BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10930
         (631 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP003076_1824650 Oryza sativa (japonica cultivar-group) genom...    61   2e-08   
pir|B86458|B86458 probable protein nitrate transporter NTL1 5408...    57   3e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AY035037_1559815 Arabidopsis thaliana putative oligopeptide t...    56   4e-07   
pir|C96621|C96621 hypothetical protein F23H11.6 [imported] - Ara...    56   4e-07   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00261_1697580 Oryza sativa genomic DNA, chromosome 4, BAC...    52   6e-06   
gb:OSJN00292_1698070 Oryza sativa genomic DNA, chromosome 4, BAC...    52   8e-06   
gb:OSJN00175_1696208 Oryza sativa genomic DNA, chromosome 4, BAC...    52   8e-06   
gb:OSJN00261_1697577 Oryza sativa genomic DNA, chromosome 4, BAC...    49   7e-05   
gb:BT000720_1634993 Arabidopsis thaliana clone RAFL09-73-M24 (R1...    46   5e-04   
gb:AY062453_1565109 Arabidopsis thaliana nitrate transporter (NT...    46   5e-04   
pir|T51361|T51361 nitrate transporter NTL1 [validated] - Arabido...    46   5e-04   Arabidopsis thaliana [mouse-ear cress]
pir|G96720|G96720 nitrate transporter (NTL1), 53025-56402 [impor...    46   5e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AY072134_1567028 Arabidopsis thaliana putative nitrate transp...    46   6e-04   
pir|C86397|C86397 protein T7N9.10 [imported] - Arabidopsis thali...    46   6e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AP003630_1831755 Oryza sativa (japonica cultivar-group) genom...    45   0.001   
gb:AB026647_1517211 Arabidopsis thaliana genomic DNA, chromosome...    45   0.001   
gb:AB009053_1510684 Arabidopsis thaliana genomic DNA, chromosome...    45   0.001   
gb:AP003372_1828661 Oryza sativa (japonica cultivar-group) genom...    40   0.042   
pir|T04378|T04378 peptide transport protein - barley>gb:AF023472...    40   0.042   Hordeum vulgare [barley]
gb:AP002483_1822204 Oryza sativa (japonica cultivar-group) genom...    39   0.055   
gb:AB026647_1517209 Arabidopsis thaliana genomic DNA, chromosome...    39   0.072   
gb:AC092779_1735702 Oryza sativa chromosome 3 BAC OSJNBb0024N19 ...    39   0.094   
gb:AP005869_1859325 Oryza sativa (japonica cultivar-group) genom...    38   0.12    
gb:AP005175_1848772 Oryza sativa (japonica cultivar-group) genom...    38   0.12    
gb:AY099800_1576825 Arabidopsis thaliana putative nitrate transp...    38   0.12    
gb:AB128925_1528356 Prunus persica PpNRT1 gene for nitrate trans...    38   0.12    
gb:AB089677_1524914 Prunus persica PpNRT1 mRNA for nitrate trans...    38   0.12    
pir|T52608|T52608 probable nitrate transporter [imported] - Arab...    38   0.12    Arabidopsis thaliana [mouse-ear cress]
pir|F84663|F84663 probable nitrate transporter [imported] - Arab...    38   0.12    Arabidopsis thaliana [mouse-ear cress]
gb:AP003999_1836131 Oryza sativa (japonica cultivar-group) genom...    38   0.16    
gb:BT005728_1638663 Arabidopsis thaliana clone RAFL15-01-K12 (R2...    37   0.21    
pir|T45958|T45958 oligopeptide transporter-like protein - Arabid...    37   0.21    Arabidopsis thaliana [mouse-ear cress]
gb:AP003791_1833396 Oryza sativa (japonica cultivar-group) genom...    37   0.36    
gb:AP003791_1833395 Oryza sativa (japonica cultivar-group) genom...    37   0.36    
gb:OSJN00261_1697578 Oryza sativa genomic DNA, chromosome 4, BAC...    37   0.36    
gb:AF420016_1798605 Narcissus pseudonarcissus putative low-affin...    36   0.47    
sp|Q05085|CHL1_ARATH|CHL1_ARATH Nitrate/chlorate transporter.>pir|A45772|A4...    36   0.47    Arabidopsis thaliana [mouse-ear cress]
gb:AK117678_1815699 Arabidopsis thaliana At1g72130 mRNA for puta...    36   0.61    
gb:CAR489612_1645347 Cicer arietinum partial mRNA for nitrate tr...    36   0.61    
gb:AY090354_1574104 Arabidopsis thaliana At1g72130/F28P5.1 mRNA,...    36   0.61    
pir|F96744|F96744 probable peptide transporter PTR2-B T9N14.15 [...    36   0.61    Arabidopsis thaliana [mouse-ear cress]
pir|A96710|A96710 hypothetical protein F24J5.19 [imported] - Ara...    36   0.61    Arabidopsis thaliana [mouse-ear cress]
gb:BNU17987_1633659 Brassica napus RCH2 protein mRNA, complete cds.    35   0.80    
gb:BNA278966_1633311 Brassica napus mRNA for nitrate transporter...    35   0.80    
gb:AB052785_1521244 Glycine max mRNA for nitrate transporter NRT...    35   0.80    
gb:AE016953_366159 Enterococcus faecalis V583, section 7 of 11 o...    35   1.0     
gb:AF361587_1791333 Arabidopsis thaliana AT3g53960/F5K20_260 mRN...    35   1.4     
gb:AB020751_1514667 Arabidopsis thaliana genomic DNA, chromosome...    35   1.4     
gb:AY570975_1178672 Xerophyta humilis clone HC323 nitrate transp...    35   1.4     
pir|T45936|T45936 transporter-like protein - Arabidopsis thalian...    35   1.4     Arabidopsis thaliana [mouse-ear cress]
gb:NPL277085_1691079 Nicotiana plumbaginifolia mRNA for putative...    34   1.8     
gb:AP004047_1836888 Oryza sativa (japonica cultivar-group) genom...    34   2.3     
gb:OSJN00149_1695685 Oryza sativa genomic DNA, chromosome 4, BAC...    34   2.3     
gb:AP003905_1835020 Oryza sativa (japonica cultivar-group) genom...    33   3.9     
gb:AP003621_1831570 Oryza sativa (japonica cultivar-group) genom...    33   3.9     
gb:AK118142_1816136 Arabidopsis thaliana At4g21680 mRNA for puta...    33   3.9     
gb:AC093018_1735829 Oryza sativa chromosome 3 BAC OSJNBb0081B07 ...    33   3.9     
pir|T05843|T05843 peptide transport protein homolog F17L22.140 -...    33   3.9     Arabidopsis thaliana [mouse-ear cress]
pir|H96720|H96720 probable peptide transporter T17F3.11 [importe...    33   3.9     Arabidopsis thaliana [mouse-ear cress]
gb:AP005173_1848761 Oryza sativa (japonica cultivar-group) genom...    33   5.2     
gb:AB102808_1526339 Nicotiana tabacum NtNRT1.2-t mRNA for nitrat...    33   5.2     
pir|F86358|F86358 Similar to peptide transporter [imported] - Ar...    33   5.2     Arabidopsis thaliana [mouse-ear cress]
gb:AJ843128_1814513 Plantago major mRNA for putative peptide tra...    32   6.7     
gb:AY084539_1569628 Arabidopsis thaliana clone 111089 mRNA, comp...    32   6.7     
gb:ATH131464_1551986 Arabidopsis thaliana mRNA for nitrate trans...    32   6.7     
gb:AB052784_1521243 Glycine max mRNA for nitrate transporter NRT...    32   6.7     
gb:AB019232_1514187 Arabidopsis thaliana genomic DNA, chromosome...    32   6.7     
pir|T52585|T52585 probable nitrate transporter ntp3 [imported] -...    32   6.7     Arabidopsis thaliana [mouse-ear cress]
gb:AP004994_1846927 Oryza sativa (japonica cultivar-group) genom...    32   8.8     
gb:AP004994_1846925 Oryza sativa (japonica cultivar-group) genom...    32   8.8     
gb:AP004669_1843009 Oryza sativa (japonica cultivar-group) genom...    32   8.8     
gb:AP003566_1830928 Oryza sativa (japonica cultivar-group) genom...    32   8.8     
gb:AP002818_1822868 Oryza sativa (japonica cultivar-group) genom...    32   8.8     
gb:AF016713_1761512 Lycopersicon esculentum oligopeptide transpo...    32   8.8     
gb:AB102807_1526338 Nicotiana tabacum NtNRT1.2-s mRNA for nitrat...    32   8.8     
pir|T24829|T24829 hypothetical protein T11B7.1 - Caenorhabditis ...    32   8.8     Caenorhabditis elegans [roundworm]


>gb:AP003076_1824650 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0481E12.
          Length = 595

 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 23/43 (53%), Positives = 32/43 (74%)
 Frame = -3

Query: 620 APSKKGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           A +  GWL G ++++N+L LF+W LA+LS  NF NYL+WA WY
Sbjct: 537 ATASGGWLAGNNINRNHLDLFFWLLAVLSFLNFLNYLFWASWY 579



>pir|B86458|B86458 probable protein nitrate transporter NTL1
           54085-51470 [imported] - Arabidopsis
           thaliana>gb:AE005172_892158 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC051630_1540096 Arabidopsis thaliana
           chromosome 1 BAC F10C21 genomic sequence, complete
           sequence.
          Length = 596

 Score = 56.6 bits (135), Expect = 3e-07
 Identities = 23/41 (56%), Positives = 29/41 (70%)
 Frame = -3

Query: 614 SKKGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           +K+GWL   DL+K+ L  FYW LA LS  NF NYL+W+ WY
Sbjct: 522 TKEGWLGDNDLNKDRLDHFYWLLASLSFINFFNYLFWSRWY 562



>gb:AY035037_1559815 Arabidopsis thaliana putative oligopeptide
           transporter protein (At1g59740) mRNA, complete
           cds.>gb:AY051041_1562517 Arabidopsis thaliana putative
           oligopeptide transporter protein (At1g59740) mRNA,
           complete cds.
          Length = 591

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 22/38 (57%), Positives = 28/38 (73%)
 Frame = -3

Query: 608 KGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALW 495
           KGWL   DL+K+ L LFYW LA+LS  NF +YL+W+ W
Sbjct: 536 KGWLGENDLNKDRLDLFYWLLAVLSLLNFLSYLFWSRW 573



>pir|C96621|C96621 hypothetical protein F23H11.6 [imported] -
           Arabidopsis thaliana>gb:AE005173_893657 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC007258_1535658 Arabidopsis thaliana
           chromosome I BAC F23H11 genomic sequence, complete
           sequence.
          Length = 474

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 22/38 (57%), Positives = 28/38 (73%)
 Frame = -3

Query: 608 KGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALW 495
           KGWL   DL+K+ L LFYW LA+LS  NF +YL+W+ W
Sbjct: 419 KGWLGENDLNKDRLDLFYWLLAVLSLLNFLSYLFWSRW 456



>gb:OSJN00261_1697580 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0076N16, complete sequence.
          Length = 557

 Score = 52.4 bits (124), Expect = 6e-06
 Identities = 20/39 (51%), Positives = 27/39 (69%)
 Frame = -3

Query: 608 KGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           +GWLEG  L+ ++L LFYW +A++    F NYLYWA  Y
Sbjct: 501 RGWLEGTSLNNSHLDLFYWVVAVIGLLGFLNYLYWAKKY 539



>gb:OSJN00292_1698070 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: P0076O17, complete sequence.
          Length = 621

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 23/38 (60%), Positives = 25/38 (65%)
 Frame = -3

Query: 605 GWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           GWL   DLDK+ L LFYW LA+LS  NF  YL  A WY
Sbjct: 555 GWLGDNDLDKDRLDLFYWMLAVLSVINFFCYLLCARWY 592



>gb:OSJN00175_1696208 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0064D20, complete sequence.
          Length = 611

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 23/38 (60%), Positives = 25/38 (65%)
 Frame = -3

Query: 605 GWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           GWL   DLDK+ L LFYW LA+LS  NF  YL  A WY
Sbjct: 545 GWLGDNDLDKDRLDLFYWMLAVLSVINFFCYLLCARWY 582



>gb:OSJN00261_1697577 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0076N16, complete sequence.
          Length = 572

 Score = 48.9 bits (115), Expect = 7e-05
 Identities = 20/38 (52%), Positives = 24/38 (63%)
 Frame = -3

Query: 605 GWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           GWLEG  L+ + L LFYW +A +    F NYLYWA  Y
Sbjct: 514 GWLEGATLNTSRLDLFYWVVAAVGLLGFVNYLYWASRY 551



>gb:BT000720_1634993 Arabidopsis thaliana clone RAFL09-73-M24
           (R19648) putative nitrate transporter (NTL1) (At1g69850)
           mRNA, complete cds.
          Length = 585

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 16/37 (43%), Positives = 25/37 (67%)
 Frame = -3

Query: 602 WLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           WL G+ +++  L  FYW + +LS  NF +YL+WA+ Y
Sbjct: 540 WLRGKSINRYKLDYFYWLMCVLSAANFLHYLFWAMRY 576



>gb:AY062453_1565109 Arabidopsis thaliana nitrate transporter (NTL1)
           (At1g69850; T17F3.12) mRNA, complete
           cds.>gb:BT002561_1636164 Arabidopsis thaliana nitrate
           transporter (NTL1) (At1g69850) mRNA, complete cds.
          Length = 585

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 16/37 (43%), Positives = 25/37 (67%)
 Frame = -3

Query: 602 WLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           WL G+ +++  L  FYW + +LS  NF +YL+WA+ Y
Sbjct: 540 WLRGKSINRYKLDYFYWLMCVLSAANFLHYLFWAMRY 576



>pir|T51361|T51361 nitrate transporter NTL1 [validated] -
           Arabidopsis thaliana>gb:AF073361_1765921 Arabidopsis
           thaliana nitrate transporter NTL1 (NRT1:2) mRNA,
           complete cds.
          Length = 585

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 16/37 (43%), Positives = 25/37 (67%)
 Frame = -3

Query: 602 WLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           WL G+ +++  L  FYW + +LS  NF +YL+WA+ Y
Sbjct: 540 WLRGKSINRYKLDYFYWLMCVLSAANFLHYLFWAMRY 576



>pir|G96720|G96720 nitrate transporter (NTL1), 53025-56402
           [imported] - Arabidopsis thaliana>gb:AE005173_894569
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010675_1537005 Arabidopsis thaliana
           chromosome 1 BAC T17F3 genomic sequence, complete
           sequence.
          Length = 600

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 16/37 (43%), Positives = 25/37 (67%)
 Frame = -3

Query: 602 WLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           WL G+ +++  L  FYW + +LS  NF +YL+WA+ Y
Sbjct: 555 WLRGKSINRYKLDYFYWLMCVLSAANFLHYLFWAMRY 591



>gb:AY072134_1567028 Arabidopsis thaliana putative nitrate
           transporter protein (At1g27040) mRNA, complete
           cds.>gb:AY096445_1575989 Arabidopsis thaliana putative
           nitrate transporter (At1g27040) mRNA, complete cds.
          Length = 567

 Score = 45.8 bits (107), Expect = 6e-04
 Identities = 19/37 (51%), Positives = 26/37 (70%)
 Frame = -3

Query: 602 WLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           WL G+ L++N L LFYW + +LS  NF +YL+WA  Y
Sbjct: 523 WL-GEKLNRNRLDLFYWLMCVLSVVNFLHYLFWAKRY 558



>pir|C86397|C86397 protein T7N9.10 [imported] - Arabidopsis
           thaliana>gb:AE005172_891583 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC000348_1530062 Genomic sequence for
           Arabidopsis thaliana BAC T7N9 from chromosome I,
           complete sequence.
          Length = 563

 Score = 45.8 bits (107), Expect = 6e-04
 Identities = 19/37 (51%), Positives = 26/37 (70%)
 Frame = -3

Query: 602 WLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           WL G+ L++N L LFYW + +LS  NF +YL+WA  Y
Sbjct: 519 WL-GEKLNRNRLDLFYWLMCVLSVVNFLHYLFWAKRY 554



>gb:AP003630_1831755 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0566A10.
          Length = 590

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 15/40 (37%), Positives = 28/40 (70%)
 Frame = -3

Query: 611 KKGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           ++ WL+G++L+  +L  FYW + +LS  N+  +L+WA+ Y
Sbjct: 541 RRAWLQGENLNHYHLERFYWVMCVLSTLNYLFFLFWAIRY 580



>gb:AB026647_1517211 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MJL12.
          Length = 521

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 18/37 (48%), Positives = 24/37 (64%)
 Frame = -3

Query: 602 WLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           WL G+DL+K  L LFY  L +L+  N  NY++WA  Y
Sbjct: 485 WLGGEDLNKTRLELFYVLLCVLNTLNLLNYIFWAKRY 521



>gb:AB009053_1510684 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MQB2.
          Length = 558

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 17/37 (45%), Positives = 26/37 (70%)
 Frame = -3

Query: 602 WLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           WL G++L++ +L  FYW + +LS  NF +YL+WA  Y
Sbjct: 515 WLLGENLNQYHLERFYWLMCVLSGINFLHYLFWASRY 551



>gb:AP003372_1828661 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:OJ1014_G12.>gb:AP003443_1829452 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:B1144D11.
          Length = 587

 Score = 39.7 bits (91), Expect = 0.042
 Identities = 18/36 (50%), Positives = 22/36 (61%)
 Frame = -3

Query: 602 WLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALW 495
           WL G  +D++ L  FYW LA+LS  N A YL  A W
Sbjct: 528 WL-GDTIDRSRLDYFYWLLAVLSVLNLAAYLVCAKW 562



>pir|T04378|T04378 peptide transport protein -
           barley>gb:AF023472_1762048 Hordeum vulgare peptide
           transporter (ptr1) mRNA, complete cds.
          Length = 579

 Score = 39.7 bits (91), Expect = 0.042
 Identities = 19/40 (47%), Positives = 25/40 (62%)
 Frame = -3

Query: 611 KKGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           K+GW+   +L+  +L  F+W LA LS  NFA YL  A WY
Sbjct: 522 KQGWIP-DNLNVGHLDYFFWLLAALSLVNFAVYLLIASWY 560



>gb:AP002483_1822204 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0019D06.>gb:AP003311_1827798
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 1, PAC clone:P0024G09.
          Length = 580

 Score = 39.3 bits (90), Expect = 0.055
 Identities = 17/38 (44%), Positives = 24/38 (63%)
 Frame = -3

Query: 605 GWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           GW+   +L++ +L  F+W LA+LS  NF  YL  A WY
Sbjct: 525 GWIP-DNLNRGHLDYFFWLLAVLSLINFGVYLVIASWY 561



>gb:AB026647_1517209 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MJL12.
          Length = 515

 Score = 38.9 bits (89), Expect = 0.072
 Identities = 17/38 (44%), Positives = 24/38 (63%)
 Frame = -3

Query: 605 GWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           GWL   DL+++ L LFY  L +L+  N  NY++WA  Y
Sbjct: 479 GWLR-DDLNESRLELFYLVLCVLNTLNLFNYIFWAKRY 515



>gb:AC092779_1735702 Oryza sativa chromosome 3 BAC OSJNBb0024N19
           genomic sequence, complete sequence.
          Length = 587

 Score = 38.5 bits (88), Expect = 0.094
 Identities = 17/37 (45%), Positives = 22/37 (59%)
 Frame = -3

Query: 602 WLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           WL  QDL+K  L LFYW +A +  FN   ++  A WY
Sbjct: 544 WL-AQDLNKGRLDLFYWMIAGIGIFNIIYFMICAKWY 579



>gb:AP005869_1859325 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:B1026C12.
          Length = 572

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 17/38 (44%), Positives = 24/38 (63%)
 Frame = -3

Query: 605 GWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           GW+   +L++ +L  F+W LA LS  NF  YL+ A WY
Sbjct: 522 GWIP-DNLNRGHLDYFFWLLAALSAVNFLVYLWIANWY 558



>gb:AP005175_1848772 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OSJNBb0040H10.>gb:AP005809_1858247 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBb0039M16.
          Length = 577

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 17/38 (44%), Positives = 24/38 (63%)
 Frame = -3

Query: 605 GWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           GW+   DL+K +L  +YW LA +S  NF  Y+Y+A  Y
Sbjct: 532 GWIP-DDLNKGHLDYYYWCLAAISAVNFVVYIYFASKY 568



>gb:AY099800_1576825 Arabidopsis thaliana putative nitrate
           transporter (At2g26690) mRNA, complete cds.
          Length = 577

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 17/38 (44%), Positives = 22/38 (57%)
 Frame = -3

Query: 605 GWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           GWL   +++   L  FYW L ILS  NF  Y+  ALW+
Sbjct: 519 GWL-ADNINHGRLDYFYWLLVILSGINFVVYIICALWF 555



>gb:AB128925_1528356 Prunus persica PpNRT1 gene for nitrate
           transporter, partial cds.
          Length = 594

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 18/39 (46%), Positives = 23/39 (58%)
 Frame = -3

Query: 608 KGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           K WL   +L++  L  FYW LA+LS  N   YL+ A WY
Sbjct: 536 KPWL-ADNLNQGKLYDFYWLLALLSALNLVIYLFCANWY 573



>gb:AB089677_1524914 Prunus persica PpNRT1 mRNA for nitrate
           transporter, complete cds.
          Length = 596

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 18/39 (46%), Positives = 23/39 (58%)
 Frame = -3

Query: 608 KGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           K WL   +L++  L  FYW LA+LS  N   YL+ A WY
Sbjct: 536 KPWL-ADNLNQGKLYDFYWLLALLSALNLVIYLFCANWY 573



>pir|T52608|T52608 probable nitrate transporter [imported] -
           Arabidopsis thaliana>gb:ATH011604_1551926 Arabidopsis
           thaliana mRNA for nitrate transporter.
          Length = 577

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 17/38 (44%), Positives = 22/38 (57%)
 Frame = -3

Query: 605 GWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           GWL   +++   L  FYW L ILS  NF  Y+  ALW+
Sbjct: 519 GWL-ADNINHGRLDYFYWLLVILSGINFVVYIICALWF 555



>pir|F84663|F84663 probable nitrate transporter [imported] -
           Arabidopsis thaliana>gb:AC003105_1531086 Arabidopsis
           thaliana chromosome 2 clone F18A8 map B68, complete
           sequence.
          Length = 586

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 17/38 (44%), Positives = 22/38 (57%)
 Frame = -3

Query: 605 GWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           GWL   +++   L  FYW L ILS  NF  Y+  ALW+
Sbjct: 528 GWL-ADNINHGRLDYFYWLLVILSGINFVVYIICALWF 564



>gb:AP003999_1836131 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1115_A05.>gb:AP006161_1861123 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:B1267B06.
          Length = 609

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 18/40 (45%), Positives = 24/40 (60%)
 Frame = -3

Query: 620 APSKKGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWA 501
           A ++  W+   DLD   L LFYW LA+L   NFA +L +A
Sbjct: 524 AATRGAWIRN-DLDAGRLDLFYWMLAVLGVANFAVFLVFA 562



>gb:BT005728_1638663 Arabidopsis thaliana clone RAFL15-01-K12
           (R20132) putative oligopeptide transporter protein
           (At5g01180) mRNA, partial cds.
          Length = 512

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 17/40 (42%), Positives = 25/40 (62%)
 Frame = -3

Query: 611 KKGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           + GW+  ++L+  +L  F+W LA LS  NF  YL+ A WY
Sbjct: 464 RPGWI-AKNLNNGHLDYFFWLLAGLSFLNFLVYLWIAKWY 502



>pir|T45958|T45958 oligopeptide transporter-like protein -
           Arabidopsis thaliana>gb:ATF7J8_1550997 Arabidopsis
           thaliana DNA chromosome 5, BAC clone F7J8 (ESSA
           project).
          Length = 570

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 17/40 (42%), Positives = 25/40 (62%)
 Frame = -3

Query: 611 KKGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           + GW+  ++L+  +L  F+W LA LS  NF  YL+ A WY
Sbjct: 522 RPGWI-AKNLNNGHLDYFFWLLAGLSFLNFLVYLWIAKWY 560



>gb:AP003791_1833396 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:B1065G12.>gb:AP006757_1862932 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0551C06.
          Length = 545

 Score = 36.6 bits (83), Expect = 0.36
 Identities = 16/38 (42%), Positives = 22/38 (57%)
 Frame = -3

Query: 605 GWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           GW+   D+++ +L  F+W L  L   NFA YL  A WY
Sbjct: 502 GWIP-DDINRGHLDYFFWLLTALCVANFAAYLLIARWY 538



>gb:AP003791_1833395 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:B1065G12.>gb:AP006757_1862931 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0551C06.
          Length = 557

 Score = 36.6 bits (83), Expect = 0.36
 Identities = 16/38 (42%), Positives = 24/38 (63%)
 Frame = -3

Query: 605 GWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           GW+   ++++ +L  F+W LA+L   NFA YL  A WY
Sbjct: 514 GWIP-DNINRGHLDDFFWLLAVLCVANFAAYLLIARWY 550



>gb:OSJN00261_1697578 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0076N16, complete sequence.
          Length = 448

 Score = 36.6 bits (83), Expect = 0.36
 Identities = 15/44 (34%), Positives = 23/44 (52%)
 Frame = -3

Query: 623 LAPSKKGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           L  + +GWL+G + ++  L  F+  LA      F NY +WA  Y
Sbjct: 387 LGDNGRGWLDGTNFNRTRLDRFFLLLATFELVAFINYAFWARRY 430



>gb:AF420016_1798605 Narcissus pseudonarcissus putative low-affinity
           nitrate transporter mRNA, partial cds.
          Length = 123

 Score = 36.2 bits (82), Expect = 0.47
 Identities = 17/37 (45%), Positives = 21/37 (56%)
 Frame = -3

Query: 602 WLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           WL   DL++  L  FYW LA+LS  N   +L  A WY
Sbjct: 76  WLP-DDLNRGKLYDFYWLLAVLSAVNLVAFLVSARWY 111



>sp|Q05085|CHL1_ARATH Nitrate/chlorate
           transporter.>pir|A45772|A45772 nitrate-inducible nitrate
           transporter - Arabidopsis thaliana>gb:ATHCHL1A_1553107
           Arabidopsis thaliana chlorate/nitrate transporter (CHL1)
           mRNA, complete cds.>gb:BT002016_1635619 Arabidopsis
           thaliana putative NPK1-related protein kinase 2
           (At1g12110) mRNA, complete cds.>gb:BT008783_1639979
           Arabidopsis thaliana At1g12110 gene, complete
           cds.>gb:F12F1_1677332 Arabidopsis thaliana chromosome 1
           BAC F12F1 sequence, complete sequence.
          Length = 590

 Score = 36.2 bits (82), Expect = 0.47
 Identities = 15/37 (40%), Positives = 22/37 (59%)
 Frame = -3

Query: 602 WLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           W+   DL+K  L  FYW +A+L   NF  +L ++ WY
Sbjct: 531 WI-ADDLNKGRLYNFYWLVAVLVALNFLIFLVFSKWY 566



>gb:AK117678_1815699 Arabidopsis thaliana At1g72130 mRNA for
           putative peptide transporter PTR2-B, complete cds,
           clone: RAFL17-34-C15.
          Length = 499

 Score = 35.8 bits (81), Expect = 0.61
 Identities = 17/40 (42%), Positives = 24/40 (60%)
 Frame = -3

Query: 611 KKGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           ++ W +  DLD+ +L  FYW LA L    FA YL++A  Y
Sbjct: 453 QRSWFDN-DLDQAHLDYFYWLLACLGFIGFAFYLWFAKSY 491



>gb:CAR489612_1645347 Cicer arietinum partial mRNA for nitrate
           transporter (ntp gene).
          Length = 201

 Score = 35.8 bits (81), Expect = 0.61
 Identities = 17/39 (43%), Positives = 23/39 (58%)
 Frame = -3

Query: 608 KGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           +GWL   +++K  L LF+  L ILS  NF  +L  A WY
Sbjct: 140 QGWL-ADNINKGRLDLFFALLTILSFINFVAFLVCAFWY 177



>gb:AY090354_1574104 Arabidopsis thaliana At1g72130/F28P5.1 mRNA,
           complete cds.>gb:BT000836_1635091 Arabidopsis thaliana
           putative oligopeptide transporter (At1g72130/F28P5.1)
           mRNA, complete cds.
          Length = 538

 Score = 35.8 bits (81), Expect = 0.61
 Identities = 17/40 (42%), Positives = 24/40 (60%)
 Frame = -3

Query: 611 KKGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           ++ W +  DLD+ +L  FYW LA L    FA YL++A  Y
Sbjct: 492 QRSWFDN-DLDQAHLDYFYWLLACLGFIGFAFYLWFAKSY 530



>pir|F96744|F96744 probable peptide transporter PTR2-B T9N14.15
           [imported] - Arabidopsis thaliana>gb:AE005173_894760
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC067754_1540312 Arabidopsis thaliana
           chromosome 1 BAC T9N14 genomic sequence, complete
           sequence.
          Length = 812

 Score = 35.8 bits (81), Expect = 0.61
 Identities = 17/40 (42%), Positives = 24/40 (60%)
 Frame = -3

Query: 611 KKGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           ++ W +  DLD+ +L  FYW LA L    FA YL++A  Y
Sbjct: 492 QRSWFDN-DLDQAHLDYFYWLLACLGFIGFAFYLWFAKSY 530



>pir|A96710|A96710 hypothetical protein F24J5.19 [imported] -
           Arabidopsis thaliana>gb:AE005173_894478 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AY091784_1574742 Arabidopsis thaliana
           At1g68570/F24J5_7 mRNA, complete
           cds.>gb:BT002278_1635881 Arabidopsis thaliana
           At1g68570/F24J5_7 mRNA, complete cds.>gb:F24J5_1678009
           Arabidopsis thaliana chromosome 1 BAC F24J5 sequence,
           complete sequence.
          Length = 596

 Score = 35.8 bits (81), Expect = 0.61
 Identities = 14/42 (33%), Positives = 20/42 (47%)
 Frame = -3

Query: 617 PSKKGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           P    WL   +L++  L  FYW + +L   N   YL+ A  Y
Sbjct: 524 PDGSNWLPDNNLNRGRLEYFYWLITVLQAVNLVYYLWCAKIY 565



>gb:BNU17987_1633659 Brassica napus RCH2 protein mRNA, complete cds.
          Length = 589

 Score = 35.4 bits (80), Expect = 0.80
 Identities = 14/37 (37%), Positives = 22/37 (59%)
 Frame = -3

Query: 602 WLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           W+   DL+K  L  FYW +A++   NF  +L ++ WY
Sbjct: 530 WI-ADDLNKGRLYNFYWLVAVIVALNFLVFLVFSKWY 565



>gb:BNA278966_1633311 Brassica napus mRNA for nitrate transporter
           (nrt1 gene).
          Length = 588

 Score = 35.4 bits (80), Expect = 0.80
 Identities = 14/37 (37%), Positives = 22/37 (59%)
 Frame = -3

Query: 602 WLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           W+   DL+K  L  FYW +A++   NF  +L ++ WY
Sbjct: 529 WI-ADDLNKGRLYNFYWLVAVIVALNFLVFLVFSKWY 564



>gb:AB052785_1521244 Glycine max mRNA for nitrate transporter
           NRT1-2, complete cds.
          Length = 605

 Score = 35.4 bits (80), Expect = 0.80
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 1/47 (2%)
 Frame = -3

Query: 629 KALAPSKKG-WLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           +A A S  G WL  QDL+K  L  FY+ +  L+  NF  ++  A WY
Sbjct: 531 RATAKSSTGNWLP-QDLNKGRLDYFYYIITALAVVNFGYFILCAKWY 576



>gb:AE016953_366159 Enterococcus faecalis V583, section 7 of 11 of
           the complete genome.>gb:AE016830_992647 Enterococcus
           faecalis V583, complete genome.
          Length = 473

 Score = 35.0 bits (79), Expect = 1.0
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 10/48 (20%)
 Frame = -3

Query: 605 GWLEG----------QDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           GW++G          ++LDK NL   +W+LAI  C   A  + WA ++
Sbjct: 61  GWIDGIYLKIGGEEYENLDKRNLGSQFWYLAIFECCISAFVILWAYFF 108



>gb:AF361587_1791333 Arabidopsis thaliana AT3g53960/F5K20_260 mRNA,
           complete cds.
          Length = 310

 Score = 34.7 bits (78), Expect = 1.4
 Identities = 17/41 (41%), Positives = 24/41 (58%)
 Frame = -3

Query: 614 SKKGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           S KGW  G+DL+ + L  FYW LA L+  N   ++  A+ Y
Sbjct: 239 SGKGWF-GKDLNSSRLDRFYWMLAALTAANICCFVIVAMRY 278



>gb:AB020751_1514667 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MRG21.
          Length = 616

 Score = 34.7 bits (78), Expect = 1.4
 Identities = 16/37 (43%), Positives = 23/37 (62%)
 Frame = -3

Query: 602 WLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           WL  +DL+K  L LFY+ +A +   NFA +L  + WY
Sbjct: 554 WL-AEDLNKGRLDLFYFMIAGILAVNFAYFLVMSRWY 589



>gb:AY570975_1178672 Xerophyta humilis clone HC323 nitrate
           transporter mRNA, partial cds.
          Length = 275

 Score = 34.7 bits (78), Expect = 1.4
 Identities = 16/39 (41%), Positives = 22/39 (56%)
 Frame = -3

Query: 608 KGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           K WL G DL+K  L  +Y+F+A L   N   ++  A WY
Sbjct: 211 KNWLAG-DLNKGRLDYYYFFIAGLGVLNLVYFMMCAKWY 248



>pir|T45936|T45936 transporter-like protein - Arabidopsis
           thaliana>gb:ATF5K20_1550800 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F5K20.
          Length = 620

 Score = 34.7 bits (78), Expect = 1.4
 Identities = 17/41 (41%), Positives = 24/41 (58%)
 Frame = -3

Query: 614 SKKGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           S KGW  G+DL+ + L  FYW LA L+  N   ++  A+ Y
Sbjct: 531 SGKGWF-GKDLNSSRLDRFYWMLAALTAANICCFVIVAMRY 570



>gb:NPL277085_1691079 Nicotiana plumbaginifolia mRNA for putative
           low-affinity nitrate transporter (nrt1.2 gene).
          Length = 594

 Score = 34.3 bits (77), Expect = 1.8
 Identities = 17/36 (47%), Positives = 22/36 (61%)
 Frame = -3

Query: 614 SKKGWLEGQDLDKNNLALFYWFLAILSCFNFANYLY 507
           +K  WL   +L++  L  FYW LAILS FN   +LY
Sbjct: 533 TKNPWL-ADNLNQGRLYDFYWLLAILSVFNLMFFLY 567



>gb:AP004047_1836888 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1191_G08.>gb:AP004098_1837706 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ2056_H01.
          Length = 584

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 16/40 (40%), Positives = 25/40 (62%)
 Frame = -3

Query: 611 KKGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           + GW+ G +L+  +L  FY+ LA LS  + A Y+  A+WY
Sbjct: 527 RPGWIPG-NLNSGHLDRFYFLLAALSLVDLAVYVACAVWY 565



>gb:OSJN00149_1695685 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0060P14, complete sequence.
          Length = 592

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 17/40 (42%), Positives = 22/40 (55%)
 Frame = -3

Query: 620 APSKKGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWA 501
           A ++  W+    LD   L LFYW LA L   NFA +L +A
Sbjct: 519 AATRGAWIR-DGLDDGRLDLFYWMLAALGVANFAAFLVFA 557



>gb:AP003905_1835020 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1177_E11.
          Length = 603

 Score = 33.1 bits (74), Expect = 3.9
 Identities = 18/44 (40%), Positives = 21/44 (47%)
 Frame = -3

Query: 623 LAPSKKGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           L   +  WL   DL+K  L  FYW LA +   N   YL  A WY
Sbjct: 536 LTGDRHPWL-ADDLNKGQLHKFYWLLAGVCLANLLVYLVAARWY 578



>gb:AP003621_1831570 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0621D05.>gb:AP003761_1833087 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0018H04.
          Length = 569

 Score = 33.1 bits (74), Expect = 3.9
 Identities = 14/40 (35%), Positives = 24/40 (60%)
 Frame = -3

Query: 611 KKGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           + GW+   DL++ +L  F+W +A L C N A ++  A+ Y
Sbjct: 525 RPGWIP-DDLNEGHLDRFFWMMAGLGCLNLAAFMSCAMKY 563



>gb:AK118142_1816136 Arabidopsis thaliana At4g21680 mRNA for
           putative peptide transporter, complete cds, clone:
           RAFL19-44-G15.
          Length = 589

 Score = 33.1 bits (74), Expect = 3.9
 Identities = 16/38 (42%), Positives = 24/38 (63%)
 Frame = -3

Query: 605 GWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           GW+  ++L+K +L  FY+ LA L+  +F  YL  A WY
Sbjct: 534 GWIP-ENLNKGHLERFYFLLAGLTAADFVVYLICAKWY 570



>gb:AC093018_1735829 Oryza sativa chromosome 3 BAC OSJNBb0081B07
           genomic sequence, complete sequence.
          Length = 585

 Score = 33.1 bits (74), Expect = 3.9
 Identities = 16/38 (42%), Positives = 21/38 (55%)
 Frame = -3

Query: 605 GWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           GW  G+DL+ + L LFYW LA +   N   Y+  A  Y
Sbjct: 519 GWF-GKDLNSSRLDLFYWLLACIGVANLVFYVVIATRY 555



>pir|T05843|T05843 peptide transport protein homolog F17L22.140 -
           Arabidopsis thaliana>gb:ATCHRIV55_1546005 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           55.>gb:ATF17L22_1548990 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F17L22 (ESSAII project).
          Length = 576

 Score = 33.1 bits (74), Expect = 3.9
 Identities = 16/38 (42%), Positives = 24/38 (63%)
 Frame = -3

Query: 605 GWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           GW+  ++L+K +L  FY+ LA L+  +F  YL  A WY
Sbjct: 521 GWIP-ENLNKGHLERFYFLLAGLTAADFVVYLICAKWY 557



>pir|H96720|H96720 probable peptide transporter T17F3.11 [imported]
           - Arabidopsis thaliana>gb:AE005173_894570 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010675_1537004 Arabidopsis thaliana
           chromosome 1 BAC T17F3 genomic sequence, complete
           sequence.
          Length = 555

 Score = 33.1 bits (74), Expect = 3.9
 Identities = 16/39 (41%), Positives = 23/39 (58%)
 Frame = -3

Query: 608 KGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           + WL   D+DK+ L  FY+F+A LS  NF  + + A  Y
Sbjct: 509 QSWLT-DDIDKSKLDCFYYFIAALSTLNFIFFFWCARRY 546



>gb:AP005173_1848761 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OSJNBb0003E08.
          Length = 618

 Score = 32.7 bits (73), Expect = 5.2
 Identities = 17/45 (37%), Positives = 23/45 (51%)
 Frame = -3

Query: 626 ALAPSKKGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           A A    GWL  +DL+K  L  FY  +A +   NF  ++  A WY
Sbjct: 546 ASAGDDGGWL-AEDLNKGRLDWFYLLIAAIGAANFLAFVACAKWY 589



>gb:AB102808_1526339 Nicotiana tabacum NtNRT1.2-t mRNA for nitrate
           transporter, complete cds.
          Length = 594

 Score = 32.7 bits (73), Expect = 5.2
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = -3

Query: 602 WLEGQDLDKNNLALFYWFLAILSCFNFANYLY 507
           WL   +L++  L  FYW LAILS FN   +LY
Sbjct: 537 WL-ADNLNQGRLYDFYWLLAILSVFNLMFFLY 567



>pir|F86358|F86358 Similar to peptide transporter [imported] -
           Arabidopsis thaliana>gb:AE005172_891207 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC006551_1534439 Arabidopsis thaliana
           chromosome I BAC F12K8 genomic sequence, complete
           sequence.
          Length = 570

 Score = 32.7 bits (73), Expect = 5.2
 Identities = 18/46 (39%), Positives = 25/46 (54%)
 Frame = -3

Query: 629 KALAPSKKGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           KA + S +      +L++ +L  FYW LA LS    A+YLY A  Y
Sbjct: 517 KATSQSGQASWFANNLNQAHLDYFYWLLACLSFIGLASYLYVAKSY 562



>gb:AJ843128_1814513 Plantago major mRNA for putative peptide
           transporter (ptr1 gene).
          Length = 159

 Score = 32.3 bits (72), Expect = 6.7
 Identities = 16/38 (42%), Positives = 22/38 (57%)
 Frame = -3

Query: 605 GWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           GW    +L+K +L  FYW LA LS    + Y+Y+A  Y
Sbjct: 117 GWF-ADNLNKAHLDYFYWLLAGLSTVGLSAYIYFARSY 153



>gb:AY084539_1569628 Arabidopsis thaliana clone 111089 mRNA,
           complete sequence.
          Length = 590

 Score = 32.3 bits (72), Expect = 6.7
 Identities = 14/37 (37%), Positives = 21/37 (56%)
 Frame = -3

Query: 608 KGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWAL 498
           K WL   +L+K  L  FYW L +L   NF  ++ +A+
Sbjct: 518 KSWLRS-NLNKARLNYFYWLLVVLGALNFLIFIVFAM 553



>gb:ATH131464_1551986 Arabidopsis thaliana mRNA for nitrate
           transporter, partial.
          Length = 567

 Score = 32.3 bits (72), Expect = 6.7
 Identities = 14/37 (37%), Positives = 21/37 (56%)
 Frame = -3

Query: 608 KGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWAL 498
           K WL   +L+K  L  FYW L +L   NF  ++ +A+
Sbjct: 495 KSWLRS-NLNKARLNYFYWLLVVLGALNFLIFIVFAM 530



>gb:AB052784_1521243 Glycine max mRNA for nitrate transporter
           NRT1-1, complete cds.
          Length = 597

 Score = 32.3 bits (72), Expect = 6.7
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 1/47 (2%)
 Frame = -3

Query: 629 KALAPSKKG-WLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           +A A S  G WL  QDL+K  L   Y+ +  L   NF  ++  A WY
Sbjct: 523 RATAKSSTGNWLP-QDLNKGRLDRLYYIITALEVVNFGYFILCAKWY 568



>gb:AB019232_1514187 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MIL23.>gb:AY143946_1583403 Arabidopsis
           thaliana At3g21670/MIL23_23 mRNA, complete
           cds.>gb:AF372959_1792672 Arabidopsis thaliana
           AT3g21670/MIL23_23 mRNA, complete cds.
          Length = 590

 Score = 32.3 bits (72), Expect = 6.7
 Identities = 14/37 (37%), Positives = 21/37 (56%)
 Frame = -3

Query: 608 KGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWAL 498
           K WL   +L+K  L  FYW L +L   NF  ++ +A+
Sbjct: 518 KSWLRS-NLNKARLNYFYWLLVVLGALNFLIFIVFAM 553



>pir|T52585|T52585 probable nitrate transporter ntp3 [imported] -
           Arabidopsis thaliana (fragment)
          Length = 567

 Score = 32.3 bits (72), Expect = 6.7
 Identities = 14/37 (37%), Positives = 21/37 (56%)
 Frame = -3

Query: 608 KGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWAL 498
           K WL   +L+K  L  FYW L +L   NF  ++ +A+
Sbjct: 495 KSWLRS-NLNKARLNYFYWLLVVLGALNFLIFIVFAM 530



>gb:AP004994_1846927 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC
           clone:OSJNBa0052G07.>gb:AP004995_1846964 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBa0068B06.
          Length = 535

 Score = 32.0 bits (71), Expect = 8.8
 Identities = 14/38 (36%), Positives = 21/38 (55%)
 Frame = -3

Query: 605 GWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           GW    D  +  L  +YWFLA+LSC +F  + +   +Y
Sbjct: 499 GWFS-DDPREARLDKYYWFLALLSCVSFVVFTHLCKYY 535



>gb:AP004994_1846925 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC
           clone:OSJNBa0052G07.>gb:AP004995_1846962 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBa0068B06.
          Length = 521

 Score = 32.0 bits (71), Expect = 8.8
 Identities = 14/38 (36%), Positives = 21/38 (55%)
 Frame = -3

Query: 605 GWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           GW    D  +  L  +YWFLA+LSC +F  + +   +Y
Sbjct: 485 GWFS-DDPREARLDKYYWFLALLSCVSFVVFTHLCKYY 521



>gb:AP004669_1843009 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0491F11.
          Length = 300

 Score = 32.0 bits (71), Expect = 8.8
 Identities = 13/32 (40%), Positives = 21/32 (65%)
 Frame = -3

Query: 587 DLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           +L++ +L  FYW LA+LS    A YL+++  Y
Sbjct: 259 NLNRGHLDYFYWLLAVLSVLGLAAYLHFSRVY 290



>gb:AP003566_1830928 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBb0008G24.
          Length = 548

 Score = 32.0 bits (71), Expect = 8.8
 Identities = 13/32 (40%), Positives = 21/32 (65%)
 Frame = -3

Query: 587 DLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           +L++ +L  FYW LA+LS    A YL+++  Y
Sbjct: 507 NLNRGHLDYFYWLLAVLSVLGLAAYLHFSRVY 538



>gb:AP002818_1822868 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0436E04.>gb:AP002969_1824013 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0455C04.
          Length = 606

 Score = 32.0 bits (71), Expect = 8.8
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = -3

Query: 611 KKGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           +  WL  Q+++      FYW LA+LS  N   ++Y+A  Y
Sbjct: 556 RPSWL-AQNINVGKFDYFYWLLAVLSTINLIVFIYFAKAY 594



>gb:AF016713_1761512 Lycopersicon esculentum oligopeptide
           transporter (LeOPT1) mRNA, complete cds.
          Length = 580

 Score = 32.0 bits (71), Expect = 8.8
 Identities = 15/40 (37%), Positives = 22/40 (55%)
 Frame = -3

Query: 611 KKGWLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           K GW+   +L+  +L  F+W LA LS FN   Y++    Y
Sbjct: 536 KPGWIPN-NLNGGHLDYFFWLLAALSFFNLVIYVFLCQMY 574



>gb:AB102807_1526338 Nicotiana tabacum NtNRT1.2-s mRNA for nitrate
           transporter, complete cds.
          Length = 594

 Score = 32.0 bits (71), Expect = 8.8
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = -3

Query: 602 WLEGQDLDKNNLALFYWFLAILSCFNFANYLYWALWY 492
           WL   +L++  L  FYW LAILS  N   +LY++  Y
Sbjct: 537 WL-ADNLNQGRLYDFYWLLAILSVLNLMFFLYFSRKY 572



>pir|T24829|T24829 hypothetical protein T11B7.1 - Caenorhabditis
           elegans>gb:CET11B7_1367606 Caenorhabditis elegans cosmid
           T11B7, complete sequence.
          Length = 445

 Score = 32.0 bits (71), Expect = 8.8
 Identities = 19/61 (31%), Positives = 32/61 (52%)
 Frame = +1

Query: 34  NILHVTTLYIQLMKQTSVSYFILVDIACI*VQIIKLNLPSKNFRSNTQTPEELNKKQNKK 213
           +ILH T  Y+Q+ KQ+    F +  +  I  Q+  + L  KN++       +L KK N+K
Sbjct: 33  DILHDTISYVQVEKQSKTINFSIPHLQMIKEQLESIQLKDKNYK-------DLEKKFNEK 85

Query: 214 K 216
           +
Sbjct: 86  Q 86


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 590,073,484
Number of Sequences: 1806583
Number of extensions: 10313628
Number of successful extensions: 23045
Number of sequences better than 10.0: 76
Number of HSP's better than 10.0 without gapping: 22465
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23030
length of database: 581,917,975
effective HSP length: 119
effective length of database: 366,934,598
effective search space used: 33024113820
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)