BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10912
         (758 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AE016959_1023963 Oryza sativa (japonica cultivar-group) chrom...   117   2e-25   
gb:ATF5E19_1550765 Arabidopsis thaliana DNA chromosome 5, BAC cl...   114   2e-24   
pir|JC5401|JC5401 inositol 1,3,4-trisphosphate 5/6-kinase (EC 2....   114   2e-24   Arabidopsis thaliana [mouse-ear cress]
gb:AY172635_1586781 Zea mays inositol phosphate kinase mRNA, com...   112   6e-24   
gb:AP004850_1845952 Oryza sativa (japonica cultivar-group) genom...    90   4e-17   
gb:AY050408_1562185 Arabidopsis thaliana AT4g08170/T12G13_10 mRN...    79   7e-14   
gb:AE016959_1020590 Oryza sativa (japonica cultivar-group) chrom...    77   3e-13   
gb:AC135228_1742191 Oryza sativa chromosome 3 BAC OSJNBb0122C16 ...    76   6e-13   
gb:AC105927_1738258 Oryza sativa (japonica cultivar-group) chrom...    70   5e-11   
gb:AF188610_1775230 Oryza sativa saline-responsive OSSR1 (Sr1) m...    64   3e-09   
pir|T10544|T10544 inositol 1,3,4-trisphosphate 5/6-kinase homolo...    58   2e-07   Arabidopsis thaliana [mouse-ear cress]
pir|T04994|T04994 hypothetical protein T16L1.260 - Arabidopsis t...    53   5e-06   Arabidopsis thaliana [mouse-ear cress]
gb:BC054977_2551182 Xenopus laevis inositol 1,3,4-triphosphate 5...    47   5e-04   
gb:AY335756_2144974 Synthetic construct Homo sapiens inositol 1,...    46   6e-04   
gb:HSU51336_2024698 Human inositol 1,3,4-trisphosphate 5/6-kinas...    46   6e-04   
gb:BC037305_1982171 Homo sapiens inositol 1,3,4-triphosphate 5/6...    46   6e-04   
gb:AF279372_1894503 Homo sapiens inositol 3,4,5,6 tetrakisphosph...    46   6e-04   
gb:BC050497_2550381 Danio rerio zgc:56075, mRNA (cDNA clone MGC:...    46   8e-04   
gb:BC025917_2095226 Mus musculus inositol 1,3,4-triphosphate 5/6...    46   8e-04   
gb:AK038913_1165211 Mus musculus adult male hypothalamus cDNA, R...    46   8e-04   
gb:AP006525_1862180 Oryza sativa (japonica cultivar-group) genom...    44   0.002   
gb:BX248515_2567121 Zebrafish DNA sequence from clone DKEY-177P2...    44   0.003   
gb:AY070449_1566834 Arabidopsis thaliana unknown protein (At2g43...    43   0.007   
gb:BC003622_1968933 Homo sapiens inositol 1,3,4-triphosphate 5/6...    41   0.027   
pir|D90531|D90531 excinuclease ABC subunit c [imported] - Mycopl...    33   4.3     Mycoplasma pulmonis
gb:AF118848_1242787 Entamoeba histolytica inositol 1,3,4-trispho...    33   5.6     
gb:TMVAJ690_2455337 Turnip mosaic virus mRNA for replicase and c...    32   9.6     
gb:TMO489259_2455313 Turnip Mosaic Virus partial gene for partia...    32   9.6     
gb:TMO488152_2455312 Turnip mosaic virus partial gene for polypr...    32   9.6     
gb:TMO307038_2455270 Turnip mosaic virus genomic RNA for partial...    32   9.6     
gb:TMO307037_2455269 Turnip mosaic virus genomic RNA for partial...    32   9.6     
gb:TMO297629_2455268 Turnip mosaic virus genomic RNA for partial...    32   9.6     
gb:TMO293279_2455267 Turnip mosaic virus partial genomic RNA for...    32   9.6     
gb:AY134473_2299110 Turnip mosaic virus strain RC4, complete gen...    32   9.6     
gb:AY090660_2296027 Turnip mosaic virus isolate CHN 12, complete...    32   9.6     
gb:AF530055_2271340 Turnip mosaic virus strain YC5, complete gen...    32   9.6     
gb:AF394602_2247440 Turnip mosaic virus strain TW, complete genome.    32   9.6     
gb:AF312911_2232913 Turnip mosaic virus strain KC polyprotein ge...    32   9.6     
gb:AF228514_2218558 Turnip mosaic virus polyprotein gene, partia...    32   9.6     
gb:AB194802_2175542 Turnip mosaic virus (isolate UK1) genomic RN...    32   9.6     
gb:AB194801_2175541 Turnip mosaic virus (isolate UK1) genomic RN...    32   9.6     
gb:AB194800_2175540 Turnip mosaic virus (isolate UK1) genomic RN...    32   9.6     
gb:AB194799_2175539 Turnip mosaic virus (isolate UK1) genomic RN...    32   9.6     
gb:AB194798_2175538 Turnip mosaic virus (isolate UK1) genomic RN...    32   9.6     
gb:AB194796_2175536 Turnip mosaic virus (isolate UK1) genomic RN...    32   9.6     
gb:AB194795_2175535 Turnip mosaic virus (isolate UK1) genomic RN...    32   9.6     
gb:AB194794_2175534 Turnip mosaic virus (isolate UK1) genomic RN...    32   9.6     
gb:AB194793_2175533 Turnip mosaic virus (isolate UK1) genomic RN...    32   9.6     
gb:AB194792_2175532 Turnip mosaic virus (isolate UK1) genomic RN...    32   9.6     
gb:AB194791_2175531 Turnip mosaic virus (isolate UK1) genomic RN...    32   9.6     
gb:AB194790_2175530 Turnip mosaic virus (isolate UK1) genomic RN...    32   9.6     
gb:AB194789_2175529 Turnip mosaic virus (isolate UK1) genomic RN...    32   9.6     
gb:AB194788_2175528 Turnip mosaic virus (isolate UK1) genomic RN...    32   9.6     
gb:AB194787_2175527 Turnip mosaic virus (isolate UK1) genomic RN...    32   9.6     
gb:AB194785_2175525 Turnip mosaic virus (isolate UK1) genomic RN...    32   9.6     
gb:AB105135_2170399 Turnip mosaic virus gene for polyprotein, co...    32   9.6     
gb:AB105134_2170398 Turnip mosaic virus gene for polyprotein, co...    32   9.6     
gb:AB093625_2169144 Turnip mosaic virus gene for polyprotein, co...    32   9.6     
gb:AB093624_2169143 Turnip mosaic virus gene for polyprotein, co...    32   9.6     
gb:AB093623_2169142 Turnip mosaic virus gene for polyprotein, co...    32   9.6     
gb:AB093622_2169141 Turnip mosaic virus gene for polyprotein, co...    32   9.6     
gb:AB093617_2169136 Turnip mosaic virus gene for polyprotein, co...    32   9.6     
gb:AB093616_2169135 Turnip mosaic virus gene for polyprotein, co...    32   9.6     
gb:AB093605_2169124 Turnip mosaic virus gene for polyprotein, co...    32   9.6     
pir|PQ0759|PQ0759 polyprotein - turnip mosaic virus (isolate 31)...    32   9.6     Turnip mosaic virus
pir|PQ0757|PQ0757 polyprotein - turnip mosaic virus (isolate 1) ...    32   9.6     Turnip mosaic virus
sp|P89509|POLG_TUMVJ|POLG_TUMVJ Genome polyprotein [Contains: P1 proteinase...    32   9.6     Turnip mosaic virus


>gb:AE016959_1023963 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC018929_1538468
           Oryza sativa chromosome 10 BAC OSJNBa0027L23 genomic
           sequence, complete sequence.>gb:AE017122_1753782 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           76 of 77 of the complete sequence.
          Length = 342

 Score =  117 bits (294), Expect = 2e-25
 Identities = 52/84 (61%), Positives = 67/84 (79%)
 Frame = -3

Query: 747 NEKNVDKYCKMMNLEDAELPPLSFLTEIARGLRRATRLHLFNFDVIRDNKVGNRYLVIDI 568
           NE+   +Y   M LEDA +PP +F+ +IA  LRRA  LHLFNFD+IRD + G+RYLVIDI
Sbjct: 240 NERTAQEYYDDMRLEDAIMPPTAFINDIAAALRRALGLHLFNFDMIRDARAGDRYLVIDI 299

Query: 567 NYFPGYAKMPNYESVMTEFFWDVL 496
           NYFPGYAKMP YE+V+T+FFW+++
Sbjct: 300 NYFPGYAKMPGYETVLTDFFWEMV 323



>gb:ATF5E19_1550765 Arabidopsis thaliana DNA chromosome 5, BAC clone
           F5E19 (ESSA project).>gb:ATI134T_1553485 Arabidopsis
           thaliana mRNA for Inositol 1,3,4-Trisphosphate 5/6
           Kinase.>gb:AY072156_1567048 Arabidopsis thaliana
           putative Inositol 1,3,4-Trisphosphate 5/6 kinase
           (At5g16760) mRNA, complete cds.>gb:AY087024_1572060
           Arabidopsis thaliana clone 30653 mRNA, complete
           sequence.>gb:AY096412_1575956 Arabidopsis thaliana
           putative inositol 1,3,4-trisphosphate 5/6 kinase
           (At5g16760) mRNA, complete cds.
          Length = 319

 Score =  114 bits (285), Expect = 2e-24
 Identities = 52/83 (62%), Positives = 69/83 (83%)
 Frame = -3

Query: 744 EKNVDKYCKMMNLEDAELPPLSFLTEIARGLRRATRLHLFNFDVIRDNKVGNRYLVIDIN 565
           +KN++ Y +  +LE  E+PPLSFLT++A+ +R +  L+LFNFDVIRD K  NRYL+IDIN
Sbjct: 232 DKNIE-YGEDRSLEKVEMPPLSFLTDLAKAMRESMGLNLFNFDVIRDAKDANRYLIIDIN 290

Query: 564 YFPGYAKMPNYESVMTEFFWDVL 496
           YFPGYAKMP+YE V+TEFFWD++
Sbjct: 291 YFPGYAKMPSYEPVLTEFFWDMV 313



>pir|JC5401|JC5401 inositol 1,3,4-trisphosphate 5/6-kinase (EC
           2.7.-.-) [imported] - Arabidopsis
           thaliana>gb:AF080173_1766436 Arabidopsis thaliana
           inositol 1,3,4-trisphosphate 5/6-kinase mRNA, complete
           cds.
          Length = 319

 Score =  114 bits (285), Expect = 2e-24
 Identities = 52/83 (62%), Positives = 69/83 (83%)
 Frame = -3

Query: 744 EKNVDKYCKMMNLEDAELPPLSFLTEIARGLRRATRLHLFNFDVIRDNKVGNRYLVIDIN 565
           +KN++ Y +  +LE  E+PPLSFLT++A+ +R +  L+LFNFDVIRD K  NRYL+IDIN
Sbjct: 232 DKNIE-YGEDRSLEKVEMPPLSFLTDLAKAMRESMGLNLFNFDVIRDAKDANRYLIIDIN 290

Query: 564 YFPGYAKMPNYESVMTEFFWDVL 496
           YFPGYAKMP+YE V+TEFFWD++
Sbjct: 291 YFPGYAKMPSYEPVLTEFFWDMV 313



>gb:AY172635_1586781 Zea mays inositol phosphate kinase mRNA,
           complete cds.
          Length = 342

 Score =  112 bits (281), Expect = 6e-24
 Identities = 50/83 (60%), Positives = 67/83 (80%)
 Frame = -3

Query: 744 EKNVDKYCKMMNLEDAELPPLSFLTEIARGLRRATRLHLFNFDVIRDNKVGNRYLVIDIN 565
           E+  ++Y    +LEDA +PP +F+ +IA GLRRA  L LFNFD+IRD + G+RYLVIDIN
Sbjct: 240 ERTAEEYYGEKSLEDAVVPPAAFINQIAGGLRRALGLQLFNFDMIRDVRAGDRYLVIDIN 299

Query: 564 YFPGYAKMPNYESVMTEFFWDVL 496
           YFPGYAKMP YE+V+T+FFW+++
Sbjct: 300 YFPGYAKMPGYETVLTDFFWEMV 322



>gb:AP004850_1845952 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1342_D02.
          Length = 355

 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 41/71 (57%), Positives = 53/71 (74%), Gaps = 2/71 (2%)
 Frame = -3

Query: 702 DAELPPLSFLTEIARGLRRATRLHLFNFDVIRDNKV--GNRYLVIDINYFPGYAKMPNYE 529
           D + P   F+ E+ARGLRR   LHLFNFD+IR+     G+RY +IDINYFPGYAKMP YE
Sbjct: 244 DDDTPAAGFVDEVARGLRRGLGLHLFNFDMIRERSEEHGDRYFIIDINYFPGYAKMPGYE 303

Query: 528 SVMTEFFWDVL 496
           + +T+FF ++L
Sbjct: 304 AALTDFFLEML 314



>gb:AY050408_1562185 Arabidopsis thaliana AT4g08170/T12G13_10 mRNA,
           complete cds.>gb:AY058241_1564366 Arabidopsis thaliana
           AT4g08170/T12G13_10 mRNA, complete cds.
          Length = 353

 Score = 79.3 bits (194), Expect = 7e-14
 Identities = 37/68 (54%), Positives = 46/68 (67%)
 Frame = -3

Query: 699 AELPPLSFLTEIARGLRRATRLHLFNFDVIRDNKVGNRYLVIDINYFPGYAKMPNYESVM 520
           AELPP   L  +A+ LRR   L LFN D+IR++   +R+ VIDINYFPGY KMP YE V 
Sbjct: 273 AELPPRPLLERLAKELRRGLGLRLFNLDIIREHGTRDRFYVIDINYFPGYGKMPEYEHVF 332

Query: 519 TEFFWDVL 496
           T+F   V+
Sbjct: 333 TDFLLSVV 340



>gb:AE016959_1020590 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC069324_1540820
           Oryza sativa chromosome 10 clone OSJNBa0071K19, complete
           sequence.>gb:AE017047_1750409 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 1 of 77 of the
           complete sequence.
          Length = 333

 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 36/63 (57%), Positives = 44/63 (69%)
 Frame = -3

Query: 699 AELPPLSFLTEIARGLRRATRLHLFNFDVIRDNKVGNRYLVIDINYFPGYAKMPNYESVM 520
           AELPP   L ++ R LRR   L LFNFD+IR++   +RY VIDINYFPGY KMP YE + 
Sbjct: 255 AELPPKPLLEKLGRELRRRLGLRLFNFDMIREHGRKDRYYVIDINYFPGYGKMPGYEHIF 314

Query: 519 TEF 511
            +F
Sbjct: 315 IDF 317



>gb:AC135228_1742191 Oryza sativa chromosome 3 BAC OSJNBb0122C16
           genomic sequence, complete sequence.>gb:AC145380_1744364
           Oryza sativa chromosome 3 BAC OSJNBa0013A09 genomic
           sequence, complete sequence.
          Length = 357

 Score = 76.3 bits (186), Expect = 6e-13
 Identities = 39/78 (50%), Positives = 48/78 (61%), Gaps = 7/78 (8%)
 Frame = -3

Query: 723 CKMMNLEDA-------ELPPLSFLTEIARGLRRATRLHLFNFDVIRDNKVGNRYLVIDIN 565
           C   N +DA       ELPP   L  +AR LRR   L LFN D+IR++   +R+ VID+N
Sbjct: 260 CASANADDADLDPHVAELPPRPLLEILARELRRRLGLRLFNIDMIREHGTRDRFYVIDMN 319

Query: 564 YFPGYAKMPNYESVMTEF 511
           YFPGY KMP YE V T+F
Sbjct: 320 YFPGYGKMPGYEHVFTDF 337



>gb:AC105927_1738258 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1781E12, complete
           sequence.>gb:AC135157_1741989 Oryza sativa (japonica
           cultivar-group) chromosome 3 clone OJ1017C11, complete
           sequence.
          Length = 357

 Score = 69.7 bits (169), Expect = 5e-11
 Identities = 31/63 (49%), Positives = 42/63 (66%)
 Frame = -3

Query: 699 AELPPLSFLTEIARGLRRATRLHLFNFDVIRDNKVGNRYLVIDINYFPGYAKMPNYESVM 520
           +ELPP   L ++ + LR    L LFN D+IR+    +RY +IDINYFPG+ KMP YE + 
Sbjct: 279 SELPPRPLLEKLGKELRGRLGLRLFNIDMIRELGTKDRYYIIDINYFPGFGKMPGYEHIF 338

Query: 519 TEF 511
           T+F
Sbjct: 339 TDF 341



>gb:AF188610_1775230 Oryza sativa saline-responsive OSSR1 (Sr1)
           mRNA, partial cds.
          Length = 117

 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 29/57 (50%), Positives = 38/57 (66%)
 Frame = -3

Query: 699 AELPPLSFLTEIARGLRRATRLHLFNFDVIRDNKVGNRYLVIDINYFPGYAKMPNYE 529
           +ELPP   L ++ + LR    L LFN D+IR+    +RY +IDINYFPG+ KMP YE
Sbjct: 54  SELPPRPLLEKLGKELRGRLGLRLFNIDMIRELGTKDRYYIIDINYFPGFGKMPGYE 110



>pir|T10544|T10544 inositol 1,3,4-trisphosphate 5/6-kinase homolog
           T12G13.10 - Arabidopsis thaliana>gb:ATCHRIV22_1544533
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 22.>gb:ATT12G13_1554332 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T12G13, partial sequence (ESSA
           project).
          Length = 338

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 27/49 (55%), Positives = 34/49 (69%)
 Frame = -3

Query: 699 AELPPLSFLTEIARGLRRATRLHLFNFDVIRDNKVGNRYLVIDINYFPG 553
           AELPP   L  +A+ LRR   L LFN D+IR++   +R+ VIDINYFPG
Sbjct: 273 AELPPRPLLERLAKELRRGLGLRLFNLDIIREHGTRDRFYVIDINYFPG 321



>pir|T04994|T04994 hypothetical protein T16L1.260 - Arabidopsis
           thaliana>gb:ATCHRIV80_1547338 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 80.>gb:ATT16L1_1554631
           Arabidopsis thaliana DNA chromosome 4, BAC clone T16L1
           (ESSAII project).
          Length = 364

 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 32/49 (65%)
 Frame = -3

Query: 699 AELPPLSFLTEIARGLRRATRLHLFNFDVIRDNKVGNRYLVIDINYFPG 553
           AELPP  FL  + + LR    L LFN D+IR++   N + VIDINYFPG
Sbjct: 292 AELPPKPFLEALVKELRSLLGLRLFNIDMIREHGSKNVFYVIDINYFPG 340



>gb:BC054977_2551182 Xenopus laevis inositol 1,3,4-triphosphate 5/6
           kinase, mRNA (cDNA clone MGC:64486 IMAGE:6881628),
           complete cds.
          Length = 396

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 28/67 (41%), Positives = 39/67 (58%)
 Frame = -3

Query: 696 ELPPLSFLTEIARGLRRATRLHLFNFDVIRDNKVGNRYLVIDINYFPGYAKMPNYESVMT 517
           E P    +  I++ LR+A  + LF  D+I +NK G ++ VIDIN FPGY  +P       
Sbjct: 255 ERPCDEVIRGISKALRQALGISLFGIDIIINNKTG-QHAVIDINAFPGYEGVP------- 306

Query: 516 EFFWDVL 496
           EFF D+L
Sbjct: 307 EFFTDLL 313



>gb:AY335756_2144974 Synthetic construct Homo sapiens inositol
           1,3,4-triphosphate 5/6 kinase (ITPK1) mRNA, partial
           cds.>gb:BT007645_2150577 Synthetic construct Homo
           sapiens inositol 1,3,4-triphosphate 5/6 kinase mRNA,
           partial cds.
          Length = 415

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 27/67 (40%), Positives = 40/67 (59%)
 Frame = -3

Query: 696 ELPPLSFLTEIARGLRRATRLHLFNFDVIRDNKVGNRYLVIDINYFPGYAKMPNYESVMT 517
           E P    + E++R LR+A  + LF  D+I +N+ G ++ VIDIN FPGY         ++
Sbjct: 255 ERPSDEVIRELSRALRQALGVSLFGIDIIINNQTG-QHAVIDINAFPGY-------EGVS 306

Query: 516 EFFWDVL 496
           EFF D+L
Sbjct: 307 EFFTDLL 313



>gb:HSU51336_2024698 Human inositol 1,3,4-trisphosphate 5/6-kinase
           mRNA, complete cds.
          Length = 414

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 27/67 (40%), Positives = 40/67 (59%)
 Frame = -3

Query: 696 ELPPLSFLTEIARGLRRATRLHLFNFDVIRDNKVGNRYLVIDINYFPGYAKMPNYESVMT 517
           E P    + E++R LR+A  + LF  D+I +N+ G ++ VIDIN FPGY         ++
Sbjct: 255 ERPSDEVIRELSRALRQALGVSLFGIDIIINNQTG-QHAVIDINAFPGY-------EGVS 306

Query: 516 EFFWDVL 496
           EFF D+L
Sbjct: 307 EFFTDLL 313



>gb:BC037305_1982171 Homo sapiens inositol 1,3,4-triphosphate 5/6
           kinase, mRNA (cDNA clone IMAGE:5261887), partial cds.
          Length = 444

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 27/67 (40%), Positives = 40/67 (59%)
 Frame = -3

Query: 696 ELPPLSFLTEIARGLRRATRLHLFNFDVIRDNKVGNRYLVIDINYFPGYAKMPNYESVMT 517
           E P    + E++R LR+A  + LF  D+I +N+ G ++ VIDIN FPGY         ++
Sbjct: 285 ERPSDEVIRELSRALRQALGVSLFGIDIIINNQTG-QHAVIDINAFPGY-------EGVS 336

Query: 516 EFFWDVL 496
           EFF D+L
Sbjct: 337 EFFTDLL 343



>gb:AF279372_1894503 Homo sapiens inositol 3,4,5,6 tetrakisphosphate
           1-kinase/inositol 1,3,4-trisphosphate 5/6-kinase mRNA,
           complete cds.>gb:BC018192_1976460 Homo sapiens inositol
           1,3,4-triphosphate 5/6 kinase, mRNA (cDNA clone
           MGC:21491 IMAGE:3867269), complete cds.
          Length = 414

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 27/67 (40%), Positives = 40/67 (59%)
 Frame = -3

Query: 696 ELPPLSFLTEIARGLRRATRLHLFNFDVIRDNKVGNRYLVIDINYFPGYAKMPNYESVMT 517
           E P    + E++R LR+A  + LF  D+I +N+ G ++ VIDIN FPGY         ++
Sbjct: 255 ERPSDEVIRELSRALRQALGVSLFGIDIIINNQTG-QHAVIDINAFPGY-------EGVS 306

Query: 516 EFFWDVL 496
           EFF D+L
Sbjct: 307 EFFTDLL 313



>gb:BC050497_2550381 Danio rerio zgc:56075, mRNA (cDNA clone
           MGC:56075 IMAGE:5409876), complete cds.
          Length = 396

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 27/65 (41%), Positives = 39/65 (60%)
 Frame = -3

Query: 690 PPLSFLTEIARGLRRATRLHLFNFDVIRDNKVGNRYLVIDINYFPGYAKMPNYESVMTEF 511
           P    + +I+R LR+A  + LF  D+I +N+ G ++ VIDIN FPGY  +P       EF
Sbjct: 257 PSNEVIQKISRKLRQALGISLFGIDIIINNQTG-QHAVIDINAFPGYEGVP-------EF 308

Query: 510 FWDVL 496
           F D+L
Sbjct: 309 FDDLL 313



>gb:BC025917_2095226 Mus musculus inositol 1,3,4-triphosphate 5/6
           kinase, mRNA (cDNA clone IMAGE:5026869), partial cds.
          Length = 196

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 26/67 (38%), Positives = 40/67 (59%)
 Frame = -3

Query: 696 ELPPLSFLTEIARGLRRATRLHLFNFDVIRDNKVGNRYLVIDINYFPGYAKMPNYESVMT 517
           E P    + E++R LR+A  + LF  D+I +N+ G ++ VID+N FPGY         ++
Sbjct: 32  ERPSDEVIRELSRALRQALGVSLFGIDIIINNQTG-QHAVIDVNAFPGY-------EGVS 83

Query: 516 EFFWDVL 496
           EFF D+L
Sbjct: 84  EFFTDLL 90



>gb:AK038913_1165211 Mus musculus adult male hypothalamus cDNA,
           RIKEN full-length enriched library, clone:A230074J21
           product:INOSITOL 3,4,5,6 TETRAKISPHOSPHATE
           1-KINASE/INOSITOL 1,3,4-TRISPHOSPHATE 5/6-KINASE homolog
           [Homo sapiens], full insert
           sequence.>gb:BC056464_2102398 Mus musculus inositol
           1,3,4-triphosphate 5/6 kinase, mRNA (cDNA clone
           MGC:67230 IMAGE:5707377), complete cds.
          Length = 419

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 26/67 (38%), Positives = 40/67 (59%)
 Frame = -3

Query: 696 ELPPLSFLTEIARGLRRATRLHLFNFDVIRDNKVGNRYLVIDINYFPGYAKMPNYESVMT 517
           E P    + E++R LR+A  + LF  D+I +N+ G ++ VID+N FPGY         ++
Sbjct: 255 ERPSDEVIRELSRALRQALGVSLFGIDIIINNQTG-QHAVIDVNAFPGY-------EGVS 306

Query: 516 EFFWDVL 496
           EFF D+L
Sbjct: 307 EFFTDLL 313



>gb:AP006525_1862180 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC
           clone:P0498F03.>gb:AP007254_1863411 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9,
           fosmid clone:OSJNOa211K08.
          Length = 504

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 20/71 (28%), Positives = 43/71 (60%)
 Frame = -3

Query: 708 LEDAELPPLSFLTEIARGLRRATRLHLFNFDVIRDNKVGNRYLVIDINYFPGYAKMPNYE 529
           ++D++L  ++ + E A+ L+    L +F FDV+     G+ ++++D+NY P + ++P  +
Sbjct: 424 VQDSKLLDINLVEEAAKLLKELLGLTIFGFDVVVQESSGD-HVIVDLNYLPSFKEVP--D 480

Query: 528 SVMTEFFWDVL 496
           +V    FWD +
Sbjct: 481 NVAMPAFWDAI 491



>gb:BX248515_2567121 Zebrafish DNA sequence from clone DKEY-177P2 in
           linkage group 20 Contains nine novel genes (zgc:56075),
           the gene for a novel protein similar to vertebrate sel-1
           suppressor of lin-12-like (C. elegans) (SEL1L), the gene
           for a novel protein similar to AHA1 activator of heat
           shock 90kDa protein ATPase homolog 1 (yeast) (ahsa1),
           the gene for a novel protein similar to vertebrate cell
           division cycle associated 4 (CDCA4), the gene for a
           novel protein similar to vertebrate serine (or cysteine)
           proteinase inhibitor clade B (ovalbumin) member 1
           (SERPINB1), a serine (or cysteine) proteinase inhibitor
           clade B (ovalbumin) family member pseudogene and the
           gene for a novel protein similar to vertebrate serine
           (or cysteine) proteinase inhibitor clade B (ovalbumin)
           family member, complete sequence.
          Length = 396

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 26/65 (40%), Positives = 38/65 (58%)
 Frame = -3

Query: 690 PPLSFLTEIARGLRRATRLHLFNFDVIRDNKVGNRYLVIDINYFPGYAKMPNYESVMTEF 511
           P    + +I+R L +A  + LF  D+I +N+ G ++ VIDIN FPGY  +P       EF
Sbjct: 257 PSNEVIQKISRKLHQALGISLFGIDIIINNQTG-QHAVIDINAFPGYEGVP-------EF 308

Query: 510 FWDVL 496
           F D+L
Sbjct: 309 FDDLL 313



>gb:AY070449_1566834 Arabidopsis thaliana unknown protein
           (At2g43980) mRNA, complete cds.>gb:AY096566_1576106
           Arabidopsis thaliana unknown protein (At2g43980) mRNA,
           complete cds.
          Length = 488

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 19/63 (30%), Positives = 37/63 (58%)
 Frame = -3

Query: 684 LSFLTEIARGLRRATRLHLFNFDVIRDNKVGNRYLVIDINYFPGYAKMPNYESVMTEFFW 505
           L  +TE A  LR+   L +F FDV+     G+ ++++D+NY P + ++P  +++    FW
Sbjct: 417 LELVTEAATWLRKKLDLTIFGFDVVIQEGTGD-HVIVDLNYLPSFKEVP--DNIAVPAFW 473

Query: 504 DVL 496
           + +
Sbjct: 474 EAI 476



>gb:BC003622_1968933 Homo sapiens inositol 1,3,4-triphosphate 5/6
           kinase, mRNA (cDNA clone MGC:2116 IMAGE:3010239),
           complete cds.>gb:BC007428_1970722 Homo sapiens inositol
           1,3,4-triphosphate 5/6 kinase, mRNA (cDNA clone MGC:3867
           IMAGE:3010239), complete cds.
          Length = 314

 Score = 40.8 bits (94), Expect = 0.027
 Identities = 21/48 (43%), Positives = 31/48 (64%)
 Frame = -3

Query: 696 ELPPLSFLTEIARGLRRATRLHLFNFDVIRDNKVGNRYLVIDINYFPG 553
           E P    + E++R LR+A  + LF  D+I +N+ G ++ VIDIN FPG
Sbjct: 255 ERPSDEVIRELSRALRQALGVSLFGIDIIINNQTG-QHAVIDINAFPG 301



>pir|D90531|D90531 excinuclease ABC subunit c [imported] -
           Mycoplasma pulmonis  (strain UAB CTIP)>gb:MPULM01_149669
           Mycoplasma pulmonis (strain UAB CTIP) complete genome;
           segment 1/3.
          Length = 563

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 23/75 (30%), Positives = 31/75 (41%), Gaps = 1/75 (1%)
 Frame = -3

Query: 747 NEKNVDKYCKMMNLEDAELPPLSFLTEIARGLRRATRLHLFNFDVIRDNKVGNRYLVIDI 568
           N KN+ +   M N   A   P+S +     G++       FN DV  D K        DI
Sbjct: 355 NVKNLHRIVMMDNSHFANFHPISVVVSYIDGIKNTNEYRKFNLDVNHDRKA-------DI 407

Query: 567 NYF-PGYAKMPNYES 526
            YF  G+ K  N +S
Sbjct: 408 EYFKEGFLKYINSKS 422



>gb:AF118848_1242787 Entamoeba histolytica inositol
           1,3,4-trisphosphate 5/6-kinase (IK) gene, complete cds.
          Length = 319

 Score = 33.1 bits (74), Expect = 5.6
 Identities = 16/49 (32%), Positives = 29/49 (59%)
 Frame = -3

Query: 675 LTEIARGLRRATRLHLFNFDVIRDNKVGNRYLVIDINYFPGYAKMPNYE 529
           + ++A  +R A  + L   D I++N+ GN  LV+D+N FP Y    +++
Sbjct: 256 MRDLAYKVRCALGVQLCGIDFIKENEQGNP-LVVDVNVFPSYGGKVDFD 303



>gb:TMVAJ690_2455337 Turnip mosaic virus mRNA for replicase and coat
           protein.
          Length = 801

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194 QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
           + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 471 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 504



>gb:TMO489259_2455313 Turnip Mosaic Virus partial gene for partial
           polyprotein, genomic RNA.
          Length = 499

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194 QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
           + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 164 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 197



>gb:TMO488152_2455312 Turnip mosaic virus partial gene for
           polyprotein, genomic RNA.
          Length = 499

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194 QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
           + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 164 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 197



>gb:TMO307038_2455270 Turnip mosaic virus genomic RNA for partial
           viral polyprotein, isolate Hangzhou C2.
          Length = 499

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194 QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
           + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 164 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 197



>gb:TMO307037_2455269 Turnip mosaic virus genomic RNA for partial
           viral polyprotein, isolate Hangzhou.
          Length = 499

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194 QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
           + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 164 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 197



>gb:TMO297629_2455268 Turnip mosaic virus genomic RNA for partial
           NIb replicase and coat protein, isolate Wenzhou.
          Length = 499

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194 QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
           + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 164 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 197



>gb:TMO293279_2455267 Turnip mosaic virus partial genomic RNA for
           viral polyprotein.
          Length = 499

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194 QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
           + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 164 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 197



>gb:AY134473_2299110 Turnip mosaic virus strain RC4, complete genome.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AY090660_2296027 Turnip mosaic virus isolate CHN 12, complete
            genome.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AF530055_2271340 Turnip mosaic virus strain YC5, complete genome.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AF394602_2247440 Turnip mosaic virus strain TW, complete genome.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AF312911_2232913 Turnip mosaic virus strain KC polyprotein gene,
           partial cds.
          Length = 361

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194 QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
           + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 26  EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 59



>gb:AF228514_2218558 Turnip mosaic virus polyprotein gene, partial
           cds.
          Length = 497

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194 QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
           + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 162 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 195



>gb:AB194802_2175542 Turnip mosaic virus (isolate UK1) genomic RNA,
            complete genome, variant: B2212.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AB194801_2175541 Turnip mosaic virus (isolate UK1) genomic RNA,
            complete genome, variant: B2211.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AB194800_2175540 Turnip mosaic virus (isolate UK1) genomic RNA,
            complete genome, variant: B221.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AB194799_2175539 Turnip mosaic virus (isolate UK1) genomic RNA,
            complete genome, variant: B22.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AB194798_2175538 Turnip mosaic virus (isolate UK1) genomic RNA,
            complete genome, variant: B2.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AB194796_2175536 Turnip mosaic virus (isolate UK1) genomic RNA,
            complete genome, variant: B111.>gb:AB194797_2175537
            Turnip mosaic virus (isolate UK1) genomic RNA, complete
            genome, variant: B1111.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AB194795_2175535 Turnip mosaic virus (isolate UK1) genomic RNA,
            complete genome, variant: B11.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AB194794_2175534 Turnip mosaic virus (isolate UK1) genomic RNA,
            complete genome, variant: B1.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AB194793_2175533 Turnip mosaic virus (isolate UK1) genomic RNA,
            complete genome, variant: B.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AB194792_2175532 Turnip mosaic virus (isolate UK1) genomic RNA,
            complete genome, variant: A12.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AB194791_2175531 Turnip mosaic virus (isolate UK1) genomic RNA,
            complete genome, variant: A1111.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AB194790_2175530 Turnip mosaic virus (isolate UK1) genomic RNA,
            complete genome, variant: A111.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AB194789_2175529 Turnip mosaic virus (isolate UK1) genomic RNA,
            complete genome, variant: A11.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AB194788_2175528 Turnip mosaic virus (isolate UK1) genomic RNA,
            complete genome, variant: A1.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AB194787_2175527 Turnip mosaic virus (isolate UK1) genomic RNA,
            complete genome, variant: A.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AB194785_2175525 Turnip mosaic virus (isolate UK1) genomic RNA,
            complete genome, variant: N1.>gb:AB194786_2175526 Turnip
            mosaic virus (isolate UK1) genomic RNA, complete genome,
            variant: N2.>gb:AF169561_2207261 Turnip mosaic virus
            strain UK1, complete genome.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AB105135_2170399 Turnip mosaic virus gene for polyprotein,
            complete cds, isolate:Tu-2R1.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AB105134_2170398 Turnip mosaic virus gene for polyprotein,
            complete cds, isolate:Tu-3.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AB093625_2169144 Turnip mosaic virus gene for polyprotein,
            complete cds, isolate:C42J.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AB093624_2169143 Turnip mosaic virus gene for polyprotein,
            complete cds, isolate:Ka1J.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AB093623_2169142 Turnip mosaic virus gene for polyprotein,
            complete cds, isolate:DMJ.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AB093622_2169141 Turnip mosaic virus gene for polyprotein,
            complete cds, isolate:2J.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AB093617_2169136 Turnip mosaic virus gene for polyprotein,
            complete cds, isolate:HOD517J.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AB093616_2169135 Turnip mosaic virus gene for polyprotein,
            complete cds, isolate:NDJ.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>gb:AB093605_2169124 Turnip mosaic virus gene for polyprotein,
            complete cds, isolate:KEN1.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862



>pir|PQ0759|PQ0759 polyprotein - turnip mosaic virus (isolate 31)
           (fragment)
          Length = 388

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194 QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
           + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 53  EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 86



>pir|PQ0757|PQ0757 polyprotein - turnip mosaic virus (isolate 1)
           (fragment)
          Length = 388

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194 QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
           + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 53  EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 86



>sp|P89509|POLG_TUMVJ Genome polyprotein [Contains: P1 proteinase
            (N-terminal protein); Helper component-proteinase (EC
            3.4.22.45) (HC-pro); Protein P3; 6 kDa protein 1 (6K1);
            Cytoplasmic inclusion protein (CI); 6 kDa protein 2
            (6K2); Viral genome-linked protein (VPg); Nuclear
            inclusion protein A (EC 3.4.22.44) (NI-a) (NIa) (NIa-pro)
            (49 kDa proteinase) (49 kDa- Pro); Nuclear inclusion
            protein B (EC 2.7.7.48) (NI-b) (NIb) (RNA- directed RNA
            polymerase); Coat protein (CP)].>gb:D83184_2398903 Turnip
            mosaic virus gene for polyprotein, complete cds.
          Length = 3164

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 194  QNKAKNLVITAVLTLYLKENPANQEKDHYLLAIF 295
            + KA  +  TA+  LYL + PA ++  HYL AIF
Sbjct: 2829 EGKAPYIAETALRKLYLDKEPAQEDLTHYLQAIF 2862


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 698,062,232
Number of Sequences: 1806583
Number of extensions: 12881962
Number of successful extensions: 32145
Number of sequences better than 10.0: 67
Number of HSP's better than 10.0 without gapping: 31399
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32138
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 46996930370
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)