BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig11024
         (831 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB015855_1512730 Nicotiana tabacum mRNA for transcription fac...   159   8e-38   
gb:AY248903_1592638 Nicotiana tabacum EIL1 mRNA, complete cds.        158   1e-37   
gb:AY248904_1592639 Nicotiana tabacum EIL2 mRNA, complete cds.        157   2e-37   
gb:AF328785_1786912 Lycopersicon esculentum EIL2 (EIL2) mRNA, co...   147   2e-34   
gb:AF498235_1805909 Lycopersicon esculentum EIL (EIL) mRNA, EIL-...   144   3e-33   
gb:AF328784_1786911 Lycopersicon esculentum EIL1 (EIL1) mRNA, co...   132   1e-29   
gb:AY248906_1592641 Nicotiana tabacum EIL4 mRNA, complete cds.        125   1e-27   
gb:AB108840_1526779 Lycopersicon esculentum LeEIL4 mRNA for EIN3...   122   6e-27   
gb:AB063191_1522205 Cucumis melo CmEIL1 mRNA for EIN3-like prote...   104   2e-21   
gb:CAR404640_1645261 Cicer arietinum mRNA for for hypothetical p...    87   3e-16   
gb:AF467783_1802440 Vigna radiata transcription factor EIL2 mRNA...    80   5e-14   
gb:AB063192_1522206 Cucumis melo CmEIL2 mRNA for EIN3-like prote...    76   7e-13   
gb:AY248907_1592642 Nicotiana tabacum EIL5 mRNA, complete cds.         74   3e-12   
gb:AF467784_1802441 Vigna radiata transcription factor EIL1 mRNA...    71   3e-11   
gb:AF387795_1794920 Cucumis melo transcription factor (EIN3) mRN...    68   2e-10   
gb:AF328786_1786913 Lycopersicon esculentum EIL3 (EIL3) mRNA, co...    65   2e-09   
gb:PEQ316086_1699812 Phalaenopsis equestris mRNA for ethylene-in...    52   1e-05   
gb:AY728192_1624914 Dianthus caryophyllus ethylene insensitive 3...    52   1e-05   
sp|O24606|EIN3_ARATH|EIN3_ARATH ETHYLENE-INSENSITIVE3 protein.>gb:AB025629_...    48   3e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AF004213_1760676 Arabidopsis thaliana ethylene-insensitive3-l...    47   3e-04   
sp|Q9SLH0|EIL1_ARATH|EIL1_ARATH ETHYLENE-INSENSITIVE3-like 1 protein.>pir|B...    47   3e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AB074971_1523295 Oryza sativa (japonica cultivar-group) OsEIL...    47   4e-04   
gb:AX077260_1460682 Sequence 3 from Patent WO0105953.                  43   0.008   
gb:AY728193_1624915 Dianthus caryophyllus ethylene insensitive 3...    42   0.011   
gb:AX077258_1460681 Sequence 1 from Patent WO0105953.                  40   0.041   
gb:SCU24241_181682 Sorangium cellulosum acyl-CoA dehydrogenase (...    35   1.7     
gb:AC024843_1204939 Caenorhabditis elegans cosmid Y61A9LA, compl...    34   3.0     
gb:CR555306_105491 Azoarcus sp. EbN1 complete genome.                  34   3.9     
gb:BC016426_2092296 Mus musculus homeo box, msh-like 1, mRNA (cD...    33   8.6     
gb:AF308572_2062365 Mus musculus homeobox protein MSX1 variant (...    33   8.6     
gb:AF261654_1781554 Dianthus caryophyllus ethylene-insensitive 3...    33   8.6     
gb:CR380954_1651407 Candida glabrata strain CBS138 chromosome H ...    33   8.6     
pir|A54772|A54772 homeotic protein Msx-1 - mouse>gb:MMHOX71_2115...    33   8.6     Mus sp. [mice]
pir|S18813|S18813 homeotic protein Hox 7 - mouse>gb:MMHOX7R_2115...    33   8.6     Mus musculus [mouse]
pir|B98260|B98260 hypothetical protein AGR_L_1400GM [imported] -...    33   8.6     Agrobacterium fabrum str. C58
sp|P13297|MSX1_MOUSE|MSX1_MOUSE Homeobox protein MSX-1 (Hox-7) (Hox-7.1).         33   8.6     Mus musculus [mouse]


>gb:AB015855_1512730 Nicotiana tabacum mRNA for transcription factor
           TEIL, complete cds.
          Length = 615

 Score =  159 bits (401), Expect = 8e-38
 Identities = 83/144 (57%), Positives = 101/144 (70%), Gaps = 3/144 (2%)
 Frame = -1

Query: 831 SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL 652
           SF+LSG+GVPEDGQRMIN+LMSFYD NIQGNK S   N   +KEQP QQ +IQ  Q  +L
Sbjct: 474 SFDLSGIGVPEDGQRMINELMSFYDNNIQGNKSSMAANVVMSKEQPRQQPSIQ--QNNYL 531

Query: 651 QNQGII-PGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPP 475
            NQGII  GNIF ++NIS+   MF  GD+F+Q K L SPFN  S +   FMFG PFNL  
Sbjct: 532 HNQGIILDGNIFGDTNISANHSMFPQGDRFDQSKVLTSPFNAGSNDNFHFMFGSPFNLQS 591

Query: 474 SDYSEGLLGVPP--LPKKDILSWY 409
           +DY+E L G+    +PK+D+  WY
Sbjct: 592 TDYTEALSGITQDNMPKQDVPVWY 615



>gb:AY248903_1592638 Nicotiana tabacum EIL1 mRNA, complete cds.
          Length = 618

 Score =  158 bits (400), Expect = 1e-37
 Identities = 83/144 (57%), Positives = 101/144 (70%), Gaps = 3/144 (2%)
 Frame = -1

Query: 831 SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL 652
           SF+LSG+GVPEDGQRMIN+LMSFYD NIQGNK S   N   +KEQP QQ +IQ  Q  +L
Sbjct: 477 SFDLSGIGVPEDGQRMINELMSFYDNNIQGNKSSMAGNVVMSKEQPRQQPSIQ--QNNYL 534

Query: 651 QNQGII-PGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPP 475
            NQGII  GNIF ++NIS+   MF  GD+F+Q K L SPFN  S +   FMFG PFNL  
Sbjct: 535 HNQGIILDGNIFGDTNISANHSMFPQGDRFDQSKVLTSPFNAGSNDNFHFMFGSPFNLQS 594

Query: 474 SDYSEGLLGVPP--LPKKDILSWY 409
           +DY+E L G+    +PK+D+  WY
Sbjct: 595 TDYTEALSGITQDNMPKQDVPVWY 618



>gb:AY248904_1592639 Nicotiana tabacum EIL2 mRNA, complete cds.
          Length = 616

 Score =  157 bits (397), Expect = 2e-37
 Identities = 82/144 (56%), Positives = 102/144 (70%), Gaps = 3/144 (2%)
 Frame = -1

Query: 831 SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL 652
           SF+LSGLGVPEDGQRMIN+LMSFYD+NIQGNK S   N   +KEQP QQ +IQ  Q  +L
Sbjct: 475 SFDLSGLGVPEDGQRMINELMSFYDSNIQGNKNSMAGNVVMSKEQPRQQPSIQ--QNNYL 532

Query: 651 QNQGII-PGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPP 475
            NQGI+  GNIF ++NIS+   +F  GD+F+Q K L SPFN  S +   FMFG PFNL  
Sbjct: 533 HNQGIVLDGNIFGDTNISANHSVFPQGDRFDQSKVLTSPFNAGSNDNFHFMFGSPFNLQS 592

Query: 474 SDYSEGLLGVPP--LPKKDILSWY 409
           +DY+E L G+    +PK+D+  WY
Sbjct: 593 TDYTEALSGITQDNMPKQDVPVWY 616



>gb:AF328785_1786912 Lycopersicon esculentum EIL2 (EIL2) mRNA,
           complete cds.
          Length = 614

 Score =  147 bits (371), Expect = 2e-34
 Identities = 77/144 (53%), Positives = 101/144 (70%), Gaps = 3/144 (2%)
 Frame = -1

Query: 831 SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL 652
           SF+ SGLGVP DGQR+IN+LMSFY++N+QGNK S   NS  +KEQPLQQ +IQ  Q  +L
Sbjct: 473 SFDTSGLGVPADGQRVINELMSFYESNVQGNKSSMAGNSVMSKEQPLQQPSIQ--QNNYL 530

Query: 651 QNQG-IIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPP 475
           Q+QG ++ G+IF ++NIS+   MF  GD+F+Q K L SPFN SS +   FMFG PFN+  
Sbjct: 531 QSQGNVLEGSIFGDTNISANNSMFVQGDRFDQSKVLTSPFNASSTDDFNFMFGSPFNMQS 590

Query: 474 SDYSEGLLGV--PPLPKKDILSWY 409
           +D SE L G+    + K+D   WY
Sbjct: 591 TDLSECLSGISHDDVTKQDASVWY 614



>gb:AF498235_1805909 Lycopersicon esculentum EIL (EIL) mRNA,
           EIL-EIN3/EIL allele, partial cds.
          Length = 359

 Score =  144 bits (362), Expect = 3e-33
 Identities = 73/130 (56%), Positives = 96/130 (73%), Gaps = 1/130 (0%)
 Frame = -1

Query: 831 SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL 652
           SF+ SGLGVP DGQR+IN+LMSFY++N+QGNK S   NS  +KEQPLQQ +IQ  Q  +L
Sbjct: 215 SFDTSGLGVPADGQRVINELMSFYESNVQGNKSSMAGNSVMSKEQPLQQPSIQ--QNNYL 272

Query: 651 QNQG-IIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPP 475
           Q+QG ++ G+IF ++NIS++  MF  GD+F+Q K L SPFN SS +   FMFG PFN+  
Sbjct: 273 QSQGNVLEGSIFGDTNISASNSMFVQGDRFDQSKVLTSPFNASSTDDFNFMFGSPFNMQS 332

Query: 474 SDYSEGLLGV 445
           +D SE L G+
Sbjct: 333 TDLSECLSGI 342



>gb:AF328784_1786911 Lycopersicon esculentum EIL1 (EIL1) mRNA,
           complete cds.
          Length = 610

 Score =  132 bits (331), Expect = 1e-29
 Identities = 70/143 (48%), Positives = 93/143 (65%), Gaps = 2/143 (1%)
 Frame = -1

Query: 831 SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL 652
           SF+LSG+GVPEDGQRMIN+LMS YD+++QG+K  N  N    KEQP QQ  +  HQ  +L
Sbjct: 474 SFDLSGIGVPEDGQRMINELMSIYDSDVQGSKRQNRGNIALTKEQPHQQPRV--HQDNYL 531

Query: 651 QNQGIIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPS 472
            +QGI+ GNIF+ +NIS+T+ M    D F+Q KA    FN  S +   FMFG PFN+  +
Sbjct: 532 LSQGIMDGNIFKNTNISTTQSMLPQVDPFDQSKA----FNAGSNDNFHFMFGSPFNIQST 587

Query: 471 DYSEGL--LGVPPLPKKDILSWY 409
           +Y+  L  +G    PK+D   WY
Sbjct: 588 NYNGNLPSIGYDTTPKQDAPIWY 610



>gb:AY248906_1592641 Nicotiana tabacum EIL4 mRNA, complete cds.
          Length = 603

 Score =  125 bits (314), Expect = 1e-27
 Identities = 68/143 (47%), Positives = 93/143 (65%), Gaps = 2/143 (1%)
 Frame = -1

Query: 831 SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL 652
           +F+LSG+GVPEDGQRMI +LMSFYD+NIQGNK  N  N    KEQP QQ  +  +Q  +L
Sbjct: 473 TFDLSGVGVPEDGQRMITELMSFYDSNIQGNKSQNTGNVALTKEQPHQQPRV--NQDNYL 530

Query: 651 QNQGIIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPS 472
            +QGI+ GNIF+++NIS++  M         P+A  SPFN    +   FMFG PFNL  +
Sbjct: 531 HSQGIMEGNIFKDANISTSHSML--------PQA--SPFNAGPNDNFHFMFGSPFNLQSA 580

Query: 471 DYSEGL--LGVPPLPKKDILSWY 409
           +Y+  L  +G    PK+++ +WY
Sbjct: 581 NYTGNLPGIGYDTTPKQNLPTWY 603



>gb:AB108840_1526779 Lycopersicon esculentum LeEIL4 mRNA for
           EIN3-like protein, complete cds.
          Length = 605

 Score =  122 bits (307), Expect = 6e-27
 Identities = 70/143 (48%), Positives = 91/143 (63%), Gaps = 3/143 (2%)
 Frame = -1

Query: 828 FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKE-QPLQQTNIQCHQGGFL 652
           F+L G+GVPEDGQRMI+DLMSFYD NIQGNK  N  N    KE QP QQ  +   Q  +L
Sbjct: 471 FDLFGVGVPEDGQRMIDDLMSFYDCNIQGNKSQNTGNVAVTKEQQPHQQPRVD--QVNYL 528

Query: 651 QNQGIIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPS 472
            ++G++ GNIF++ N+S+++ M   G+  +Q K LNS  N      L FMFGPPFNL  +
Sbjct: 529 HSRGMMEGNIFKDINVSASQSMQPQGNLVDQCKILNSSDN------LQFMFGPPFNLQST 582

Query: 471 DYSEGL--LGVPPLPKKDILSWY 409
           +Y   L  +G    PK+DI  WY
Sbjct: 583 NYPGSLPGIGCDTTPKQDIPIWY 605



>gb:AB063191_1522205 Cucumis melo CmEIL1 mRNA for EIN3-like protein,
           complete cds.
          Length = 693

 Score =  104 bits (259), Expect = 2e-21
 Identities = 62/138 (44%), Positives = 83/138 (60%), Gaps = 8/138 (5%)
 Frame = -1

Query: 828 FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKIS-NPRNSGPAKEQPLQQTNIQCHQGGFL 652
           F LS LGVPEDGQ++ ++LMS YDTNIQGNK + N  NS   + Q L Q  IQ  Q  + 
Sbjct: 472 FRLSTLGVPEDGQKLTSELMSIYDTNIQGNKNNLNTVNSATTENQNLPQLKIQPQQDDYF 531

Query: 651 QNQGI-IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPF-----NVSSIETLPFMFGP 493
           +NQG+ + GN F  SN+SS+  MFT  + QF++ K +NSPF     + ++      MF  
Sbjct: 532 RNQGLMMEGNFFDGSNVSSSHQMFTRDEGQFDRFKPMNSPFENNHHHHNNNNNFHLMFSS 591

Query: 492 PFNLPPSDYSEGLLGVPP 439
           PF+L   DY E +  V P
Sbjct: 592 PFDLSTFDYKEEVPSVQP 609



>gb:CAR404640_1645261 Cicer arietinum mRNA for for hypothetical
           protein, clone Can47.
          Length = 354

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 55/149 (36%), Positives = 79/149 (53%), Gaps = 8/149 (5%)
 Frame = -1

Query: 831 SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL 652
           SF+L+GLGVPEDGQ+MI +LMS YDTN+ GNK ++  N    + Q L Q  IQ  Q  F 
Sbjct: 216 SFDLTGLGVPEDGQKMITELMSIYDTNVIGNKNASSTNCVAVENQNLSQPCIQQQQDNFF 275

Query: 651 QNQGII--PGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVS-SIETLPFMFGPPFNL 481
            +QG++    N F                QF++ K +NSPF  + +   +  MFG P +L
Sbjct: 276 SSQGMVMEAANFFTRDE-----------SQFDRFKPINSPFETNHNNNNIHLMFGSPCDL 324

Query: 480 PPSDYSEGL----LGVPPLPKK-DILSWY 409
              D+ E +    +G+    K+ D+  WY
Sbjct: 325 ASFDFKEDIQLQGVGIDTFHKQPDMSIWY 353



>gb:AF467783_1802440 Vigna radiata transcription factor EIL2 mRNA,
           complete cds.
          Length = 622

 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 55/147 (37%), Positives = 84/147 (57%), Gaps = 8/147 (5%)
 Frame = -1

Query: 825 NLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCH-QGGFLQ 649
           +L+GL V EDG++ I+DLM+ YDTN+QGNK  +  N    +     Q  +Q H Q  F++
Sbjct: 475 DLTGLEVSEDGKKRISDLMTNYDTNVQGNKNMSSCNRVAGEVLNFPQHGMQQHQQDNFIR 534

Query: 648 NQGI-IPGNIFQESNISSTRPMFTSGD-QFEQPKALNSPF--NVSSIETLPFMFGPPFNL 481
            +GI + GN+F E+ +S+    F   + QF++ KALNSPF  N ++      MFG   +L
Sbjct: 535 GRGITMEGNVFDEATMSNNHHTFARDECQFDRFKALNSPFETNHNNNNNFHSMFGSFCDL 594

Query: 480 PPSDYSEGL--LGVPPLPKK-DILSWY 409
              D+ E +  +G+  L K+ D   WY
Sbjct: 595 ASFDFKEDMQGVGMDALQKQTDFSVWY 621



>gb:AB063192_1522206 Cucumis melo CmEIL2 mRNA for EIN3-like protein,
           complete cds.
          Length = 615

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 55/146 (37%), Positives = 73/146 (50%), Gaps = 6/146 (4%)
 Frame = -1

Query: 828 FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQ--TNIQCHQGGF 655
           F +SGLG+PEDGQ+MI+DL+SFYD+N+Q +K  N  N     +   QQ     Q      
Sbjct: 477 FRVSGLGLPEDGQKMISDLLSFYDSNLQQDKHLNSGNLDMQDDHNQQQQLPKFQLQVDDN 536

Query: 654 LQNQGIIPGN---IFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETL-PFMFGPPF 487
           L  Q  + GN   I Q  + SS +  F      E   A +SPF +   + +  F FG PF
Sbjct: 537 LYCQATMVGNTMPIQQHPDFSSNKHPFD-----EYKAAFDSPFGMYPNDNISDFRFGSPF 591

Query: 486 NLPPSDYSEGLLGVPPLPKKDILSWY 409
           NL   DY+        LPK+D   WY
Sbjct: 592 NLASIDYA---AADTQLPKQDTPLWY 614



>gb:AY248907_1592642 Nicotiana tabacum EIL5 mRNA, complete cds.
          Length = 608

 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 50/142 (35%), Positives = 74/142 (52%), Gaps = 1/142 (0%)
 Frame = -1

Query: 831 SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL 652
           S  +SGLG+PEDGQRMI+DL +FYD N+Q N      NS     Q +QQ           
Sbjct: 472 SMTVSGLGLPEDGQRMISDLFTFYDNNLQQNSSICSGNSKILANQNMQQNQTVELPMDDN 531

Query: 651 QNQGIIPGNIFQESNISSTRPMFTSGDQFEQPK-ALNSPFNVSSIETLPFMFGPPFNLPP 475
            N G +     QE++++      ++  Q++Q K   ++PF  +  +   + FG PFN+  
Sbjct: 532 FNLGHMEAEA-QETSMTMNSAYTSTEFQYDQCKLPFDAPFTGNLNDITDYRFGSPFNMGG 590

Query: 474 SDYSEGLLGVPPLPKKDILSWY 409
           SDYS     +  L K+DI +WY
Sbjct: 591 SDYS-----MDQLTKQDISTWY 607



>gb:AF467784_1802441 Vigna radiata transcription factor EIL1 mRNA,
           complete cds.
          Length = 609

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 50/132 (37%), Positives = 67/132 (50%), Gaps = 8/132 (6%)
 Frame = -1

Query: 831 SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQ---- 664
           SF +SGLGVPEDGQ+MINDLM+ YDTNI GN   +  N   A+ Q   QT +Q  Q    
Sbjct: 473 SFAVSGLGVPEDGQKMINDLMTIYDTNIIGNNNLSSNNFVAAENQNFSQTMLQQQQQDSR 532

Query: 663 -GGFLQNQGII-PGNIFQESNISSTRPMFTSGDQFEQPKA--LNSPFNVSSIETLPFMFG 496
              +   QG++  GN F                QFE+ KA  +N+PF     +T   +F 
Sbjct: 533 RDNYFTGQGMMTEGNFFAREE-----------GQFERFKAMNMNAPF-----DTNHMLFS 576

Query: 495 PPFNLPPSDYSE 460
           P  +L   D+ +
Sbjct: 577 PQCDLSSFDFKD 588



>gb:AF387795_1794920 Cucumis melo transcription factor (EIN3) mRNA,
           partial cds.
          Length = 621

 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 49/132 (37%), Positives = 78/132 (59%), Gaps = 12/132 (9%)
 Frame = -1

Query: 804 PEDGQRMINDLMSFYDTNIQGNKIS-NPRNSGPAKEQP---LQQTNIQCHQGGFLQNQGI 637
           PEDGQ++I++L+  YDTNIQGNK + N  NS   + Q    ++++N+  ++    ++QG+
Sbjct: 480 PEDGQKLISELI--YDTNIQGNKNNLNTGNSATTENQKSPSIKRSNL--NKMIDFRDQGL 535

Query: 636 I-PGNIFQESNISSTRPMFTSGD-QFEQPKALNSPF------NVSSIETLPFMFGPPFNL 481
           +  GN F  SN+SS+  MFT  + Q ++ K +NSPF      + ++      MF  PF+L
Sbjct: 536 MMEGNFFDGSNVSSSHQMFTRDEGQSDRFKPMNSPFENNHHHHNNNNNNFHLMFSSPFDL 595

Query: 480 PPSDYSEGLLGV 445
              DY E + GV
Sbjct: 596 STFDYKEEVPGV 607



>gb:AF328786_1786913 Lycopersicon esculentum EIL3 (EIL3) mRNA,
           complete cds.
          Length = 601

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 50/143 (34%), Positives = 73/143 (51%), Gaps = 2/143 (1%)
 Frame = -1

Query: 831 SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL 652
           S + SGLG+PED QR+I+DL++ YD N Q N       S     Q L Q      Q   L
Sbjct: 468 SMSASGLGLPEDDQRIISDLITSYDNNFQQNGSICSGISEILVNQSLPQ-----QQTVEL 522

Query: 651 QNQGIIPGNIFQESNISSTRPMFTSGD-QFEQPK-ALNSPFNVSSIETLPFMFGPPFNLP 478
              G I     + S   ++ P++ S + Q++Q K + ++PF  +  +   + FG PFNL 
Sbjct: 523 PMDGNINLGHMETSAQETSMPVYRSTEFQYDQCKMSFDAPFGGNINDITDYRFGSPFNLG 582

Query: 477 PSDYSEGLLGVPPLPKKDILSWY 409
            SDY+     V  L K+DI +WY
Sbjct: 583 GSDYA-----VEQLTKQDISTWY 600



>gb:PEQ316086_1699812 Phalaenopsis equestris mRNA for
           ethylene-insensitive 3 protein (in3 gene).
          Length = 621

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 35/130 (26%), Positives = 65/130 (50%), Gaps = 5/130 (3%)
 Frame = -1

Query: 828 FNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNI-----QCHQ 664
           F++SGLG+P+DGQ++I +L++ YD+N+   K+S    +G      +Q+T+      +   
Sbjct: 492 FSISGLGLPDDGQKLIAELLNQYDSNMNHGKVSGEVRAG----NEVQKTDTFRLPNEAMS 547

Query: 663 GGFLQNQGIIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFN 484
             F    G     IF+E+N S    +    +Q +Q        N ++  +  F FG  F+
Sbjct: 548 SFFGSKNGGGGSGIFEEANCSQLCSIHEELEQMDQVYQ-----NQATDMSNDFRFGSSFS 602

Query: 483 LPPSDYSEGL 454
            P  D+++ +
Sbjct: 603 SPAMDFADSM 612



>gb:AY728192_1624914 Dianthus caryophyllus ethylene insensitive
           3-like 3 mRNA, complete cds.
          Length = 591

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 41/125 (32%), Positives = 59/125 (47%), Gaps = 3/125 (2%)
 Frame = -1

Query: 825 NLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQN 646
           NL G+G+P+ GQ+MI +LMS YD N          NSG   +  +QQ   + +     Q 
Sbjct: 477 NLQGVGIPDAGQKMIGELMSMYDVN---------NNSGSVNQNVVQQIGFRQNDQIQFQG 527

Query: 645 QGIIPGNIFQESNISSTRPMFTSGDQFE---QPKALNSPFNVSSIETLPFMFGPPFNLPP 475
           +G+   N F  + I   +  F   ++FE   Q  ALNS        TLP     PF+LP 
Sbjct: 528 RGLTQ-NSFGPTAIQMNQIGFNRSNRFEHNMQENALNS--------TLP----SPFDLPF 574

Query: 474 SDYSE 460
            D+ +
Sbjct: 575 IDFMD 579



>sp|O24606|EIN3_ARATH ETHYLENE-INSENSITIVE3
           protein.>gb:AB025629_1516532 Arabidopsis thaliana
           genomic DNA, chromosome 3, P1 clone:
           MOE17.>gb:AY069875_1566621 Arabidopsis thaliana
           AT3g20770/MOE17_6 mRNA, complete
           cds.>gb:AF004216_1760679 Arabidopsis thaliana
           ethylene-insensitive3 (EIN3) mRNA, complete
           cds.>gb:AF004217_1760680 Arabidopsis thaliana
           ethylene-insensitive3 (EIN3) gene, complete cds.
          Length = 628

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 27/74 (36%), Positives = 43/74 (58%)
 Frame = -1

Query: 825 NLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFLQN 646
           +L+G+ VPEDGQ+MI++LMS YD N+Q N+ S    +   +   L Q  +  HQ      
Sbjct: 465 DLTGI-VPEDGQKMISELMSMYDRNVQSNQTSMVMEN---QSVSLLQPTVHNHQEHLQFP 520

Query: 645 QGIIPGNIFQESNI 604
             ++ G+ F++ NI
Sbjct: 521 GNMVEGSFFEDLNI 534



>gb:AF004213_1760676 Arabidopsis thaliana
           ethylene-insensitive3-like1 (EIL1) mRNA, complete cds.
          Length = 584

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 31/78 (39%), Positives = 42/78 (53%), Gaps = 8/78 (10%)
 Frame = -1

Query: 825 NLSGLGVPEDGQRMINDLMSFYDTNIQGNK-----ISNPRNSGPAKEQPLQQTNIQCHQG 661
           +LSG+GVPE+GQ+MI +LM+ YD N+Q N+     + N      AK    QQ N      
Sbjct: 465 DLSGVGVPENGQKMITELMAMYDRNVQSNQTPPTLMENQSMVIDAKAAQNQQLNFNSGNQ 524

Query: 660 GFLQ---NQGIIPGNIFQ 616
            F+Q   N G+   N FQ
Sbjct: 525 MFMQQGTNNGV--NNRFQ 540



>sp|Q9SLH0|EIL1_ARATH ETHYLENE-INSENSITIVE3-like 1
           protein.>pir|B84668|B84668 ethylene-insensitive3-like1
           (EIL1) [imported] - Arabidopsis
           thaliana>gb:AC005623_1532853 Arabidopsis thaliana
           chromosome 2 clone T20P8 map B68, complete
           sequence.>gb:AY065191_1566345 Arabidopsis thaliana
           ethylene-insensitive3-like1 (EIL1) (At2g27050; T20P8.10)
           mRNA, complete cds.>gb:BT003344_1636767 Arabidopsis
           thaliana ethylene-insensitive3-like1 (EIL1) (At2g27050)
           mRNA, complete cds.
          Length = 584

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 31/78 (39%), Positives = 42/78 (53%), Gaps = 8/78 (10%)
 Frame = -1

Query: 825 NLSGLGVPEDGQRMINDLMSFYDTNIQGNK-----ISNPRNSGPAKEQPLQQTNIQCHQG 661
           +LSG+GVPE+GQ+MI +LM+ YD N+Q N+     + N      AK    QQ N      
Sbjct: 465 DLSGVGVPENGQKMITELMAMYDRNVQSNQTPPTLMENQSMVIDAKAAQNQQLNFNSGNQ 524

Query: 660 GFLQ---NQGIIPGNIFQ 616
            F+Q   N G+   N FQ
Sbjct: 525 MFMQQGTNNGV--NNRFQ 540



>gb:AB074971_1523295 Oryza sativa (japonica cultivar-group) OsEIL1
           mRNA for ethylene-insensitive-3-like protein, complete
           cds.
          Length = 640

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 36/122 (29%), Positives = 54/122 (44%), Gaps = 5/122 (4%)
 Frame = -1

Query: 831 SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGGFL 652
           + N    G+P DGQR I +LM+ YD N   NK  +  N+   +        IQ  +G F 
Sbjct: 493 ALNNLDFGLPMDGQRSITELMNMYDNNFVANKNLSNDNATIMERPNAVNPRIQIEEGFFG 552

Query: 651 QNQGI--IPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSSIE---TLPFMFGPPF 487
           Q  GI    G +F++ N    +P  T+  Q +     ++PF     +      F FG  F
Sbjct: 553 QGSGIGGSNGGVFEDVNGMMQQPQQTTPAQQQFFIRDDTPFGNQMGDINGASEFRFGSGF 612

Query: 486 NL 481
           N+
Sbjct: 613 NM 614



>gb:AX077260_1460682 Sequence 3 from Patent WO0105953.
          Length = 647

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 37/138 (26%), Positives = 56/138 (40%), Gaps = 5/138 (3%)
 Frame = -1

Query: 807 VPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQP-LQQTNIQCHQGGFLQNQGIIP 631
           +P DGQR I +LM+ YDTN   +K  +  +S    E+P      IQ  +G F Q  G+  
Sbjct: 511 LPMDGQRSIAELMNMYDTNFMTSKTMSSSDSVTIMERPNAMPQRIQMDEGFFGQGNGVFD 570

Query: 630 G-NIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSS---IETLPFMFGPPFNLPPSDYS 463
             N   +       P+     Q +     ++PF         T  F FG  FN+  +  +
Sbjct: 571 DVNSMMQQQQQQAPPVVQQQQQQQFFIRDDTPFMSQMGDITSTAEFRFGSGFNMSSTAAA 630

Query: 462 EGLLGVPPLPKKDILSWY 409
               G     K D  +W+
Sbjct: 631 ADYPGA--AQKNDGTNWF 646



>gb:AY728193_1624915 Dianthus caryophyllus ethylene insensitive
           3-like 4 mRNA, complete cds.
          Length = 704

 Score = 42.4 bits (98), Expect = 0.011
 Identities = 21/58 (36%), Positives = 34/58 (58%)
 Frame = -1

Query: 831 SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPAKEQPLQQTNIQCHQGG 658
           + + SGLG+PE GQ+ I +L+S YD+N+Q N+  N      ++   L Q N+  +  G
Sbjct: 473 TISASGLGIPEYGQKFIANLISVYDSNLQPNENFNLGTGIASETSDLMQKNMLLNMDG 530



>gb:AX077258_1460681 Sequence 1 from Patent WO0105953.
          Length = 643

 Score = 40.4 bits (93), Expect = 0.041
 Identities = 26/67 (38%), Positives = 35/67 (52%), Gaps = 3/67 (4%)
 Frame = -1

Query: 831 SFNLSGLGVPEDGQRMINDLMSFYDTNIQGNKISNPRNSGPA-KEQP--LQQTNIQCHQG 661
           + N     +P DGQR I +LM+ YD N   NK  NP +   A  E+P  + Q  IQ  +G
Sbjct: 503 ALNSVDFSLPMDGQRSIAELMNMYDNNFVPNK--NPSSDSVAVMERPNAMPQQRIQMDEG 560

Query: 660 GFLQNQG 640
            F+Q  G
Sbjct: 561 FFVQGNG 567



>gb:SCU24241_181682 Sorangium cellulosum acyl-CoA dehydrogenase
            (sorE), beta-hydroxybutyryl-CoA dehydrogenase (sorD),
            putative methoxymalonyl-CoA synthase (sorC), reductase
            (sorR), soraphen polyketide synthase A (sorA), soraphen
            polyketide synthase B (sorB), O-methyltransferase (sorM),
            beta-mannanase, and xylanse-arabinofuranosidase
            bifunctional enzyme genes, complete cds; and unknown
            genes.
          Length = 6315

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 30/101 (29%), Positives = 46/101 (45%), Gaps = 2/101 (1%)
 Frame = +1

Query: 505  EGECLDGADVERG-VQSLGLLELVSRCEHGTSRGNVALLEDIPRDDPLVLKETALMTLNV 681
            +G    GA+  R  +++LG    ++RC+    R   ALL+ IP   PL     A   L+ 
Sbjct: 5911 KGASAPGAEALRSELEALGAAVTLARCDAADPRALQALLDSIPSAHPLTAVVHAAGALDD 5970

Query: 682  GLLKRLFFSRSRVPRIRDFVPLDVCVVERHEIV-DHPLPVF 801
            GL+  +  S  R+ R+  F P        H++  D PL  F
Sbjct: 5971 GLISAM--SPERIDRV--FAPKLDAAWHLHQLTQDKPLAAF 6007



 Score = 32.7 bits (73), Expect = 8.6
 Identities = 31/101 (30%), Positives = 44/101 (43%), Gaps = 2/101 (1%)
 Frame = +1

Query: 505  EGECLDGADVERG-VQSLGLLELVSRCEHGTSRGNVALLEDIPRDDPLVLKETALMTLNV 681
            +G    GA+  R  +++LG    +  C+    R   ALL+ IP   PL     A   L+ 
Sbjct: 3837 QGAHAPGAEASRTELEALGASVTLRACDAADPRALQALLDSIPSAHPLTAVVHAAGALDD 3896

Query: 682  GLLKRLFFSRSRVPRIRDFVPLDVCVVERHEIV-DHPLPVF 801
            GLL  +  S  R+ R+  F P        HE+  D PL  F
Sbjct: 3897 GLLGAM--SPERIDRV--FAPKLDAAWHLHELTQDKPLAAF 3933



>gb:AC024843_1204939 Caenorhabditis elegans cosmid Y61A9LA, complete
           sequence.
          Length = 743

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 27/102 (26%), Positives = 43/102 (42%), Gaps = 9/102 (8%)
 Frame = -1

Query: 801 EDGQRMINDLMSFYDTNIQGNKIS---------NPRNSGPAKEQPLQQTNIQCHQGGFLQ 649
           E  Q+++ DL S  D+   G K++         NP   G  + Q  QQ  +    GGF+ 
Sbjct: 559 EQKQKLVQDLRSLLDSVTMGMKVAAVAQMSQAQNPIQGGLFQHQQQQQQPMMSGGGGFVS 618

Query: 648 NQGIIPGNIFQESNISSTRPMFTSGDQFEQPKALNSPFNVSS 523
              ++P  +  +S       M      F QP+ LN+   +SS
Sbjct: 619 GVQVVPMQVPMQS--YQMPQMQIHHQAFPQPQQLNTTPLLSS 658



>gb:CR555306_105491 Azoarcus sp. EbN1 complete genome.
          Length = 380

 Score = 33.9 bits (76), Expect = 3.9
 Identities = 29/95 (30%), Positives = 40/95 (42%), Gaps = 4/95 (4%)
 Frame = +1

Query: 331 PENGRPNRVAFLVHRAVRRGEAADNLVPAEDVFLWQGWNAK*AFRVIGGWEV----EGRA 498
           P++ RP+RV  +VHRAV+R           D    +G  A    +   GW V       A
Sbjct: 7   PDSARPDRVGRVVHRAVQRPVGR-----LRDRAAGRGSRAVELAQRRAGWRVARHGSAAA 61

Query: 499 KHEGECLDGADVERGVQSLGLLELVSRCEHGTSRG 603
           +  G  L G    R  ++   L   SRCE  + RG
Sbjct: 62  RLVGAVLAGVAPGRPERAGEALHRTSRCERASGRG 96



>gb:BC016426_2092296 Mus musculus homeo box, msh-like 1, mRNA (cDNA
           clone MGC:25404 IMAGE:4923403), complete cds.
          Length = 297

 Score = 32.7 bits (73), Expect = 8.6
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 3/82 (3%)
 Frame = -1

Query: 708 AKEQPLQQTNIQCHQGGFLQNQGIIPGNIFQESNISSTRPM--FTSGDQFEQPK-ALNSP 538
           AKE  L  +      GG +Q+ G  PG++      SS RP+  F+ G   + P+ AL   
Sbjct: 69  AKESVLVASEGAQAAGGSVQHLGTRPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKA 128

Query: 537 FNVSSIETLPFMFGPPFNLPPS 472
            +   ++  P+M  P F+ PP+
Sbjct: 129 ESPEKLDRTPWMQSPRFSPPPA 150



>gb:AF308572_2062365 Mus musculus homeobox protein MSX1 variant
           (Msx1) mRNA, complete cds.
          Length = 303

 Score = 32.7 bits (73), Expect = 8.6
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 3/82 (3%)
 Frame = -1

Query: 708 AKEQPLQQTNIQCHQGGFLQNQGIIPGNIFQESNISSTRPM--FTSGDQFEQPK-ALNSP 538
           AKE  L  +      GG +Q+ G  PG++      SS RP+  F+ G   + P+ AL   
Sbjct: 75  AKESVLVASEGAQAAGGSVQHLGTRPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKA 134

Query: 537 FNVSSIETLPFMFGPPFNLPPS 472
            +   ++  P+M  P F+ PP+
Sbjct: 135 ESPEKLDRTPWMQSPRFSPPPA 156



>gb:AF261654_1781554 Dianthus caryophyllus ethylene-insensitive
           3-like protein 1 (EIL1) mRNA, complete cds.
          Length = 662

 Score = 32.7 bits (73), Expect = 8.6
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 18/101 (17%)
 Frame = -1

Query: 729 NPRNSGPAKEQP-LQQTN-----------IQCHQGGFLQNQGIIPGNIFQESNISSTRPM 586
           N +N+   K++P LQ +N           +Q    G  +    + GNI Q +  S+  P+
Sbjct: 547 NGKNNNQVKQKPSLQMSNGFNGVSPSRQQMQAPMDGGFRGLSNMSGNIPQRTKTSAGHPV 606

Query: 585 FTSG-----DQFEQPKALNSPFNVS-SIETLPFMFGPPFNL 481
           F+SG      Q +Q +  +S F +  + +   F F  PFN+
Sbjct: 607 FSSGGMQQQQQLDQCRTFDSSFPMHLNDDITDFGFNSPFNI 647



>gb:CR380954_1651407 Candida glabrata strain CBS138 chromosome H
           complete sequence.
          Length = 453

 Score = 32.7 bits (73), Expect = 8.6
 Identities = 30/107 (28%), Positives = 45/107 (42%), Gaps = 10/107 (9%)
 Frame = -1

Query: 750 IQGNKISNPRNSGPAKEQPLQQTNIQCHQGG------FLQNQGII----PGNIFQESNIS 601
           + G KI+NP N  P+ EQP+   +++CH+G       FL    I     P  +F+ SNI 
Sbjct: 185 LTGFKIANPFN--PSVEQPVPSFHVECHRGTKEGTLYFLPEIIIFGFKKPILVFESSNIE 242

Query: 600 STRPMFTSGDQFEQPKALNSPFNVSSIETLPFMFGPPFNLPPSDYSE 460
           S                    FNV+ I+ +   +G  F     D +E
Sbjct: 243 S----------ISYSSITRLTFNVTLIKKVDDGYGTKFEFSMIDQTE 279



>pir|A54772|A54772 homeotic protein Msx-1 - mouse>gb:MMHOX71_2115377
           Mouse homeobox Hox-7.1 mRNA.>gb:S73812_2139185
           Msx-1/Hox-7/7.1=Msx-1 [mice, Genomic, 5421 nt].
          Length = 323

 Score = 32.7 bits (73), Expect = 8.6
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 3/82 (3%)
 Frame = -1

Query: 708 AKEQPLQQTNIQCHQGGFLQNQGIIPGNIFQESNISSTRPM--FTSGDQFEQPK-ALNSP 538
           AKE  L  +      GG +Q+ G  PG++      SS RP+  F+ G   + P+ AL   
Sbjct: 69  AKESVLVASEGAQAAGGSVQHLGTRPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKA 128

Query: 537 FNVSSIETLPFMFGPPFNLPPS 472
            +   ++  P+M  P F+ PP+
Sbjct: 129 ESPEKLDRTPWMQSPRFSPPPA 150



>pir|S18813|S18813 homeotic protein Hox 7 - mouse>gb:MMHOX7R_2115378
           Mouse Hox-7 mRNA for homeobox protein, homolog of
           Drosophila Msh gene.
          Length = 299

 Score = 32.7 bits (73), Expect = 8.6
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 3/82 (3%)
 Frame = -1

Query: 708 AKEQPLQQTNIQCHQGGFLQNQGIIPGNIFQESNISSTRPM--FTSGDQFEQPK-ALNSP 538
           AKE  L  +      GG +Q+ G  PG++      SS RP+  F+ G   + P+ AL   
Sbjct: 75  AKESVLVASEGAQAAGGSVQHLGTRPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKA 134

Query: 537 FNVSSIETLPFMFGPPFNLPPS 472
            +   ++  P+M  P F+ PP+
Sbjct: 135 ESPEKLDRTPWMQSPRFSPPPA 156



>pir|B98260|B98260 hypothetical protein AGR_L_1400GM [imported] -
           Agrobacterium tumefaciens (strain C58,
           Cereon)>pir|AG3024|AG3024 histidase hutH [imported] -
           Agrobacterium tumefaciens  (strain C58,
           Dupont)>gb:AE008303_235546 Agrobacterium tumefaciens
           str. C58 linear chromosome, section 107 of 187 of the
           complete sequence.>gb:AE009311_250640 Agrobacterium
           tumefaciens str. C58 linear chromosome, section 81 of
           187 of the complete sequence.>gb:AE007870_1080659
           Agrobacterium tumefaciens str. C58 linear chromosome,
           complete sequence.>gb:AE008689_1088483 Agrobacterium
           tumefaciens str. C58 linear chromosome, complete
           sequence.
          Length = 500

 Score = 32.7 bits (73), Expect = 8.6
 Identities = 16/40 (40%), Positives = 25/40 (62%)
 Frame = +1

Query: 487 EGRAKHEGECLDGADVERGVQSLGLLELVSRCEHGTSRGN 606
           EGR +H+GE + G    +G+++LGL  +V R + G S  N
Sbjct: 156 EGRVRHQGELISG---RQGLEALGLEPIVLRAKEGLSLVN 192



>sp|P13297|MSX1_MOUSE Homeobox protein MSX-1 (Hox-7) (Hox-7.1).
          Length = 293

 Score = 32.7 bits (73), Expect = 8.6
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 3/82 (3%)
 Frame = -1

Query: 708 AKEQPLQQTNIQCHQGGFLQNQGIIPGNIFQESNISSTRPM--FTSGDQFEQPK-ALNSP 538
           AKE  L  +      GG +Q+ G  PG++      SS RP+  F+ G   + P+ AL   
Sbjct: 69  AKESVLVASEGAQAAGGSVQHLGTRPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKA 128

Query: 537 FNVSSIETLPFMFGPPFNLPPS 472
            +   ++  P+M  P F+ PP+
Sbjct: 129 ESPEKLDRTPWMQSPRFSPPPA 150


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 846,795,147
Number of Sequences: 1806583
Number of extensions: 17506798
Number of successful extensions: 46515
Number of sequences better than 10.0: 36
Number of HSP's better than 10.0 without gapping: 43560
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46388
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 55035364698
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)