ERRSRSGRRGQPKKGGGGGKGTWGNITDEMYAE 124


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 833,086,952
Number of Sequences: 1806583
Number of extensions: 16489983
Number of successful extensions: 56864
Number of sequences better than 10.0: 81
Number of HSP's better than 10.0 without gapping: 52193
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 56410
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 68001319770
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)