BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10926
         (778 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:OSA272423_1692430 Oryza sativa partial mRNA for putative B' r...    70   4e-11   
gb:OSA312313_1692516 Oryza sativa putative B'kappa gene for prot...    69   7e-11   
gb:AP002524_1822383 Oryza sativa (japonica cultivar-group) genom...    69   1e-10   
gb:AC144738_1744169 Oryza sativa (japonica cultivar-group) chrom...    69   1e-10   
gb:AY059748_1564605 Arabidopsis thaliana putative AtBgamma prote...    64   2e-09   
gb:ATAC015985_1543572 Arabidopsis thaliana chromosome III BAC F8...    63   5e-09   
gb:AY093761_1575421 Arabidopsis thaliana AT4g15410/dl3750w mRNA,...    62   1e-08   
gb:ATU73528_1557222 Arabidopsis thaliana B' regulatory subunit o...    62   1e-08   
pir|F71418|F71418 hypothetical protein - Arabidopsis thaliana>gb...    62   1e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AB023041_1515456 Arabidopsis thaliana genomic DNA, chromosome...    60   6e-08   
gb:AY085069_1570151 Arabidopsis thaliana clone 126195 mRNA, comp...    59   1e-07   
gb:AC011810_1537518 Arabidopsis thaliana chromosome I BAC T6J4 g...    59   1e-07   
gb:AB019232_1514185 Arabidopsis thaliana genomic DNA, chromosome...    59   1e-07   
gb:OSA312315_1692518 Oryza sativa putative B'teta gene for prote...    58   2e-07   
pir|T48372|T48372 AtB'alpha regulatory subunit of PP2A - Arabido...    57   3e-07   Arabidopsis thaliana [mouse-ear cress]
pir|T06727|T06727 hypothetical protein F28P10.90 - Arabidopsis t...    57   4e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AC087412_1734031 Oryza sativa chromosome 3 BAC OSJNBb0070O09 ...    56   8e-07   
gb:AC079736_1732767 Oryza sativa (japonica cultivar-group) chrom...    56   8e-07   
gb:OSA312314_1692517 Oryza sativa putative B'zeta gene for prote...    55   2e-06   
gb:AB023041_1515457 Arabidopsis thaliana genomic DNA, chromosome...    54   3e-06   
gb:MMU59418_2122684 Mus musculus protein phosphatase 2A B'alpha3...    50   5e-05   
gb:BC003979_2089503 Mus musculus protein phosphatase 2, regulato...    50   5e-05   
gb:AK047089_1168004 Mus musculus 10 days neonate cerebellum cDNA...    50   5e-05   
sp|Q60996|2A5G_MOUSE|2A5G_MOUSE Serine/threonine protein phosphatase 2A, 56...    50   5e-05   Mus musculus [mouse]
gb:AE014297_1140126 Drosophila melanogaster chromosome 3R, compl...    50   6e-05   
gb:AE014297_1140125 Drosophila melanogaster chromosome 3R, compl...    50   6e-05   
gb:AE014297_1140124 Drosophila melanogaster chromosome 3R, compl...    50   6e-05   
gb:AE014297_1140122 Drosophila melanogaster chromosome 3R, compl...    50   6e-05   
gb:DME277140_1379134 Drosophila melanogaster mRNA for regulatory...    49   1e-04   
gb:OCU38192_1442610 Oryctolagus cuniculus protein phosphatase 2A...    49   1e-04   
gb:BC081028_2561937 Xenopus laevis MGC81679 protein, mRNA (cDNA ...    48   2e-04   
gb:HSGAMPP2A_2013369 H.sapiens mRNA for gamma 1 isoform of 61kDa...    48   2e-04   
gb:AY052369_1935290 Homo sapiens PP2A B56 gamma gene, complete c...    48   2e-04   
gb:OSJN00053_1693968 Oryza sativa genomic DNA, chromosome 4, BAC...    48   2e-04   
gb:BC063910_2553613 Xenopus tropicalis hypothetical protein MGC7...    47   3e-04   
gb:HUMORFY_2035358 Homo sapiens KIAA0044 mRNA, partial cds.            47   3e-04   
gb:AY052369_1935289 Homo sapiens PP2A B56 gamma gene, complete c...    47   3e-04   
gb:AK131391_1917931 Homo sapiens cDNA FLJ16473 fis, clone BRHIP3...    47   3e-04   
gb:AP005673_1855761 Oryza sativa (japonica cultivar-group) genom...    47   3e-04   
gb:CR861200_1185210 Pongo pygmaeus mRNA; cDNA DKFZp459H033 (from...    47   3e-04   
gb:CR860408_1184478 Pongo pygmaeus mRNA; cDNA DKFZp459B2423 (fro...    47   3e-04   
gb:CR381646_2570127 Zebrafish DNA sequence from clone DKEY-241L7...    47   5e-04   
gb:AB055636_2046451 Mus musculus PP2A B56 gamma 2 mRNA for prote...    46   7e-04   
gb:BC064705_2553882 Danio rerio zgc:77529, mRNA (cDNA clone MGC:...    46   9e-04   
gb:AY389498_2084471 Mus musculus protein phosphatase 2A B56gamma...    46   9e-04   
gb:AB055635_2046450 Mus musculus PP2A B56 gamma 3 mRNA for prote...    46   9e-04   
gb:AY052369_1935288 Homo sapiens PP2A B56 gamma gene, complete c...    46   9e-04   
gb:OCU38190_1442608 Oryctolagus cuniculus protein phosphatase PP...    46   9e-04   
gb:OCU37770_1442606 Oryctolagus cuniculus protein phosphatase 2A...    46   9e-04   
sp|Q28651|2A5G_RABIT|2A5G_RABIT Serine/threonine protein phosphatase 2A, 56...    46   9e-04   Oryctolagus cuniculus [domestic rabbit]
sp|Q13362|2A5G_HUMAN|2A5G_HUMAN Serine/threonine protein phosphatase 2A, 56...    46   9e-04   Homo sapiens [man]
gb:AY338234_2083794 Mus musculus protein phosphatase 2A B56 delt...    45   0.001   
gb:AF316616_2062671 Mus musculus protein phosphatase 2 regulator...    45   0.001   
gb:AB074009_2047550 Mus musculus ppp2r5d, mea1, peas gene for pr...    45   0.001   
gb:AB053464_2046403 Mus musculus mRNA for protein phosphatase 2A...    45   0.001   
gb:AB000635_1863518 Homo sapiens mRNA for protein phosphatase 2A...    45   0.001   
gb:OCU38195_1442613 Oryctolagus cuniculus protein phosphatase PP...    45   0.001   
pir|T19242|T19242 hypothetical protein C13G3.3b - Caenorhabditis...    45   0.001   Caenorhabditis elegans [roundworm]
pir|T19241|T19241 hypothetical protein C13G3.3a - Caenorhabditis...    45   0.001   Caenorhabditis elegans [roundworm]
pir|S68686|S68686 phosphoprotein phosphatase (EC 3.1.3.16) 2A re...    45   0.001   Homo sapiens [man]
sp|Q28653|2A5D_RABIT|2A5D_RABIT Serine/threonine protein phosphatase 2A, 56...    45   0.001   Oryctolagus cuniculus [domestic rabbit]
sp|Q14738|2A5D_HUMAN|2A5D_HUMAN Serine/threonine protein phosphatase 2A, 56...    45   0.001   Homo sapiens [man]
gb:AJ821837_1814277 Guillardia theta partial mRNA for putative r...    39   0.082   
gb:AE017348_1758221 Cryptococcus neoformans var. neoformans JEC2...    37   0.53    
gb:AY088455_1573474 Arabidopsis thaliana clone 6790 mRNA, comple...    35   1.5     
gb:ATAC011623_1543329 Arabidopsis thaliana chromosome III BAC F2...    35   1.5     
gb:AK118837_1816795 Arabidopsis thaliana At5g18760 mRNA for unkn...    34   2.6     
gb:CEY38H8A_1369750 Caenorhabditis elegans YAC Y38H8A, complete ...    34   3.4     
gb:SME591793_187183 Sinorhizobium meliloti 1021 complete chromos...    34   3.4     
pir|T26720|T26720 hypothetical protein Y45F10A.6 - Caenorhabditi...    34   3.4     Caenorhabditis elegans [roundworm]
gb:BA000023_693177 Sulfolobus tokodaii str. 7 DNA, complete genome.    33   4.5     
pir|A98114|A98114 conserved hypothetical protein spr1940 [import...    33   4.5     Streptococcus pneumoniae R6
pir|D95249|D95249 transcription regulator, BglG family [imported...    33   4.5     Streptococcus pneumoniae
gb:OSJN00146_1695644 Oryza sativa genomic DNA, chromosome 4, BAC...    33   7.7     
gb:AE015942_320862 Clostridium tetani E88, section 7 of 10 of th...    33   7.7     


>gb:OSA272423_1692430 Oryza sativa partial mRNA for putative B'
           regulatory subunit of PP2A (sircs1 gene).
          Length = 143

 Score = 70.1 bits (170), Expect = 4e-11
 Identities = 35/82 (42%), Positives = 53/82 (64%)
 Frame = -2

Query: 774 ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD 595
           E NSQ HWN+A+LNLT NV+K+ +EMD+ L  AC  K +E++     +  +RRLTWE L+
Sbjct: 55  EHNSQNHWNQAVLNLTDNVKKMFSEMDDVLFSACLVKYKEDEERQASLESKRRLTWEKLE 114

Query: 594 VIAASNISALTKPANASCLVSC 529
             +A++   +T   + + LV C
Sbjct: 115 --SAASFQPVT--GHTAVLVGC 132



>gb:OSA312313_1692516 Oryza sativa putative B'kappa gene for protein
           phosphatase 2A B'kappa subunit, exons
           1-2.>gb:AC093956_1736204 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OJ1263_E10, complete
           sequence.
          Length = 510

 Score = 69.3 bits (168), Expect = 7e-11
 Identities = 31/64 (48%), Positives = 44/64 (68%)
 Frame = -2

Query: 774 ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD 595
           E NSQ HWN+A+LNLT NV+K+ +EMD+ L  AC  K +E++     +  +RRLTWE L+
Sbjct: 422 EHNSQNHWNQAVLNLTDNVKKMFSEMDDVLFSACLVKYKEDEERQASLESKRRLTWEKLE 481

Query: 594 VIAA 583
             A+
Sbjct: 482 SAAS 485



>gb:AP002524_1822383 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0406H10.>gb:AP002903_1823787 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0509B06.
          Length = 503

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 30/65 (46%), Positives = 45/65 (69%)
 Frame = -2

Query: 774 ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD 595
           ERN++ HWN+++LN+T NV+K+  +MDE L+ ACQ+  + E+       ERRRL WE L+
Sbjct: 409 ERNTRWHWNQSVLNVTLNVKKMFLDMDERLLLACQNNFQAEEEKRAATEERRRLMWEQLE 468

Query: 594 VIAAS 580
             AA+
Sbjct: 469 RNAAA 473



>gb:AC144738_1744169 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0029B02, complete sequence.
          Length = 491

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 29/60 (48%), Positives = 42/60 (70%)
 Frame = -2

Query: 774 ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD 595
           ERN++ HWN+++LN+T NVRK+  EMDE L+  CQ   +EE+       ERR+L WE+L+
Sbjct: 403 ERNTRWHWNQSVLNVTMNVRKMFLEMDEGLLLTCQRNFQEEEEKRAASEERRKLIWENLE 462



>gb:AY059748_1564605 Arabidopsis thaliana putative AtBgamma protein
           (At5g25510) mRNA, complete cds.>gb:AY142557_1582973
           Arabidopsis thaliana putative AtBgamma protein
           (At5g25510) mRNA, complete cds.
          Length = 500

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 27/64 (42%), Positives = 44/64 (68%)
 Frame = -2

Query: 774 ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD 595
           E+N+Q HWN+++LNLT NVRK+  EMDE L  +C ++ +E+++     AE+R+  W  L+
Sbjct: 416 EKNAQNHWNQSVLNLTLNVRKMFCEMDEALFMSCHARFKEDEAKQCSAAEKRKEVWARLE 475

Query: 594 VIAA 583
             A+
Sbjct: 476 NAAS 479



>gb:ATAC015985_1543572 Arabidopsis thaliana chromosome III BAC F8A24
           genomic sequence, complete sequence.>gb:ATU73527_1557221
           Arabidopsis thaliana B' regulatory subunit of PP2A
           (AtB'beta) mRNA, complete cds.>gb:AY072226_1567112
           Arabidopsis thaliana putative B' regulatory subunit of
           PP2A AtB'beta (At3g09880) mRNA, complete
           cds.>gb:AY113852_1578263 Arabidopsis thaliana putative
           B' regulatory subunit of PP2A AtB'beta (At3g09880) mRNA,
           complete cds.
          Length = 499

 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 29/64 (45%), Positives = 42/64 (65%)
 Frame = -2

Query: 774 ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD 595
           E+N Q HWN+A+  LT N++K+  EMD EL   CQ + EE+++ S  V E+R+ TW+ L 
Sbjct: 421 EKNIQSHWNQAVHGLTTNIKKMFMEMDPELFEECQRQYEEKQAKSKEVEEQRQYTWKRLA 480

Query: 594 VIAA 583
             AA
Sbjct: 481 EAAA 484



>gb:AY093761_1575421 Arabidopsis thaliana AT4g15410/dl3750w mRNA,
           complete cds.
          Length = 522

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 28/65 (43%), Positives = 44/65 (67%)
 Frame = -2

Query: 774 ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD 595
           ERN++ HWN+A+ +LT NVRKV+ E D+ L   C +K +E+++    V  +R  TW+ L+
Sbjct: 431 ERNTRGHWNQAVQSLTLNVRKVMAETDQILFDECLAKFQEDEANETEVVAKREATWKLLE 490

Query: 594 VIAAS 580
            +AAS
Sbjct: 491 ELAAS 495



>gb:ATU73528_1557222 Arabidopsis thaliana B' regulatory subunit of
           PP2A (AtB'gamma) mRNA, complete cds.>gb:BT020581_1642975
           Arabidopsis thaliana At4g15415 gene, complete cds.
          Length = 522

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 28/65 (43%), Positives = 44/65 (67%)
 Frame = -2

Query: 774 ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD 595
           ERN++ HWN+A+ +LT NVRKV+ E D+ L   C +K +E+++    V  +R  TW+ L+
Sbjct: 431 ERNTRGHWNQAVQSLTLNVRKVMAETDQILFDECLAKFQEDEANETEVVAKREATWKLLE 490

Query: 594 VIAAS 580
            +AAS
Sbjct: 491 ELAAS 495



>pir|F71418|F71418 hypothetical protein - Arabidopsis
            thaliana>gb:ATCHRIV41_1545343 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 41.>gb:ATFCA3_1551591
            Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
            fragment No. 3.
          Length = 969

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 28/65 (43%), Positives = 44/65 (67%)
 Frame = -2

Query: 774  ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD 595
            ERN++ HWN+A+ +LT NVRKV+ E D+ L   C +K +E+++    V  +R  TW+ L+
Sbjct: 878  ERNTRGHWNQAVQSLTLNVRKVMAETDQILFDECLAKFQEDEANETEVVAKREATWKLLE 937

Query: 594  VIAAS 580
             +AAS
Sbjct: 938  ELAAS 942



>gb:AB023041_1515456 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MPE11.>gb:AY059158_1564521 Arabidopsis
           thaliana AT3g26020/MPE11_17 mRNA, complete
           cds.>gb:AF367267_1791720 Arabidopsis thaliana
           AT3g26020/MPE11_17 mRNA, complete cds.
          Length = 510

 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 26/68 (38%), Positives = 42/68 (61%)
 Frame = -2

Query: 774 ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD 595
           ERN+Q HWN+A+ +LT NVRK+  ++D EL   C +K +E++S +     +R  TW+ L+
Sbjct: 443 ERNAQKHWNQAVHSLTLNVRKIFHDLDPELFKECLAKFKEDESKAAETEAKREATWKRLE 502

Query: 594 VIAASNIS 571
            +     S
Sbjct: 503 ELGVRKAS 510



>gb:AY085069_1570151 Arabidopsis thaliana clone 126195 mRNA,
           complete sequence.
          Length = 492

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 25/62 (40%), Positives = 40/62 (64%)
 Frame = -2

Query: 774 ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD 595
           ERN+Q HWN+A+ +LT NV+K+  ++D EL   C +K  E++S    +  +R  TW+ L+
Sbjct: 422 ERNTQKHWNQAVHSLTLNVQKIFNDIDAELFKDCLAKFREDESKEAEIGAKREATWKRLE 481

Query: 594 VI 589
            I
Sbjct: 482 EI 483



>gb:AC011810_1537518 Arabidopsis thaliana chromosome I BAC T6J4
           genomic sequence, complete sequence.
          Length = 492

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 25/62 (40%), Positives = 40/62 (64%)
 Frame = -2

Query: 774 ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD 595
           ERN+Q HWN+A+ +LT NV+K+  ++D EL   C +K  E++S    +  +R  TW+ L+
Sbjct: 422 ERNTQKHWNQAVHSLTLNVQKIFNDIDAELFKDCLAKFREDESKEAEIGAKREATWKRLE 481

Query: 594 VI 589
            I
Sbjct: 482 EI 483



>gb:AB019232_1514185 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MIL23.
          Length = 518

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 27/65 (41%), Positives = 42/65 (64%)
 Frame = -2

Query: 774 ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD 595
           ERN++ HWN+A+ +LT NVRKV+ E+D+ L   C +K + E+     V  +R  TW+ L+
Sbjct: 424 ERNTRGHWNQAVQSLTINVRKVLCEIDQVLFDECLAKFQVEEVNKTEVKAKRERTWQRLE 483

Query: 594 VIAAS 580
            +A S
Sbjct: 484 DLATS 488



>gb:OSA312315_1692518 Oryza sativa putative B'teta gene for protein
           phosphatase 2A B'teta subunit, exons
           1-2.>gb:AP005730_1856739 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBa0073J19.>gb:AP006617_1862508 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBa0091F23.>gb:AP006723_1862690 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:B1203H11.
          Length = 516

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 25/65 (38%), Positives = 41/65 (63%)
 Frame = -2

Query: 774 ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD 595
           ERN++ HWN+A+ +L+ NVRK+  + D  L   C  K EE+++    +  +R  TW+ L+
Sbjct: 436 ERNTKEHWNQAVQSLSLNVRKIFMDHDPVLFEECLKKFEEDEAKETALRSKREATWKRLE 495

Query: 594 VIAAS 580
            IA+S
Sbjct: 496 EIASS 500



>pir|T48372|T48372 AtB'alpha regulatory subunit of PP2A -
           Arabidopsis thaliana>gb:ATF12E4_1548364 Arabidopsis
           thaliana DNA chromosome 5, BAC clone F12E4 (ESSA
           project).>gb:ATU73526_1557220 Arabidopsis thaliana B'
           regulatory subunit of PP2A (AtB'alpha) mRNA, complete
           cds.>gb:BT002933_1636521 Arabidopsis thaliana clone
           RAFL14-80-D07 (R20269) unknown protein (At5g03470) mRNA,
           complete cds.
          Length = 495

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 24/60 (40%), Positives = 39/60 (65%)
 Frame = -2

Query: 774 ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD 595
           E+N + HWN+A+  L+ N++++  EMD EL   CQ + EE+++ S  V E+R+  W  LD
Sbjct: 421 EKNIESHWNQAVHGLSANIKRMFMEMDPELFEECQQQYEEKQAKSKQVEEQRQNRWRRLD 480



>pir|T06727|T06727 hypothetical protein F28P10.90 - Arabidopsis
           thaliana>gb:ATF28P10_1550403 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F28P10.>gb:ATH276037_1552239
           Arabidopsis thaliana B epsilon gene for B regulatory
           subunit of PP2A, exons 1-2.>gb:BT010562_1640508
           Arabidopsis thaliana At3g54930 gene, complete
           cds.>gb:AK175667_1817655 Arabidopsis thaliana mRNA for
           protein phosphatase 2A regulatory subunit B'-like
           protein, complete cds, clone: RAFL22-15-N06.
          Length = 497

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 25/64 (39%), Positives = 42/64 (65%)
 Frame = -2

Query: 774 ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD 595
           ERN + HWN+A+  L++NVR++  EMD EL   C+ +  E ++ +  + E+R LTW+ L+
Sbjct: 430 ERNMKGHWNQAVHGLSENVRRMFLEMDTELFEECEKQYLENEAKACELLEQRELTWKRLE 489

Query: 594 VIAA 583
             A+
Sbjct: 490 EAAS 493



>gb:AC087412_1734031 Oryza sativa chromosome 3 BAC OSJNBb0070O09
           genomic sequence, complete sequence.
          Length = 535

 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 26/64 (40%), Positives = 38/64 (59%)
 Frame = -2

Query: 774 ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD 595
           ERN   HWN+A+  LT NVRK+  +MD EL   CQ +  E+++ +  + E+R   W  L+
Sbjct: 461 ERNITSHWNQAVHGLTANVRKMFLDMDSELFEECQQQYIEKQARAKDMEEQRLSAWRQLE 520

Query: 594 VIAA 583
             AA
Sbjct: 521 AAAA 524



>gb:AC079736_1732767 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBa0003G23 map MAP_LOC, complete
           sequence.
          Length = 93

 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 26/64 (40%), Positives = 38/64 (59%)
 Frame = -2

Query: 774 ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD 595
           ERN   HWN+A+  LT NVRK+  +MD EL   CQ +  E+++ +  + E+R   W  L+
Sbjct: 19  ERNITSHWNQAVHGLTANVRKMFLDMDSELFEECQQQYIEKQARAKDMEEQRLSAWRQLE 78

Query: 594 VIAA 583
             AA
Sbjct: 79  AAAA 82



>gb:OSA312314_1692517 Oryza sativa putative B'zeta gene for protein
           phosphatase 2A B'zeta subunit, exons
           1-2.>gb:AC092852_1735773 Oryza sativa chromosome 3 BAC
           OSJNBa0032G11 genomic sequence, complete sequence.
          Length = 517

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 23/69 (33%), Positives = 43/69 (62%)
 Frame = -2

Query: 774 ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD 595
           ERN+  HWN+A+ +LT NVRK+ ++ D  +   CQ K E+EK+       ++ + W+ L+
Sbjct: 432 ERNANGHWNQAVQSLTLNVRKLFSDHDVGVYDECQRKYEDEKAKEKETKLKQEVAWKRLE 491

Query: 594 VIAASNISA 568
            +A++  ++
Sbjct: 492 EMASAKATS 500



>gb:AB023041_1515457 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MPE11.>gb:AY091037_1574266 Arabidopsis
           thaliana putative protein phosphatase 2A regulatory
           subunit isoform B delta (At3g26030) mRNA, complete
           cds.>gb:AY117349_1579390 Arabidopsis thaliana putative
           protein phosphatase 2A regulatory subunit isoform B
           delta (At3g26030) mRNA, complete
           cds.>gb:AF062396_1765290 Arabidopsis thaliana protein
           phosphatase 2A regulatory subunit isoform B' delta mRNA,
           complete cds.
          Length = 477

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 23/65 (35%), Positives = 39/65 (60%)
 Frame = -2

Query: 774 ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD 595
           E+N   HWN+A+ NLT+NV KV+++ + +L   C  K +E++  +    ++   TW  L+
Sbjct: 410 EKNGSSHWNQAVKNLTENVLKVLSDTNPDLFEECLHKFQEDQQKAEDTKKKNGETWRQLE 469

Query: 594 VIAAS 580
            I AS
Sbjct: 470 EIVAS 474



>gb:MMU59418_2122684 Mus musculus protein phosphatase 2A B'alpha3
           regulatory subunit mRNA, partial cds.
          Length = 421

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 24/77 (31%), Positives = 37/77 (48%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK    +  + R   W  ++ 
Sbjct: 345 RNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIEN 404

Query: 591 IAASNISALTKPANASC 541
           +A +N   L K     C
Sbjct: 405 LAKANPQVLKKRVTREC 421



>gb:BC003979_2089503 Mus musculus protein phosphatase 2, regulatory
           subunit B (B56), gamma isoform, mRNA (cDNA clone
           MGC:7455 IMAGE:3489999), complete cds.
          Length = 452

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 24/77 (31%), Positives = 37/77 (48%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK    +  + R   W  ++ 
Sbjct: 376 RNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIEN 435

Query: 591 IAASNISALTKPANASC 541
           +A +N   L K     C
Sbjct: 436 LAKANPQVLKKRVTREC 452



>gb:AK047089_1168004 Mus musculus 10 days neonate cerebellum cDNA,
           RIKEN full-length enriched library, clone:B930018J08
           product:unknown EST, full insert sequence.
          Length = 80

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 24/77 (31%), Positives = 37/77 (48%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK    +  + R   W  ++ 
Sbjct: 4   RNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIEN 63

Query: 591 IAASNISALTKPANASC 541
           +A +N   L K     C
Sbjct: 64  LAKANPQVLKKRVTREC 80



>sp|Q60996|2A5G_MOUSE Serine/threonine protein phosphatase 2A, 56
           kDa regulatory subunit, gamma isoform (PP2A, B subunit,
           B' gamma isoform) (PP2A, B subunit, B56 gamma isoform)
           (PP2A, B subunit, PR61 gamma isoform) (PP2A, B subunit,
           R5 gamma isoform) (PP2A, B subunit, B'alpha3 isoform)
           (Fragment).>gb:MMU37353_2121026 Mus musculus protein
           phosphatase 2A B'alpha3 regulatory subunit mRNA, partial
           cds.
          Length = 435

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 24/77 (31%), Positives = 37/77 (48%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK    +  + R   W  ++ 
Sbjct: 359 RNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIEN 418

Query: 591 IAASNISALTKPANASC 541
           +A +N   L K     C
Sbjct: 419 LAKANPQVLKKRVTREC 435



>gb:AE014297_1140126 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003721_1222119 Drosophila melanogaster
            chromosome 3R, section 59 of 118 of the complete
            sequence.>gb:AY118546_1300268 Drosophila melanogaster
            LD29902 full insert cDNA.
          Length = 951

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 21/65 (32%), Positives = 34/65 (52%)
 Frame = -2

Query: 771  RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
            RNS+ HWNK I  L  N  K+  E+D+ L   C    ++EK +      +R   W+ ++ 
Sbjct: 814  RNSKTHWNKTIHGLIYNALKLFMEIDQRLFDECSKNYKQEKQMEREKLSQREELWQQVES 873

Query: 591  IAASN 577
            +A +N
Sbjct: 874  LAKTN 878



>gb:AE014297_1140125 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003721_1222118 Drosophila melanogaster
            chromosome 3R, section 59 of 118 of the complete
            sequence.
          Length = 984

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 21/65 (32%), Positives = 34/65 (52%)
 Frame = -2

Query: 771  RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
            RNS+ HWNK I  L  N  K+  E+D+ L   C    ++EK +      +R   W+ ++ 
Sbjct: 814  RNSKTHWNKTIHGLIYNALKLFMEIDQRLFDECSKNYKQEKQMEREKLSQREELWQQVES 873

Query: 591  IAASN 577
            +A +N
Sbjct: 874  LAKTN 878



>gb:AE014297_1140124 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003721_1222117 Drosophila melanogaster
           chromosome 3R, section 59 of 118 of the complete
           sequence.
          Length = 554

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 21/65 (32%), Positives = 34/65 (52%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  E+D+ L   C    ++EK +      +R   W+ ++ 
Sbjct: 417 RNSKTHWNKTIHGLIYNALKLFMEIDQRLFDECSKNYKQEKQMEREKLSQREELWQQVES 476

Query: 591 IAASN 577
           +A +N
Sbjct: 477 LAKTN 481



>gb:AE014297_1140122 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE014297_1140123 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE003721_1222115
           Drosophila melanogaster chromosome 3R, section 59 of 118
           of the complete sequence.>gb:AE003721_1222116 Drosophila
           melanogaster chromosome 3R, section 59 of 118 of the
           complete sequence.
          Length = 670

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 21/65 (32%), Positives = 34/65 (52%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  E+D+ L   C    ++EK +      +R   W+ ++ 
Sbjct: 533 RNSKTHWNKTIHGLIYNALKLFMEIDQRLFDECSKNYKQEKQMEREKLSQREELWQQVES 592

Query: 591 IAASN 577
           +A +N
Sbjct: 593 LAKTN 597



>gb:DME277140_1379134 Drosophila melanogaster mRNA for regulatory
           subunit B' of serine-threonine protein phosphatase 2A
           (PP2A,B' gene).
          Length = 670

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 21/65 (32%), Positives = 34/65 (52%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  E+D+ L   C    ++EK +      +R   W+ ++ 
Sbjct: 533 RNSKTHWNKNIHGLIYNALKLFMEIDQRLFDECSKNYKQEKQMEREKLSQREELWQQVES 592

Query: 591 IAASN 577
           +A +N
Sbjct: 593 LAKTN 597



>gb:OCU38192_1442610 Oryctolagus cuniculus protein phosphatase 2A0
           B' subunit beta4 isoform mRNA, complete cds.
          Length = 449

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 24/73 (32%), Positives = 37/73 (50%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK    +  + R   W  ++ 
Sbjct: 376 RNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIEN 435

Query: 591 IAASNISALTKPA 553
           +A +N   L K A
Sbjct: 436 LAKANPQVLKKRA 448



>gb:BC081028_2561937 Xenopus laevis MGC81679 protein, mRNA (cDNA
           clone MGC:81679 IMAGE:6864669), complete cds.
          Length = 506

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 22/65 (33%), Positives = 34/65 (52%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK    +  + R   W  ++ 
Sbjct: 429 RNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKQKEKLKLKEREEAWVKIEN 488

Query: 591 IAASN 577
           +A SN
Sbjct: 489 LAKSN 493



>gb:HSGAMPP2A_2013369 H.sapiens mRNA for gamma 1 isoform of 61kDa
           regulatory subunit of PP2A.
          Length = 449

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 23/71 (32%), Positives = 36/71 (50%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK    +  + R   W  ++ 
Sbjct: 376 RNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIEN 435

Query: 591 IAASNISALTK 559
           +A +N   L K
Sbjct: 436 LAKANPQVLKK 446



>gb:AY052369_1935290 Homo sapiens PP2A B56 gamma gene, complete cds,
           alternative splice products.>gb:HUMPP2ABB_2035806 Homo
           sapiens protein phosphatase 2A B56-gamma1 (PP2A) mRNA,
           3' end of cds.
          Length = 439

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 23/71 (32%), Positives = 36/71 (50%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK    +  + R   W  ++ 
Sbjct: 366 RNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIEN 425

Query: 591 IAASNISALTK 559
           +A +N   L K
Sbjct: 426 LAKANPQVLKK 436



>gb:OSJN00053_1693968 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0081L15, complete
           sequence.>gb:OSJN00125_1695290 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OJ000223_09, complete sequence.
          Length = 509

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 20/63 (31%), Positives = 34/63 (53%)
 Frame = -2

Query: 774 ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD 595
           ERN++ HWN+A+ +LT NVRK+ ++ D      C  K  +++        +R   W+ L+
Sbjct: 425 ERNARGHWNQAVRSLTLNVRKIFSDHDSAFFGECTQKFNDDELKQEESNSKREALWKRLE 484

Query: 594 VIA 586
             A
Sbjct: 485 EAA 487



>gb:BC063910_2553613 Xenopus tropicalis hypothetical protein
           MGC76127, mRNA (cDNA clone MGC:76127 IMAGE:5309201),
           complete cds.
          Length = 577

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 22/65 (33%), Positives = 34/65 (52%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK    +  + R   W  ++ 
Sbjct: 429 RNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKQKEKLKLKEREEAWIKIEN 488

Query: 591 IAASN 577
           +A SN
Sbjct: 489 LAKSN 493



>gb:HUMORFY_2035358 Homo sapiens KIAA0044 mRNA, partial cds.
          Length = 484

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 23/72 (31%), Positives = 36/72 (50%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK    +  + R   W  ++ 
Sbjct: 375 RNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIEN 434

Query: 591 IAASNISALTKP 556
           +A +N  A   P
Sbjct: 435 LAKANPQAQKDP 446



>gb:AY052369_1935289 Homo sapiens PP2A B56 gamma gene, complete cds,
           alternative splice products.
          Length = 475

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 23/72 (31%), Positives = 36/72 (50%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK    +  + R   W  ++ 
Sbjct: 366 RNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIEN 425

Query: 591 IAASNISALTKP 556
           +A +N  A   P
Sbjct: 426 LAKANPQAQKDP 437



>gb:AK131391_1917931 Homo sapiens cDNA FLJ16473 fis, clone
           BRHIP3026052, highly similar to Serine/threonine protein
           phosphatase 2A, 56 kDa regulatory subunit, gamma
           isoform.
          Length = 540

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 23/72 (31%), Positives = 36/72 (50%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK    +  + R   W  ++ 
Sbjct: 431 RNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIEN 490

Query: 591 IAASNISALTKP 556
           +A +N  A   P
Sbjct: 491 LAKANPQAQKDP 502



>gb:AP005673_1855761 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:B1029H08.
          Length = 517

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 21/69 (30%), Positives = 40/69 (57%)
 Frame = -2

Query: 774 ERNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD 595
           E+N   HWN+A+ +L+ NV+K+ ++ D EL   C  K EE K+       ++   W+ L+
Sbjct: 432 EKNVIEHWNQAVKSLSLNVQKLFSDRDPELYKECLRKYEENKAKEKDHKLKQESVWKRLE 491

Query: 594 VIAASNISA 568
            +A++  ++
Sbjct: 492 EVASAKATS 500



>gb:CR861200_1185210 Pongo pygmaeus mRNA; cDNA DKFZp459H033 (from
           clone DKFZp459H033).
          Length = 410

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 23/72 (31%), Positives = 36/72 (50%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK    +  + R   W  ++ 
Sbjct: 301 RNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIEN 360

Query: 591 IAASNISALTKP 556
           +A +N  A   P
Sbjct: 361 LAKANPQAQKDP 372



>gb:CR860408_1184478 Pongo pygmaeus mRNA; cDNA DKFZp459B2423 (from
           clone DKFZp459B2423).
          Length = 410

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 23/72 (31%), Positives = 36/72 (50%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK    +  + R   W  ++ 
Sbjct: 301 RNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIEN 360

Query: 591 IAASNISALTKP 556
           +A +N  A   P
Sbjct: 361 LAKANPQAQKDP 372



>gb:CR381646_2570127 Zebrafish DNA sequence from clone DKEY-241L7 in
           linkage group 20 Contains the hsp90a gene for heat shock
           protein 90-alpha, the gene for a novel protein similar
           to heat shock protein 90-alpha, the gene for a novel
           protein similar to vertebrate protein phosphatase 2
           regulatory subunit B (B56) gamma isoform (PPP2R5C),
           seven novel genes and five CpG islands, complete
           sequence.
          Length = 577

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 26/78 (33%), Positives = 38/78 (48%), Gaps = 1/78 (1%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  +   EK+      + R   W  ++ 
Sbjct: 428 RNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFRAEKNKEKAKWKEREEAWIKIEN 487

Query: 591 IAASNISALTK-PANASC 541
           +A SN   L    AN+ C
Sbjct: 488 LAKSNPQFLMYIDANSLC 505



>gb:AB055636_2046451 Mus musculus PP2A B56 gamma 2 mRNA for protein
           phosphatase 2A B56 regulatory subunit gamma 2 isoform,
           complete cds.
          Length = 475

 Score = 46.2 bits (108), Expect = 7e-04
 Identities = 22/68 (32%), Positives = 35/68 (51%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK    +  + R   W  ++ 
Sbjct: 366 RNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIEN 425

Query: 591 IAASNISA 568
           +A +N  A
Sbjct: 426 LAKANPQA 433



>gb:BC064705_2553882 Danio rerio zgc:77529, mRNA (cDNA clone
           MGC:73160 IMAGE:4144870), complete
           cds.>gb:BC067382_2554714 Danio rerio zgc:77529, mRNA
           (cDNA clone MGC:77529 IMAGE:6802612), complete cds.
          Length = 601

 Score = 45.8 bits (107), Expect = 9e-04
 Identities = 20/65 (30%), Positives = 32/65 (49%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           +NS+ HWNK I  L  N  K+  EM+++L   C  + + EK       + R   W  ++ 
Sbjct: 439 KNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKEKYKVKEREEMWHKIEA 498

Query: 591 IAASN 577
           +A  N
Sbjct: 499 LAKQN 503



>gb:AY389498_2084471 Mus musculus protein phosphatase 2A B56gamma4
           subunit mRNA, partial cds.
          Length = 171

 Score = 45.8 bits (107), Expect = 9e-04
 Identities = 21/65 (32%), Positives = 34/65 (52%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK    +  + R   W  ++ 
Sbjct: 51  RNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIEN 110

Query: 591 IAASN 577
           +A +N
Sbjct: 111 LAKAN 115



>gb:AB055635_2046450 Mus musculus PP2A B56 gamma 3 mRNA for protein
           phosphatase 2A B56 regulatory subunit gamma 3 isoform,
           complete cds.
          Length = 514

 Score = 45.8 bits (107), Expect = 9e-04
 Identities = 21/65 (32%), Positives = 34/65 (52%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK    +  + R   W  ++ 
Sbjct: 366 RNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIEN 425

Query: 591 IAASN 577
           +A +N
Sbjct: 426 LAKAN 430



>gb:AY052369_1935288 Homo sapiens PP2A B56 gamma gene, complete cds,
           alternative splice products.>gb:HSU37352_2023865 Human
           protein phosphatase 2A B'alpha1 regulatory subunit mRNA,
           complete cds.
          Length = 514

 Score = 45.8 bits (107), Expect = 9e-04
 Identities = 21/65 (32%), Positives = 34/65 (52%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK    +  + R   W  ++ 
Sbjct: 366 RNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIEN 425

Query: 591 IAASN 577
           +A +N
Sbjct: 426 LAKAN 430



>gb:OCU38190_1442608 Oryctolagus cuniculus protein phosphatase PP2A0
           B' subunit beta2 isoform mRNA, complete cds.
          Length = 486

 Score = 45.8 bits (107), Expect = 9e-04
 Identities = 21/65 (32%), Positives = 34/65 (52%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK    +  + R   W  ++ 
Sbjct: 376 RNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIEN 435

Query: 591 IAASN 577
           +A +N
Sbjct: 436 LAKAN 440



>gb:OCU37770_1442606 Oryctolagus cuniculus protein phosphatase 2A0
           B' regulatory subunit beta1 isoform mRNA, partial cds.
          Length = 497

 Score = 45.8 bits (107), Expect = 9e-04
 Identities = 21/65 (32%), Positives = 34/65 (52%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK    +  + R   W  ++ 
Sbjct: 376 RNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIEN 435

Query: 591 IAASN 577
           +A +N
Sbjct: 436 LAKAN 440



>sp|Q28651|2A5G_RABIT Serine/threonine protein phosphatase 2A, 56
           kDa regulatory subunit, gamma isoform (PP2A, B subunit,
           B' gamma isoform) (PP2A, B subunit, B56 gamma isoform)
           (PP2A, B subunit, PR61 gamma isoform) (PP2A, B subunit,
           R5 gamma isoform) (PP2A, B subunit, B' beta
           isoform).>gb:OCU38191_1442609 Oryctolagus cuniculus
           protein phosphatase 2A0 B' regulatory subunit beta3
           isoform mRNA, complete cds.
          Length = 524

 Score = 45.8 bits (107), Expect = 9e-04
 Identities = 21/65 (32%), Positives = 34/65 (52%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK    +  + R   W  ++ 
Sbjct: 376 RNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIEN 435

Query: 591 IAASN 577
           +A +N
Sbjct: 436 LAKAN 440



>sp|Q13362|2A5G_HUMAN Serine/threonine protein phosphatase 2A, 56
           kDa regulatory subunit, gamma isoform (PP2A, B subunit,
           B' gamma isoform) (PP2A, B subunit, B56 gamma isoform)
           (PP2A, B subunit, PR61 gamma isoform) (PP2A, B subunit,
           R5 gamma isoform).
          Length = 524

 Score = 45.8 bits (107), Expect = 9e-04
 Identities = 21/65 (32%), Positives = 34/65 (52%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK    +  + R   W  ++ 
Sbjct: 376 RNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIEN 435

Query: 591 IAASN 577
           +A +N
Sbjct: 436 LAKAN 440



>gb:AY338234_2083794 Mus musculus protein phosphatase 2A B56 delta
           subunit mRNA, complete cds.
          Length = 595

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 21/65 (32%), Positives = 33/65 (50%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK       + R   W+ ++ 
Sbjct: 445 RNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEE 504

Query: 591 IAASN 577
           +A  N
Sbjct: 505 LARLN 509



>gb:AF316616_2062671 Mus musculus protein phosphatase 2 regulatory
           subunit B56 delta isoform (Ppp2r5d) mRNA, complete cds.
          Length = 594

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 21/65 (32%), Positives = 33/65 (50%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK       + R   W+ ++ 
Sbjct: 444 RNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEE 503

Query: 591 IAASN 577
           +A  N
Sbjct: 504 LARLN 508



>gb:AB074009_2047550 Mus musculus ppp2r5d, mea1, peas gene for
           protein phosphatase 2a regulatory b56-delta subunit,
           male-enhanced antigen-1, peas, partial and compcomplete
           cds.
          Length = 559

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 21/65 (32%), Positives = 33/65 (50%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK       + R   W+ ++ 
Sbjct: 409 RNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEE 468

Query: 591 IAASN 577
           +A  N
Sbjct: 469 LARLN 473



>gb:AB053464_2046403 Mus musculus mRNA for protein phosphatase 2A
           B56delta regulatory subunit, complete
           cds.>gb:BC010716_2091066 Mus musculus protein
           phosphatase 2, regulatory subunit B (B56), delta
           isoform, mRNA (cDNA clone MGC:6551 IMAGE:2655861),
           complete cds.
          Length = 594

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 21/65 (32%), Positives = 33/65 (50%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK       + R   W+ ++ 
Sbjct: 444 RNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEE 503

Query: 591 IAASN 577
           +A  N
Sbjct: 504 LARLN 508



>gb:AB000635_1863518 Homo sapiens mRNA for protein phosphatase 2A
           delta (B'') regulatory subunit, delta3 isoform, complete
           cds.
          Length = 496

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 21/65 (32%), Positives = 33/65 (50%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK       + R   W+ ++ 
Sbjct: 346 RNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEE 405

Query: 591 IAASN 577
           +A  N
Sbjct: 406 LARLN 410



>gb:OCU38195_1442613 Oryctolagus cuniculus protein phosphatase PP2A0
           B' subunit gamma isoform mRNA, partial cds.
          Length = 571

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 21/65 (32%), Positives = 33/65 (50%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK       + R   W+ ++ 
Sbjct: 421 RNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEE 480

Query: 591 IAASN 577
           +A  N
Sbjct: 481 LARLN 485



>pir|T19242|T19242 hypothetical protein C13G3.3b - Caenorhabditis
           elegans>gb:CEC13G3_1360405 Caenorhabditis elegans cosmid
           C13G3, complete sequence.
          Length = 561

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 33/137 (24%), Positives = 63/137 (45%), Gaps = 10/137 (7%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           +NS+ HWNK I  L  N  K+  EM+++L   C    ++++     + E +   W +++ 
Sbjct: 401 KNSKSHWNKTIHGLIYNALKMFMEMNQKLFDECSQAYQKDRVQEKTLNEEKERIWNNIEK 460

Query: 591 IAASN-----ISALTKPANASCLVSC----*MIEHQRTPSVSWIYFNPFLSKA-GKAADQ 442
            A  N     + AL    N   ++S      + E+ +T +V  +  +  L  A G ++ +
Sbjct: 461 QAMGNPQYVEVKALFARFNPDEIISSRQQNGVDENMKTSTV--LSKDEILKNAVGVSSMK 518

Query: 441 SSLGYGDVHTYIQFPRD 391
           + + +G  H    FP D
Sbjct: 519 NDMDFGPNHKQSDFPPD 535



>pir|T19241|T19241 hypothetical protein C13G3.3a - Caenorhabditis
           elegans>gb:CEC13G3_1360404 Caenorhabditis elegans cosmid
           C13G3, complete sequence.
          Length = 557

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 33/137 (24%), Positives = 63/137 (45%), Gaps = 10/137 (7%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           +NS+ HWNK I  L  N  K+  EM+++L   C    ++++     + E +   W +++ 
Sbjct: 397 KNSKSHWNKTIHGLIYNALKMFMEMNQKLFDECSQAYQKDRVQEKTLNEEKERIWNNIEK 456

Query: 591 IAASN-----ISALTKPANASCLVSC----*MIEHQRTPSVSWIYFNPFLSKA-GKAADQ 442
            A  N     + AL    N   ++S      + E+ +T +V  +  +  L  A G ++ +
Sbjct: 457 QAMGNPQYVEVKALFARFNPDEIISSRQQNGVDENMKTSTV--LSKDEILKNAVGVSSMK 514

Query: 441 SSLGYGDVHTYIQFPRD 391
           + + +G  H    FP D
Sbjct: 515 NDMDFGPNHKQSDFPPD 531



>pir|S68686|S68686 phosphoprotein phosphatase (EC 3.1.3.16) 2A
           regulatory chain, 74K - human>gb:BC001175_1967356 Homo
           sapiens protein phosphatase 2, regulatory subunit B
           (B56), delta isoform, transcript variant 2, mRNA (cDNA
           clone MGC:2134 IMAGE:3355395), complete
           cds.>gb:HUMPP27KRS_2035799 Homo sapiens mRNA for protein
           phosphatase 2A 74 kDa regulatory subunit (delta or B''
           subunit), complete cds.
          Length = 570

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 21/65 (32%), Positives = 33/65 (50%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK       + R   W+ ++ 
Sbjct: 420 RNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEE 479

Query: 591 IAASN 577
           +A  N
Sbjct: 480 LARLN 484



>sp|Q28653|2A5D_RABIT Serine/threonine protein phosphatase 2A, 56
           kDa regulatory subunit, delta isoform (PP2A, B subunit,
           B' delta isoform) (PP2A, B subunit, B56 delta isoform)
           (PP2A, B subunit, PR61 delta isoform) (PP2A, B subunit,
           R5 delta isoform) (PP2A, B subunit,
           B'-gamma).>gb:OCU38193_1442611 Oryctolagus cuniculus
           protein phosphatase PP2A0 B' subunit gamma isoform mRNA,
           complete cds.
          Length = 586

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 21/65 (32%), Positives = 33/65 (50%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK       + R   W+ ++ 
Sbjct: 436 RNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEE 495

Query: 591 IAASN 577
           +A  N
Sbjct: 496 LARLN 500



>sp|Q14738|2A5D_HUMAN Serine/threonine protein phosphatase 2A, 56
           kDa regulatory subunit, delta isoform (PP2A, B subunit,
           B' delta isoform) (PP2A, B subunit, B56 delta isoform)
           (PP2A, B subunit, PR61 delta isoform) (PP2A, B subunit,
           R5 delta isoform).>gb:AB000634_1863517 Homo sapiens mRNA
           for protein phosphatase 2A delta (B'') regulatory
           subunit, delta1 isoform, complete
           cds.>gb:AL136304_1919074 Human DNA sequence from clone
           RP1-20C7 on chromosome 6p12.3-21.2 Contains the PPP2R5D
           gene for delta variant of protein phosphatase 2
           regulatory subunit B (B56), the MEA gene for
           male-enhanced antigen, the gene for testis intracellular
           mediator protein (PEAS), the gene for a novel protein
           (LOC88745), the 3' end of a gene for a novel protein
           (KIAA0076 KIAA0708) and a CpG island, complete
           sequence.>gb:AL136304_1919075 Human DNA sequence from
           clone RP1-20C7 on chromosome 6p12.3-21.2 Contains the
           PPP2R5D gene for delta variant of protein phosphatase 2
           regulatory subunit B (B56), the MEA gene for
           male-enhanced antigen, the gene for testis intracellular
           mediator protein (PEAS), the gene for a novel protein
           (LOC88745), the 3' end of a gene for a novel protein
           (KIAA0076 KIAA0708) and a CpG island, complete
           sequence.>gb:BC001095_1967287 Homo sapiens protein
           phosphatase 2, regulatory subunit B (B56), delta
           isoform, transcript variant 1, mRNA (cDNA clone MGC:3277
           IMAGE:3507280), complete cds.>gb:BC010692_1972761 Homo
           sapiens protein phosphatase 2, regulatory subunit B
           (B56), delta isoform, transcript variant 1, mRNA (cDNA
           clone MGC:8949 IMAGE:3853892), complete
           cds.>gb:HUMB56DA_2029510 Homo sapiens protein
           phosphatase 2A B56-delta (PP2A) mRNA, complete cds.
          Length = 602

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 21/65 (32%), Positives = 33/65 (50%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           RNS+ HWNK I  L  N  K+  EM+++L   C  + + EK       + R   W+ ++ 
Sbjct: 452 RNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEE 511

Query: 591 IAASN 577
           +A  N
Sbjct: 512 LARLN 516



>gb:AJ821837_1814277 Guillardia theta partial mRNA for putative
           regulatory subunit of protein phosphatase 2A (supase2A
           gene).
          Length = 157

 Score = 39.3 bits (90), Expect = 0.082
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 2/62 (3%)
 Frame = -2

Query: 774 ERNSQXHWNKAILNLTQNVRKVITEMDEEL--VCACQSKLEEEKSLSNVVAERRRLTWEH 601
           E N+  HWN  +  LT NV+K+  +MD  L   C  + K+  EK+ +  ++ +++  WE 
Sbjct: 91  EANTTKHWNSTVHGLTFNVQKLFMDMDARLWEECTQKHKMNMEKNAAAHLSRKQK--WEQ 148

Query: 600 LD 595
           L+
Sbjct: 149 LE 150



>gb:AE017348_1758221 Cryptococcus neoformans var. neoformans JEC21
           chromosome 8, complete sequence.
          Length = 705

 Score = 36.6 bits (83), Expect = 0.53
 Identities = 18/65 (27%), Positives = 31/65 (47%)
 Frame = -2

Query: 771 RNSQXHWNKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDV 592
           +NS+ HWN+ I  +  N  K+  E+++E+   CQ+    ++   +  A  R   W  L  
Sbjct: 511 QNSKTHWNRTIHGMVYNALKLFMEINQEVFEECQNNYRAQRKAESDRAIERYDEWLQLRE 570

Query: 591 IAASN 577
            A  N
Sbjct: 571 QAIQN 575



>gb:AY088455_1573474 Arabidopsis thaliana clone 6790 mRNA, complete
           sequence.
          Length = 424

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 20/72 (27%), Positives = 32/72 (44%)
 Frame = -1

Query: 751 EQSDSEPDTKREESDHGDGRGARVCLPKQTRGREVVVECGCGETKADMGTPRRYCC*QYF 572
           +Q  S P  + +E    +    R+CL     G  + +EC C   K D+      C  ++F
Sbjct: 195 DQVSSVPPEETDEEIPEEEAVCRICLDVCEEGNTLKMECSC---KGDLRLVHEACAMKWF 251

Query: 571 SSN*TRKCKLSR 536
           S+  TR C + R
Sbjct: 252 STKGTRTCDVCR 263



>gb:ATAC011623_1543329 Arabidopsis thaliana chromosome III BAC
           F24P17 genomic sequence, complete
           sequence.>gb:AY133573_1581396 Arabidopsis thaliana
           At3g06330/F24P17_21 mRNA, complete
           cds.>gb:AF428443_1799373 Arabidopsis thaliana
           AT3g06330/F24P17_21 mRNA, complete cds.
          Length = 426

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 20/72 (27%), Positives = 32/72 (44%)
 Frame = -1

Query: 751 EQSDSEPDTKREESDHGDGRGARVCLPKQTRGREVVVECGCGETKADMGTPRRYCC*QYF 572
           +Q  S P  + +E    +    R+CL     G  + +EC C   K D+      C  ++F
Sbjct: 197 DQVSSVPPEETDEEIPEEEAVCRICLDVCEEGNTLKMECSC---KGDLRLVHEACAMKWF 253

Query: 571 SSN*TRKCKLSR 536
           S+  TR C + R
Sbjct: 254 STKGTRTCDVCR 265



>gb:AK118837_1816795 Arabidopsis thaliana At5g18760 mRNA for unknown
           protein, complete cds, clone: RAFL21-16-M15.
          Length = 411

 Score = 34.3 bits (77), Expect = 2.6
 Identities = 20/72 (27%), Positives = 32/72 (44%)
 Frame = -1

Query: 751 EQSDSEPDTKREESDHGDGRGARVCLPKQTRGREVVVECGCGETKADMGTPRRYCC*QYF 572
           +Q    P  + EE    +    R+CL     G  + +EC C   K D+     +C  ++F
Sbjct: 182 DQITPVPAEETEEEIPEEEAVCRICLDVCEEGNTLKMECSC---KGDLRLVHEHCAIKWF 238

Query: 571 SSN*TRKCKLSR 536
           S+  TR C + R
Sbjct: 239 STKGTRICDVCR 250



>gb:CEY38H8A_1369750 Caenorhabditis elegans YAC Y38H8A, complete
            sequence.>gb:CEY45F10A_1370073 Caenorhabditis elegans YAC
            Y45F10A, complete sequence.
          Length = 1268

 Score = 33.9 bits (76), Expect = 3.4
 Identities = 32/114 (28%), Positives = 52/114 (45%), Gaps = 8/114 (7%)
 Frame = -2

Query: 747  KAILNLTQN-VRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEH-LDVIAASNI 574
            K + NL  N +R +I  + ++    C+   EE ++L NVV E   L+W H L V A   +
Sbjct: 816  KVVQNLEDNQMRSIIKSIGKD----CRFTNEELEALYNVVKEEHLLSWRHRLGVSARGKM 871

Query: 573  SALT-KPANASCLVSC*MIEHQRTPSV-----SWIYFNPFLSKAGKAADQSSLG 430
            +A+T +P    C  S   +++     V      W   N F+ +  +  D S  G
Sbjct: 872  AAVTERPRPDPCAQSQYRLDYDLFSEVFPRLLPWPVTNIFIIRVFRLLDISDNG 925



>gb:SME591793_187183 Sinorhizobium meliloti 1021 complete
           chromosome; segment 12/12.
          Length = 460

 Score = 33.9 bits (76), Expect = 3.4
 Identities = 20/59 (33%), Positives = 31/59 (52%)
 Frame = -2

Query: 744 AILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLDVIAASNISA 568
           A L    ++R  I    EEL  A  ++LEEE+ +S +VAE+ +L   +   +AA    A
Sbjct: 186 ADLKALADIRSGIAREREELTAAMTARLEEERRMSMLVAEKEKLRQRNAADLAAEQRKA 244



>pir|T26720|T26720 hypothetical protein Y45F10A.6 - Caenorhabditis
            elegans>gb:CEY38H8A_1369751 Caenorhabditis elegans YAC
            Y38H8A, complete sequence.>gb:CEY45F10A_1370072
            Caenorhabditis elegans YAC Y45F10A, complete sequence.
          Length = 1270

 Score = 33.9 bits (76), Expect = 3.4
 Identities = 32/114 (28%), Positives = 52/114 (45%), Gaps = 8/114 (7%)
 Frame = -2

Query: 747  KAILNLTQN-VRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEH-LDVIAASNI 574
            K + NL  N +R +I  + ++    C+   EE ++L NVV E   L+W H L V A   +
Sbjct: 816  KVVQNLEDNQMRSIIKSIGKD----CRFTNEELEALYNVVKEEHLLSWRHRLGVSARGKM 871

Query: 573  SALT-KPANASCLVSC*MIEHQRTPSV-----SWIYFNPFLSKAGKAADQSSLG 430
            +A+T +P    C  S   +++     V      W   N F+ +  +  D S  G
Sbjct: 872  AAVTERPRPDPCAQSQYRLDYDLFSEVFPRLLPWPVTNIFIIRVFRLLDISDNG 925



>gb:BA000023_693177 Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 260

 Score = 33.5 bits (75), Expect = 4.5
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 4/79 (5%)
 Frame = +2

Query: 518 SII*QLTRQLAFAGLVRAEILLAAITSRCSHVSLRLSATTFDNDFSSSSLLWQAHTSSSS 697
           +I+ QL  +L  + L  A+I L +++S C    +  +       F  SS+  +    SSS
Sbjct: 57  NILFQLLSKLRVSSLTNADITLPSVSSSCKMPFIGSNIPLLLRSFIKSSVCKRVPKVSSS 116

Query: 698 ISVITFLT----FCVRFRI 742
           + V + L     FC RFR+
Sbjct: 117 LKVSSILVMLFHFCNRFRV 135



>pir|A98114|A98114 conserved hypothetical protein spr1940 [imported]
           - Streptococcus pneumoniae (strain
           R6)>gb:AE008558_238258 Streptococcus pneumoniae R6
           section 174 of 184 of the complete
           genome.>gb:AE007317_944416 Streptococcus pneumoniae R6,
           complete genome.
          Length = 676

 Score = 33.5 bits (75), Expect = 4.5
 Identities = 14/49 (28%), Positives = 30/49 (61%)
 Frame = +1

Query: 622 SLRNHIRQRLLFLEFALAGTHELLVHLRDHFPHVLCQVQNRFVPMXLAI 768
           +LR H+      L+F L  ++E ++H+++H+P +   V++  +P+  AI
Sbjct: 317 NLRRHLIPAYYRLKFGLPSSNEYVLHVKEHYPDLFELVKDSLMPLMDAI 365



>pir|D95249|D95249 transcription regulator, BglG family [imported] -
           Streptococcus pneumoniae (strain
           TIGR4)>gb:AE007501_227250 Streptococcus pneumoniae TIGR4
           section 184 of 194 of the complete
           genome.>gb:AE005672_1105018 Streptococcus pneumoniae
           TIGR4, complete genome.
          Length = 676

 Score = 33.5 bits (75), Expect = 4.5
 Identities = 14/49 (28%), Positives = 30/49 (61%)
 Frame = +1

Query: 622 SLRNHIRQRLLFLEFALAGTHELLVHLRDHFPHVLCQVQNRFVPMXLAI 768
           +LR H+      L+F L  ++E ++H+++H+P +   V++  +P+  AI
Sbjct: 317 NLRRHLIPAYYRLKFGLPSSNEYVLHVKEHYPDLFELVKDSLMPLMDAI 365



>gb:OSJN00146_1695644 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0094O15, complete
           sequence.>gb:OSJN00193_1696501 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBb0004G23, complete
           sequence.
          Length = 459

 Score = 32.7 bits (73), Expect = 7.7
 Identities = 19/82 (23%), Positives = 38/82 (46%), Gaps = 8/82 (9%)
 Frame = -1

Query: 757 PLEQSDSEPDTKREESDHGDGRG-------ARVCLPKQTRGREVV-VECGCGETKADMGT 602
           P+  S+  PD    E    DG          R+C+ + + G + + +EC C   K ++  
Sbjct: 185 PVTSSNVIPDIVPSEPGDEDGEDIAEEEAVCRICMVELSEGSDTLKLECSC---KGELAL 241

Query: 601 PRRYCC*QYFSSN*TRKCKLSR 536
             ++C  ++F+   TR C++ +
Sbjct: 242 AHKHCAMKWFTMKGTRTCEVCK 263



>gb:AE015942_320862 Clostridium tetani E88, section 7 of 10 of the
           complete genome.>gb:AE015927_963651 Clostridium tetani
           E88, complete genome.
          Length = 571

 Score = 32.7 bits (73), Expect = 7.7
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 3/71 (4%)
 Frame = -2

Query: 750 NKAILNLTQNVRKVITEMDEELVCACQSKLEEEKSLSNVVAERRRLTWEHLD---VIAAS 580
           N  ++ L  N   +IT  D+E +   + ++EEEK L  ++ + + +    LD   V  AS
Sbjct: 212 NGELIILDGNKGLIITNPDDEKINLYKKQIEEEKKLQKILGKYKNIEVITLDGRKVEVAS 271

Query: 579 NISALTKPANA 547
           NI ++    NA
Sbjct: 272 NIGSIEDSENA 282


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 807,269,927
Number of Sequences: 1806583
Number of extensions: 16593460
Number of successful extensions: 39636
Number of sequences better than 10.0: 75
Number of HSP's better than 10.0 without gapping: 38498
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 39625
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 49166019464
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)