BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10871
         (966 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:BC019429_2092911 Mus musculus cDNA clone MGC:30371 IMAGE:5149...   249   7e-65   
gb:AY024357_1559010 Arabidopsis thaliana floral homeotic protein...   249   7e-65   
gb:AC069474_1540905 Arabidopsis thaliana chromosome 3 BAC T2E22 ...   249   7e-65   
gb:AB024033_1515781 Arabidopsis thaliana genomic DNA, chromosome...   207   2e-52   
gb:AP002897_1823662 Oryza sativa (japonica cultivar-group) genom...   201   1e-50   
gb:AP002897_1823661 Oryza sativa (japonica cultivar-group) genom...   201   1e-50   
gb:AP002525_1822409 Oryza sativa (japonica cultivar-group) genom...   129   7e-29   
gb:AY084634_1569722 Arabidopsis thaliana clone 113763 mRNA, comp...   125   2e-27   
pir|C84920|C84920 hypothetical protein At2g47850 [imported] - Ar...   124   3e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AK117978_1815983 Arabidopsis thaliana At3g02830 mRNA for puta...   122   1e-26   
gb:ATAC018363_1543684 Arabidopsis thaliana chromosome III BAC F1...   122   1e-26   
gb:AP002525_1822420 Oryza sativa (japonica cultivar-group) genom...   121   2e-26   
gb:AP002525_1822419 Oryza sativa (japonica cultivar-group) genom...   121   2e-26   
gb:AP005492_1852799 Oryza sativa (japonica cultivar-group) genom...   121   2e-26   
gb:AY048253_1561714 Arabidopsis thaliana At1g04990/F13M7_1 mRNA,...   120   5e-26   
pir|T48868|T48868 zinc finger protein [imported] - garden pea>gb...   119   9e-26   Pisum sativum [garden pea]
pir|T48874|T48874 zinc finger protein 1 [imported] - Arabidopsis...   119   1e-25   Arabidopsis thaliana [mouse-ear cress]
gb:AP003451_1829649 Oryza sativa (japonica cultivar-group) genom...   117   3e-25   
pir|T06698|T06698 hypothetical protein T29H11.40 - Arabidopsis t...   117   4e-25   Arabidopsis thaliana [mouse-ear cress]
gb:AB008265_1510409 Arabidopsis thaliana genomic DNA, chromosome...   113   5e-24   
gb:AB005242_1509522 Arabidopsis thaliana genomic DNA, chromosome...   112   8e-24   
gb:BT020223_1642618 Arabidopsis thaliana At5g63260 mRNA, complet...   112   1e-23   
pir|T01114|T01114 hypothetical protein At2g32930 [imported] - Ar...   109   7e-23   Arabidopsis thaliana [mouse-ear cress]
pir|F86183|F86183 hypothetical protein [imported] - Arabidopsis ...   109   9e-23   Arabidopsis thaliana [mouse-ear cress]
gb:ATAC011623_1543321 Arabidopsis thaliana chromosome III BAC F2...   107   4e-22   
gb:BT010886_1640832 Arabidopsis thaliana At5g18550 gene, complet...   105   2e-21   
gb:AP003451_1829650 Oryza sativa (japonica cultivar-group) genom...    97   6e-19   
gb:AY573063_1615759 Oryza sativa (japonica cultivar-group) zinc-...    89   1e-16   
gb:CCCTH1_2568343 C.carpio mRNA for CTH1 protein.                      59   1e-07   
gb:DRE249490_2571035 Danio rerio mRNA for putative zinc finger p...    58   3e-07   
gb:DRY17841_2571408 Danio rerio mRNA for putative zinc finger pr...    57   7e-07   
gb:BT004106_1637207 Arabidopsis thaliana clone RAFL15-27-H11 (R2...    54   6e-06   
pir|B86419|B86419 probable zinc finger protein, 86473-88078 [imp...    52   2e-05   Arabidopsis thaliana [mouse-ear cress]
pir|T19155|T19155 hypothetical protein C09G9.6 - Caenorhabditis ...    51   3e-05   Caenorhabditis elegans [roundworm]
pir|G86418|G86418 probable zinc finger protein, 78337-80281 [imp...    49   1e-04   Arabidopsis thaliana [mouse-ear cress]
pir|T31491|T31491 hypothetical protein Y116A8C.19 - Caenorhabdit...    47   6e-04   Caenorhabditis elegans [roundworm]
gb:AF061983_2471356 Xenopus laevis CCCH zinc finger protein C3H-...    46   0.001   
gb:AY736015_1348806 Caenorhabditis briggsae POS-1 (pos-1b) mRNA,...    45   0.002   
gb:AY736014_1348805 Caenorhabditis briggsae POS-1 (pos-1a) mRNA,...    45   0.002   
gb:CR382132_1664936 Yarrowia lipolytica chromosome F of strain C...    44   0.005   
pir|T37246|T37246 probable transcription factor pos-1 - Caenorha...    44   0.005   Caenorhabditis elegans [roundworm]
gb:BC083870_2108932 Rattus norvegicus makorin, ring finger prote...    44   0.006   
gb:OSJN00095_1694820 Oryza sativa genomic DNA, chromosome 4, BAC...    44   0.006   
gb:AK011295_1156310 Mus musculus 10 days embryo whole body cDNA,...    44   0.006   
gb:AK009515_1155185 Mus musculus adult male tongue cDNA, RIKEN f...    44   0.006   
sp|Q9ERV1|MKR2_MOUSE|MKR2_MOUSE Makorin 2.>gb:AF277171_2061264 Mus musculus...    44   0.006   Mus musculus [mouse]
gb:AF277164S7_1894405 Homo sapiens Makorin RING zinc-finger prot...    43   0.011   
gb:AF161555_1150448 Homo sapiens HSPC070 mRNA, complete cds.           43   0.011   
sp|Q9H000|MKR2_HUMAN|MKR2_HUMAN Makorin 2 (HSPC070).>gb:BC015715_1975262 Ho...    43   0.011   Homo sapiens [man]
gb:AE016818_1747817 Ashbya gossypii (= Eremothecium gossypii) AT...    42   0.014   
pir|T21620|T21620 hypothetical protein F32A11.6 - Caenorhabditis...    42   0.014   Caenorhabditis elegans [roundworm]
gb:AX971584_1486893 Sequence 2387 from Patent EP1104808.               42   0.018   
pir|T28994|T28994 hypothetical protein ZC513.6 - Caenorhabditis ...    42   0.018   Caenorhabditis elegans [roundworm]
gb:AP003308_1827741 Oryza sativa (japonica cultivar-group) genom...    42   0.024   
pir|T19760|T19760 hypothetical protein C35D6.4 - Caenorhabditis ...    42   0.024   Caenorhabditis elegans [roundworm]
pir|T21963|T21963 hypothetical protein F38C2.7 - Caenorhabditis ...    42   0.024   Caenorhabditis elegans [roundworm]
gb:AF439559_2494356 Gallus gallus makorin-2 (MKRN2) mRNA, comple...    41   0.031   
gb:AY736016_1348807 Caenorhabditis remanei POS-1 (pos-1) mRNA, c...    41   0.031   
gb:SEQPYGHL2B_2579843 Seriola quinqueradiata GHL2 mRNA for YGHL2...    41   0.040   
gb:AB032769_2461451 Seriola quinqueradiata mRNA for zinc finger ...    41   0.040   
gb:SPCC1906_1721147 S.pombe chromosome III cosmid c1906.               41   0.040   
sp|O74463|YQC1_SCHPO|YQC1_SCHPO Hypothetical protein C1739.01 in chromosome...    41   0.040   Schizosaccharomyces pombe
sp|Q9DD48|MKR2_SERQU|MKR2_SERQU Makorin 2 (Zinc finger protein YGHLC3HC4).>...    41   0.040   Seriola quinqueradiata [five-ray yellowtail]
gb:AK129275_2069506 Mus musculus mRNA for mKIAA1064 protein.           40   0.053   
gb:AF395876_1900729 Homo sapiens 36 kDa muscleblind protein EXP3...    40   0.053   
gb:AF255334_1893136 Homo sapiens EXP35 mRNA, complete cds.             40   0.053   
gb:AB028987_1865843 Homo sapiens mRNA for KIAA1064 protein, part...    40   0.053   
gb:CEU81043_1368663 Caenorhabditis elegans MEX-1 (mex-1) mRNA, c...    40   0.053   
pir|T26124|T26124 hypothetical protein W03C9.7 - Caenorhabditis ...    40   0.053   Caenorhabditis elegans [roundworm]
gb:AE017343_1755806 Cryptococcus neoformans var. neoformans JEC2...    40   0.069   
gb:CR382132_1665507 Yarrowia lipolytica chromosome F of strain C...    40   0.069   
gb:CR382130_1662919 Yarrowia lipolytica chromosome D of strain C...    40   0.069   
gb:CR382124_1657056 Kluyveromyces lactis strain NRRL Y-1140 chro...    40   0.090   
pir|T21961|T21961 hypothetical protein F38C2.5 - Caenorhabditis ...    40   0.090   Caenorhabditis elegans [roundworm]
sp|Q9TT91|MKR1_MACEU|MKR1_MACEU Makorin 1.>gb:AF192786_1415884 Macropus eug...    40   0.090   Notamacropus eugenii
gb:AF236664_1779598 Aspergillus nidulans hypothetical zinc-finge...    39   0.12    
gb:AB029332_1194705 Halocynthia roretzi mRNA for HrZF-1, complet...    39   0.12    
pir|T27239|T27239 hypothetical protein Y57G11C.25 - Caenorhabdit...    39   0.12    Caenorhabditis elegans [roundworm]
gb:BC065352_2553970 Danio rerio makorin, ring finger protein, 2,...    39   0.20    
gb:BC045986_2549498 Danio rerio makorin, ring finger protein, 2,...    39   0.20    
gb:AF192787_2479345 Gallus gallus makorin 1 (MKRN1) mRNA, comple...    39   0.20    
gb:AE017349_1758636 Cryptococcus neoformans var. neoformans JEC2...    39   0.20    
gb:AE017342_1754764 Cryptococcus neoformans var. neoformans JEC2...    39   0.20    
gb:CNS06C8G_1372637 chromosome I of strain GB-M1 of Encephalitoz...    39   0.20    
gb:CEY60A9A_1370801 Caenorhabditis elegans YAC Y60A9A, complete ...    39   0.20    
sp|Q9DFG8|MKR2_BRARE|MKR2_BRARE Makorin 2.>gb:AF277172_2483900 Danio rerio ...    39   0.20    Danio rerio [leopard danio]
gb:BC073564_2557393 Xenopus laevis hypothetical protein LOC44366...    38   0.26    
gb:AB185115_2467124 Takifugu rubripes MKRN1 mRNA for makorin RIN...    38   0.26    
gb:AB083692_2463708 Seriola quinqueradiata gene for Makorin1, pa...    38   0.26    
gb:AB083365_2463700 Seriola quinqueradiata mRNA for Makorin1, pa...    38   0.26    
gb:AB073984_2463259 Seriola quinqueradiata MAKORIN1 mRNA for gen...    38   0.26    
gb:AB182269_2466959 Takifugu rubripes MKRN1 mRNA for makorin RIN...    38   0.34    
gb:AE016820_1749997 Ashbya gossypii (= Eremothecium gossypii) AT...    38   0.34    
pir|F86348|F86348 hypothetical protein F24J8.17 [imported] - Ara...    38   0.34    Arabidopsis thaliana [mouse-ear cress]
sp|P26651|TTP_HUMAN|TTP_HUMAN Tristetraproline (TTP) (TIS11A protein) (TIS...    38   0.34    Homo sapiens [man]
pir|T31489|T31489 hypothetical protein Y116A8C.17 - Caenorhabdit...    37   0.45    Caenorhabditis elegans [roundworm]
gb:BC081358_2562241 Xenopus tropicalis MGC89691 protein, mRNA (c...    37   0.58    
gb:AC098571_1736744 Oryza sativa (japonica cultivar-group) chrom...    37   0.58    
gb:CR382138_1670817 Debaryomyces hansenii chromosome F of strain...    37   0.58    
gb:CR382126_1658712 Kluyveromyces lactis strain NRRL Y-1140 chro...    37   0.58    
gb:BC073459_2557298 Xenopus laevis MGC80969 protein, mRNA (cDNA ...    37   0.76    
gb:AF409139_1797022 Arabidopsis thaliana U2 auxiliary factor sma...    37   0.76    
gb:AK003361_1151814 Mus musculus 18-day embryo whole body cDNA, ...    37   0.76    
gb:AE005172_891645 Arabidopsis thaliana chromosome 1, top arm co...    37   0.76    
pir|T31503|T31503 hypothetical protein Y116A8C.35 - Caenorhabdit...    37   0.76    Caenorhabditis elegans [roundworm]
pir|T31492|T31492 hypothetical protein Y116A8C.20 - Caenorhabdit...    37   0.76    Caenorhabditis elegans [roundworm]
gb:BC044086_2548480 Xenopus laevis zinc finger protein 36, C3H t...    36   1.00    
gb:AF061981_2471354 Xenopus laevis CCCH zinc finger protein C3H-...    36   1.00    
gb:AF061980_2471353 Xenopus laevis CCCH zinc finger protein C3H-...    36   1.00    
gb:BC066091_2105715 Mus musculus expressed sequence AW494914, mR...    36   1.00    
gb:BC065169_2105575 Mus musculus expressed sequence AW494914, mR...    36   1.00    
gb:BC062952_2105094 Mus musculus expressed sequence AW494914, mR...    36   1.00    
gb:HSU07802_2021823 Human Tis11d gene, complete cds.                   36   1.00    
gb:D63484_1994818 Human mRNA for KIAA0150 gene, partial cds.           36   1.00    
gb:BC038670_1982377 Homo sapiens zinc finger CCCH type domain co...    36   1.00    
gb:BC005010_1969522 Homo sapiens zinc finger protein 36, C3H typ...    36   1.00    
gb:BC001974_1968014 Homo sapiens cDNA clone IMAGE:3457069, parti...    36   1.00    
gb:AC124143_1740429 Oryza sativa (japonica cultivar-group) chrom...    36   1.00    
gb:OSA18348_1692369 Oryza sativa mRNA for U2 snRNP auxiliary fac...    36   1.00    
gb:CR382135_1668460 Debaryomyces hansenii chromosome C of strain...    36   1.00    
gb:CR380951_1649987 Candida glabrata strain CBS138 chromosome E ...    36   1.00    
gb:AK053628_1170499 Mus musculus 0 day neonate eyeball cDNA, RIK...    36   1.00    
gb:AK005006_1152753 Mus musculus adult male liver cDNA, RIKEN fu...    36   1.00    
pir|S49147|S49147 ERF-2 protein - human>gb:HSERF2_2013038 H.sapi...    36   1.00    Homo sapiens [man]
pir|S04743|S04743 TPA-induced protein 11 - mouse>gb:MMTIS11_2117...    36   1.00    Mus musculus [mouse]
sp|Q8IXZ2|ZCC3_HUMAN|ZCC3_HUMAN Zinc finger CCCH type domain containing pro...    36   1.00    Homo sapiens [man]
sp|P22893|TTP_MOUSE|TTP_MOUSE Tristetraproline (TTP) (TIS11A protein) (TIS...    36   1.00    Mus musculus [mouse]
sp|P23949|TISD_MOUSE|TISD_MOUSE Butyrate response factor 2 (TIS11D protein)...    36   1.00    Mus musculus [mouse]
sp|P47974|TISD_HUMAN|TISD_HUMAN Butyrate response factor 2 (TIS11D protein)...    36   1.00    Homo sapiens [man]
sp|P47977|CTH2_YEAST|CTH2_YEAST Zinc finger protein CTH2 (YTIS11 protein).>...    36   1.00    Saccharomyces cerevisiae [brewer's yeast]
gb:FRNINE1_2572043 Fugu rubripes U2 small nuclear ribonucleoprot...    36   1.3     
gb:BC084221_2563611 Xenopus laevis cDNA clone MGC:80832 IMAGE:55...    36   1.3     
gb:AF061982_2471355 Xenopus laevis CCCH zinc finger protein C3H-...    36   1.3     
gb:AB097482_2464754 Xenopus laevis mRNA for hypothetical protein...    36   1.3     
gb:AF409140_1797023 Arabidopsis thaliana U2 auxiliary factor sma...    36   1.3     
gb:CEF38B7_1363617 Caenorhabditis elegans cosmid F38B7, complete...    36   1.3     
gb:CEF38B7_1363616 Caenorhabditis elegans cosmid F38B7, complete...    36   1.3     
pir|T21955|T21955 hypothetical protein F38B7.1b - Caenorhabditis...    36   1.3     Caenorhabditis elegans [roundworm]
pir|T21954|T21954 hypothetical protein F38B7.1a - Caenorhabditis...    36   1.3     Caenorhabditis elegans [roundworm]
pir|JC6068|JC6068 U2 auxiliary factor small chain - fission yeas...    36   1.3     Schizosaccharomyces pombe
sp|Q09176|U2AG_SCHPO|U2AG_SCHPO Splicing factor U2AF 23 kDa subunit (U2 aux...    36   1.3     Schizosaccharomyces pombe
sp|Q13434|MKR4_HUMAN|MKR4_HUMAN Makorin 4 (Zinc finger protein 127-Xp) (ZNF...    36   1.3     Homo sapiens [man]
gb:BT019467_2151374 Synthetic construct Homo sapiens zinc finger...    35   1.7     
gb:HSBERG36_2011023 H.sapiens mRNA for early response gene, Berg36.    35   1.7     
gb:BC060778_1985689 Homo sapiens DEAH (Asp-Glu-Ala-Asp/His) box ...    35   1.7     
gb:BC009717_1972203 Homo sapiens U11/U12 snRNP 20K, transcript v...    35   1.7     
gb:AK057423_1912030 Homo sapiens cDNA FLJ32861 fis, clone TESTI2...    35   1.7     
gb:SPBC337_1719947 S.pombe chromosome II cosmid c337.                  35   1.7     
gb:AY136436_1581936 Arabidopsis thaliana U2 snRNP auxiliary fact...    35   1.7     
gb:AX883668_1479428 Sequence 18573 from Patent EP1074617.              35   1.7     
gb:CR860870_1184916 Pongo pygmaeus mRNA; cDNA DKFZp469G0620 (fro...    35   1.7     
gb:CR857070_1181323 Pongo pygmaeus mRNA; cDNA DKFZp469I134 (from...    35   1.7     
gb:AK014200_1157821 Mus musculus 13 days embryo head cDNA, RIKEN...    35   1.7     
pir|T40265|T40265 hypothetical zinc-finger protein - fission yea...    35   1.7     Schizosaccharomyces pombe
pir|B39590|B39590 TPA-induced protein 11B - mouse                      35   1.7     Mus musculus [mouse]
sp|P17431|TISB_RAT|TISB_RAT Butyrate response factor 1 (TIS11B protein) (...    35   1.7     Rattus norvegicus [brown rat]
sp|P23950|TISB_MOUSE|TISB_MOUSE Butyrate response factor 1 (TIS11B protein)...    35   1.7     Mus musculus [mouse]
sp|Q07352|TISB_HUMAN|TISB_HUMAN Butyrate response factor 1 (TIS11B protein)...    35   1.7     Homo sapiens [man]
gb:BC045289_2549135 Danio rerio no arches, mRNA (cDNA clone MGC:...    35   2.2     
gb:AF277173_2483901 Danio rerio Makorin RING zinc-finger protein...    35   2.2     
gb:AB046743_2462205 Danio rerio nar gene for no arches, partial ...    35   2.2     
gb:CR382136_1669337 Debaryomyces hansenii chromosome D of strain...    35   2.2     
gb:CR382128_1660853 Yarrowia lipolytica chromosome B of strain C...    35   2.2     
gb:AY099878_1576903 Arabidopsis thaliana unknown protein (At2g02...    35   2.2     
gb:AY059770_1564622 Arabidopsis thaliana unknown protein (At2g02...    35   2.2     
gb:DMTICC1_1380253 D.melanogaster TIScc1 mRNA.                         35   2.2     
gb:AE014298_1125408 Drosophila melanogaster chromosome X, comple...    35   2.2     
gb:AE014298_1125407 Drosophila melanogaster chromosome X, comple...    35   2.2     
gb:AE005172_890036 Arabidopsis thaliana chromosome 1, top arm co...    35   2.2     
pir|F84433|F84433 hypothetical protein At2g02160 [imported] - Ar...    35   2.2     Arabidopsis thaliana [mouse-ear cress]
sp|P53781|TTP_BOVIN|TTP_BOVIN Tristetraproline (TTP) (TIS11A protein) (TIS...    35   2.2     Bos taurus [bovine]
sp|P47980|TIS1_DROME|TIS1_DROME TIS11 protein (dTIS11).>gb:DMU13397_1380428...    35   2.2     Drosophila melanogaster
gb:AE014134_1127518 Drosophila melanogaster chromosome 2L, compl...    31   2.8     
gb:BC080440_2561729 Xenopus tropicalis cpsf4-prov protein, mRNA ...    35   2.9     
gb:BC075128_2558241 Xenopus laevis MGC81862 protein, mRNA (cDNA ...    35   2.9     
gb:BC074368_2557877 Xenopus laevis MGC84269 protein, mRNA (cDNA ...    35   2.9     
gb:BC063991_2553691 Danio rerio zgc:77882, mRNA (cDNA clone MGC:...    35   2.9     
gb:BC089824_2111022 Rattus norvegicus similar to CPSF4 protein, ...    35   2.9     
gb:BC057067_2102568 Mus musculus cleavage and polyadenylation sp...    35   2.9     
gb:AF033201_2051666 Mus musculus clipper/cleavage and polyadenyl...    35   2.9     
gb:HUMU2AF1RA_2037962 Homo sapiens U2AF1-RS1 mRNA, complete cds.       35   2.9     
gb:BC050738_1984515 Homo sapiens cleavage and polyadenylation sp...    35   2.9     
gb:BC050451_1984353 Homo sapiens U2(RNU2) small nuclear RNA auxi...    35   2.9     
gb:BC034435_1981282 Homo sapiens zinc finger CCCH type domain co...    35   2.9     
gb:BC021186_1977403 Homo sapiens U2(RNU2) small nuclear RNA auxi...    35   2.9     
gb:BC003101_1968687 Homo sapiens cleavage and polyadenylation sp...    35   2.9     
gb:BTU96448_1437868 Bos taurus cleavage and polyadenylation spec...    35   2.9     
gb:AY462109_1430396 Ovis aries tristetraprolin mRNA, complete cds.     35   2.9     
pir|T26177|T26177 hypothetical protein W05B10.2 - Caenorhabditis...    35   2.9     Caenorhabditis elegans [roundworm]
pir|T26081|T26081 hypothetical protein W02A2.7 - Caenorhabditis ...    35   2.9     Caenorhabditis elegans [roundworm]
sp|Q62377|U2R2_MOUSE|U2R2_MOUSE U2 small nuclear ribonucleoprotein auxiliar...    35   2.9     Mus musculus [mouse]
sp|Q15696|U2R2_HUMAN|U2R2_HUMAN U2 small nuclear ribonucleoprotein auxiliar...    35   2.9     Homo sapiens [man]
sp|Q15695|U2R1_HUMAN|U2R1_HUMAN U2 small nuclear ribonucleoprotein auxiliar...    35   2.9     Homo sapiens [man]
sp|Q06053|DUS3_YEAST|DUS3_YEAST tRNA-dihydrouridine synthase 3 (EC 1.-.-.-)...    35   2.9     Saccharomyces cerevisiae [brewer's yeast]
sp|O95639|CPSD_HUMAN|CPSD_HUMAN Cleavage and polyadenylation specificity fa...    35   2.9     Homo sapiens [man]
gb:AY122140_1301502 Drosophila melanogaster GM14666 full insert ...    31   2.9     
gb:AE014134_1127519 Drosophila melanogaster chromosome 2L, compl...    31   2.9     
gb:GGA291762_2572760 Gallus gallus U2AF1 gene for U2snRNP auxili...    34   3.8     
gb:BC058066_2552254 Danio rerio zgc:63779, mRNA (cDNA clone MGC:...    34   3.8     
gb:BC019000_1976692 Homo sapiens KIAA0853, mRNA (cDNA clone IMAG...    34   3.8     
gb:AY283618_1941905 Homo sapiens hypothetical protein mRNA, comp...    34   3.8     
gb:AL157758_1921003 Human DNA sequence from clone RP11-106H11 on...    34   3.8     
gb:AL157758_1921002 Human DNA sequence from clone RP11-106H11 on...    34   3.8     
gb:AE017343_1755901 Cryptococcus neoformans var. neoformans JEC2...    34   3.8     
gb:OSJN00069_1694275 Oryza sativa genomic DNA, chromosome 4, BAC...    34   3.8     
gb:CR382132_1665203 Yarrowia lipolytica chromosome F of strain C...    34   3.8     
gb:CR382122_1655230 Kluyveromyces lactis strain NRRL Y-1140 chro...    34   3.8     
gb:CR858742_1182896 Pongo pygmaeus mRNA; cDNA DKFZp469G0339 (fro...    34   3.8     
gb:AK008332_1154520 Mus musculus adult male small intestine cDNA...    34   3.8     
pir|S57977|S57977 CCCH zinc finger protein CTH1 - yeast (Sacchar...    34   3.8     Saccharomyces cerevisiae [brewer's yeast]
pir|JC6125|JC6125 U2 small nuclear ribonucleoprotein auxiliary f...    34   3.8     Drosophila melanogaster
sp|Q9D883|U2AG_MOUSE|U2AG_MOUSE Splicing factor U2AF 35 kDa subunit (U2 aux...    34   3.8     Mus musculus [mouse]
sp|Q01081|U2AG_HUMAN|U2AG_HUMAN Splicing factor U2AF 35 kDa subunit (U2 aux...    34   3.8     Homo sapiens [man]
sp|Q94535|U2AG_DROME|U2AG_DROME Splicing factor U2af 38 kDa subunit (U2 aux...    34   3.8     Drosophila melanogaster
sp|P47976|CTH1_YEAST|CTH1_YEAST Zinc finger protein CTH1.>gb:YSCCTH1_172864...    34   3.8     Saccharomyces cerevisiae [brewer's yeast]
gb:GGA291765_2572763 Gallus gallus mRNA for U2snRNP auxiliary fa...    34   4.9     
gb:BC084660_2563960 Xenopus laevis hypothetical LOC495238, mRNA ...    34   4.9     
gb:AF506202_2498536 Danio rerio U2 small nuclear RNA auxiliary f...    34   4.9     
gb:AF090120_2472563 Fugu rubripes beta-amyloid precursor protein...    34   4.9     
gb:BC002184_2088941 Mus musculus U2 small nuclear ribonucleoprot...    34   4.9     
gb:AJ627978_1907108 Homo sapiens mRNA for U2 snRNP auxiliary fac...    34   4.9     
gb:AE017349_1758637 Cryptococcus neoformans var. neoformans JEC2...    34   4.9     
gb:AY088484_1573503 Arabidopsis thaliana clone 7104 mRNA, comple...    34   4.9     
gb:AY080846_1568538 Arabidopsis thaliana unknown protein (At3g51...    34   4.9     
gb:AX885379_1480832 Sequence 1242 from Patent EP1033401.               34   4.9     
gb:HSM803975_1187071 Homo sapiens mRNA; cDNA DKFZp313J1712 (from...    34   4.9     
gb:AY325238_1177907 Rattus norvegicus Cb2-807 mRNA, complete cds...    34   4.9     
pir|T49074|T49074 hypothetical protein F4F15.60 - Arabidopsis th...    34   4.9     Arabidopsis thaliana [mouse-ear cress]
sp|Q29350|U2AG_PIG|U2AG_PIG Splicing factor U2AF 35 kDa subunit (U2 auxil...    34   4.9     Sus scrofa [pigs]
sp|P47973|TTP_RAT|TTP_RAT Tristetraproline (TTP) (TIS11A protein) (TIS11...    34   4.9     Rattus norvegicus [brown rat]
sp|P41000|SCP3_SCHPO|SCP3_SCHPO Protein scp3.>pir|T11624|T11624 spindle poi...    34   4.9     Schizosaccharomyces pombe
gb:S69507_2139024 U2afbp-rs=U2 small nuclear ribonucleoprotein a...    33   6.5     
gb:BC086322_2109517 Rattus norvegicus cDNA clone MGC:105652 IMAG...    33   6.5     
gb:AP003507_1830059 Oryza sativa (japonica cultivar-group) genom...    33   6.5     
gb:OSJN00091_1694741 Oryza sativa genomic DNA, chromosome 4, BAC...    33   6.5     
gb:CR380959_1653970 Candida glabrata strain CBS138 chromosome M ...    33   6.5     
gb:AB024035_1515823 Arabidopsis thaliana genomic DNA, chromosome...    33   6.5     
gb:AK030552_1162060 Mus musculus adult male pituitary gland cDNA...    33   6.5     
sp|Q64707|U2R1_MOUSE|U2R1_MOUSE U2 small nuclear ribonucleoprotein auxiliar...    33   6.5     Mus musculus [mouse]
gb:BC084352_2563733 Xenopus laevis hypothetical LOC495149, mRNA ...    33   8.4     
gb:BC074559_2558054 Xenopus tropicalis makorin, ring finger prot...    33   8.4     
gb:AB182270_2466960 Takifugu rubripes MKRN2 mRNA for makorin RIN...    33   8.4     
gb:BC003883_2089426 Mus musculus mRNA similar to RIKEN cDNA 2010...    33   8.4     


>gb:BC019429_2092911 Mus musculus cDNA clone MGC:30371
           IMAGE:5149920, complete cds.
          Length = 526

 Score =  249 bits (635), Expect = 7e-65
 Identities = 114/201 (56%), Positives = 138/201 (68%), Gaps = 18/201 (8%)
 Frame = -3

Query: 961 HNSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDR------------------YTINP 836
           +NSKGLP+R+GEVDCPFYLKTGSCKYGA CRYNHPDR                  + + P
Sbjct: 317 YNSKGLPVRMGEVDCPFYLKTGSCKYGANCRYNHPDRNELSSPFSVINPSSAVVGHAVLP 376

Query: 835 PAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERC 656
             A ++ G++NP AS+FQ+  P L QT FG    IYPQRPGQ+ECD+YMK GECKFGERC
Sbjct: 377 ALASVSAGLINPAASIFQSLQPGLPQTTFGQVPVIYPQRPGQIECDYYMKRGECKFGERC 436

Query: 655 RFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPP 476
           +FHHP+D S    +  +  +QN K +LAGLPRREG  HCP+YMKTG C +   CKFDHPP
Sbjct: 437 KFHHPIDRSAPARN--QTLEQNVKFTLAGLPRREGVQHCPFYMKTGTCSYAVNCKFDHPP 494

Query: 475 PGELIGGTSQVTSTSVGEEEG 413
           PGE++    + T T   EEEG
Sbjct: 495 PGEVMAAAGKETLTK-AEEEG 514



 Score =  114 bits (286), Expect = 2e-24
 Identities = 66/199 (33%), Positives = 89/199 (44%), Gaps = 28/199 (14%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRL 764
           P R GE DCP++LKT  CK+G  C++NHP    I          +   T++     D   
Sbjct: 197 PERPGEPDCPYFLKTQKCKFGLKCKFNHPKDKLI----------LAQDTSAETDASD--- 243

Query: 763 TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLD----------------- 635
                       P+RP +  C FY KTG+CKFG  C+FHHP D                 
Sbjct: 244 -----------LPERPTEPLCSFYTKTGKCKFGAACKFHHPKDIQVPSDGQEADDEEQTH 292

Query: 634 -----------HSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKF 488
                      +SL   +S      N K    GLP R G + CP+Y+KTG CK+GA C++
Sbjct: 293 SIDHLGTTSDGNSLKALTSNPASSYNSK----GLPVRMGEVDCPFYLKTGSCKYGANCRY 348

Query: 487 DHPPPGELIGGTSQVTSTS 431
           +HP   EL    S +  +S
Sbjct: 349 NHPDRNELSSPFSVINPSS 367



 Score =  102 bits (255), Expect = 9e-21
 Identities = 52/155 (33%), Positives = 78/155 (50%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRL 764
           P R GE DC  Y+ T +CK+G  C+++HP               +  P   +    +P  
Sbjct: 146 PQRPGEKDCTHYMLTRTCKFGDNCKFDHP---------------IWVPAGGIPDWKEPPA 190

Query: 763 TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK 584
             +       IYP+RPG+ +C +++KT +CKFG +C+F+HP D  +        +  + +
Sbjct: 191 VPS------EIYPERPGEPDCPYFLKTQKCKFGLKCKFNHPKDKLIL------AQDTSAE 238

Query: 583 LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP 479
              + LP R     C +Y KTG CKFGA CKF HP
Sbjct: 239 TDASDLPERPTEPLCSFYTKTGKCKFGAACKFHHP 273



 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 67/204 (32%), Positives = 88/204 (43%), Gaps = 44/204 (21%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTAS---L 788
           ++  LP R  E  C FY KTG CK+GA C+++HP    I  P+          T S   L
Sbjct: 240 DASDLPERPTEPLCSFYTKTGKCKFGAACKFHHPK--DIQVPSDGQEADDEEQTHSIDHL 297

Query: 787 FQTFDPRLTQTMFGFATTIY-----PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLS 623
             T D    + +     + Y     P R G+V+C FY+KTG CK+G  CR++HP  + LS
Sbjct: 298 GTTSDGNSLKALTSNPASSYNSKGLPVRMGEVDCPFYLKTGSCKYGANCRYNHPDRNELS 357

Query: 622 -------VTSSMEGE-----------------------------QQNFKLSLAGLPRREG 551
                   +S++ G                              Q  F       P+R G
Sbjct: 358 SPFSVINPSSAVVGHAVLPALASVSAGLINPAASIFQSLQPGLPQTTFGQVPVIYPQRPG 417

Query: 550 AIHCPYYMKTGICKFGATCKFDHP 479
            I C YYMK G CKFG  CKF HP
Sbjct: 418 QIECDYYMKRGECKFGERCKFHHP 441



 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 35/85 (41%), Positives = 48/85 (56%)
 Frame = -3

Query: 733 IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE 554
           +YPQRPG+ +C  YM T  CKFG+ C+F HP+         +   ++   +     P R 
Sbjct: 144 VYPQRPGEKDCTHYMLTRTCKFGDNCKFDHPI---WVPAGGIPDWKEPPAVPSEIYPERP 200

Query: 553 GAIHCPYYMKTGICKFGATCKFDHP 479
           G   CPY++KT  CKFG  CKF+HP
Sbjct: 201 GEPDCPYFLKTQKCKFGLKCKFNHP 225



>gb:AY024357_1559010 Arabidopsis thaliana floral homeotic protein
           HUA1 (HUA1) mRNA, complete cds.
          Length = 524

 Score =  249 bits (635), Expect = 7e-65
 Identities = 117/183 (63%), Positives = 134/183 (73%), Gaps = 12/183 (6%)
 Frame = -3

Query: 961 HNSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAA------------HLN 818
           HNSKGLP+R GEVDCPFYLKTGSCKYGATCRYNHP+R    P AA            +LN
Sbjct: 332 HNSKGLPVRSGEVDCPFYLKTGSCKYGATCRYNHPERTAFIPQAAGVNYSLVSSNTANLN 391

Query: 817 VGVVNPTASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPL 638
           +G+V P  S +QT    LTQ   G  +  YPQRPGQ ECD+YMKTGECKFGERC+FHHP 
Sbjct: 392 LGLVTPATSFYQT----LTQPTLGVISATYPQRPGQSECDYYMKTGECKFGERCKFHHPA 447

Query: 637 DHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG 458
           D  LS  +    +Q N KLSLAG PRREGA++CPYYMKTG CK+GATCKFDHPPPGE++ 
Sbjct: 448 DR-LSAMTKQAPQQPNVKLSLAGYPRREGALNCPYYMKTGTCKYGATCKFDHPPPGEVMA 506

Query: 457 GTS 449
            T+
Sbjct: 507 KTT 509



 Score =  119 bits (298), Expect = 9e-26
 Identities = 67/173 (38%), Positives = 87/173 (50%), Gaps = 18/173 (10%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRL 764
           P R GE DCP+Y+KT  CKYG+ C++NHP                    A   +T D   
Sbjct: 223 PERPGEPDCPYYIKTQRCKYGSKCKFNHPRE----------------EAAVSVETQDS-- 264

Query: 763 TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL---------SVTSS 611
                       P+RP +  C FYMKTG+CKFG  C+FHHP D  L         SV  +
Sbjct: 265 -----------LPERPSEPMCTFYMKTGKCKFGLSCKFHHPKDIQLPSSSQDIGSSVGLT 313

Query: 610 MEGEQQN-----FKLSL----AGLPRREGAIHCPYYMKTGICKFGATCKFDHP 479
            E +  N     F  +L     GLP R G + CP+Y+KTG CK+GATC+++HP
Sbjct: 314 SEPDATNNPHVTFTPALYHNSKGLPVRSGEVDCPFYLKTGSCKYGATCRYNHP 366



 Score =  112 bits (279), Expect = 1e-23
 Identities = 68/189 (35%), Positives = 92/189 (48%), Gaps = 33/189 (17%)
 Frame = -3

Query: 946 LPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVG-VVNPTASLFQTFDP 770
           LP R  E  C FY+KTG CK+G +C+++HP    I  P++  ++G  V  T+    T +P
Sbjct: 265 LPERPSEPMCTFYMKTGKCKFGLSCKFHHPK--DIQLPSSSQDIGSSVGLTSEPDATNNP 322

Query: 769 RLTQTMFGFATTIY------PQRPGQVECDFYMKTGECKFGERCRFHHP-----LDHSLS 623
            +T     F   +Y      P R G+V+C FY+KTG CK+G  CR++HP     +  +  
Sbjct: 323 HVT-----FTPALYHNSKGLPVRSGEVDCPFYLKTGSCKYGATCRYNHPERTAFIPQAAG 377

Query: 622 VTSSM-EGEQQNFKLSL--------------------AGLPRREGAIHCPYYMKTGICKF 506
           V  S+      N  L L                    A  P+R G   C YYMKTG CKF
Sbjct: 378 VNYSLVSSNTANLNLGLVTPATSFYQTLTQPTLGVISATYPQRPGQSECDYYMKTGECKF 437

Query: 505 GATCKFDHP 479
           G  CKF HP
Sbjct: 438 GERCKFHHP 446



 Score =  105 bits (261), Expect = 2e-21
 Identities = 61/183 (33%), Positives = 90/183 (49%), Gaps = 3/183 (1%)
 Frame = -3

Query: 964 LHNSKGLPI---RLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTA 794
           L ++  LPI   R GE DC  Y++T +CK+G +CR++HP    I  P   +      P  
Sbjct: 162 LESTSHLPIYPQRAGEKDCTHYMQTRTCKFGESCRFDHP----IWVPEGGIPDWKEAPVV 217

Query: 793 SLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTS 614
              +                 YP+RPG+ +C +Y+KT  CK+G +C+F+HP + +     
Sbjct: 218 PNEE-----------------YPERPGEPDCPYYIKTQRCKYGSKCKFNHPREEAAVSVE 260

Query: 613 SMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTST 434
           + +            LP R     C +YMKTG CKFG +CKF HP   +L   +SQ   +
Sbjct: 261 TQD-----------SLPERPSEPMCTFYMKTGKCKFGLSCKFHHPKDIQL-PSSSQDIGS 308

Query: 433 SVG 425
           SVG
Sbjct: 309 SVG 311



>gb:AC069474_1540905 Arabidopsis thaliana chromosome 3 BAC T2E22
           genomic sequence, complete sequence.
          Length = 328

 Score =  249 bits (635), Expect = 7e-65
 Identities = 117/183 (63%), Positives = 134/183 (73%), Gaps = 12/183 (6%)
 Frame = -3

Query: 961 HNSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAA------------HLN 818
           HNSKGLP+R GEVDCPFYLKTGSCKYGATCRYNHP+R    P AA            +LN
Sbjct: 136 HNSKGLPVRSGEVDCPFYLKTGSCKYGATCRYNHPERTAFIPQAAGVNYSLVSSNTANLN 195

Query: 817 VGVVNPTASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPL 638
           +G+V P  S +QT    LTQ   G  +  YPQRPGQ ECD+YMKTGECKFGERC+FHHP 
Sbjct: 196 LGLVTPATSFYQT----LTQPTLGVISATYPQRPGQSECDYYMKTGECKFGERCKFHHPA 251

Query: 637 DHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG 458
           D  LS  +    +Q N KLSLAG PRREGA++CPYYMKTG CK+GATCKFDHPPPGE++ 
Sbjct: 252 DR-LSAMTKQAPQQPNVKLSLAGYPRREGALNCPYYMKTGTCKYGATCKFDHPPPGEVMA 310

Query: 457 GTS 449
            T+
Sbjct: 311 KTT 313



 Score =  119 bits (298), Expect = 9e-26
 Identities = 67/173 (38%), Positives = 87/173 (50%), Gaps = 18/173 (10%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRL 764
           P R GE DCP+Y+KT  CKYG+ C++NHP                    A   +T D   
Sbjct: 27  PERPGEPDCPYYIKTQRCKYGSKCKFNHPRE----------------EAAVSVETQDS-- 68

Query: 763 TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL---------SVTSS 611
                       P+RP +  C FYMKTG+CKFG  C+FHHP D  L         SV  +
Sbjct: 69  -----------LPERPSEPMCTFYMKTGKCKFGLSCKFHHPKDIQLPSSSQDIGSSVGLT 117

Query: 610 MEGEQQN-----FKLSL----AGLPRREGAIHCPYYMKTGICKFGATCKFDHP 479
            E +  N     F  +L     GLP R G + CP+Y+KTG CK+GATC+++HP
Sbjct: 118 SEPDATNNPHVTFTPALYHNSKGLPVRSGEVDCPFYLKTGSCKYGATCRYNHP 170



 Score =  112 bits (279), Expect = 1e-23
 Identities = 68/189 (35%), Positives = 92/189 (48%), Gaps = 33/189 (17%)
 Frame = -3

Query: 946 LPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVG-VVNPTASLFQTFDP 770
           LP R  E  C FY+KTG CK+G +C+++HP    I  P++  ++G  V  T+    T +P
Sbjct: 69  LPERPSEPMCTFYMKTGKCKFGLSCKFHHPK--DIQLPSSSQDIGSSVGLTSEPDATNNP 126

Query: 769 RLTQTMFGFATTIY------PQRPGQVECDFYMKTGECKFGERCRFHHP-----LDHSLS 623
            +T     F   +Y      P R G+V+C FY+KTG CK+G  CR++HP     +  +  
Sbjct: 127 HVT-----FTPALYHNSKGLPVRSGEVDCPFYLKTGSCKYGATCRYNHPERTAFIPQAAG 181

Query: 622 VTSSM-EGEQQNFKLSL--------------------AGLPRREGAIHCPYYMKTGICKF 506
           V  S+      N  L L                    A  P+R G   C YYMKTG CKF
Sbjct: 182 VNYSLVSSNTANLNLGLVTPATSFYQTLTQPTLGVISATYPQRPGQSECDYYMKTGECKF 241

Query: 505 GATCKFDHP 479
           G  CKF HP
Sbjct: 242 GERCKFHHP 250



 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 40/102 (39%), Positives = 58/102 (56%)
 Frame = -3

Query: 730 YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG 551
           YP+RPG+ +C +Y+KT  CK+G +C+F+HP + +     + +            LP R  
Sbjct: 26  YPERPGEPDCPYYIKTQRCKYGSKCKFNHPREEAAVSVETQD-----------SLPERPS 74

Query: 550 AIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVG 425
              C +YMKTG CKFG +CKF HP   +L   +SQ   +SVG
Sbjct: 75  EPMCTFYMKTGKCKFGLSCKFHHPKDIQL-PSSSQDIGSSVG 115



>gb:AB024033_1515781 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MBK21.
          Length = 326

 Score =  207 bits (528), Expect = 2e-52
 Identities = 106/186 (56%), Positives = 122/186 (65%), Gaps = 15/186 (8%)
 Frame = -3

Query: 961 HNSKGLPIRL---GEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAA------------ 827
           HNSKGLP+R    GEVDCPFYLKTGSCKYGATCRYNHP+R    P AA            
Sbjct: 149 HNSKGLPVRSLFQGEVDCPFYLKTGSCKYGATCRYNHPERTAFIPQAAGVNYSLVSSNTA 208

Query: 826 HLNVGVVNPTASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFH 647
           +LN+G+V P  S +QT    LTQ  +                  YMKTGECKFGERC+FH
Sbjct: 209 NLNLGLVTPATSFYQT----LTQPTY------------------YMKTGECKFGERCKFH 246

Query: 646 HPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGE 467
           HP D  LS  +    +Q N KLSLAG PRREGA++CPYYMKTG CK+GATCKFDHPPPGE
Sbjct: 247 HPADR-LSAMTKQAPQQPNVKLSLAGYPRREGALNCPYYMKTGTCKYGATCKFDHPPPGE 305

Query: 466 LIGGTS 449
           ++  T+
Sbjct: 306 VMAKTT 311



 Score =  114 bits (286), Expect = 2e-24
 Identities = 67/176 (38%), Positives = 88/176 (50%), Gaps = 21/176 (11%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRL 764
           P R GE DCP+Y+KT  CKYG+ C++NHP                    A   +T D   
Sbjct: 40  PERPGEPDCPYYIKTQRCKYGSKCKFNHPRE----------------EAAVSVETQDS-- 81

Query: 763 TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL---------SVTSS 611
                       P+RP +  C FYMKTG+CKFG  C+FHHP D  L         SV  +
Sbjct: 82  -----------LPERPSEPMCTFYMKTGKCKFGLSCKFHHPKDIQLPSSSQDIGSSVGLT 130

Query: 610 MEGEQQN-----FKLSL----AGLPRR---EGAIHCPYYMKTGICKFGATCKFDHP 479
            E +  N     F  +L     GLP R   +G + CP+Y+KTG CK+GATC+++HP
Sbjct: 131 SEPDATNNPHVTFTPALYHNSKGLPVRSLFQGEVDCPFYLKTGSCKYGATCRYNHP 186



 Score = 99.8 bits (247), Expect = 7e-20
 Identities = 60/171 (35%), Positives = 82/171 (47%), Gaps = 15/171 (8%)
 Frame = -3

Query: 946 LPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVG-------VVNPTASL 788
           LP R  E  C FY+KTG CK+G +C+++HP    I  P++  ++G         + T + 
Sbjct: 82  LPERPSEPMCTFYMKTGKCKFGLSCKFHHPK--DIQLPSSSQDIGSSVGLTSEPDATNNP 139

Query: 787 FQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHP-----LDHSLS 623
             TF P L     G       Q  G+V+C FY+KTG CK+G  CR++HP     +  +  
Sbjct: 140 HVTFTPALYHNSKGLPVRSLFQ--GEVDCPFYLKTGSCKYGATCRYNHPERTAFIPQAAG 197

Query: 622 VTSSMEGEQQ---NFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP 479
           V  S+        N  L        +      YYMKTG CKFG  CKF HP
Sbjct: 198 VNYSLVSSNTANLNLGLVTPATSFYQTLTQPTYYMKTGECKFGERCKFHHP 248



 Score = 90.5 bits (223), Expect = 4e-17
 Identities = 51/161 (31%), Positives = 78/161 (48%)
 Frame = -3

Query: 907 LKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIY 728
           ++T +CK+G +CR++HP    I  P   +      P     +                 Y
Sbjct: 1   MQTRTCKFGESCRFDHP----IWVPEGGIPDWKEAPVVPNEE-----------------Y 39

Query: 727 PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA 548
           P+RPG+ +C +Y+KT  CK+G +C+F+HP + +     + +            LP R   
Sbjct: 40  PERPGEPDCPYYIKTQRCKYGSKCKFNHPREEAAVSVETQD-----------SLPERPSE 88

Query: 547 IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVG 425
             C +YMKTG CKFG +CKF HP   +L   +SQ   +SVG
Sbjct: 89  PMCTFYMKTGKCKFGLSCKFHHPKDIQL-PSSSQDIGSSVG 128



>gb:AP002897_1823662 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0686E09.
          Length = 462

 Score =  201 bits (512), Expect = 1e-50
 Identities = 96/181 (53%), Positives = 121/181 (66%), Gaps = 11/181 (6%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVG----------V 809
           NSKGLP+R GEVDCPFY+K GSCK+G+TCR+NHPDR  +N P   L +G          +
Sbjct: 281 NSKGLPMRPGEVDCPFYMKMGSCKFGSTCRFNHPDRLVLNFP---LPLGQTILPTPESML 337

Query: 808 VNPTASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHS 629
           +N +A+  Q FD        G     YPQRPG   CDFYMKTG CKF +RC+FHHP+D S
Sbjct: 338 LNSSANFMQGFDFHAAHMPVGPGPVTYPQRPGATVCDFYMKTGFCKFADRCKFHHPIDRS 397

Query: 628 L-SVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGT 452
               +++ E  +++ +L+LAGLPRRE A+ C +YMKTG+CKFG  CKFDHPPP E I   
Sbjct: 398 APDPSANWEPAEESVQLTLAGLPRREDAVVCAFYMKTGVCKFGMQCKFDHPPPQEAIAKV 457

Query: 451 S 449
           S
Sbjct: 458 S 458



 Score =  115 bits (288), Expect = 1e-24
 Identities = 65/180 (36%), Positives = 88/180 (48%), Gaps = 25/180 (13%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRL 764
           P + GE DCPF++KTG CK+G+ C++NHP                VN  AS   T D  L
Sbjct: 154 PEQEGEPDCPFFMKTGKCKFGSKCKFNHPKE-------------KVNALAS-GNTNDKHL 199

Query: 763 TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL-------------- 626
                   ++I P RP +  C FY KTG+CKF   C+F+HP D  +              
Sbjct: 200 IAD-----SSILPVRPSEPLCSFYAKTGKCKFRAMCKFNHPKDIEIPSSQNEPESAVTVE 254

Query: 625 ------SVTSSMEGEQQN-----FKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP 479
                 S   S+  + Q       + +  GLP R G + CP+YMK G CKFG+TC+F+HP
Sbjct: 255 GETDIGSAADSVSAKMQTPVAAAQEFNSKGLPMRPGEVDCPFYMKMGSCKFGSTCRFNHP 314



 Score =  112 bits (279), Expect = 1e-23
 Identities = 68/192 (35%), Positives = 89/192 (46%), Gaps = 32/192 (16%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTI----NPPAAHLNVGVVNPTAS 791
           +S  LP+R  E  C FY KTG CK+ A C++NHP    I    N P + + V       S
Sbjct: 202 DSSILPVRPSEPLCSFYAKTGKCKFRAMCKFNHPKDIEIPSSQNEPESAVTVEGETDIGS 261

Query: 790 LFQTFDPRLTQTMFG---FATTIYPQRPGQVECDFYMKTGECKFGERCRFHH-------- 644
              +   ++   +     F +   P RPG+V+C FYMK G CKFG  CRF+H        
Sbjct: 262 AADSVSAKMQTPVAAAQEFNSKGLPMRPGEVDCPFYMKMGSCKFGSTCRFNHPDRLVLNF 321

Query: 643 --PLDHSLSVT------SSMEGEQQNFKLSLAGL---------PRREGAIHCPYYMKTGI 515
             PL  ++  T      +S     Q F    A +         P+R GA  C +YMKTG 
Sbjct: 322 PLPLGQTILPTPESMLLNSSANFMQGFDFHAAHMPVGPGPVTYPQRPGATVCDFYMKTGF 381

Query: 514 CKFGATCKFDHP 479
           CKF   CKF HP
Sbjct: 382 CKFADRCKFHHP 393



 Score =  102 bits (255), Expect = 9e-21
 Identities = 56/176 (31%), Positives = 87/176 (49%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRL 764
           P R GE DC FY+ T +CK+G +C+++HP ++       +      N   S         
Sbjct: 103 PQRPGEKDCAFYMMTRTCKFGGSCKFDHP-QWVPEGGIPNWKEQAANVEES--------- 152

Query: 763 TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK 584
                      YP++ G+ +C F+MKTG+CKFG +C+F+HP +  ++  +S     ++  
Sbjct: 153 -----------YPEQEGEPDCPFFMKTGKCKFGSKCKFNHPKE-KVNALASGNTNDKHLI 200

Query: 583 LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEE 416
              + LP R     C +Y KTG CKF A CKF+HP   E+    ++  S    E E
Sbjct: 201 ADSSILPVRPSEPLCSFYAKTGKCKFRAMCKFNHPKDIEIPSSQNEPESAVTVEGE 256



 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 46/102 (45%), Positives = 58/102 (56%), Gaps = 4/102 (3%)
 Frame = -3

Query: 772 PRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ 593
           PRL  ++      IYPQRPG+ +C FYM T  CKFG  C+F HP           EG   
Sbjct: 93  PRLESSL-----PIYPQRPGEKDCAFYMMTRTCKFGGSCKFDHP-------QWVPEGGIP 140

Query: 592 NFKLSLAGL----PRREGAIHCPYYMKTGICKFGATCKFDHP 479
           N+K   A +    P +EG   CP++MKTG CKFG+ CKF+HP
Sbjct: 141 NWKEQAANVEESYPEQEGEPDCPFFMKTGKCKFGSKCKFNHP 182



 Score = 50.1 bits (118), Expect = 7e-05
 Identities = 31/93 (33%), Positives = 43/93 (46%), Gaps = 13/93 (13%)
 Frame = -3

Query: 652 FHHPLDHSLSVTSSMEG--------EQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGAT 497
           +H P+  S S    +E         ++   + SL   P+R G   C +YM T  CKFG +
Sbjct: 66  YHQPIMGSHSTVEQIEALYSSNTMTKRPRLESSLPIYPQRPGEKDCAFYMMTRTCKFGGS 125

Query: 496 CKFDHP---PPGELIGGTSQVTST--SVGEEEG 413
           CKFDHP   P G +     Q  +   S  E+EG
Sbjct: 126 CKFDHPQWVPEGGIPNWKEQAANVEESYPEQEG 158



>gb:AP002897_1823661 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0686E09.
          Length = 461

 Score =  201 bits (512), Expect = 1e-50
 Identities = 96/181 (53%), Positives = 121/181 (66%), Gaps = 11/181 (6%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVG----------V 809
           NSKGLP+R GEVDCPFY+K GSCK+G+TCR+NHPDR  +N P   L +G          +
Sbjct: 280 NSKGLPMRPGEVDCPFYMKMGSCKFGSTCRFNHPDRLVLNFP---LPLGQTILPTPESML 336

Query: 808 VNPTASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHS 629
           +N +A+  Q FD        G     YPQRPG   CDFYMKTG CKF +RC+FHHP+D S
Sbjct: 337 LNSSANFMQGFDFHAAHMPVGPGPVTYPQRPGATVCDFYMKTGFCKFADRCKFHHPIDRS 396

Query: 628 L-SVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGT 452
               +++ E  +++ +L+LAGLPRRE A+ C +YMKTG+CKFG  CKFDHPPP E I   
Sbjct: 397 APDPSANWEPAEESVQLTLAGLPRREDAVVCAFYMKTGVCKFGMQCKFDHPPPQEAIAKV 456

Query: 451 S 449
           S
Sbjct: 457 S 457



 Score =  115 bits (288), Expect = 1e-24
 Identities = 65/180 (36%), Positives = 88/180 (48%), Gaps = 25/180 (13%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRL 764
           P + GE DCPF++KTG CK+G+ C++NHP                VN  AS   T D  L
Sbjct: 153 PEQEGEPDCPFFMKTGKCKFGSKCKFNHPKE-------------KVNALAS-GNTNDKHL 198

Query: 763 TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL-------------- 626
                   ++I P RP +  C FY KTG+CKF   C+F+HP D  +              
Sbjct: 199 IAD-----SSILPVRPSEPLCSFYAKTGKCKFRAMCKFNHPKDIEIPSSQNEPESAVTVE 253

Query: 625 ------SVTSSMEGEQQN-----FKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP 479
                 S   S+  + Q       + +  GLP R G + CP+YMK G CKFG+TC+F+HP
Sbjct: 254 GETDIGSAADSVSAKMQTPVAAAQEFNSKGLPMRPGEVDCPFYMKMGSCKFGSTCRFNHP 313



 Score =  112 bits (279), Expect = 1e-23
 Identities = 68/192 (35%), Positives = 89/192 (46%), Gaps = 32/192 (16%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTI----NPPAAHLNVGVVNPTAS 791
           +S  LP+R  E  C FY KTG CK+ A C++NHP    I    N P + + V       S
Sbjct: 201 DSSILPVRPSEPLCSFYAKTGKCKFRAMCKFNHPKDIEIPSSQNEPESAVTVEGETDIGS 260

Query: 790 LFQTFDPRLTQTMFG---FATTIYPQRPGQVECDFYMKTGECKFGERCRFHH-------- 644
              +   ++   +     F +   P RPG+V+C FYMK G CKFG  CRF+H        
Sbjct: 261 AADSVSAKMQTPVAAAQEFNSKGLPMRPGEVDCPFYMKMGSCKFGSTCRFNHPDRLVLNF 320

Query: 643 --PLDHSLSVT------SSMEGEQQNFKLSLAGL---------PRREGAIHCPYYMKTGI 515
             PL  ++  T      +S     Q F    A +         P+R GA  C +YMKTG 
Sbjct: 321 PLPLGQTILPTPESMLLNSSANFMQGFDFHAAHMPVGPGPVTYPQRPGATVCDFYMKTGF 380

Query: 514 CKFGATCKFDHP 479
           CKF   CKF HP
Sbjct: 381 CKFADRCKFHHP 392



 Score =  102 bits (254), Expect = 1e-20
 Identities = 57/178 (32%), Positives = 90/178 (50%), Gaps = 2/178 (1%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVN--PTASLFQTFDP 770
           P R GE DC FY+ T +CK+G +C+++HP              G+ N    A++ ++   
Sbjct: 103 PQRPGEKDCAFYMMTRTCKFGGSCKFDHPQWVPEG--------GIPNWKEAANVEES--- 151

Query: 769 RLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQN 590
                        YP++ G+ +C F+MKTG+CKFG +C+F+HP +  ++  +S     ++
Sbjct: 152 -------------YPEQEGEPDCPFFMKTGKCKFGSKCKFNHPKE-KVNALASGNTNDKH 197

Query: 589 FKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEE 416
                + LP R     C +Y KTG CKF A CKF+HP   E+    ++  S    E E
Sbjct: 198 LIADSSILPVRPSEPLCSFYAKTGKCKFRAMCKFNHPKDIEIPSSQNEPESAVTVEGE 255



 Score = 86.3 bits (212), Expect = 8e-16
 Identities = 45/101 (44%), Positives = 57/101 (56%), Gaps = 3/101 (2%)
 Frame = -3

Query: 772 PRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ 593
           PRL  ++      IYPQRPG+ +C FYM T  CKFG  C+F HP           EG   
Sbjct: 93  PRLESSL-----PIYPQRPGEKDCAFYMMTRTCKFGGSCKFDHP-------QWVPEGGIP 140

Query: 592 NFKLSL---AGLPRREGAIHCPYYMKTGICKFGATCKFDHP 479
           N+K +       P +EG   CP++MKTG CKFG+ CKF+HP
Sbjct: 141 NWKEAANVEESYPEQEGEPDCPFFMKTGKCKFGSKCKFNHP 181



 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 24/66 (36%), Positives = 33/66 (50%), Gaps = 8/66 (12%)
 Frame = -3

Query: 652 FHHPLDHSLSVTSSMEG--------EQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGAT 497
           +H P+  S S    +E         ++   + SL   P+R G   C +YM T  CKFG +
Sbjct: 66  YHQPIMGSHSTVEQIEALYSSNTMTKRPRLESSLPIYPQRPGEKDCAFYMMTRTCKFGGS 125

Query: 496 CKFDHP 479
           CKFDHP
Sbjct: 126 CKFDHP 131



>gb:AP002525_1822409 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0462H08.
          Length = 466

 Score =  129 bits (325), Expect = 7e-29
 Identities = 73/168 (43%), Positives = 88/168 (52%), Gaps = 1/168 (0%)
 Frame = -3

Query: 946 LPIRLGEVDCPFYLKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDP 770
           LP R GE DC +YL+TG+C YG  CRYNHP DR      AA LN G     ++       
Sbjct: 48  LPERPGEADCVYYLRTGACGYGENCRYNHPRDRAA----AAVLNGGGKTTHSAE------ 97

Query: 769 RLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQN 590
                        YP+RPGQ  C++YMK G CKFG  C++ HP           EG  Q 
Sbjct: 98  -------------YPERPGQPVCEYYMKNGTCKFGSNCKYDHP----------REGSVQA 134

Query: 589 FKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQ 446
             L+ +G P R G   C YY+KTG CKFG+TCKF HP     IGG S+
Sbjct: 135 VMLNSSGYPLRSGEKDCTYYVKTGHCKFGSTCKFHHPE----IGGVSE 178



 Score = 96.3 bits (238), Expect = 8e-19
 Identities = 42/84 (50%), Positives = 51/84 (60%)
 Frame = -3

Query: 730 YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG 551
           +P RPGQ EC +Y+KTG CKFG  C++HHP          +   + N  LS  GLP R G
Sbjct: 296 FPARPGQPECQYYLKTGSCKFGSACKYHHP--------QYLNTPKSNCMLSPLGLPLRPG 347

Query: 550 AIHCPYYMKTGICKFGATCKFDHP 479
           +  C YY + G CKFG TCKFDHP
Sbjct: 348 SQPCAYYTQHGFCKFGPTCKFDHP 371



 Score = 73.9 bits (180), Expect = 4e-12
 Identities = 54/200 (27%), Positives = 81/200 (40%), Gaps = 40/200 (20%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQT 779
           NS G P+R GE DC +Y+KTG CK+G+TC+++HP+            +G V+ T +++  
Sbjct: 138 NSSGYPLRSGEKDCTYYVKTGHCKFGSTCKFHHPE------------IGGVSETPNMYPP 185

Query: 778 FDPRLT------QTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVT 617
             P+        Q + G+     P  PG      Y            +  +P    ++  
Sbjct: 186 VQPQPISSSHPYQHLAGWQMGRPPVLPGSFLSGSYPPMMLPSTVVPMQGWNPYISPVNQV 245

Query: 616 SSMEGEQ-----------------------QNFKLSLAGLP-----------RREGAIHC 539
           +S  G Q                       Q   LS + +P            R G   C
Sbjct: 246 ASAGGHQTVQAGPFYGLSHQGPSAAVTYGSQYAPLSSSTMPSSSSKQEPAFPARPGQPEC 305

Query: 538 PYYMKTGICKFGATCKFDHP 479
            YY+KTG CKFG+ CK+ HP
Sbjct: 306 QYYLKTGSCKFGSACKYHHP 325



 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 41/130 (31%), Positives = 61/130 (46%), Gaps = 3/130 (2%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRL 764
           P R G+ +C +YLKTGSCK+G+ C+Y+HP    +N P ++  +  +              
Sbjct: 297 PARPGQPECQYYLKTGSCKFGSACKYHHPQ--YLNTPKSNCMLSPLG------------- 341

Query: 763 TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHP---LDHSLSVTSSMEGEQQ 593
                       P RPG   C +Y + G CKFG  C+F HP   L +S S +S  +    
Sbjct: 342 -----------LPLRPGSQPCAYYTQHGFCKFGPTCKFDHPMGTLSYSPSASSITDLPIA 390

Query: 592 NFKLSLAGLP 563
            + L+ A  P
Sbjct: 391 PYPLNYAVAP 400



 Score = 43.5 bits (101), Expect = 0.006
 Identities = 15/31 (48%), Positives = 22/31 (70%)
 Frame = -3

Query: 949 GLPIRLGEVDCPFYLKTGSCKYGATCRYNHP 857
           GLP+R G   C +Y + G CK+G TC+++HP
Sbjct: 341 GLPLRPGSQPCAYYTQHGFCKFGPTCKFDHP 371



>gb:AY084634_1569722 Arabidopsis thaliana clone 113763 mRNA,
           complete sequence.
          Length = 354

 Score =  125 bits (313), Expect = 2e-27
 Identities = 72/199 (36%), Positives = 92/199 (46%), Gaps = 39/199 (19%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASL--- 788
           N    P+R  E DC ++L+ G CK+G TC++NHP   + N   +     V +   SL   
Sbjct: 105 NVLSYPLRPNEDDCSYFLRIGQCKFGGTCKFNHPQTQSTNLMVSVRGSPVYSALQSLTGQ 164

Query: 787 ---------FQTFDPRLTQTMFGFAT---------------------------TIYPQRP 716
                    F    PRL Q   GFA+                            ++P+RP
Sbjct: 165 PSYSWSRTSFVANPPRL-QDPSGFASGSQGGLFSSGFHSGNSVPLGFYALPRENVFPERP 223

Query: 715 GQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCP 536
           GQ EC FYMKTG+CKFG  C+FHHP D        +        LS  GLP R G   C 
Sbjct: 224 GQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCV--------LSSVGLPLRPGEPLCV 275

Query: 535 YYMKTGICKFGATCKFDHP 479
           +Y + GICKFG +CKFDHP
Sbjct: 276 FYSRYGICKFGPSCKFDHP 294



 Score =  112 bits (281), Expect = 8e-24
 Identities = 59/156 (37%), Positives = 82/156 (52%), Gaps = 1/156 (0%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPR 767
           P R GE DC +Y++TG C++G+TCR+NHP DR             +V  TA +       
Sbjct: 19  PERHGEPDCAYYIRTGLCRFGSTCRFNHPHDR------------KLVIATARI------- 59

Query: 766 LTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNF 587
                       YP+R GQ EC+FY+KTG CKFG  C+FHHP + +        G   + 
Sbjct: 60  ---------KGEYPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKA--------GIDGSV 102

Query: 586 KLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP 479
            +++   P R     C Y+++ G CKFG TCKF+HP
Sbjct: 103 SVNVLSYPLRPNEDDCSYFLRIGQCKFGGTCKFNHP 138



 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/101 (42%), Positives = 58/101 (57%), Gaps = 1/101 (0%)
 Frame = -3

Query: 730 YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRRE 554
           YP+R G+ +C +Y++TG C+FG  CRF+HP D  L + T+ ++GE           P R 
Sbjct: 18  YPERHGEPDCAYYIRTGLCRFGSTCRFNHPHDRKLVIATARIKGE----------YPERI 67

Query: 553 GAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTS 431
           G   C +Y+KTG CKFG TCKF HP     I G+  V   S
Sbjct: 68  GQPECEFYLKTGTCKFGVTCKFHHPRNKAGIDGSVSVNVLS 108



 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 37/103 (35%), Positives = 50/103 (48%), Gaps = 1/103 (0%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPR 767
           P R G+ +C FY+KTG CK+G  C+++HP DR T  P     +VG+              
Sbjct: 220 PERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCVLSSVGL-------------- 265

Query: 766 LTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPL 638
                        P RPG+  C FY + G CKFG  C+F HP+
Sbjct: 266 -------------PLRPGEPLCVFYSRYGICKFGPSCKFDHPM 295



 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 25/60 (41%), Positives = 37/60 (61%), Gaps = 1/60 (1%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDR-YTINPPAAHLNVGVVNPTASLFQ 782
           +S GLP+R GE  C FY + G CK+G +C+++HP R +T N      N    +P++SL Q
Sbjct: 261 SSVGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMRVFTYNN-----NTASPSPSSSLHQ 315



>pir|C84920|C84920 hypothetical protein At2g47850 [imported] -
           Arabidopsis thaliana>gb:AC005309_1532461 Arabidopsis
           thaliana chromosome 2 clone F17A22 map CIC06C03,
           complete sequence.
          Length = 553

 Score =  124 bits (311), Expect = 3e-27
 Identities = 65/162 (40%), Positives = 79/162 (48%), Gaps = 1/162 (0%)
 Frame = -3

Query: 955 SKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQT 779
           S   P R G  DC +Y++TG C YG  CRYNHP DR ++                     
Sbjct: 113 SDSYPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDRASVEATVR---------------- 156

Query: 778 FDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGE 599
                       AT  YP+R G+  C FY+KTG CKFG  C+FHHP         +  G 
Sbjct: 157 ------------ATGQYPERFGEPPCQFYLKTGTCKFGASCKFHHP--------KNAGGS 196

Query: 598 QQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPP 473
             +  L++ G P REG   C YY+KTG CKFG TCKF HP P
Sbjct: 197 MSHVPLNIYGYPVREGDNECSYYLKTGQCKFGITCKFHHPQP 238



 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 42/84 (50%), Positives = 54/84 (64%)
 Frame = -3

Query: 730 YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG 551
           +P+RPG+ EC +Y+KTG+CKFG  C+FHHP D            + N  LS  GLP R G
Sbjct: 371 FPERPGEPECQYYLKTGDCKFGTSCKFHHPRDR--------VPPRANCVLSPIGLPLRPG 422

Query: 550 AIHCPYYMKTGICKFGATCKFDHP 479
              C +Y++ G CKFG+TCKFDHP
Sbjct: 423 VQRCTFYVQNGFCKFGSTCKFDHP 446



 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 39/110 (35%), Positives = 55/110 (50%), Gaps = 1/110 (0%)
 Frame = -3

Query: 964 LHNSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASL 788
           +   +  P R GE +C +YLKTG CK+G +C+++HP DR    PP A+    V++P    
Sbjct: 365 IQKEQAFPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRV---PPRANC---VLSPIG-- 416

Query: 787 FQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPL 638
                               P RPG   C FY++ G CKFG  C+F HP+
Sbjct: 417 -------------------LPLRPGVQRCTFYVQNGFCKFGSTCKFDHPM 447



 Score = 67.0 bits (162), Expect = 5e-10
 Identities = 55/199 (27%), Positives = 82/199 (41%), Gaps = 39/199 (19%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPD--RYTINPPAA-----HLNVGVVNP 800
           N  G P+R G+ +C +YLKTG CK+G TC+++HP     T+ PP A     + +V  + P
Sbjct: 203 NIYGYPVREGDNECSYYLKTGQCKFGITCKFHHPQPAGTTVPPPPASAPQFYPSVQSLMP 262

Query: 799 TASLFQTFDPRLTQTMF--GFATTIYPQ---RPGQVECDFYMKTGECKFGERCRFHHPLD 635
                 +   R+ +T+    +    Y      PG V    +                P+ 
Sbjct: 263 DQYGGPSSSLRVARTLLPGSYMQGAYGPMLLTPGVVPIPGWSPYSSLTVSLLLLLQAPVS 322

Query: 634 HSL--------------------SVTSSMEGEQQNFKLSLAGLPRREGAI-------HCP 536
            +L                    S T S+ G   +   S  G+ ++E A         C 
Sbjct: 323 PALSPGAQHAVGATSLYGVTQLTSTTPSLPGVYPSLS-SPTGVIQKEQAFPERPGEPECQ 381

Query: 535 YYMKTGICKFGATCKFDHP 479
           YY+KTG CKFG +CKF HP
Sbjct: 382 YYLKTGDCKFGTSCKFHHP 400



 Score = 45.1 bits (105), Expect = 0.002
 Identities = 17/42 (40%), Positives = 25/42 (59%)
 Frame = -3

Query: 565 PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVT 440
           P R GA  C YYM+TG+C +G  C+++HP     +  T + T
Sbjct: 117 PERPGAPDCAYYMRTGVCGYGNRCRYNHPRDRASVEATVRAT 158



>gb:AK117978_1815983 Arabidopsis thaliana At3g02830 mRNA for
           putative zinc finger protein 1 (zfn1), complete cds,
           clone: RAFL19-18-D10.
          Length = 397

 Score =  122 bits (306), Expect = 1e-26
 Identities = 62/158 (39%), Positives = 84/158 (53%), Gaps = 1/158 (0%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPR 767
           P R GE DC +Y++TG C++G+TCR+NHP DR  +                         
Sbjct: 38  PERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELV------------------------I 73

Query: 766 LTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNF 587
            T  M G     YP+R GQ EC++Y+KTG CKFG  C+FHHP + +        G     
Sbjct: 74  ATARMRG----EYPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKA--------GIAGRV 121

Query: 586 KLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPP 473
            L++ G P R   + C Y+++TG CKFG TCKF+HP P
Sbjct: 122 SLNMLGYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQP 159



 Score =  103 bits (258), Expect = 4e-21
 Identities = 77/273 (28%), Positives = 110/273 (40%), Gaps = 73/273 (26%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTG------SCKYG---------------------------A 878
           N  G P+R  EVDC ++L+TG      +CK+                            A
Sbjct: 124 NMLGYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTSGQQSYPWSRASFIA 183

Query: 877 TCRYNHPDRYTI-------------NPPAAHLNVGVVNPTAS------------------ 791
           + R+  P  Y               NP +  L  G V+P+ +                  
Sbjct: 184 SPRWQDPSSYASLIMPQGVVPVQGWNPYSGQL--GSVSPSGTGNDQNYRNLQQNETIESG 241

Query: 790 -----LFQTFDPRLTQTMFGFAT----TIYPQRPGQVECDFYMKTGECKFGERCRFHHPL 638
                 F  ++P  +  + G+       ++P+RPGQ EC FYMKTG+CKFG  C+FHHP 
Sbjct: 242 SQSQGSFSGYNPGSSVPLGGYYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPR 301

Query: 637 DHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG 458
           D         +    +  LS  GLP R G   C +Y + GICKFG +CKFDHP       
Sbjct: 302 DR--------QAPPPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYD 353

Query: 457 GTSQVTSTSVGEEEGYAKLVEAIQKQQQ*TFCS 359
            T+  T   V    G ++ +   + +Q  T  S
Sbjct: 354 NTASETDEVVETSTGKSRRLSVSETRQAATTSS 386



 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 43/88 (48%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = -3

Query: 739 TTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLP 563
           T  YP+RPG+ +C +Y++TG C+FG  CRF+HP D  L + T+ M GE           P
Sbjct: 34  TGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARMRGE----------YP 83

Query: 562 RREGAIHCPYYMKTGICKFGATCKFDHP 479
            R G   C YY+KTG CKFG TCKF HP
Sbjct: 84  ERIGQPECEYYLKTGTCKFGVTCKFHHP 111



 Score = 79.0 bits (193), Expect = 1e-13
 Identities = 37/116 (31%), Positives = 60/116 (51%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRL 764
           P R+G+ +C +YLKTG+CK+G TC+++HP              G+             R+
Sbjct: 83  PERIGQPECEYYLKTGTCKFGVTCKFHHPRN----------KAGIAG-----------RV 121

Query: 763 TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQ 596
           +  M G     YP R  +V+C ++++TG CKFG  C+F+HP     ++     G+Q
Sbjct: 122 SLNMLG-----YPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTSGQQ 172



 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 19/41 (46%), Positives = 30/41 (73%)
 Frame = -3

Query: 565 PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV 443
           P R G   C YY++TG+C+FG+TC+F+HP   EL+  T+++
Sbjct: 38  PERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARM 78



 Score = 45.8 bits (107), Expect = 0.001
 Identities = 19/38 (50%), Positives = 27/38 (71%)
 Frame = -3

Query: 964 LHNSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDR 851
           L +S GLP+R GE  C FY + G CK+G +C+++HP R
Sbjct: 311 LLSSIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMR 348



>gb:ATAC018363_1543684 Arabidopsis thaliana chromosome III BAC F13E7
           genomic sequence, complete sequence.
          Length = 377

 Score =  122 bits (306), Expect = 1e-26
 Identities = 62/158 (39%), Positives = 84/158 (53%), Gaps = 1/158 (0%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPR 767
           P R GE DC +Y++TG C++G+TCR+NHP DR  +                         
Sbjct: 18  PERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELV------------------------I 53

Query: 766 LTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNF 587
            T  M G     YP+R GQ EC++Y+KTG CKFG  C+FHHP + +        G     
Sbjct: 54  ATARMRG----EYPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKA--------GIAGRV 101

Query: 586 KLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPP 473
            L++ G P R   + C Y+++TG CKFG TCKF+HP P
Sbjct: 102 SLNMLGYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQP 139



 Score =  103 bits (258), Expect = 4e-21
 Identities = 77/273 (28%), Positives = 110/273 (40%), Gaps = 73/273 (26%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTG------SCKYG---------------------------A 878
           N  G P+R  EVDC ++L+TG      +CK+                            A
Sbjct: 104 NMLGYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTSGQQSYPWSRASFIA 163

Query: 877 TCRYNHPDRYTI-------------NPPAAHLNVGVVNPTAS------------------ 791
           + R+  P  Y               NP +  L  G V+P+ +                  
Sbjct: 164 SPRWQDPSSYASLIMPQGVVPVQGWNPYSGQL--GSVSPSGTGNDQNYRNLQQNETIESG 221

Query: 790 -----LFQTFDPRLTQTMFGFAT----TIYPQRPGQVECDFYMKTGECKFGERCRFHHPL 638
                 F  ++P  +  + G+       ++P+RPGQ EC FYMKTG+CKFG  C+FHHP 
Sbjct: 222 SQSQGSFSGYNPGSSVPLGGYYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPR 281

Query: 637 DHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG 458
           D         +    +  LS  GLP R G   C +Y + GICKFG +CKFDHP       
Sbjct: 282 DR--------QAPPPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYD 333

Query: 457 GTSQVTSTSVGEEEGYAKLVEAIQKQQQ*TFCS 359
            T+  T   V    G ++ +   + +Q  T  S
Sbjct: 334 NTASETDEVVETSTGKSRRLSVSETRQAATTSS 366



 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 43/88 (48%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = -3

Query: 739 TTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLP 563
           T  YP+RPG+ +C +Y++TG C+FG  CRF+HP D  L + T+ M GE           P
Sbjct: 14  TGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARMRGE----------YP 63

Query: 562 RREGAIHCPYYMKTGICKFGATCKFDHP 479
            R G   C YY+KTG CKFG TCKF HP
Sbjct: 64  ERIGQPECEYYLKTGTCKFGVTCKFHHP 91



 Score = 79.0 bits (193), Expect = 1e-13
 Identities = 37/116 (31%), Positives = 60/116 (51%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRL 764
           P R+G+ +C +YLKTG+CK+G TC+++HP              G+             R+
Sbjct: 63  PERIGQPECEYYLKTGTCKFGVTCKFHHPRN----------KAGIAG-----------RV 101

Query: 763 TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQ 596
           +  M G     YP R  +V+C ++++TG CKFG  C+F+HP     ++     G+Q
Sbjct: 102 SLNMLG-----YPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTSGQQ 152



 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 19/41 (46%), Positives = 30/41 (73%)
 Frame = -3

Query: 565 PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV 443
           P R G   C YY++TG+C+FG+TC+F+HP   EL+  T+++
Sbjct: 18  PERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARM 58



 Score = 45.8 bits (107), Expect = 0.001
 Identities = 19/38 (50%), Positives = 27/38 (71%)
 Frame = -3

Query: 964 LHNSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDR 851
           L +S GLP+R GE  C FY + G CK+G +C+++HP R
Sbjct: 291 LLSSIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMR 328



>gb:AP002525_1822420 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0462H08.
          Length = 447

 Score =  121 bits (304), Expect = 2e-26
 Identities = 71/186 (38%), Positives = 88/186 (47%), Gaps = 4/186 (2%)
 Frame = -3

Query: 946 LPIRLGEVDCPFYLKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDP 770
           LP R GE DC +YL+TG+C +G  CRYNHP DR          N   ++           
Sbjct: 27  LPERPGEEDCVYYLRTGACGFGDRCRYNHPRDRGGTEFGGGARNAAALD----------- 75

Query: 769 RLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQN 590
                        YP+R GQ  C++YMKTG CKFG  C++HHP           +G    
Sbjct: 76  -------------YPERAGQPICEYYMKTGTCKFGTNCKYHHP---------KQDGAVLP 113

Query: 589 FKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGEL---IGGTSQVTSTSVGEE 419
             L+ +G P R G   C YYMKTG CKFG TCKF HP  G +    G    + S S+   
Sbjct: 114 VMLNNSGFPIRLGEKECSYYMKTGQCKFGTTCKFHHPEFGGVPMTPGIYPPLQSPSIASP 173

Query: 418 EGYAKL 401
             YA L
Sbjct: 174 HPYASL 179



 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 34/84 (40%), Positives = 52/84 (61%)
 Frame = -3

Query: 730 YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG 551
           +P+RPGQ +C +YM+TG+CKFG  C++HHP +        +   +  + ++   LP R G
Sbjct: 275 FPERPGQPDCQYYMRTGDCKFGATCKYHHPRE--------LSAPKSGYMVNSLCLPLRPG 326

Query: 550 AIHCPYYMKTGICKFGATCKFDHP 479
           A  C YY + G C++G  CK+DHP
Sbjct: 327 AQPCAYYAQNGYCRYGVACKYDHP 350



 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 58/193 (30%), Positives = 80/193 (41%), Gaps = 33/193 (17%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPD------RYTINPPAAHLNVGVVNPT 797
           N+ G PIRLGE +C +Y+KTG CK+G TC+++HP+         I PP    ++   +P 
Sbjct: 117 NNSGFPIRLGEKECSYYMKTGQCKFGTTCKFHHPEFGGVPMTPGIYPPLQSPSIASPHPY 176

Query: 796 ASLFQ----------------TFDPRL-------TQTMFGFATTIYPQRPG----QVECD 698
           ASL                  ++ P +        Q    +  ++ P   G     V+  
Sbjct: 177 ASLANWQMGRPPVVPGSYIPGSYTPMMLSSGMIPLQGWSPYPASVNPVVSGGAQQNVQAG 236

Query: 697 FYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTG 518
                G         +  P     S T      QQ       G P R G   C YYM+TG
Sbjct: 237 PVYGMGHHGSSSTIAYGGPYVPYASSTGQSSNNQQEH-----GFPERPGQPDCQYYMRTG 291

Query: 517 ICKFGATCKFDHP 479
            CKFGATCK+ HP
Sbjct: 292 DCKFGATCKYHHP 304



 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 39/90 (43%), Positives = 52/90 (57%)
 Frame = -3

Query: 748 GFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAG 569
           G A    P+RPG+ +C +Y++TG C FG+RCR++HP D      +   G  +N   +   
Sbjct: 21  GDAAGRLPERPGEEDCVYYLRTGACGFGDRCRYNHPRDRG---GTEFGGGARN--AAALD 75

Query: 568 LPRREGAIHCPYYMKTGICKFGATCKFDHP 479
            P R G   C YYMKTG CKFG  CK+ HP
Sbjct: 76  YPERAGQPICEYYMKTGTCKFGTNCKYHHP 105



 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 34/104 (32%), Positives = 52/104 (50%)
 Frame = -3

Query: 949 GLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDP 770
           G P R G+ DC +Y++TG CK+GATC+Y+HP R    P + ++    VN           
Sbjct: 274 GFPERPGQPDCQYYMRTGDCKFGATCKYHHP-RELSAPKSGYM----VN----------- 317

Query: 769 RLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPL 638
                     +   P RPG   C +Y + G C++G  C++ HP+
Sbjct: 318 ----------SLCLPLRPGAQPCAYYAQNGYCRYGVACKYDHPM 351



 Score = 43.9 bits (102), Expect = 0.005
 Identities = 16/34 (47%), Positives = 22/34 (64%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHP 857
           NS  LP+R G   C +Y + G C+YG  C+Y+HP
Sbjct: 317 NSLCLPLRPGAQPCAYYAQNGYCRYGVACKYDHP 350



>gb:AP002525_1822419 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0462H08.
          Length = 476

 Score =  121 bits (304), Expect = 2e-26
 Identities = 71/186 (38%), Positives = 88/186 (47%), Gaps = 4/186 (2%)
 Frame = -3

Query: 946 LPIRLGEVDCPFYLKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDP 770
           LP R GE DC +YL+TG+C +G  CRYNHP DR          N   ++           
Sbjct: 56  LPERPGEEDCVYYLRTGACGFGDRCRYNHPRDRGGTEFGGGARNAAALD----------- 104

Query: 769 RLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQN 590
                        YP+R GQ  C++YMKTG CKFG  C++HHP           +G    
Sbjct: 105 -------------YPERAGQPICEYYMKTGTCKFGTNCKYHHP---------KQDGAVLP 142

Query: 589 FKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGEL---IGGTSQVTSTSVGEE 419
             L+ +G P R G   C YYMKTG CKFG TCKF HP  G +    G    + S S+   
Sbjct: 143 VMLNNSGFPIRLGEKECSYYMKTGQCKFGTTCKFHHPEFGGVPMTPGIYPPLQSPSIASP 202

Query: 418 EGYAKL 401
             YA L
Sbjct: 203 HPYASL 208



 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 34/84 (40%), Positives = 52/84 (61%)
 Frame = -3

Query: 730 YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG 551
           +P+RPGQ +C +YM+TG+CKFG  C++HHP +        +   +  + ++   LP R G
Sbjct: 304 FPERPGQPDCQYYMRTGDCKFGATCKYHHPRE--------LSAPKSGYMVNSLCLPLRPG 355

Query: 550 AIHCPYYMKTGICKFGATCKFDHP 479
           A  C YY + G C++G  CK+DHP
Sbjct: 356 AQPCAYYAQNGYCRYGVACKYDHP 379



 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 58/193 (30%), Positives = 80/193 (41%), Gaps = 33/193 (17%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPD------RYTINPPAAHLNVGVVNPT 797
           N+ G PIRLGE +C +Y+KTG CK+G TC+++HP+         I PP    ++   +P 
Sbjct: 146 NNSGFPIRLGEKECSYYMKTGQCKFGTTCKFHHPEFGGVPMTPGIYPPLQSPSIASPHPY 205

Query: 796 ASLFQ----------------TFDPRL-------TQTMFGFATTIYPQRPG----QVECD 698
           ASL                  ++ P +        Q    +  ++ P   G     V+  
Sbjct: 206 ASLANWQMGRPPVVPGSYIPGSYTPMMLSSGMIPLQGWSPYPASVNPVVSGGAQQNVQAG 265

Query: 697 FYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTG 518
                G         +  P     S T      QQ       G P R G   C YYM+TG
Sbjct: 266 PVYGMGHHGSSSTIAYGGPYVPYASSTGQSSNNQQEH-----GFPERPGQPDCQYYMRTG 320

Query: 517 ICKFGATCKFDHP 479
            CKFGATCK+ HP
Sbjct: 321 DCKFGATCKYHHP 333



 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 39/90 (43%), Positives = 52/90 (57%)
 Frame = -3

Query: 748 GFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAG 569
           G A    P+RPG+ +C +Y++TG C FG+RCR++HP D      +   G  +N   +   
Sbjct: 50  GDAAGRLPERPGEEDCVYYLRTGACGFGDRCRYNHPRDRG---GTEFGGGARN--AAALD 104

Query: 568 LPRREGAIHCPYYMKTGICKFGATCKFDHP 479
            P R G   C YYMKTG CKFG  CK+ HP
Sbjct: 105 YPERAGQPICEYYMKTGTCKFGTNCKYHHP 134



 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 34/104 (32%), Positives = 52/104 (50%)
 Frame = -3

Query: 949 GLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDP 770
           G P R G+ DC +Y++TG CK+GATC+Y+HP R    P + ++    VN           
Sbjct: 303 GFPERPGQPDCQYYMRTGDCKFGATCKYHHP-RELSAPKSGYM----VN----------- 346

Query: 769 RLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPL 638
                     +   P RPG   C +Y + G C++G  C++ HP+
Sbjct: 347 ----------SLCLPLRPGAQPCAYYAQNGYCRYGVACKYDHPM 380



 Score = 43.9 bits (102), Expect = 0.005
 Identities = 16/34 (47%), Positives = 22/34 (64%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHP 857
           NS  LP+R G   C +Y + G C+YG  C+Y+HP
Sbjct: 346 NSLCLPLRPGAQPCAYYAQNGYCRYGVACKYDHP 379



>gb:AP005492_1852799 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0077L03.
          Length = 711

 Score =  121 bits (303), Expect = 2e-26
 Identities = 65/171 (38%), Positives = 82/171 (47%), Gaps = 13/171 (7%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRL 764
           P R GE DC +Y+K GSCK+G +C YNHPD      P          P            
Sbjct: 42  PRRPGEPDCSYYVKFGSCKFGISCVYNHPD------PRPQHGADDKKPAEQ--------- 86

Query: 763 TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHP-----------LDHSLSVT 617
                      +P+RPG+ +C +Y+K G CKFG  CRF+HP              +    
Sbjct: 87  -----------FPRRPGEPDCSYYVKFGSCKFGMNCRFNHPPRMPVPPQQEYFSGNACHC 135

Query: 616 SSMEGEQ--QNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPG 470
             +EG+   +  KL++ GLP R G   C YYM  GICKFG  CKFDHP PG
Sbjct: 136 HHIEGKSKVEQVKLNVLGLPLRPGTGLCSYYMNRGICKFGTNCKFDHPDPG 186



 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 34/85 (40%), Positives = 47/85 (55%)
 Frame = -3

Query: 730 YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG 551
           +P+RPG+ +C +Y+K G CKFG  C ++HP           +  +Q         PRR G
Sbjct: 41  HPRRPGEPDCSYYVKFGSCKFGISCVYNHPDPRPQHGADDKKPAEQ--------FPRRPG 92

Query: 550 AIHCPYYMKTGICKFGATCKFDHPP 476
              C YY+K G CKFG  C+F+HPP
Sbjct: 93  EPDCSYYVKFGSCKFGMNCRFNHPP 117



 Score = 44.3 bits (103), Expect = 0.004
 Identities = 16/35 (45%), Positives = 23/35 (65%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPD 854
           N  GLP+R G   C +Y+  G CK+G  C+++HPD
Sbjct: 150 NVLGLPLRPGTGLCSYYMNRGICKFGTNCKFDHPD 184



>gb:AY048253_1561714 Arabidopsis thaliana At1g04990/F13M7_1 mRNA,
           complete cds.>gb:AY113065_1578225 Arabidopsis thaliana
           At1g04990/F13M7_1 mRNA, complete cds.
          Length = 404

 Score =  120 bits (300), Expect = 5e-26
 Identities = 61/157 (38%), Positives = 80/157 (50%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRL 764
           P R GE DC FYL+TG C YG++CRYNHP          HL   V      L        
Sbjct: 45  PDRPGERDCQFYLRTGLCGYGSSCRYNHP---------THLPQDVAYYKEEL-------- 87

Query: 763 TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK 584
                       P+R GQ +C++++KTG CK+G  C++HHP D + +         Q   
Sbjct: 88  ------------PERIGQPDCEYFLKTGACKYGPTCKYHHPKDRNGA---------QPVM 126

Query: 583 LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPP 473
            ++ GLP R G   CPYY++TG C+FG  CKF HP P
Sbjct: 127 FNVIGLPMRLGEKPCPYYLRTGTCRFGVACKFHHPQP 163



 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 61/216 (28%), Positives = 89/216 (41%), Gaps = 54/216 (25%)
 Frame = -3

Query: 964 LHNSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPD-------RYTINP-PAAHLNVGV 809
           + N  GLP+RLGE  CP+YL+TG+C++G  C+++HP         Y ++  PAA L    
Sbjct: 126 MFNVIGLPMRLGEKPCPYYLRTGTCRFGVACKFHHPQPDNGHSTAYGMSSFPAADLRYAS 185

Query: 808 ---------VNPTASLFQTFDPRLTQTMFGF------------ATTIY------------ 728
                      P   + Q++ P L     GF            + ++Y            
Sbjct: 186 GLTMMSTYGTLPRPQVPQSYVPILVSPSQGFLPPQGWAPYMAASNSMYNVKNQPYYSGSS 245

Query: 727 -------------PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNF 587
                         +   Q EC F+M TG CK+G+ C++ HP         S+       
Sbjct: 246 ASMAMAVALNRGLSESSDQPECRFFMNTGTCKYGDDCKYSHPGVRISQPPPSL------- 298

Query: 586 KLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP 479
            ++   LP R G   C  +   G CKFG  CKFDHP
Sbjct: 299 -INPFVLPARPGQPACGNFRSYGFCKFGPNCKFDHP 333



 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 35/84 (41%), Positives = 46/84 (54%)
 Frame = -3

Query: 730 YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG 551
           YP RPG+ +C FY++TG C +G  CR++HP      V    E            LP R G
Sbjct: 44  YPDRPGERDCQFYLRTGLCGYGSSCRYNHPTHLPQDVAYYKE-----------ELPERIG 92

Query: 550 AIHCPYYMKTGICKFGATCKFDHP 479
              C Y++KTG CK+G TCK+ HP
Sbjct: 93  QPDCEYFLKTGACKYGPTCKYHHP 116



 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 36/102 (35%), Positives = 51/102 (50%)
 Frame = -3

Query: 946 LPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPR 767
           LP R+G+ DC ++LKTG+CKYG TC+Y+HP       P     +G+              
Sbjct: 87  LPERIGQPDCEYFLKTGACKYGPTCKYHHPKDRNGAQPVMFNVIGL-------------- 132

Query: 766 LTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHP 641
                        P R G+  C +Y++TG C+FG  C+FHHP
Sbjct: 133 -------------PMRLGEKPCPYYLRTGTCRFGVACKFHHP 161



 Score = 67.0 bits (162), Expect = 5e-10
 Identities = 34/106 (32%), Positives = 48/106 (45%)
 Frame = -3

Query: 955 SKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTF 776
           ++GL     + +C F++ TG+CKYG  C+Y+HP             V +  P  SL   F
Sbjct: 255 NRGLSESSDQPECRFFMNTGTCKYGDDCKYSHP------------GVRISQPPPSLINPF 302

Query: 775 DPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPL 638
                         + P RPGQ  C  +   G CKFG  C+F HP+
Sbjct: 303 --------------VLPARPGQPACGNFRSYGFCKFGPNCKFDHPM 334



>pir|T48868|T48868 zinc finger protein [imported] - garden
           pea>gb:AF160977_1773385 Pisum sativum zinc finger
           protein mRNA, complete cds.
          Length = 417

 Score =  119 bits (298), Expect = 9e-26
 Identities = 60/161 (37%), Positives = 78/161 (48%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRL 764
           P   GE DC +Y++TG C++GATCR+NHP       P   L +                 
Sbjct: 28  PEHPGEPDCSYYIRTGLCRFGATCRFNHP-------PNRKLAIATARMKGE--------- 71

Query: 763 TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK 584
                      +P+R GQ EC +Y+KTG CKFG  CRFHHP D +        G      
Sbjct: 72  -----------FPERLGQPECQYYLKTGTCKFGATCRFHHPKDKA--------GVAGRVA 112

Query: 583 LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELI 461
           L++ G P R       YY++TG CKFG TCKF HP P  ++
Sbjct: 113 LNILGYPLRPNESERAYYLRTGQCKFGNTCKFHHPQPSNMV 153



 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 50/120 (41%), Positives = 63/120 (52%), Gaps = 15/120 (12%)
 Frame = -3

Query: 733 IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE 554
           I+P+RP Q EC FYMKTG+CKFG  CRFHHP +  +     +        LS  GLP R 
Sbjct: 274 IFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERQIPAPDCV--------LSPIGLPLRP 325

Query: 553 GAIHCPYYMKTGICKFGATCKFDHP---------------PPGELIGGTSQVTSTSVGEE 419
           G   C +Y + GICKFG +CKFDHP               P   L+G +S   + S+  E
Sbjct: 326 GEPLCVFYSRYGICKFGPSCKFDHPMGIFTYNVASPLADTPGRRLLGSSSGTAALSLSSE 385



 Score = 92.8 bits (229), Expect = 9e-18
 Identities = 40/85 (47%), Positives = 55/85 (64%), Gaps = 1/85 (1%)
 Frame = -3

Query: 730 YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRRE 554
           YP+ PG+ +C +Y++TG C+FG  CRF+HP +  L++ T+ M+GE           P R 
Sbjct: 27  YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARMKGE----------FPERL 76

Query: 553 GAIHCPYYMKTGICKFGATCKFDHP 479
           G   C YY+KTG CKFGATC+F HP
Sbjct: 77  GQPECQYYLKTGTCKFGATCRFHHP 101



 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 36/102 (35%), Positives = 48/102 (47%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRL 764
           P R  + +C FY+KTG CK+GA CR++HP    I  P       V++P            
Sbjct: 276 PERPDQPECQFYMKTGDCKFGAVCRFHHPRERQIPAPDC-----VLSPIG---------- 320

Query: 763 TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPL 638
                       P RPG+  C FY + G CKFG  C+F HP+
Sbjct: 321 -----------LPLRPGEPLCVFYSRYGICKFGPSCKFDHPM 351



 Score = 66.2 bits (160), Expect = 9e-10
 Identities = 53/198 (26%), Positives = 82/198 (41%), Gaps = 38/198 (19%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNH--PDRYTINPPAAHLNVGVVNPTASLF 785
           N  G P+R  E +  +YL+TG CK+G TC+++H  P    ++   + +   V +PT    
Sbjct: 114 NILGYPLRPNESERAYYLRTGQCKFGNTCKFHHPQPSNMVLSMRGSTVYPTVQSPTTPGQ 173

Query: 784 QTFDPRLT-------------QTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHH 644
           Q++   +T             Q    +A  I PQ    V        G   +G +     
Sbjct: 174 QSYAAGITNWSSSSYVPSPRWQGPSSYAPLILPQGVVSV-------PGWSTYGGQMGSES 226

Query: 643 P---LDHSLSVTSSMEGEQQNFKLSLAGLPRREGAI--------------------HCPY 533
           P   + +  +  +S +GE +N  L  A    R G++                     C +
Sbjct: 227 PQQTMRNDQTYGTSHQGELENAGLQGAYSQYRSGSVPVGFYALQRDNIFPERPDQPECQF 286

Query: 532 YMKTGICKFGATCKFDHP 479
           YMKTG CKFGA C+F HP
Sbjct: 287 YMKTGDCKFGAVCRFHHP 304



 Score = 51.2 bits (121), Expect = 3e-05
 Identities = 19/41 (46%), Positives = 29/41 (70%)
 Frame = -3

Query: 565 PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV 443
           P   G   C YY++TG+C+FGATC+F+HPP  +L   T+++
Sbjct: 28  PEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARM 68



 Score = 43.5 bits (101), Expect = 0.006
 Identities = 16/31 (51%), Positives = 23/31 (74%)
 Frame = -3

Query: 949 GLPIRLGEVDCPFYLKTGSCKYGATCRYNHP 857
           GLP+R GE  C FY + G CK+G +C+++HP
Sbjct: 320 GLPLRPGEPLCVFYSRYGICKFGPSCKFDHP 350



>pir|T48874|T48874 zinc finger protein 1 [imported] - Arabidopsis
           thaliana>gb:AF138743_1771388 Arabidopsis thaliana zinc
           finger protein 1 (zfn1) mRNA, complete cds.
          Length = 424

 Score =  119 bits (297), Expect = 1e-25
 Identities = 61/158 (38%), Positives = 82/158 (51%), Gaps = 1/158 (0%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPR 767
           P R GE DC +Y++TG C++G+TCR NHP DR  +                         
Sbjct: 38  PERPGEPDCSYYIRTGLCRFGSTCRVNHPRDRELVIA----------------------- 74

Query: 766 LTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNF 587
            T  M G     YP+R G  EC++Y+KTG CKFG  C+FHHP + +        G     
Sbjct: 75  -TARMRGE----YPERIGHPECEYYLKTGTCKFGVTCKFHHPRNKA--------GIAGRV 121

Query: 586 KLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPP 473
            L++ G P R   + C Y+++TG CKFG TCKF+HP P
Sbjct: 122 SLNMLGYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQP 159



 Score =  103 bits (258), Expect = 4e-21
 Identities = 77/273 (28%), Positives = 110/273 (40%), Gaps = 73/273 (26%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTG------SCKYG---------------------------A 878
           N  G P+R  EVDC ++L+TG      +CK+                            A
Sbjct: 124 NMLGYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTSGQQSYPWSRASFIA 183

Query: 877 TCRYNHPDRYTI-------------NPPAAHLNVGVVNPTAS------------------ 791
           + R+  P  Y               NP +  L  G V+P+ +                  
Sbjct: 184 SPRWQDPSSYASLIMPQGVVPVQGWNPYSGQL--GSVSPSGTGNDQNYRNLQQNETIESG 241

Query: 790 -----LFQTFDPRLTQTMFGFAT----TIYPQRPGQVECDFYMKTGECKFGERCRFHHPL 638
                 F  ++P  +  + G+       ++P+RPGQ EC FYMKTG+CKFG  C+FHHP 
Sbjct: 242 SQSQGSFSGYNPGSSVPLGGYYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPR 301

Query: 637 DHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIG 458
           D         +    +  LS  GLP R G   C +Y + GICKFG +CKFDHP       
Sbjct: 302 DR--------QAPPPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYD 353

Query: 457 GTSQVTSTSVGEEEGYAKLVEAIQKQQQ*TFCS 359
            T+  T   V    G ++ +   + +Q  T  S
Sbjct: 354 NTASETDEVVETSTGKSRRLSVSETRQAATTSS 386



 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 42/88 (47%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = -3

Query: 739 TTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLP 563
           T  YP+RPG+ +C +Y++TG C+FG  CR +HP D  L + T+ M GE           P
Sbjct: 34  TGSYPERPGEPDCSYYIRTGLCRFGSTCRVNHPRDRELVIATARMRGE----------YP 83

Query: 562 RREGAIHCPYYMKTGICKFGATCKFDHP 479
            R G   C YY+KTG CKFG TCKF HP
Sbjct: 84  ERIGHPECEYYLKTGTCKFGVTCKFHHP 111



 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 37/116 (31%), Positives = 59/116 (50%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRL 764
           P R+G  +C +YLKTG+CK+G TC+++HP              G+             R+
Sbjct: 83  PERIGHPECEYYLKTGTCKFGVTCKFHHPRN----------KAGIAG-----------RV 121

Query: 763 TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQ 596
           +  M G     YP R  +V+C ++++TG CKFG  C+F+HP     ++     G+Q
Sbjct: 122 SLNMLG-----YPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTSGQQ 172



 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 18/41 (43%), Positives = 29/41 (70%)
 Frame = -3

Query: 565 PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV 443
           P R G   C YY++TG+C+FG+TC+ +HP   EL+  T+++
Sbjct: 38  PERPGEPDCSYYIRTGLCRFGSTCRVNHPRDRELVIATARM 78



 Score = 45.8 bits (107), Expect = 0.001
 Identities = 19/38 (50%), Positives = 27/38 (71%)
 Frame = -3

Query: 964 LHNSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDR 851
           L +S GLP+R GE  C FY + G CK+G +C+++HP R
Sbjct: 311 LLSSIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMR 348



>gb:AP003451_1829649 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0413C03.
          Length = 439

 Score =  117 bits (293), Expect = 3e-25
 Identities = 58/155 (37%), Positives = 77/155 (49%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRL 764
           P R GE DC +YL+TG C++G +CR+NHP    +   +A +                   
Sbjct: 78  PERSGEPDCTYYLRTGLCRFGMSCRFNHPQDRNLAIASARMKGE---------------- 121

Query: 763 TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK 584
                      YP+R GQ EC +Y+KTG CKFG  C+FHHP + +        G     +
Sbjct: 122 -----------YPERMGQPECQYYLKTGTCKFGPTCKFHHPREKA--------GIAGRVQ 162

Query: 583 LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP 479
           L+  G P R     C YY+KTG CK+G TCKF HP
Sbjct: 163 LNTLGYPLRPSEKECAYYLKTGQCKYGNTCKFHHP 197



 Score = 96.7 bits (239), Expect = 6e-19
 Identities = 43/85 (50%), Positives = 53/85 (62%)
 Frame = -3

Query: 733 IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE 554
           ++P+RP Q EC +YMKTG+CKFG  C+FHHP   S+     +        LS  GLP R 
Sbjct: 328 VFPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSMPTPDCV--------LSPVGLPLRP 379

Query: 553 GAIHCPYYMKTGICKFGATCKFDHP 479
           G   C +Y + GICKFGA CKFDHP
Sbjct: 380 GEELCKFYSRYGICKFGANCKFDHP 404



 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 44/99 (44%), Positives = 60/99 (60%), Gaps = 1/99 (1%)
 Frame = -3

Query: 730 YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS-MEGEQQNFKLSLAGLPRRE 554
           YP+R G+ +C +Y++TG C+FG  CRF+HP D +L++ S+ M+GE           P R 
Sbjct: 77  YPERSGEPDCTYYLRTGLCRFGMSCRFNHPQDRNLAIASARMKGE----------YPERM 126

Query: 553 GAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTS 437
           G   C YY+KTG CKFG TCKF HP     I G  Q+ +
Sbjct: 127 GQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNT 165



 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 58/199 (29%), Positives = 79/199 (39%), Gaps = 39/199 (19%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRY-------------------TINP 836
           N+ G P+R  E +C +YLKTG CKYG TC+++HP+ +                   T  P
Sbjct: 164 NTLGYPLRPSEKECAYYLKTGQCKYGNTCKFHHPELFNAMASSRGSPIYPSVHSSATAGP 223

Query: 835 PAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECK--FGE 662
           P          P  S   +  PR  Q    +A  I PQ   QV   +   TG+       
Sbjct: 224 PYTGTMASWAFPRGSFIPS--PR-WQNPSNYAPMIVPQGLVQVP-SWNSYTGQMMPVSSS 279

Query: 661 RCRFHHP-------LDHSLSVTSSMEGEQQNFKLSLAGLPR-----------REGAIHCP 536
             R   P           +  ++  +G    ++ S   +P+           R     C 
Sbjct: 280 ESRLQSPGAQQTYGTSQQVDASAGNQGMLSPYRSSSYPVPQYALQRENVFPERPDQPECQ 339

Query: 535 YYMKTGICKFGATCKFDHP 479
           YYMKTG CKFGA CKF HP
Sbjct: 340 YYMKTGDCKFGAVCKFHHP 358



 Score = 66.6 bits (161), Expect = 7e-10
 Identities = 34/108 (31%), Positives = 49/108 (45%)
 Frame = -3

Query: 964 LHNSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLF 785
           L      P R  + +C +Y+KTG CK+GA C+++HP   ++  P       V++P     
Sbjct: 323 LQRENVFPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSMPTPDC-----VLSPVG--- 374

Query: 784 QTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHP 641
                              P RPG+  C FY + G CKFG  C+F HP
Sbjct: 375 ------------------LPLRPGEELCKFYSRYGICKFGANCKFDHP 404



 Score = 47.4 bits (111), Expect = 4e-04
 Identities = 27/67 (40%), Positives = 39/67 (58%), Gaps = 12/67 (17%)
 Frame = -3

Query: 949 GLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPP-------AAHLNVGVV----- 806
           GLP+R GE  C FY + G CK+GA C+++HP   T+ PP       +A  NV +V     
Sbjct: 374 GLPLRPGEELCKFYSRYGICKFGANCKFDHP---TMAPPMGVYAYGSASTNVPMVRRLLQ 430

Query: 805 NPTASLF 785
           +P+AS +
Sbjct: 431 SPSASAY 437



>pir|T06698|T06698 hypothetical protein T29H11.40 - Arabidopsis
           thaliana>gb:ATT29H11_1555656 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T29H11.
          Length = 448

 Score =  117 bits (292), Expect = 4e-25
 Identities = 62/164 (37%), Positives = 86/164 (52%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRL 764
           P+R G  DC FY++TGSCK+G++C++NHP                    A  FQ      
Sbjct: 108 PVRPGAEDCSFYMRTGSCKFGSSCKFNHP-------------------LARKFQIARDNK 148

Query: 763 TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK 584
            +        +     G ++C +Y +TG CK+GE CRF+H +  S  + S+ E       
Sbjct: 149 VREKEDDGGKL-----GLIDCKYYFRTGGCKYGETCRFNHTIPKS-GLASAPE------- 195

Query: 583 LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGT 452
           L+  GLP R G + CPYYM+ G CK+GA CKF+HP P   IGGT
Sbjct: 196 LNFLGLPLRPGEVECPYYMRNGSCKYGAECKFNHPDP-TTIGGT 238



 Score = 89.7 bits (221), Expect = 8e-17
 Identities = 64/178 (35%), Positives = 81/178 (45%), Gaps = 18/178 (10%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTI---NPPAAHLNVGVVNPTASL 788
           N  GLP+R GEV+CP+Y++ GSCKYGA C++NHPD  TI   + P+   N GV   T S 
Sbjct: 197 NFLGLPLRPGEVECPYYMRNGSCKYGAECKFNHPDPTTIGGTDSPSFRGNNGVSIGTFSP 256

Query: 787 FQTF--------DPRLTQTMFGFATTIYPQRPG----QVECDFYMKTGECKFGERCRFHH 644
             TF         PR       F   +  Q  G      E + Y         ER  F  
Sbjct: 257 KATFQASSTSWSSPRHVNGTSPFIPVMLSQTHGVTSQNPEWNGYQ--ASVYSSERGVFSP 314

Query: 643 P---LDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP 479
               L ++ S  +SM   Q   ++     P R     C YYMKTG CKF   CK+ HP
Sbjct: 315 STTYLMNNSSAETSMLLSQYRHQMPAEEFPERPDQPECSYYMKTGDCKFKFNCKYHHP 372



 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 36/83 (43%), Positives = 48/83 (57%)
 Frame = -3

Query: 730 YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG 551
           +P+RP Q EC +YMKTG+CKF   C++HHP +    +          + L+  GLP R  
Sbjct: 343 FPERPDQPECSYYMKTGDCKFKFNCKYHHPKNRLPKLPP--------YALNDKGLPLRPD 394

Query: 550 AIHCPYYMKTGICKFGATCKFDH 482
              C YY + GICKFG  C+FDH
Sbjct: 395 QNICTYYSRYGICKFGPACRFDH 417



 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 36/112 (32%), Positives = 49/112 (43%), Gaps = 1/112 (0%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPR 767
           P R  + +C +Y+KTG CK+   C+Y+HP +R    PP A  + G+              
Sbjct: 344 PERPDQPECSYYMKTGDCKFKFNCKYHHPKNRLPKLPPYALNDKGL-------------- 389

Query: 766 LTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS 611
                        P RP Q  C +Y + G CKFG  CRF H +    S  SS
Sbjct: 390 -------------PLRPDQNICTYYSRYGICKFGPACRFDHSVQPPYSTESS 428



 Score = 42.4 bits (98), Expect = 0.014
 Identities = 17/42 (40%), Positives = 26/42 (61%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPP 833
           N KGLP+R  +  C +Y + G CK+G  CR++H    ++ PP
Sbjct: 385 NDKGLPLRPDQNICTYYSRYGICKFGPACRFDH----SVQPP 422



>gb:AB008265_1510409 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MDC12.
          Length = 435

 Score =  113 bits (283), Expect = 5e-24
 Identities = 60/163 (36%), Positives = 83/163 (50%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRL 764
           P+R    DC FY++TGSCKYG++C++NHP R         L +G            +P+L
Sbjct: 99  PVRPDSEDCSFYMRTGSCKYGSSCKFNHPVR-------RKLQIGRERVRERDEDVENPKL 151

Query: 763 TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK 584
                             +EC +Y +TG CK+GE CRF H  +H+   +          +
Sbjct: 152 ------------------MECKYYFRTGGCKYGESCRFSHMKEHNSPASVP--------E 185

Query: 583 LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGG 455
           L+  GLP R G   CP+YM+ G CKFG+ CKF+HP P   IGG
Sbjct: 186 LNFLGLPIRPGEKECPFYMRNGSCKFGSDCKFNHPDP-TAIGG 227



 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 49/155 (31%), Positives = 75/155 (48%), Gaps = 1/155 (0%)
 Frame = -3

Query: 886 YGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIYPQRPGQV 707
           Y A+  Y  P+R  + P +  +N  +   ++          +Q     +   +P+RP Q 
Sbjct: 289 YQASSAYP-PERSPLAPSSYQVNNSLAETSS---------FSQYQHQMSVEEFPERPDQP 338

Query: 706 ECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYM 527
           EC +Y+KTG+CKF  +C++HHP         +   +Q  F  +  GLP R     C +Y 
Sbjct: 339 ECTYYLKTGDCKFKYKCKYHHP--------KNRLPKQAAFSFNDKGLPLRPDQSMCTHYS 390

Query: 526 KTGICKFGATCKFDHPPPGELIGGTSQ-VTSTSVG 425
           + GICKFG  C+FDH  P      +SQ V +  VG
Sbjct: 391 RYGICKFGPACRFDHSIPPTFSPSSSQTVEARQVG 425



 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 58/176 (32%), Positives = 86/176 (48%), Gaps = 16/176 (9%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTI----NPPAAHLNVGVVNPTA- 794
           N  GLPIR GE +CPFY++ GSCK+G+ C++NHPD   I    +P     N G  +P A 
Sbjct: 187 NFLGLPIRPGEKECPFYMRNGSCKFGSDCKFNHPDPTAIGGVDSPLYRGNNGGSFSPKAP 246

Query: 793 SLFQTFDPRLTQTMFG-----FATTIYPQ----RPGQVECDFYMKTGEC--KFGERCRFH 647
           S   +     T+ M G     F  +++P      P   + + Y  +     +        
Sbjct: 247 SQASSTSWSSTRHMNGTGTAPFIPSMFPHSRGVTPQASDWNGYQASSAYPPERSPLAPSS 306

Query: 646 HPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP 479
           + +++SL+ TSS    Q   ++S+   P R     C YY+KTG CKF   CK+ HP
Sbjct: 307 YQVNNSLAETSSF--SQYQHQMSVEEFPERPDQPECTYYLKTGDCKFKYKCKYHHP 360



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 21/55 (38%), Positives = 33/55 (60%)
 Frame = -3

Query: 607 EGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV 443
           E E+ + K  +   P R  +  C +YM+TG CK+G++CKF+HP   +L  G  +V
Sbjct: 85  EEEEGSEKRMMMVYPVRPDSEDCSFYMRTGSCKYGSSCKFNHPVRRKLQIGRERV 139



 Score = 42.0 bits (97), Expect = 0.018
 Identities = 17/44 (38%), Positives = 26/44 (59%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAA 827
           N KGLP+R  +  C  Y + G CK+G  CR++H    T +P ++
Sbjct: 373 NDKGLPLRPDQSMCTHYSRYGICKFGPACRFDHSIPPTFSPSSS 416



>gb:AB005242_1509522 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MQK4.>gb:AF138872_1771391 Arabidopsis thaliana
           zinc finger protein 3 (ZFN3) mRNA, complete cds.
          Length = 368

 Score =  112 bits (281), Expect = 8e-24
 Identities = 59/156 (37%), Positives = 82/156 (52%), Gaps = 1/156 (0%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPR 767
           P R GE DC +Y++TG C++G+TCR+NHP DR             +V  TA +       
Sbjct: 40  PERHGEPDCAYYIRTGLCRFGSTCRFNHPHDR------------KLVIATARI------- 80

Query: 766 LTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNF 587
                       YP+R GQ EC+FY+KTG CKFG  C+FHHP + +        G   + 
Sbjct: 81  ---------KGEYPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKA--------GIDGSV 123

Query: 586 KLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP 479
            +++   P R     C Y+++ G CKFG TCKF+HP
Sbjct: 124 SVNVLSYPLRPNEDDCSYFLRIGQCKFGGTCKFNHP 159



 Score =  111 bits (278), Expect = 2e-23
 Identities = 66/199 (33%), Positives = 86/199 (43%), Gaps = 39/199 (19%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASL--- 788
           N    P+R  E DC ++L+ G CK+G TC++NHP   + N   +     V +   SL   
Sbjct: 126 NVLSYPLRPNEDDCSYFLRIGQCKFGGTCKFNHPQTQSTNLMVSVRGSPVYSALQSLTGQ 185

Query: 787 ---------FQTFDPRLTQTMFGFAT---------------------------TIYPQRP 716
                    F    PRL Q   GFA+                            ++P+RP
Sbjct: 186 PSYSWSRTSFVANPPRL-QDPSGFASGSQGGLFSSGFHSGNSVPLGFYALPRENVFPERP 244

Query: 715 GQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCP 536
           GQ EC FYMKTG+CKFG  C+FHHP D        +                  G   C 
Sbjct: 245 GQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCV---------------LSSGEPLCV 289

Query: 535 YYMKTGICKFGATCKFDHP 479
           +Y + GICKFG +CKFDHP
Sbjct: 290 FYSRYGICKFGPSCKFDHP 308



 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 43/101 (42%), Positives = 58/101 (57%), Gaps = 1/101 (0%)
 Frame = -3

Query: 730 YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSV-TSSMEGEQQNFKLSLAGLPRRE 554
           YP+R G+ +C +Y++TG C+FG  CRF+HP D  L + T+ ++GE           P R 
Sbjct: 39  YPERHGEPDCAYYIRTGLCRFGSTCRFNHPHDRKLVIATARIKGE----------YPERI 88

Query: 553 GAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTS 431
           G   C +Y+KTG CKFG TCKF HP     I G+  V   S
Sbjct: 89  GQPECEFYLKTGTCKFGVTCKFHHPRNKAGIDGSVSVNVLS 129



 Score = 38.9 bits (89), Expect = 0.15
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 1/51 (1%)
 Frame = -3

Query: 931 GEVDCPFYLKTGSCKYGATCRYNHPDR-YTINPPAAHLNVGVVNPTASLFQ 782
           GE  C FY + G CK+G +C+++HP R +T N      N    +P++SL Q
Sbjct: 284 GEPLCVFYSRYGICKFGPSCKFDHPMRVFTYNN-----NTASPSPSSSLHQ 329



>gb:BT020223_1642618 Arabidopsis thaliana At5g63260 mRNA, complete
           cds.>gb:BT020443_1642838 Arabidopsis thaliana At5g63260
           mRNA, complete cds.
          Length = 435

 Score =  112 bits (280), Expect = 1e-23
 Identities = 59/163 (36%), Positives = 83/163 (50%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRL 764
           P++    DC FY++TGSCKYG++C++NHP R         L +G            +P+L
Sbjct: 99  PVKPDSEDCSFYMRTGSCKYGSSCKFNHPVR-------RKLQIGRERVRERDEDVENPKL 151

Query: 763 TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK 584
                             +EC +Y +TG CK+GE CRF H  +H+   +          +
Sbjct: 152 ------------------MECKYYFRTGGCKYGESCRFSHMKEHNSPASVP--------E 185

Query: 583 LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGG 455
           L+  GLP R G   CP+YM+ G CKFG+ CKF+HP P   IGG
Sbjct: 186 LNFLGLPIRPGEKECPFYMRNGSCKFGSDCKFNHPDP-TAIGG 227



 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 49/155 (31%), Positives = 75/155 (48%), Gaps = 1/155 (0%)
 Frame = -3

Query: 886 YGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIYPQRPGQV 707
           Y A+  Y  P+R  + P +  +N  +   ++          +Q     +   +P+RP Q 
Sbjct: 289 YQASSAYP-PERSPLAPSSYQVNNSLAETSS---------FSQYQHQMSVEEFPERPDQP 338

Query: 706 ECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYM 527
           EC +Y+KTG+CKF  +C++HHP         +   +Q  F  +  GLP R     C +Y 
Sbjct: 339 ECTYYLKTGDCKFKYKCKYHHP--------KNRLPKQAAFSFNDKGLPLRPDQSMCTHYS 390

Query: 526 KTGICKFGATCKFDHPPPGELIGGTSQ-VTSTSVG 425
           + GICKFG  C+FDH  P      +SQ V +  VG
Sbjct: 391 RYGICKFGPACRFDHSIPPTFSPSSSQTVEARQVG 425



 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 58/176 (32%), Positives = 86/176 (48%), Gaps = 16/176 (9%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTI----NPPAAHLNVGVVNPTA- 794
           N  GLPIR GE +CPFY++ GSCK+G+ C++NHPD   I    +P     N G  +P A 
Sbjct: 187 NFLGLPIRPGEKECPFYMRNGSCKFGSDCKFNHPDPTAIGGVDSPLYRGNNGGSFSPKAP 246

Query: 793 SLFQTFDPRLTQTMFG-----FATTIYPQ----RPGQVECDFYMKTGEC--KFGERCRFH 647
           S   +     T+ M G     F  +++P      P   + + Y  +     +        
Sbjct: 247 SQASSTSWSSTRHMNGTGTAPFIPSMFPHSRGVTPQASDWNGYQASSAYPPERSPLAPSS 306

Query: 646 HPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP 479
           + +++SL+ TSS    Q   ++S+   P R     C YY+KTG CKF   CK+ HP
Sbjct: 307 YQVNNSLAETSSF--SQYQHQMSVEEFPERPDQPECTYYLKTGDCKFKYKCKYHHP 360



 Score = 44.3 bits (103), Expect = 0.004
 Identities = 20/55 (36%), Positives = 33/55 (60%)
 Frame = -3

Query: 607 EGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQV 443
           E E+ + K  +   P +  +  C +YM+TG CK+G++CKF+HP   +L  G  +V
Sbjct: 85  EEEEGSEKRMMMVYPVKPDSEDCSFYMRTGSCKYGSSCKFNHPVRRKLQIGRERV 139



 Score = 42.0 bits (97), Expect = 0.018
 Identities = 17/44 (38%), Positives = 26/44 (59%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAA 827
           N KGLP+R  +  C  Y + G CK+G  CR++H    T +P ++
Sbjct: 373 NDKGLPLRPDQSMCTHYSRYGICKFGPACRFDHSIPPTFSPSSS 416



>pir|T01114|T01114 hypothetical protein At2g32930 [imported] -
           Arabidopsis thaliana>gb:AC003033_1531000 Arabidopsis
           thaliana chromosome 2 BAC T21L14 genomic sequence,
           complete sequence.>gb:AF138744_1771389 Arabidopsis
           thaliana zinc finger protein 2 (zfn2) mRNA, complete
           cds.
          Length = 453

 Score =  109 bits (273), Expect = 7e-23
 Identities = 59/164 (35%), Positives = 80/164 (48%)
 Frame = -3

Query: 964 LHNSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLF 785
           +  S   P R GE DC F+L+TG C YG +CRYNHP          +L  G++     L 
Sbjct: 35  MEQSSPYPDRPGERDCQFFLRTGQCGYGNSCRYNHP--------LTNLPQGIIYYRDQL- 85

Query: 784 QTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSME 605
                              P+R GQ +C+    TG CK+G  C++HHP D + +      
Sbjct: 86  -------------------PERVGQPDCE----TGACKYGPTCKYHHPKDRNGAGP---- 118

Query: 604 GEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPP 473
                   ++ GLP R+G   CPYYM+TG+C+FG  CKF HP P
Sbjct: 119 -----VLFNVLGLPMRQGEKPCPYYMQTGLCRFGVACKFHHPHP 157



 Score = 73.2 bits (178), Expect = 7e-12
 Identities = 55/221 (24%), Positives = 81/221 (36%), Gaps = 60/221 (27%)
 Frame = -3

Query: 964 LHNSKGLPIRLGEVDCPFYLKTGSCK---------------------------------- 887
           L N  GLP+R GE  CP+Y++TG C+                                  
Sbjct: 120 LFNVLGLPMRQGEKPCPYYMQTGLCRFGVACKFHHPHPHSQPSNGHSAYAMSSFPSVGFP 179

Query: 886 --------------YGATCRYNHPDRYTINPPAAHLNVGVV------------NPTASLF 785
                         YGA  R   P      P     + G++            NP  ++ 
Sbjct: 180 YASGMTMVSLPPATYGAIPRPQVPQSQAYMPYMVAPSQGLLPPQGWATYMTASNPIYNMK 239

Query: 784 QTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSME 605
              D   + ++    T+ +     + EC F+M TG CK+G+ C++ HP +  L    ++ 
Sbjct: 240 TQLDSSSSASVAVTVTSHHHSFSERAECRFFMNTGTCKYGDDCKYSHPKERLLQSPPTL- 298

Query: 604 GEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDH 482
                  L+   LP R G   C  +   G CKFGA CKFDH
Sbjct: 299 -------LNPIVLPARPGQPACGNFKAYGFCKFGANCKFDH 332



 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 29/95 (30%), Positives = 40/95 (42%)
 Frame = -3

Query: 922 DCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGF 743
           +C F++ TG+CKYG  C+Y+HP    +  P   LN                         
Sbjct: 266 ECRFFMNTGTCKYGDDCKYSHPKERLLQSPPTLLN------------------------- 300

Query: 742 ATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPL 638
              + P RPGQ  C  +   G CKFG  C+F H +
Sbjct: 301 -PIVLPARPGQPACGNFKAYGFCKFGANCKFDHSM 334



>pir|F86183|F86183 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_889520 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F13M7_1677405 Arabidopsis thaliana
           chromosome 1 BAC F13M7 sequence, complete sequence.
          Length = 396

 Score =  109 bits (272), Expect = 9e-23
 Identities = 60/157 (38%), Positives = 76/157 (48%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRL 764
           P R GE DC FYL+TG C YG++CRYNHP          HL   V      L        
Sbjct: 41  PDRPGERDCQFYLRTGLCGYGSSCRYNHP---------THLPQDVAYYKEEL-------- 83

Query: 763 TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFK 584
                       P+R GQ +C+    TG CK+G  C++HHP D + +         Q   
Sbjct: 84  ------------PERIGQPDCE----TGACKYGPTCKYHHPKDRNGA---------QPVM 118

Query: 583 LSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPP 473
            ++ GLP R G   CPYY++TG C+FG  CKF HP P
Sbjct: 119 FNVIGLPMRLGEKPCPYYLRTGTCRFGVACKFHHPQP 155



 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 61/216 (28%), Positives = 89/216 (41%), Gaps = 54/216 (25%)
 Frame = -3

Query: 964 LHNSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPD-------RYTINP-PAAHLNVGV 809
           + N  GLP+RLGE  CP+YL+TG+C++G  C+++HP         Y ++  PAA L    
Sbjct: 118 MFNVIGLPMRLGEKPCPYYLRTGTCRFGVACKFHHPQPDNGHSTAYGMSSFPAADLRYAS 177

Query: 808 ---------VNPTASLFQTFDPRLTQTMFGF------------ATTIY------------ 728
                      P   + Q++ P L     GF            + ++Y            
Sbjct: 178 GLTMMSTYGTLPRPQVPQSYVPILVSPSQGFLPPQGWAPYMAASNSMYNVKNQPYYSGSS 237

Query: 727 -------------PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNF 587
                         +   Q EC F+M TG CK+G+ C++ HP         S+       
Sbjct: 238 ASMAMAVALNRGLSESSDQPECRFFMNTGTCKYGDDCKYSHPGVRISQPPPSL------- 290

Query: 586 KLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP 479
            ++   LP R G   C  +   G CKFG  CKFDHP
Sbjct: 291 -INPFVLPARPGQPACGNFRSYGFCKFGPNCKFDHP 325



 Score = 67.0 bits (162), Expect = 5e-10
 Identities = 34/106 (32%), Positives = 48/106 (45%)
 Frame = -3

Query: 955 SKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTF 776
           ++GL     + +C F++ TG+CKYG  C+Y+HP             V +  P  SL   F
Sbjct: 247 NRGLSESSDQPECRFFMNTGTCKYGDDCKYSHP------------GVRISQPPPSLINPF 294

Query: 775 DPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPL 638
                         + P RPGQ  C  +   G CKFG  C+F HP+
Sbjct: 295 --------------VLPARPGQPACGNFRSYGFCKFGPNCKFDHPM 326



>gb:ATAC011623_1543321 Arabidopsis thaliana chromosome III BAC
           F24P17 genomic sequence, complete sequence.
          Length = 437

 Score =  107 bits (267), Expect = 4e-22
 Identities = 61/167 (36%), Positives = 77/167 (46%), Gaps = 1/167 (0%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNPTASLFQTFDPR 767
           P R  E DC +YL+TG C YG+ CR+NHP DR  +        +G V   A         
Sbjct: 27  PERPDEPDCIYYLRTGVCGYGSRCRFNHPRDRGAV--------IGGVRGEAGAL------ 72

Query: 766 LTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNF 587
                        P+R G   C  +M+TG CKFG  C++HHP            G     
Sbjct: 73  -------------PERMGHPVCQHFMRTGTCKFGASCKYHHPRQ------GGGGGSVAPV 113

Query: 586 KLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQ 446
            LS  G P R G   C YY++TG CKFG TC+F+HP P  + G   Q
Sbjct: 114 SLSYLGYPLRPGEKECSYYLRTGQCKFGLTCRFNHPVPLAVQGPPQQ 160



 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 40/83 (48%), Positives = 51/83 (61%)
 Frame = -3

Query: 730 YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG 551
           +PQRP Q EC ++M+TG+CKFG  CR+HHP+D     T  +        LS  GLP R G
Sbjct: 279 FPQRPDQPECQYFMRTGDCKFGSSCRYHHPVDAVPPKTGIV--------LSSIGLPLRPG 330

Query: 550 AIHCPYYMKTGICKFGATCKFDH 482
              C ++ + GICKFG  CKFDH
Sbjct: 331 VAQCTHFAQHGICKFGPACKFDH 353



 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 41/102 (40%), Positives = 60/102 (58%)
 Frame = -3

Query: 730 YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG 551
           YP+RP + +C +Y++TG C +G RCRF+HP D   +V   + GE          LP R G
Sbjct: 26  YPERPDEPDCIYYLRTGVCGYGSRCRFNHPRDRG-AVIGGVRGE-------AGALPERMG 77

Query: 550 AIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVG 425
              C ++M+TG CKFGA+CK+ HP  G   G  + V+ + +G
Sbjct: 78  HPVCQHFMRTGTCKFGASCKYHHPRQGGGGGSVAPVSLSYLG 119



 Score = 79.0 bits (193), Expect = 1e-13
 Identities = 37/118 (31%), Positives = 61/118 (51%)
 Frame = -3

Query: 946 LPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPR 767
           LP R+G   C  +++TG+CK+GA+C+Y+HP +       A +++  +             
Sbjct: 72  LPERMGHPVCQHFMRTGTCKFGASCKYHHPRQGGGGGSVAPVSLSYLG------------ 119

Query: 766 LTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ 593
                       YP RPG+ EC +Y++TG+CKFG  CRF+HP+  ++        +QQ
Sbjct: 120 ------------YPLRPGEKECSYYLRTGQCKFGLTCRFNHPVPLAVQGPPQQPQQQQ 165



 Score = 69.7 bits (169), Expect = 8e-11
 Identities = 55/197 (27%), Positives = 74/197 (37%), Gaps = 40/197 (20%)
 Frame = -3

Query: 949 GLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDP 770
           G P+R GE +C +YL+TG CK+G TCR+NHP    +  P          P   L QT  P
Sbjct: 119 GYPLRPGEKECSYYLRTGQCKFGLTCRFNHPVPLAVQGPPQQPQQQQPQPQPQL-QTIYP 177

Query: 769 RLTQ-------------TMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHS 629
            L               T   F T  Y Q P        +  G   +       +P   S
Sbjct: 178 TLQSQSIPSSQQYGLVLTRPSFLTGSYLQSP--YGPPMVLPPGMVPYSG----WNPYQAS 231

Query: 628 LSVTSSMEGEQQNFKLSLAGL---------------------------PRREGAIHCPYY 530
           LS   S   +      S+ GL                           P+R     C Y+
Sbjct: 232 LSAMPSPGTQPSIGSSSIYGLTPLSPSATAYTGTYQSVPSSNSTSKEFPQRPDQPECQYF 291

Query: 529 MKTGICKFGATCKFDHP 479
           M+TG CKFG++C++ HP
Sbjct: 292 MRTGDCKFGSSCRYHHP 308



 Score = 67.8 bits (164), Expect = 3e-10
 Identities = 37/115 (32%), Positives = 55/115 (47%)
 Frame = -3

Query: 955 SKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTF 776
           SK  P R  + +C ++++TG CK+G++CRY+HP      PP      G+V  +  L    
Sbjct: 276 SKEFPQRPDQPECQYFMRTGDCKFGSSCRYHHP--VDAVPP----KTGIVLSSIGL---- 325

Query: 775 DPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSS 611
                           P RPG  +C  + + G CKFG  C+F H +  SLS + S
Sbjct: 326 ----------------PLRPGVAQCTHFAQHGICKFGPACKFDHSMSSSLSYSPS 364



 Score = 37.0 bits (84), Expect = 0.58
 Identities = 13/33 (39%), Positives = 21/33 (63%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNH 860
           +S GLP+R G   C  + + G CK+G  C+++H
Sbjct: 321 SSIGLPLRPGVAQCTHFAQHGICKFGPACKFDH 353



>gb:BT010886_1640832 Arabidopsis thaliana At5g18550 gene, complete
           cds.
          Length = 465

 Score =  105 bits (261), Expect = 2e-21
 Identities = 64/176 (36%), Positives = 81/176 (46%), Gaps = 3/176 (1%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRL 764
           P R  E DC +YL+TG C YG+ CR+NHP       P     +G +   A  F       
Sbjct: 49  PERPDEPDCIYYLRTGVCGYGSRCRFNHPRN---RAPV----LGGLRTEAGEF------- 94

Query: 763 TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL--SVTSSMEGEQQN 590
                       P+R GQ  C  +M+TG CKFG  C++HHP       SVT         
Sbjct: 95  ------------PERMGQPVCQHFMRTGTCKFGASCKYHHPRQGGGGDSVTP-------- 134

Query: 589 FKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP-PPGELIGGTSQVTSTSVG 425
             L+  G P R G   C Y+M+TG CKFG+TC++ HP PPG       Q    S G
Sbjct: 135 VSLNYMGFPLRPGEKECSYFMRTGQCKFGSTCRYHHPVPPGVQAPSQQQQQQLSAG 190



 Score = 94.0 bits (232), Expect = 4e-18
 Identities = 41/83 (49%), Positives = 54/83 (65%)
 Frame = -3

Query: 730 YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG 551
           +PQRP Q EC ++M+TG+CKFG  CRFHHP++ +    S+         LS  GLP R G
Sbjct: 297 FPQRPEQPECQYFMRTGDCKFGTSCRFHHPMEAASPEAST---------LSHIGLPLRPG 347

Query: 550 AIHCPYYMKTGICKFGATCKFDH 482
           A+ C ++ + GICKFG  CKFDH
Sbjct: 348 AVPCTHFAQHGICKFGPACKFDH 370



 Score = 83.2 bits (204), Expect = 7e-15
 Identities = 40/101 (39%), Positives = 58/101 (57%)
 Frame = -3

Query: 730 YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG 551
           +P+RP + +C +Y++TG C +G RCRF+HP + +  V   +  E   F       P R G
Sbjct: 48  FPERPDEPDCIYYLRTGVCGYGSRCRFNHPRNRA-PVLGGLRTEAGEF-------PERMG 99

Query: 550 AIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSV 428
              C ++M+TG CKFGA+CK+ HP  G   GG   VT  S+
Sbjct: 100 QPVCQHFMRTGTCKFGASCKYHHPRQG---GGGDSVTPVSL 137



 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 52/198 (26%), Positives = 81/198 (40%), Gaps = 38/198 (19%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPA----AHLNVGVVNPTAS 791
           N  G P+R GE +C ++++TG CK+G+TCRY+HP    +  P+      L+ G     + 
Sbjct: 138 NYMGFPLRPGEKECSYFMRTGQCKFGSTCRYHHPVPPGVQAPSQQQQQQLSAGPTMYPSL 197

Query: 790 LFQTFD-----------PRL-----TQTMFGFATTIYPQRPGQVECDFY----------- 692
             QT             P+L      Q+ +G+   + P  PG V    +           
Sbjct: 198 QSQTVPSSQQYGVVLARPQLLPGSYVQSPYGYGQMVLP--PGMVPYSGWNPYQASVSAMP 255

Query: 691 -------MKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPY 533
                  M T             P   S   ++ +  ++Q F       P+R     C Y
Sbjct: 256 SPGTQPSMGTSSVYGITPLSPSAPAYQSGPSSTGVSNKEQTF-------PQRPEQPECQY 308

Query: 532 YMKTGICKFGATCKFDHP 479
           +M+TG CKFG +C+F HP
Sbjct: 309 FMRTGDCKFGTSCRFHHP 326



 Score = 59.7 bits (143), Expect = 8e-08
 Identities = 33/105 (31%), Positives = 49/105 (46%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRL 764
           P R  + +C ++++TG CK+G +CR++HP             +   +P AS         
Sbjct: 298 PQRPEQPECQYFMRTGDCKFGTSCRFHHP-------------MEAASPEAS--------- 335

Query: 763 TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHS 629
           T +  G      P RPG V C  + + G CKFG  C+F H L  S
Sbjct: 336 TLSHIGL-----PLRPGAVPCTHFAQHGICKFGPACKFDHSLGSS 375



 Score = 38.1 bits (87), Expect = 0.26
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 3/63 (4%)
 Frame = -3

Query: 949 GLPIRLGEVDCPFYLKTGSCKYGATCRYNH---PDRYTINPPAAHLNVGVVNPTASLFQT 779
           GLP+R G V C  + + G CK+G  C+++H       + +P  + L    V P  S   T
Sbjct: 341 GLPLRPGAVPCTHFAQHGICKFGPACKFDHSLGSSSLSYSPSPSSLTDMPVAPYPSSLGT 400

Query: 778 FDP 770
             P
Sbjct: 401 LAP 403



>gb:AP003451_1829650 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0413C03.
          Length = 322

 Score = 96.7 bits (239), Expect = 6e-19
 Identities = 43/85 (50%), Positives = 53/85 (62%)
 Frame = -3

Query: 733 IYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRRE 554
           ++P+RP Q EC +YMKTG+CKFG  C+FHHP   S+     +        LS  GLP R 
Sbjct: 211 VFPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSMPTPDCV--------LSPVGLPLRP 262

Query: 553 GAIHCPYYMKTGICKFGATCKFDHP 479
           G   C +Y + GICKFGA CKFDHP
Sbjct: 263 GEELCKFYSRYGICKFGANCKFDHP 287



 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 40/84 (47%), Positives = 50/84 (59%)
 Frame = -3

Query: 730 YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG 551
           YP+R GQ EC +Y+KTG CKFG  C+FHHP + +        G     +L+  G P R  
Sbjct: 5   YPERMGQPECQYYLKTGTCKFGPTCKFHHPREKA--------GIAGRVQLNTLGYPLRPS 56

Query: 550 AIHCPYYMKTGICKFGATCKFDHP 479
              C YY+KTG CK+G TCKF HP
Sbjct: 57  EKECAYYLKTGQCKYGNTCKFHHP 80



 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 37/101 (36%), Positives = 52/101 (51%)
 Frame = -3

Query: 943 PIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRL 764
           P R+G+ +C +YLKTG+CK+G TC+++HP           LN                  
Sbjct: 6   PERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLN------------------ 47

Query: 763 TQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHP 641
                   T  YP RP + EC +Y+KTG+CK+G  C+FHHP
Sbjct: 48  --------TLGYPLRPSEKECAYYLKTGQCKYGNTCKFHHP 80



 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 58/199 (29%), Positives = 79/199 (39%), Gaps = 39/199 (19%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRY-------------------TINP 836
           N+ G P+R  E +C +YLKTG CKYG TC+++HP+ +                   T  P
Sbjct: 47  NTLGYPLRPSEKECAYYLKTGQCKYGNTCKFHHPELFNAMASSRGSPIYPSVHSSATAGP 106

Query: 835 PAAHLNVGVVNPTASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECK--FGE 662
           P          P  S   +  PR  Q    +A  I PQ   QV   +   TG+       
Sbjct: 107 PYTGTMASWAFPRGSFIPS--PR-WQNPSNYAPMIVPQGLVQVP-SWNSYTGQMMPVSSS 162

Query: 661 RCRFHHP-------LDHSLSVTSSMEGEQQNFKLSLAGLPR-----------REGAIHCP 536
             R   P           +  ++  +G    ++ S   +P+           R     C 
Sbjct: 163 ESRLQSPGAQQTYGTSQQVDASAGNQGMLSPYRSSSYPVPQYALQRENVFPERPDQPECQ 222

Query: 535 YYMKTGICKFGATCKFDHP 479
           YYMKTG CKFGA CKF HP
Sbjct: 223 YYMKTGDCKFGAVCKFHHP 241



 Score = 66.6 bits (161), Expect = 7e-10
 Identities = 34/108 (31%), Positives = 49/108 (45%)
 Frame = -3

Query: 964 LHNSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLF 785
           L      P R  + +C +Y+KTG CK+GA C+++HP   ++  P       V++P     
Sbjct: 206 LQRENVFPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSMPTPDC-----VLSPVG--- 257

Query: 784 QTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHP 641
                              P RPG+  C FY + G CKFG  C+F HP
Sbjct: 258 ------------------LPLRPGEELCKFYSRYGICKFGANCKFDHP 287



 Score = 50.4 bits (119), Expect = 5e-05
 Identities = 22/43 (51%), Positives = 25/43 (58%)
 Frame = -3

Query: 565 PRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTS 437
           P R G   C YY+KTG CKFG TCKF HP     I G  Q+ +
Sbjct: 6   PERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNT 48



 Score = 47.4 bits (111), Expect = 4e-04
 Identities = 27/67 (40%), Positives = 39/67 (58%), Gaps = 12/67 (17%)
 Frame = -3

Query: 949 GLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPP-------AAHLNVGVV----- 806
           GLP+R GE  C FY + G CK+GA C+++HP   T+ PP       +A  NV +V     
Sbjct: 257 GLPLRPGEELCKFYSRYGICKFGANCKFDHP---TMAPPMGVYAYGSASTNVPMVRRLLQ 313

Query: 805 NPTASLF 785
           +P+AS +
Sbjct: 314 SPSASAY 320



>gb:AY573063_1615759 Oryza sativa (japonica cultivar-group)
           zinc-finger transcription factor (Zinc) mRNA, complete
           cds.>gb:AY620413_1618335 Oryza sativa (japonica
           cultivar-group) clone P0462H08 zinc finger protein mRNA,
           complete cds.
          Length = 207

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 34/84 (40%), Positives = 52/84 (61%)
 Frame = -3

Query: 730 YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG 551
           +P+RPGQ +C +YM+TG+CKFG  C++HHP +        +   +  + ++   LP R G
Sbjct: 35  FPERPGQPDCQYYMRTGDCKFGATCKYHHPRE--------LSAPKSGYMVNSLCLPLRPG 86

Query: 550 AIHCPYYMKTGICKFGATCKFDHP 479
           A  C YY + G C++G  CK+DHP
Sbjct: 87  AQPCAYYAQNGYCRYGVACKYDHP 110



 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 34/104 (32%), Positives = 52/104 (50%)
 Frame = -3

Query: 949 GLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDP 770
           G P R G+ DC +Y++TG CK+GATC+Y+HP R    P + ++    VN           
Sbjct: 34  GFPERPGQPDCQYYMRTGDCKFGATCKYHHP-RELSAPKSGYM----VN----------- 77

Query: 769 RLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPL 638
                     +   P RPG   C +Y + G C++G  C++ HP+
Sbjct: 78  ----------SLCLPLRPGAQPCAYYAQNGYCRYGVACKYDHPM 111



 Score = 51.2 bits (121), Expect = 3e-05
 Identities = 20/31 (64%), Positives = 22/31 (70%)
 Frame = -3

Query: 571 GLPRREGAIHCPYYMKTGICKFGATCKFDHP 479
           G P R G   C YYM+TG CKFGATCK+ HP
Sbjct: 34  GFPERPGQPDCQYYMRTGDCKFGATCKYHHP 64



 Score = 43.9 bits (102), Expect = 0.005
 Identities = 16/34 (47%), Positives = 22/34 (64%)
 Frame = -3

Query: 958 NSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHP 857
           NS  LP+R G   C +Y + G C+YG  C+Y+HP
Sbjct: 77  NSLCLPLRPGAQPCAYYAQNGYCRYGVACKYDHP 110



>gb:CCCTH1_2568343 C.carpio mRNA for CTH1 protein.
          Length = 327

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 48/166 (28%), Positives = 66/166 (39%), Gaps = 5/166 (3%)
 Frame = -3

Query: 919 CPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFA 740
           C  Y +TG+CKY   C++ H   + ++ P+ H            + T    +  T   F 
Sbjct: 63  CSRYAETGTCKYAERCQFAH-GLHDLHVPSRHPKYKT--ELCRTYHTAGYCVYGTRCLFV 119

Query: 739 TTIYPQRPGQ-----VECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSL 575
             +  QRP +     V C  +   G C FG RC F H    S S     E   Q    S 
Sbjct: 120 HNLKEQRPVRQRCRNVPCRTFRAFGVCPFGTRCHFLHVEGGSESDGGEEEQTCQPMSQSQ 179

Query: 574 AGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTS 437
              PR  GA+ C  +   G C +G  C+F H  P  + G  S  TS
Sbjct: 180 EWKPR--GAL-CRTFSAFGFCLYGTRCRFQHGLPNSIKGVNSTHTS 222



>gb:DRE249490_2571035 Danio rerio mRNA for putative zinc finger
           protein (zfCth1 gene).
          Length = 319

 Score = 57.8 bits (138), Expect = 3e-07
 Identities = 47/166 (28%), Positives = 66/166 (39%), Gaps = 5/166 (3%)
 Frame = -3

Query: 919 CPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFA 740
           C  Y +TG+CKY   C++ H   + ++ P+ H            + T    +  T   F 
Sbjct: 65  CSRYAETGTCKYAERCQFAH-GLHDLHVPSRHPK--YKTELCRTYHTAGYCVYGTRCLFV 121

Query: 739 TTIYPQRP-----GQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSL 575
             +  QRP       V C  +   G C FG RC F H    S S  +  E   Q    S 
Sbjct: 122 HNLKEQRPIRPRRRNVPCRTFRAFGVCPFGNRCHFLHVEGGSESDGAEEEQTWQPPSQSQ 181

Query: 574 AGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTS 437
              PR  GA+ C  +   G C +G  C+F H  P  + G  +  TS
Sbjct: 182 EWKPR--GAL-CRTFSAFGFCLYGTRCRFQHGLPNTIKGHNANHTS 224



>gb:DRY17841_2571408 Danio rerio mRNA for putative zinc finger
           protein.
          Length = 308

 Score = 56.6 bits (135), Expect = 7e-07
 Identities = 47/166 (28%), Positives = 66/166 (39%), Gaps = 5/166 (3%)
 Frame = -3

Query: 919 CPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFA 740
           C  Y +TG+CKY   C++ H   + ++ P+ H            + T    +  T   F 
Sbjct: 54  CSRYAETGTCKYAERCQFAH-GLHDLHVPSRHPK--YKTELCRTYHTAGYCVYGTRCLFV 110

Query: 739 TTIYPQRP-----GQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSL 575
             +  QRP       V C  +   G C FG RC F H    S S  +  E   Q    S 
Sbjct: 111 HNLKEQRPIRPRRRNVPCRTFRAFGVCPFGTRCHFLHVEGGSESDGAEEEQTWQPPSQSQ 170

Query: 574 AGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTS 437
              PR  GA+ C  +   G C +G  C+F H  P  + G  +  TS
Sbjct: 171 EWKPR--GAL-CRTFSAFGFCLYGTRCRFQHGLPNTIKGHHANHTS 213



>gb:BT004106_1637207 Arabidopsis thaliana clone RAFL15-27-H11
           (R20987) unknown protein (At2g47850) mRNA, partial cds.
          Length = 151

 Score = 53.5 bits (127), Expect = 6e-06
 Identities = 22/38 (57%), Positives = 26/38 (68%)
 Frame = -3

Query: 592 NFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP 479
           N  LS  GLP R G   C +Y++ G CKFG+TCKFDHP
Sbjct: 7   NCVLSPIGLPLRPGVQRCTFYVQNGFCKFGSTCKFDHP 44



 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 22/51 (43%), Positives = 31/51 (60%), Gaps = 1/51 (1%)
 Frame = -3

Query: 949 GLPIRLGEVDCPFYLKTGSCKYGATCRYNHP-DRYTINPPAAHLNVGVVNP 800
           GLP+R G   C FY++ G CK+G+TC+++HP      NP A+ L    V P
Sbjct: 14  GLPLRPGVQRCTFYVQNGFCKFGSTCKFDHPMGTIRYNPSASSLADAPVAP 64



 Score = 44.3 bits (103), Expect = 0.004
 Identities = 16/30 (53%), Positives = 20/30 (66%)
 Frame = -3

Query: 727 PQRPGQVECDFYMKTGECKFGERCRFHHPL 638
           P RPG   C FY++ G CKFG  C+F HP+
Sbjct: 16  PLRPGVQRCTFYVQNGFCKFGSTCKFDHPM 45



>pir|B86419|B86419 probable zinc finger protein, 86473-88078
           [imported] - Arabidopsis thaliana>gb:AE005172_891810
           Arabidopsis thaliana chromosome 1, top arm complete
           sequence.>gb:AC068667_1540462 Arabidopsis thaliana
           chromosome 1 BAC F15D2 genomic sequence, complete
           sequence.
          Length = 287

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 32/101 (31%), Positives = 44/101 (43%), Gaps = 1/101 (0%)
 Frame = -3

Query: 778 FDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGE 599
           FD R   +     ++ YP RPG+  C FYMK   C++G  C ++HP              
Sbjct: 112 FDGRTQWSHAPVLSSAYPVRPGEDNCLFYMKNHLCEWGSECCYNHP-------------- 157

Query: 598 QQNFKLSLAGLPRREG-AIHCPYYMKTGICKFGATCKFDHP 479
                  L  +P R G  + C    K G CK G+ C F+HP
Sbjct: 158 ------PLQEIPCRIGKKLDC----KAGACKRGSNCPFNHP 188



 Score = 43.9 bits (102), Expect = 0.005
 Identities = 30/106 (28%), Positives = 40/106 (37%), Gaps = 1/106 (0%)
 Frame = -3

Query: 955 SKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTF 776
           S   P+R GE +C FY+K   C++G+ C YNHP    I                      
Sbjct: 125 SSAYPVRPGEDNCLFYMKNHLCEWGSECCYNHPPLQEI---------------------- 162

Query: 775 DPRLTQTMFGFATTIYPQRPG-QVECDFYMKTGECKFGERCRFHHP 641
                           P R G +++C    K G CK G  C F+HP
Sbjct: 163 ----------------PCRIGKKLDC----KAGACKRGSNCPFNHP 188



 Score = 38.5 bits (88), Expect = 0.20
 Identities = 14/34 (41%), Positives = 23/34 (67%)
 Frame = -3

Query: 565 PRREGAIHCPYYMKTGICKFGATCKFDHPPPGEL 464
           P R G  +C +YMK  +C++G+ C ++HPP  E+
Sbjct: 129 PVRPGEDNCLFYMKNHLCEWGSECCYNHPPLQEI 162



>pir|T19155|T19155 hypothetical protein C09G9.6 - Caenorhabditis
           elegans>gb:CEC09G9_1360307 Caenorhabditis elegans cosmid
           C09G9, complete sequence.>gb:CEC27B7_1360711
           Caenorhabditis elegans cosmid C27B7, complete sequence.
          Length = 407

 Score = 51.2 bits (121), Expect = 3e-05
 Identities = 34/112 (30%), Positives = 45/112 (40%)
 Frame = -3

Query: 805 NPTASLFQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSL 626
           N  A  FQ FDPR      G A    P+    V C  ++++  C F + CRF H  +  L
Sbjct: 88  NQVAPPFQQFDPRRR----GLARMQKPESYKTVICQAWLESKTCSFADNCRFAHG-EEEL 142

Query: 625 SVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPPPG 470
             T     +   +K  L           C  Y  TG+C +G  C F HP  G
Sbjct: 143 RPTFVEPLQNNKYKTKL-----------CDKYTTTGLCPYGKRCLFIHPDHG 183



>pir|G86418|G86418 probable zinc finger protein, 78337-80281
           [imported] - Arabidopsis thaliana>gb:AE005172_891807
           Arabidopsis thaliana chromosome 1, top arm complete
           sequence.>gb:AC068667_1540459 Arabidopsis thaliana
           chromosome 1 BAC F15D2 genomic sequence, complete
           sequence.
          Length = 321

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 18/36 (50%), Positives = 25/36 (69%)
 Frame = -3

Query: 964 LHNSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHP 857
           +  S   P+R G+ DC FYLK G C+Y ++CR+NHP
Sbjct: 46  MRQSSPYPVRPGKKDCQFYLKNGLCRYRSSCRFNHP 81



 Score = 47.0 bits (110), Expect = 6e-04
 Identities = 16/30 (53%), Positives = 22/30 (73%)
 Frame = -3

Query: 730 YPQRPGQVECDFYMKTGECKFGERCRFHHP 641
           YP RPG+ +C FY+K G C++   CRF+HP
Sbjct: 52  YPVRPGKKDCQFYLKNGLCRYRSSCRFNHP 81



 Score = 38.9 bits (89), Expect = 0.15
 Identities = 12/29 (41%), Positives = 21/29 (72%)
 Frame = -3

Query: 565 PRREGAIHCPYYMKTGICKFGATCKFDHP 479
           P R G   C +Y+K G+C++ ++C+F+HP
Sbjct: 53  PVRPGKKDCQFYLKNGLCRYRSSCRFNHP 81



>pir|T31491|T31491 hypothetical protein Y116A8C.19 - Caenorhabditis
           elegans>gb:CEY116A8C_1369380 Caenorhabditis elegans YAC
           Y116A8C, complete sequence.
          Length = 196

 Score = 47.0 bits (110), Expect = 6e-04
 Identities = 28/94 (29%), Positives = 44/94 (46%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C F  +  +C +GE+C+F H + H L  T + +   +N+K  L           C  +  
Sbjct: 89  CGFQRRGQKCIYGEQCKFAHSV-HELRFTQAKK-THRNYKTVL-----------CDKFST 135

Query: 523 TGICKFGATCKFDHPPPGELIGGTSQVTSTSVGE 422
           TG CK+GA C+F H      +G TS   S  + +
Sbjct: 136 TGYCKYGARCQFIH----RALGSTSTTESAEMAD 165



 Score = 38.1 bits (87), Expect = 0.26
 Identities = 20/45 (44%), Positives = 26/45 (57%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSL 575
           V CD +  TG CK+G RC+F H    S S T S   E  +FKL++
Sbjct: 128 VLCDKFSTTGYCKYGARCQFIHRALGSTSTTES--AEMADFKLNV 170



>gb:AF061983_2471356 Xenopus laevis CCCH zinc finger protein C3H-4
           (C3H-4) mRNA, complete cds.
          Length = 276

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 36/168 (21%), Positives = 56/168 (33%)
 Frame = -3

Query: 919 CPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFA 740
           C  +   G+C YG  C + H  +    PP    N+ +            PR     +G  
Sbjct: 89  CRSFHVLGTCNYGLRCLFIHSPQERREPPVLPDNLSL-----------PPR----RYG-- 131

Query: 739 TTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPR 560
                  P +  C  +   G C +G RC F HP                           
Sbjct: 132 ------GPYRERCRLWSAPGGCPYGARCHFQHP--------------------------- 158

Query: 559 REGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEE 416
           +     C ++   G C +GA C F H PP +  G  ++ +S S+   +
Sbjct: 159 KSARETCRHFAALGDCPYGACCHFSHSPPLDRWGSGTKNSSGSLSPSD 206



>gb:AY736015_1348806 Caenorhabditis briggsae POS-1 (pos-1b) mRNA,
           complete cds.
          Length = 263

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 23/74 (31%), Positives = 35/74 (47%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           CD Y ++  C +GE+CRF H + H L +     G            P+ +  + C  +  
Sbjct: 106 CDSYKRSATCSYGEQCRFAHGV-HELRLPQHPRGRNH---------PKYK-TVLCDKFST 154

Query: 523 TGICKFGATCKFDH 482
           TG CK+G  C+F H
Sbjct: 155 TGNCKYGTRCQFIH 168



 Score = 37.0 bits (84), Expect = 0.58
 Identities = 27/94 (28%), Positives = 36/94 (38%)
 Frame = -3

Query: 919 CPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFA 740
           C  Y ++ +C YG  CR+ H               GV           + RL Q   G  
Sbjct: 106 CDSYKRSATCSYGEQCRFAH---------------GV----------HELRLPQHPRGRN 140

Query: 739 TTIYPQRPGQVECDFYMKTGECKFGERCRFHHPL 638
              Y      V CD +  TG CK+G RC+F H +
Sbjct: 141 HPKYKT----VLCDKFSTTGNCKYGTRCQFIHKI 170



>gb:AY736014_1348805 Caenorhabditis briggsae POS-1 (pos-1a) mRNA,
           complete cds.
          Length = 271

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 23/74 (31%), Positives = 36/74 (48%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           CD Y ++  C +GE+CRF H + H L +  +  G            P+ +  + C  +  
Sbjct: 106 CDSYKRSQTCSYGEQCRFAHGV-HELRLPQNPRGRNH---------PKYK-TVLCDKFST 154

Query: 523 TGICKFGATCKFDH 482
           TG CK+G  C+F H
Sbjct: 155 TGNCKYGTRCQFIH 168



 Score = 37.0 bits (84), Expect = 0.58
 Identities = 27/94 (28%), Positives = 36/94 (38%)
 Frame = -3

Query: 919 CPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFA 740
           C  Y ++ +C YG  CR+ H               GV           + RL Q   G  
Sbjct: 106 CDSYKRSQTCSYGEQCRFAH---------------GV----------HELRLPQNPRGRN 140

Query: 739 TTIYPQRPGQVECDFYMKTGECKFGERCRFHHPL 638
              Y      V CD +  TG CK+G RC+F H +
Sbjct: 141 HPKYKT----VLCDKFSTTGNCKYGTRCQFIHKI 170



 Score = 33.5 bits (75), Expect = 6.5
 Identities = 15/42 (35%), Positives = 22/42 (52%)
 Frame = -3

Query: 919 CPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTA 794
           C  +  TG+CKYG  C++ H     +NP       G++N TA
Sbjct: 149 CDKFSTTGNCKYGTRCQFIHK---IVNPTLLAQESGILNNTA 187



>gb:CR382132_1664936 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 210

 Score = 43.9 bits (102), Expect = 0.005
 Identities = 16/38 (42%), Positives = 25/38 (65%)
 Frame = -3

Query: 715 GQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEG 602
           G  +C F+MKTG+C+FG++CRF H    + +  S+  G
Sbjct: 118 GPKKCSFFMKTGKCRFGDKCRFSHDKSGATATGSASSG 155



 Score = 37.7 bits (86), Expect = 0.34
 Identities = 14/38 (36%), Positives = 21/38 (55%)
 Frame = -3

Query: 562 RREGAIHCPYYMKTGICKFGATCKFDHPPPGELIGGTS 449
           +  G   C ++MKTG C+FG  C+F H   G    G++
Sbjct: 115 KESGPKKCSFFMKTGKCRFGDKCRFSHDKSGATATGSA 152



 Score = 35.4 bits (80), Expect = 1.7
 Identities = 11/24 (45%), Positives = 17/24 (70%)
 Frame = -3

Query: 931 GEVDCPFYLKTGSCKYGATCRYNH 860
           G   C F++KTG C++G  CR++H
Sbjct: 118 GPKKCSFFMKTGKCRFGDKCRFSH 141



>pir|T37246|T37246 probable transcription factor pos-1 -
           Caenorhabditis elegans>gb:AB006208_1192969
           Caenorhabditis elegans pos-1 mRNA for cytoplasmic
           zinc-finger protein, complete cds.>gb:U41109_1403838
           Caenorhabditis elegans cosmid F52E1, complete sequence.
          Length = 264

 Score = 43.9 bits (102), Expect = 0.005
 Identities = 22/74 (29%), Positives = 36/74 (48%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           CD Y ++  C +G++CRF H + H L +  +  G            P+ +  + C  +  
Sbjct: 104 CDAYKRSQACSYGDQCRFAHGV-HELRLPMNPRGRNH---------PKYK-TVLCDKFSM 152

Query: 523 TGICKFGATCKFDH 482
           TG CK+G  C+F H
Sbjct: 153 TGNCKYGTRCQFIH 166



 Score = 34.7 bits (78), Expect = 2.9
 Identities = 23/94 (24%), Positives = 33/94 (35%)
 Frame = -3

Query: 919 CPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFA 740
           C  Y ++ +C YG  CR+ H       P         +NP       +   L        
Sbjct: 104 CDAYKRSQACSYGDQCRFAHGVHELRLP---------MNPRGRNHPKYKTVL-------- 146

Query: 739 TTIYPQRPGQVECDFYMKTGECKFGERCRFHHPL 638
                       CD +  TG CK+G RC+F H +
Sbjct: 147 ------------CDKFSMTGNCKYGTRCQFIHKI 168



>gb:BC083870_2108932 Rattus norvegicus makorin, ring finger protein,
           2 (predicted), mRNA (cDNA clone MGC:95133
           IMAGE:7128406), complete cds.
          Length = 417

 Score = 43.5 bits (101), Expect = 0.006
 Identities = 27/86 (31%), Positives = 35/86 (40%)
 Frame = -3

Query: 712 QVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPY 533
           QV C ++M  G C+ G +C F H L +S   T                         C Y
Sbjct: 5   QVTCRYFMH-GVCREGSQCLFSHDLANSKPSTI------------------------CKY 39

Query: 532 YMKTGICKFGATCKFDHPPPGELIGG 455
           Y K G C +GA C++DH  P    GG
Sbjct: 40  YQK-GYCAYGARCRYDHTKPPAAAGG 64



>gb:OSJN00095_1694820 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0004A17, complete sequence.
          Length = 711

 Score = 43.5 bits (101), Expect = 0.006
 Identities = 40/140 (28%), Positives = 55/140 (39%), Gaps = 21/140 (15%)
 Frame = -3

Query: 922 DCPFYLKTG-SCKYGATCRYNHPDRYTINPPAAH--LNVGVVNPTASLFQTFDPRLTQTM 752
           DC ++L +  +CK G  C + H D   +NP      LN   +NP       F       M
Sbjct: 36  DCVYFLASPLTCKKGNECDFRHSDNARMNPRDCWYWLNSNCLNPKCP----FRHPPIDGM 91

Query: 751 FGFATTIYPQRPGQ----------VECDFYMKTGECKFGERCRFHH--------PLDHSL 626
           FG  TT  P               V C +Y K G C  G+RC F+H        P +  +
Sbjct: 92  FGAPTTGMPAVSSHYAPFNSGKQLVPC-YYFKKGNCLKGDRCAFYHGPQSVGNNPSEQVV 150

Query: 625 SVTSSMEGEQQNFKLSLAGL 566
            V+S    + Q  K  L G+
Sbjct: 151 KVSSLPLEQLQTQKNDLLGI 170



>gb:AK011295_1156310 Mus musculus 10 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2610002L04
           product:makorin, ring finger protein, 2, full insert
           sequence.>gb:AK077926_1172119 Mus musculus 13 days
           embryo male testis cDNA, RIKEN full-length enriched
           library, clone:6030446P03 product:makorin, ring finger
           protein, 2, full insert sequence.>gb:BC025547_2095060
           Mus musculus makorin, ring finger protein, 2, mRNA (cDNA
           clone MGC:35811 IMAGE:5320887), complete cds.
          Length = 416

 Score = 43.5 bits (101), Expect = 0.006
 Identities = 27/86 (31%), Positives = 35/86 (40%)
 Frame = -3

Query: 712 QVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPY 533
           QV C ++M  G C+ G +C F H L +S   T                         C Y
Sbjct: 5   QVTCRYFMH-GVCREGSQCLFSHDLANSKPSTI------------------------CKY 39

Query: 532 YMKTGICKFGATCKFDHPPPGELIGG 455
           Y K G C +GA C++DH  P    GG
Sbjct: 40  YQK-GYCAYGARCRYDHTKPPAAAGG 64



>gb:AK009515_1155185 Mus musculus adult male tongue cDNA, RIKEN
           full-length enriched library, clone:2310026N20
           product:makorin, ring finger protein, 2, full insert
           sequence.
          Length = 363

 Score = 43.5 bits (101), Expect = 0.006
 Identities = 27/86 (31%), Positives = 35/86 (40%)
 Frame = -3

Query: 712 QVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPY 533
           QV C ++M  G C+ G +C F H L +S   T                         C Y
Sbjct: 5   QVTCRYFMH-GVCREGSQCLFSHDLANSKPSTI------------------------CKY 39

Query: 532 YMKTGICKFGATCKFDHPPPGELIGG 455
           Y K G C +GA C++DH  P    GG
Sbjct: 40  YQK-GYCAYGARCRYDHTKPPAAAGG 64



>sp|Q9ERV1|MKR2_MOUSE Makorin 2.>gb:AF277171_2061264 Mus musculus
           Makorin RING zinc-finger protein 2 (Mkrn2) mRNA,
           complete cds.
          Length = 416

 Score = 43.5 bits (101), Expect = 0.006
 Identities = 27/86 (31%), Positives = 35/86 (40%)
 Frame = -3

Query: 712 QVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPY 533
           QV C ++M  G C+ G +C F H L +S   T                         C Y
Sbjct: 5   QVTCRYFMH-GVCREGSQCLFSHDLANSKPSTI------------------------CKY 39

Query: 532 YMKTGICKFGATCKFDHPPPGELIGG 455
           Y K G C +GA C++DH  P    GG
Sbjct: 40  YQK-GYCAYGARCRYDHTKPPAAAGG 64



>gb:AF277164S7_1894405 Homo sapiens Makorin RING zinc-finger protein
           2 (MKRN2) gene, exons 7, 8 and complete
           cds.>gb:AF302084_1895785 Homo sapiens MAKORIN2 (MKRN2)
           mRNA, complete cds.
          Length = 416

 Score = 42.7 bits (99), Expect = 0.011
 Identities = 27/95 (28%), Positives = 37/95 (38%)
 Frame = -3

Query: 712 QVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPY 533
           Q+ C ++M  G C+ G +C F H L +S   T                         C Y
Sbjct: 5   QITCRYFMH-GVCREGSQCLFSHDLANSKPSTI------------------------CKY 39

Query: 532 YMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSV 428
           Y K G C +G  C++DH  P    GG     + SV
Sbjct: 40  YQK-GYCAYGTRCRYDHTRPSAAAGGAVGTMAHSV 73



>gb:AF161555_1150448 Homo sapiens HSPC070 mRNA, complete cds.
          Length = 416

 Score = 42.7 bits (99), Expect = 0.011
 Identities = 27/95 (28%), Positives = 37/95 (38%)
 Frame = -3

Query: 712 QVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPY 533
           Q+ C ++M  G C+ G +C F H L +S   T                         C Y
Sbjct: 5   QITCRYFMH-GVCREGSQCLFSHDLANSKPSTI------------------------CKY 39

Query: 532 YMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSV 428
           Y K G C +G  C++DH  P    GG     + SV
Sbjct: 40  YQK-GYCAYGTRCRYDHTRPSAAAGGAVGTMAHSV 73



>sp|Q9H000|MKR2_HUMAN Makorin 2 (HSPC070).>gb:BC015715_1975262 Homo
           sapiens makorin, ring finger protein, 2, mRNA (cDNA
           clone MGC:16931 IMAGE:3916199), complete cds.
          Length = 416

 Score = 42.7 bits (99), Expect = 0.011
 Identities = 27/95 (28%), Positives = 37/95 (38%)
 Frame = -3

Query: 712 QVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPY 533
           Q+ C ++M  G C+ G +C F H L +S   T                         C Y
Sbjct: 5   QITCRYFMH-GVCREGSQCLFSHDLANSKPSTI------------------------CKY 39

Query: 532 YMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSV 428
           Y K G C +G  C++DH  P    GG     + SV
Sbjct: 40  YQK-GYCAYGTRCRYDHTRPSAAAGGAVGTMAHSV 73



>gb:AE016818_1747817 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 209

 Score = 42.4 bits (98), Expect = 0.014
 Identities = 27/84 (32%), Positives = 37/84 (44%), Gaps = 3/84 (3%)
 Frame = -3

Query: 706 ECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYM 527
           EC F+ K G C     C++ H +D +  V    +       L  A   +    I CP Y+
Sbjct: 94  ECVFFTKNGYCTQSPECQYLH-IDPTSKVQQCEDYRMGFCPLGTACPCKHVKKIICPKYV 152

Query: 526 KTGICKFGATCKFDHPP---PGEL 464
            TG C  G  C ++HPP   P EL
Sbjct: 153 -TGFCPLGRDCDWEHPPFYVPNEL 175



 Score = 34.3 bits (77), Expect = 3.8
 Identities = 24/94 (25%), Positives = 37/94 (39%)
 Frame = -3

Query: 922 DCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGF 743
           +C F+ K G C     C+Y H                 ++PT+ + Q  D R+     G 
Sbjct: 94  ECVFFTKNGYCTQSPECQYLH-----------------IDPTSKVQQCEDYRMGFCPLGT 136

Query: 742 ATTIYPQRPGQVECDFYMKTGECKFGERCRFHHP 641
           A     +   ++ C  Y+ TG C  G  C + HP
Sbjct: 137 ACPC--KHVKKIICPKYV-TGFCPLGRDCDWEHP 167



>pir|T21620|T21620 hypothetical protein F32A11.6 - Caenorhabditis
           elegans>gb:CEF32A11_1363245 Caenorhabditis elegans
           cosmid F32A11, complete sequence.
          Length = 367

 Score = 42.4 bits (98), Expect = 0.014
 Identities = 28/98 (28%), Positives = 40/98 (40%), Gaps = 14/98 (14%)
 Frame = -3

Query: 730 YPQRPGQVE-------------CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQN 590
           +PQRP + E             C  ++++  C F E CRF H  +      + +E  Q N
Sbjct: 114 FPQRPPRGERRMQKPESYKTVICQAWLESKTCTFAENCRFAHGEEELRP--AKLESRQNN 171

Query: 589 -FKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP 479
            +K  L           C  Y  TG+C +G  C F HP
Sbjct: 172 KYKTKL-----------CDKYTTTGLCPYGKRCLFIHP 198



 Score = 33.9 bits (76), Expect = 4.9
 Identities = 23/71 (32%), Positives = 30/71 (42%), Gaps = 3/71 (4%)
 Frame = -3

Query: 919 CPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVG---VVNPTASLFQTFDPRLTQTMF 749
           C  Y  TG C YG  C + HPD    N P A++       V+   +L    D   +Q M 
Sbjct: 178 CDKYTTTGLCPYGKRCLFIHPD----NQPNAYIRADKLYEVSQRHALADLRDHVESQIMT 233

Query: 748 GFATTIYPQRP 716
           G     Y Q+P
Sbjct: 234 GNTRNSYNQQP 244



>gb:AX971584_1486893 Sequence 2387 from Patent EP1104808.
          Length = 91

 Score = 42.0 bits (97), Expect = 0.018
 Identities = 25/86 (29%), Positives = 34/86 (39%)
 Frame = -3

Query: 712 QVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPY 533
           Q+ C ++M  G C+ G +C F H L +S   T                         C Y
Sbjct: 5   QITCRYFMH-GVCREGSQCLFSHDLANSKPSTI------------------------CKY 39

Query: 532 YMKTGICKFGATCKFDHPPPGELIGG 455
           Y K G C +G  C++DH  P    GG
Sbjct: 40  YQK-GYCAYGTRCRYDHTRPSAAAGG 64



>pir|T28994|T28994 hypothetical protein ZC513.6 - Caenorhabditis
           elegans>gb:U53155_1404885 Caenorhabditis elegans cosmid
           ZC513, complete sequence.
          Length = 393

 Score = 42.0 bits (97), Expect = 0.018
 Identities = 26/87 (29%), Positives = 37/87 (42%), Gaps = 1/87 (1%)
 Frame = -3

Query: 727 PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQN-FKLSLAGLPRREG 551
           P+    V C  ++++  C F E CRF H  +      S +E  Q N ++  L        
Sbjct: 103 PESYKTVICQAWLESKTCAFAENCRFAHGEEELRP--SLIEARQNNKYRTKL-------- 152

Query: 550 AIHCPYYMKTGICKFGATCKFDHPPPG 470
              C  Y  TG+C +G  C F HP  G
Sbjct: 153 ---CDKYTTTGLCPYGKRCLFIHPDNG 176



>gb:AP003308_1827741 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1129G05.
          Length = 698

 Score = 41.6 bits (96), Expect = 0.024
 Identities = 33/118 (27%), Positives = 52/118 (44%), Gaps = 8/118 (6%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHH---PLDHSLSVT-----SSMEGEQQNFKLSLAGLPRREGA 548
           C FY+  G+C+ G  C+F H   PL  S   T     S ++G+   +   L+  P     
Sbjct: 435 CHFYLH-GKCQQGNLCKFSHDTTPLTKSKPCTHYARGSCLKGDDCPYDHELSKYP----- 488

Query: 547 IHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGYAKLVEAIQKQQQ 374
             C  +M+ G+C  G  CKF H  P      T++  ST   ++   + + E    Q+Q
Sbjct: 489 --CHNFMENGMCIRGDKCKFSHVIP------TAEGPSTPDAKKSNASSVPEKANCQEQ 538



>pir|T19760|T19760 hypothetical protein C35D6.4 - Caenorhabditis
           elegans>gb:CEC35D6_1361018 Caenorhabditis elegans cosmid
           C35D6, complete sequence.
          Length = 203

 Score = 41.6 bits (96), Expect = 0.024
 Identities = 22/74 (29%), Positives = 36/74 (48%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C F+ +  +C +GE+C+F H + H L    + +   +N+K  L           C  +  
Sbjct: 94  CGFHRRGQKCAYGEKCKFAHSV-HELRFPQT-KRNHRNYKTVL-----------CNNFST 140

Query: 523 TGICKFGATCKFDH 482
           TG CK+G  C+F H
Sbjct: 141 TGHCKYGIRCQFIH 154



 Score = 36.6 bits (83), Expect = 0.76
 Identities = 26/116 (22%), Positives = 45/116 (38%), Gaps = 1/116 (0%)
 Frame = -3

Query: 919 CPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFA 740
           C F+ +   C YG  C++ H                      S+ +   P+  +    + 
Sbjct: 94  CGFHRRGQKCAYGEKCKFAH----------------------SVHELRFPQTKRNHRNYK 131

Query: 739 TTIYPQRPGQVECDFYMKTGECKFGERCRF-HHPLDHSLSVTSSMEGEQQNFKLSL 575
           T +         C+ +  TG CK+G RC+F H  +D   S +S+   E +N  + L
Sbjct: 132 TVL---------CNNFSTTGHCKYGIRCQFIHRSMD---STSSNQSNETENITIDL 175



>pir|T21963|T21963 hypothetical protein F38C2.7 - Caenorhabditis
           elegans>gb:CEF38C2_1363629 Caenorhabditis elegans cosmid
           F38C2, complete sequence.
          Length = 203

 Score = 41.6 bits (96), Expect = 0.024
 Identities = 22/74 (29%), Positives = 36/74 (48%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C F+ +  +C +GE+C+F H + H L    + +   +N+K  L           C  +  
Sbjct: 94  CGFHRRGQKCAYGEKCKFAHSV-HELRFPQT-KRNHRNYKTVL-----------CNNFST 140

Query: 523 TGICKFGATCKFDH 482
           TG CK+G  C+F H
Sbjct: 141 TGHCKYGIRCQFIH 154



>gb:AF439559_2494356 Gallus gallus makorin-2 (MKRN2) mRNA, complete
           cds.
          Length = 417

 Score = 41.2 bits (95), Expect = 0.031
 Identities = 25/77 (32%), Positives = 33/77 (42%)
 Frame = -3

Query: 712 QVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPY 533
           QV C +Y++ G C+ G +C F H L  S S T                         C Y
Sbjct: 5   QVTCRYYVQ-GVCREGSKCLFSHDLSSSKSSTV------------------------CKY 39

Query: 532 YMKTGICKFGATCKFDH 482
           Y K G C +GA C++DH
Sbjct: 40  YQK-GQCAYGARCRYDH 55



>gb:AY736016_1348807 Caenorhabditis remanei POS-1 (pos-1) mRNA,
           complete cds.
          Length = 261

 Score = 41.2 bits (95), Expect = 0.031
 Identities = 21/72 (29%), Positives = 33/72 (45%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           CD Y +   C +G++CRF H + H L +     G            P+ +  + C  +  
Sbjct: 106 CDSYKRNQTCSYGDQCRFAHGV-HELRLPQHPRGRNH---------PKYK-TVLCDKFST 154

Query: 523 TGICKFGATCKF 488
           TG CK+G  C+F
Sbjct: 155 TGNCKYGTRCQF 166



>gb:SEQPYGHL2B_2579843 Seriola quinqueradiata GHL2 mRNA for YGHL2,
           complete cds.
          Length = 392

 Score = 40.8 bits (94), Expect = 0.040
 Identities = 24/86 (27%), Positives = 36/86 (41%)
 Frame = -3

Query: 712 QVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPY 533
           QV C +++  G C+ G RC F H L++S   T                         C +
Sbjct: 3   QVTCRYFLH-GVCREGSRCLFSHDLNNSKPSTI------------------------CKF 37

Query: 532 YMKTGICKFGATCKFDHPPPGELIGG 455
           Y + G+C +G  C++DH  P    GG
Sbjct: 38  YQR-GVCAYGERCRYDHIKPSSRGGG 62



>gb:AB032769_2461451 Seriola quinqueradiata mRNA for zinc finger
           protein YGHLC3HC4, partial cds.
          Length = 421

 Score = 40.8 bits (94), Expect = 0.040
 Identities = 24/86 (27%), Positives = 36/86 (41%)
 Frame = -3

Query: 712 QVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPY 533
           QV C +++  G C+ G RC F H L++S   T                         C +
Sbjct: 3   QVTCRYFLH-GVCREGSRCLFSHDLNNSKPSTI------------------------CKF 37

Query: 532 YMKTGICKFGATCKFDHPPPGELIGG 455
           Y + G+C +G  C++DH  P    GG
Sbjct: 38  YQR-GVCAYGERCRYDHIKPSSRGGG 62



>gb:SPCC1906_1721147 S.pombe chromosome III cosmid c1906.
          Length = 379

 Score = 40.8 bits (94), Expect = 0.040
 Identities = 30/101 (29%), Positives = 37/101 (36%), Gaps = 2/101 (1%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYY 530
           V C F+ + G C  GE C F H L+    +                          C Y+
Sbjct: 45  VPCKFF-RNGTCTAGENCPFSHSLETERPI--------------------------CKYF 77

Query: 529 MKTGICKFGATCKFDHPPPG--ELIGGTSQVTSTSVGEEEG 413
           +K G CKFG  C   H  PG   L  GTS  T  S+    G
Sbjct: 78  LK-GNCKFGPKCALSHALPGNTNLPNGTSTNTMASMAANGG 117



>sp|O74463|YQC1_SCHPO Hypothetical protein C1739.01 in chromosome
           III.>pir|T41213|T41213 probable zinc finger protein
           SPCC1906.05 - fission yeast  (Schizosaccharomyces pombe)
          Length = 547

 Score = 40.8 bits (94), Expect = 0.040
 Identities = 30/101 (29%), Positives = 37/101 (36%), Gaps = 2/101 (1%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYY 530
           V C F+ + G C  GE C F H L+    +                          C Y+
Sbjct: 45  VPCKFF-RNGTCTAGENCPFSHSLETERPI--------------------------CKYF 77

Query: 529 MKTGICKFGATCKFDHPPPG--ELIGGTSQVTSTSVGEEEG 413
           +K G CKFG  C   H  PG   L  GTS  T  S+    G
Sbjct: 78  LK-GNCKFGPKCALSHALPGNTNLPNGTSTNTMASMAANGG 117



>sp|Q9DD48|MKR2_SERQU Makorin 2 (Zinc finger protein
           YGHLC3HC4).>gb:AB047517_2462217 Seriola quinqueradiata
           gene for zinc finger protein YGHLC3HC4, complete
           cds.>gb:AB049436_2462299 Seriola quinqueradiata YGHL2
           mRNA for ring zinc finger protein MAKORIN2, complete
           cds, clone:pMYGHL2-L72.>gb:AB049437_2462300 Seriola
           quinqueradiata YGHL2 mRNA for ring zinc finger protein
           MAKORIN2, complete cds,
           clone:pMYGHL2-S72.>gb:AB049438_2462301 Seriola
           quinqueradiata YGHL2 mRNA for ring zinc finger protein
           MAKORIN2, complete cds,
           clone:pMYGHL2-L621.>gb:AB049439_2462302 Seriola
           quinqueradiata YGHL2 mRNA for ring zinc finger protein
           MAKORIN2, complete cds,
           clone:pMYGHL2-S621.>gb:AB078011_2463372 Seriola
           quinqueradiata mRNA for Makorin ring finger protein 2,
           complete cds, clone:pYGHL2full.>gb:AB086844_2463978
           Seriola quinqueradiata GHL2 gene for ring finger protein
           MAKORIN2, complete cds.
          Length = 423

 Score = 40.8 bits (94), Expect = 0.040
 Identities = 24/86 (27%), Positives = 36/86 (41%)
 Frame = -3

Query: 712 QVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPY 533
           QV C +++  G C+ G RC F H L++S   T                         C +
Sbjct: 5   QVTCRYFLH-GVCREGSRCLFSHDLNNSKPSTI------------------------CKF 39

Query: 532 YMKTGICKFGATCKFDHPPPGELIGG 455
           Y + G+C +G  C++DH  P    GG
Sbjct: 40  YQR-GVCAYGERCRYDHIKPSSRGGG 64



>gb:AK129275_2069506 Mus musculus mRNA for mKIAA1064 protein.
          Length = 912

 Score = 40.4 bits (93), Expect = 0.053
 Identities = 32/125 (25%), Positives = 53/125 (42%), Gaps = 11/125 (8%)
 Frame = -3

Query: 721 RPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGL-------P 563
           + G+V C ++++ G C +G+ C F H ++        +  +++  K  + G        P
Sbjct: 80  KKGKVICKYFVE-GRCTWGDHCNFSHDIE--------LPKKRELCKFYITGFCARAENCP 130

Query: 562 RREGAIHCPYYMKTGICKFGATCKFDHPP----PGELIGGTSQVTSTSVGEEEGYAKLVE 395
              G   C  Y  TG C  G  C F H P      EL+       + +  E+E   K VE
Sbjct: 131 YMHGDFPCKLYHTTGNCINGDDCMFSHDPLTEETRELLDKMLADDAEAGAEDE---KEVE 187

Query: 394 AIQKQ 380
            ++KQ
Sbjct: 188 ELKKQ 192



>gb:AF395876_1900729 Homo sapiens 36 kDa muscleblind protein EXP36
           mRNA, complete cds.
          Length = 314

 Score = 40.4 bits (93), Expect = 0.053
 Identities = 47/165 (28%), Positives = 61/165 (36%), Gaps = 3/165 (1%)
 Frame = -3

Query: 961 HNSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGV-VNPTASLF 785
           H SK   +  G V   F    G C     C+Y HP      PP  HL   + +N   +L 
Sbjct: 38  HPSKSCQVENGRVIACFDSLKGRCSR-ENCKYLHP------PP--HLKTQLEINGRNNLI 88

Query: 784 QTFDPRLTQTMFGFATTIYPQRPGQ-VECDFYMKTGECKFGER-CRFHHPLDHSLSVTSS 611
           Q  +  +       A  + P  P Q V C  Y + G C  GE  CRF HP D ++  T+ 
Sbjct: 89  QQKNMAMLAQQMQLANAMMPGAPLQPVVCREYQR-GNCNRGENDCRFAHPADSTMIDTND 147

Query: 610 MEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPP 476
                                  C  Y+K G C     CK+ HPP
Sbjct: 148 ------------------NTVTVCMDYIK-GRCS-REKCKYFHPP 172



>gb:AF255334_1893136 Homo sapiens EXP35 mRNA, complete cds.
          Length = 302

 Score = 40.4 bits (93), Expect = 0.053
 Identities = 47/165 (28%), Positives = 61/165 (36%), Gaps = 3/165 (1%)
 Frame = -3

Query: 961 HNSKGLPIRLGEVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGV-VNPTASLF 785
           H SK   +  G V   F    G C     C+Y HP      PP  HL   + +N   +L 
Sbjct: 38  HPSKSCQVENGRVIACFDSLKGRCSR-ENCKYLHP------PP--HLKTQLEINGRNNLI 88

Query: 784 QTFDPRLTQTMFGFATTIYPQRPGQ-VECDFYMKTGECKFGER-CRFHHPLDHSLSVTSS 611
           Q  +  +       A  + P  P Q V C  Y + G C  GE  CRF HP D ++  T+ 
Sbjct: 89  QQKNMAMLAQQMQLANAMMPGAPLQPVVCREYQR-GNCNRGENDCRFAHPADSTMIDTND 147

Query: 610 MEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHPP 476
                                  C  Y+K G C     CK+ HPP
Sbjct: 148 ------------------NTVTVCMDYIK-GRCS-REKCKYFHPP 172



>gb:AB028987_1865843 Homo sapiens mRNA for KIAA1064 protein, partial
           cds.
          Length = 1315

 Score = 40.4 bits (93), Expect = 0.053
 Identities = 32/125 (25%), Positives = 53/125 (42%), Gaps = 11/125 (8%)
 Frame = -3

Query: 721 RPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGL-------P 563
           + G+V C ++++ G C +G+ C F H ++        +  +++  K  + G        P
Sbjct: 402 KKGKVICKYFVE-GRCTWGDHCNFSHDIE--------LPKKRELCKFYITGFCARAENCP 452

Query: 562 RREGAIHCPYYMKTGICKFGATCKFDHPP----PGELIGGTSQVTSTSVGEEEGYAKLVE 395
              G   C  Y  TG C  G  C F H P      EL+       + +  E+E   K VE
Sbjct: 453 YMHGDFPCKLYHTTGNCINGDDCMFSHDPLTEETRELLDKMLADDAEAGAEDE---KEVE 509

Query: 394 AIQKQ 380
            ++KQ
Sbjct: 510 ELKKQ 514



>gb:CEU81043_1368663 Caenorhabditis elegans MEX-1 (mex-1) mRNA,
           complete cds.>gb:CEW03C9_1368862 Caenorhabditis elegans
           cosmid W03C9, complete sequence.>gb:CEY17G7B_1369476
           Caenorhabditis elegans YAC Y17G7B, complete sequence.
          Length = 494

 Score = 40.4 bits (93), Expect = 0.053
 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 1/75 (1%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGE-QQNFKLSLAGLPRREGAIHCPYYM 527
           CD + ++G C +GE CRF H  ++ L + S   G+    +K  L           C  + 
Sbjct: 144 CDAFKRSGSCPYGEACRFAHG-ENELRMPSQPRGKAHPKYKTQL-----------CDKFS 191

Query: 526 KTGICKFGATCKFDH 482
             G C +G  C+F H
Sbjct: 192 NFGQCPYGPRCQFIH 206



>pir|T26124|T26124 hypothetical protein W03C9.7 - Caenorhabditis
           elegans
          Length = 511

 Score = 40.4 bits (93), Expect = 0.053
 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 1/75 (1%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGE-QQNFKLSLAGLPRREGAIHCPYYM 527
           CD + ++G C +GE CRF H  ++ L + S   G+    +K  L           C  + 
Sbjct: 144 CDAFKRSGSCPYGEACRFAHG-ENELRMPSQPRGKAHPKYKTQL-----------CDKFS 191

Query: 526 KTGICKFGATCKFDH 482
             G C +G  C+F H
Sbjct: 192 NFGQCPYGPRCQFIH 206



>gb:AE017343_1755806 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 463

 Score = 40.0 bits (92), Expect = 0.069
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ 593
           C F+ + G CKF +RCRF H      SV +S +GE +
Sbjct: 314 CKFFAQQGRCKFNDRCRFAHIAPDGSSVDTSAQGENR 350



>gb:CR382132_1665507 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 395

 Score = 40.0 bits (92), Expect = 0.069
 Identities = 21/74 (28%), Positives = 32/74 (43%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + KTG C +GE+C+F H             GE +   L     P +  +  C  +++
Sbjct: 337 CSSFQKTGSCSYGEKCQFAH-------------GEHE---LKNVDRPPKWRSKLCQNWLR 380

Query: 523 TGICKFGATCKFDH 482
           TG C +   C F H
Sbjct: 381 TGTCAYNDRCCFKH 394



>gb:CR382130_1662919 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 193

 Score = 40.0 bits (92), Expect = 0.069
 Identities = 23/76 (30%), Positives = 34/76 (44%)
 Frame = -3

Query: 706 ECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYM 527
           EC FY+K G C     C++ H +D +  +      E+   K+      +    + C  YM
Sbjct: 87  ECQFYVKNGFCTQSPDCQYLH-IDPASKIPVCFNYEKGFCKMGPECSRKHIRRMPCELYM 145

Query: 526 KTGICKFGATCKFDHP 479
            TG C  G  C+F HP
Sbjct: 146 -TGFCPKGRVCEFAHP 160



 Score = 35.8 bits (81), Expect = 1.3
 Identities = 25/94 (26%), Positives = 36/94 (38%)
 Frame = -3

Query: 922 DCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGF 743
           +C FY+K G C     C+Y H D  +  P   +   G        F    P  ++     
Sbjct: 87  ECQFYVKNGFCTQSPDCQYLHIDPASKIPVCFNYEKG--------FCKMGPECSR----- 133

Query: 742 ATTIYPQRPGQVECDFYMKTGECKFGERCRFHHP 641
                 +   ++ C+ YM TG C  G  C F HP
Sbjct: 134 ------KHIRRMPCELYM-TGFCPKGRVCEFAHP 160



>gb:CR382124_1657056 Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 310

 Score = 39.7 bits (91), Expect = 0.090
 Identities = 21/74 (28%), Positives = 32/74 (43%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C+ +   G CK+G +C+F H L H L +    +    NF+              C  + K
Sbjct: 214 CESFATKGTCKYGNKCQFAHGL-HELKI----KERSNNFRTK-----------PCVNWQK 257

Query: 523 TGICKFGATCKFDH 482
            G C++G  C F H
Sbjct: 258 YGYCRYGKRCCFKH 271



>pir|T21961|T21961 hypothetical protein F38C2.5 - Caenorhabditis
           elegans>gb:CEF38C2_1363630 Caenorhabditis elegans cosmid
           F38C2, complete sequence.
          Length = 186

 Score = 39.7 bits (91), Expect = 0.090
 Identities = 19/74 (25%), Positives = 31/74 (41%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  +  T  C +GE+C+F H ++       +       +K  L           C  + +
Sbjct: 78  CKTFQLTRACSYGEQCKFAHSVEELQLKQKNRGVNHPKYKTVL-----------CDNFSR 126

Query: 523 TGICKFGATCKFDH 482
           TG CK+G  C+F H
Sbjct: 127 TGHCKYGTKCQFIH 140



>sp|Q9TT91|MKR1_MACEU Makorin 1.>gb:AF192786_1415884 Macropus
           eugenii makorin 1 (MKRN1) mRNA, complete cds.
          Length = 478

 Score = 39.7 bits (91), Expect = 0.090
 Identities = 23/80 (28%), Positives = 33/80 (41%)
 Frame = -3

Query: 712 QVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPY 533
           QV C ++M  G CK G  CR+ H L  S                        + A+ C Y
Sbjct: 54  QVTCRYFMH-GVCKKGNNCRYSHDLSTS------------------------QSAMVCRY 88

Query: 532 YMKTGICKFGATCKFDHPPP 473
           Y + G C +G  C+++H  P
Sbjct: 89  YQR-GCCAYGDRCRYEHTKP 107



>gb:AF236664_1779598 Aspergillus nidulans hypothetical zinc-finger
           protein (hzfA) gene, partial cds.
          Length = 152

 Score = 39.3 bits (90), Expect = 0.12
 Identities = 24/87 (27%), Positives = 37/87 (42%), Gaps = 2/87 (2%)
 Frame = -3

Query: 736 TIYPQRPGQVECDFYMKTGECKFGERCRF-HHPLDH-SLSVTSSMEGEQQNFKLSLAGLP 563
           ++YP+      C  +++TG+C  G  C   H P  H S +    + G   N +   A + 
Sbjct: 24  SLYPRSEQSAICKDFLQTGKCSAGNSCDLSHEPSPHRSPACVHFLRGRCSNPECRYAHVR 83

Query: 562 RREGAIHCPYYMKTGICKFGATCKFDH 482
              GA  C  +   G C  G TC+  H
Sbjct: 84  VTPGAPVCRAFATLGYCDKGETCEERH 110



>gb:AB029332_1194705 Halocynthia roretzi mRNA for HrZF-1, complete
           cds.
          Length = 621

 Score = 39.3 bits (90), Expect = 0.12
 Identities = 21/95 (22%), Positives = 36/95 (37%)
 Frame = -3

Query: 730 YPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREG 551
           +P +     C  Y   G C +GE+C F+H L       +  +  +   +L          
Sbjct: 461 FPSKYRTEPCTTYHTIGMCPYGEQCNFYHDLKEKNDHPNVTKTSRYKTRL---------- 510

Query: 550 AIHCPYYMKTGICKFGATCKFDHPPPGELIGGTSQ 446
              C  + K G C +G  C F H     ++  +S+
Sbjct: 511 ---CKTWQKAGECPYGVKCDFAHGTDDLILNSSSK 542



>pir|T27239|T27239 hypothetical protein Y57G11C.25 - Caenorhabditis
           elegans>gb:CEY57G11C_1370742 Caenorhabditis elegans YAC
           Y57G11C, complete sequence.
          Length = 199

 Score = 39.3 bits (90), Expect = 0.12
 Identities = 19/74 (25%), Positives = 35/74 (47%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  +  T  C +GE+C+F H ++        ++ + QN  ++      +   + C  +  
Sbjct: 74  CKTFQLTKACSYGEQCKFAHSVEE-------LQLKHQNLGINNP----KYKTVLCDNFST 122

Query: 523 TGICKFGATCKFDH 482
           TG CK+G  C+F H
Sbjct: 123 TGHCKYGTKCQFIH 136



>gb:BC065352_2553970 Danio rerio makorin, ring finger protein, 2,
           mRNA (cDNA clone MGC:77393 IMAGE:6969527), complete cds.
          Length = 414

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 27/95 (28%), Positives = 38/95 (40%), Gaps = 1/95 (1%)
 Frame = -3

Query: 712 QVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPY 533
           QV C +++  G C+ G RC F H L  S   T                         C Y
Sbjct: 5   QVTCRYFLH-GVCREGSRCLFSHDLTTSKPSTI------------------------CKY 39

Query: 532 YMKTGICKFGATCKFDH-PPPGELIGGTSQVTSTS 431
           Y + G C +G  C++DH  PPG   G  +  ++ S
Sbjct: 40  YQR-GACAYGDRCRYDHIKPPGRGSGAPADHSNRS 73



>gb:BC045986_2549498 Danio rerio makorin, ring finger protein, 2,
           mRNA (cDNA clone MGC:56198 IMAGE:5600186), complete cds.
          Length = 305

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 27/95 (28%), Positives = 38/95 (40%), Gaps = 1/95 (1%)
 Frame = -3

Query: 712 QVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPY 533
           QV C +++  G C+ G RC F H L  S   T                         C Y
Sbjct: 5   QVTCRYFLH-GVCREGSRCLFSHDLTTSKPSTI------------------------CKY 39

Query: 532 YMKTGICKFGATCKFDH-PPPGELIGGTSQVTSTS 431
           Y + G C +G  C++DH  PPG   G  +  ++ S
Sbjct: 40  YQR-GACAYGDRCRYDHIKPPGRGSGAPADHSNRS 73



>gb:AF192787_2479345 Gallus gallus makorin 1 (MKRN1) mRNA, complete
           cds.
          Length = 464

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 22/80 (27%), Positives = 33/80 (41%)
 Frame = -3

Query: 712 QVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPY 533
           QV C ++M  G CK G+ CR+ H L                           + A+ C Y
Sbjct: 51  QVTCRYFMH-GVCKEGDNCRYSHDLSTG------------------------QSAMVCRY 85

Query: 532 YMKTGICKFGATCKFDHPPP 473
           Y + G C +G  C+++H  P
Sbjct: 86  YQR-GCCAYGDHCRYEHTKP 104



>gb:AE017349_1758636 Cryptococcus neoformans var. neoformans JEC21
           chromosome 9, complete sequence.
          Length = 483

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 34/149 (22%), Positives = 51/149 (34%), Gaps = 35/149 (23%)
 Frame = -3

Query: 919 CPFYLKTGSCKYGATCRYNH-PDRYTINP-------------PAAHLNVGVVNPTASLFQ 782
           CP++ KTG C+ G  C+  H PDR    P             P +H       P+ + FQ
Sbjct: 246 CPYFSKTGRCRKGHICKAIHDPDRVAACPNFLRGRCELGPICPLSHRTTAHNTPSCTRFQ 305

Query: 781 TFD------------------PRLTQTMF-GFATTIYPQRPG--QVECDFYMKTGECKFG 665
                                P      F G+  T   + P     +C  +  TG+C  G
Sbjct: 306 ALSYCTRPNCPYPHVKVSNDAPICEDFAFTGWCDTAEGECPNLHSYDCPEFWSTGKCPRG 365

Query: 664 ERCRFHHPLDHSLSVTSSMEGEQQNFKLS 578
            +C+  H L       +  E  ++  K S
Sbjct: 366 AKCKLRHTLRAEKGRVAKPESTKEEEKKS 394



 Score = 33.9 bits (76), Expect = 4.9
 Identities = 20/43 (46%), Positives = 26/43 (60%), Gaps = 2/43 (4%)
 Frame = -3

Query: 598 QQNFKLSL--AGLPRREGAIHCPYYMKTGICKFGATCKFDHPP 476
           Q N  L+L  + +PRR G + CPY+ KTG C+ G  CK  H P
Sbjct: 227 QPNGDLTLPKSNVPRR-GQL-CPYFSKTGRCRKGHICKAIHDP 267



>gb:AE017342_1754764 Cryptococcus neoformans var. neoformans JEC21
           chromosome 2, complete sequence.
          Length = 332

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 21/77 (27%), Positives = 30/77 (38%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C +++K G+C+ G  C + HP D  +       G    F +     PR+           
Sbjct: 127 CIWFVKQGKCELGGECLYFHPRDRRVECPDYNRG----FCVLGPNCPRKHIRRRLCDAYA 182

Query: 523 TGICKFGATCKFDHPPP 473
            G C  G  CK  HP P
Sbjct: 183 AGFCPDGKDCKLAHPSP 199



>gb:CNS06C8G_1372637 chromosome I of strain GB-M1 of Encephalitozoon
           cuniculi (Microspora).
          Length = 176

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 25/79 (31%), Positives = 37/79 (46%), Gaps = 3/79 (3%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHSLSVTS---SMEGEQQNFKLSLAGLPRREGAIHC 539
           V C  +++ G CK G +C F H  D S        S  GE  N + +   +     +  C
Sbjct: 50  VVCKHWLR-GLCKKGIKCEFMHEYDLSRMPECYFFSSYGECMNPECNYIHIDPNSSSKEC 108

Query: 538 PYYMKTGICKFGATCKFDH 482
           P+Y + G C+ GA+CK  H
Sbjct: 109 PWYNR-GFCRNGASCKNKH 126



>gb:CEY60A9A_1370801 Caenorhabditis elegans YAC Y60A9A, complete
           sequence.
          Length = 203

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 21/72 (29%), Positives = 34/72 (47%)
 Frame = -3

Query: 697 FYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTG 518
           F+ +  +C +GE+C+F H + H L    +    + N+K  L           C  +  TG
Sbjct: 96  FHRRGQKCAYGEKCKFAHSV-HELRFPQTKRNHR-NYKTVL-----------CNKFSTTG 142

Query: 517 ICKFGATCKFDH 482
            CK+G  C+F H
Sbjct: 143 HCKYGIRCQFIH 154



 Score = 33.9 bits (76), Expect = 4.9
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 1/46 (2%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRF-HHPLDHSLSVTSSMEGEQQNFKLSL 575
           V C+ +  TG CK+G RC+F H  +D   S +S+   E +N  + L
Sbjct: 133 VLCNKFSTTGHCKYGIRCQFIHRSMD---STSSNQSNETENVTIDL 175



>sp|Q9DFG8|MKR2_BRARE Makorin 2.>gb:AF277172_2483900 Danio rerio
           Makorin RING zinc-finger protein 2 (mkrn2) mRNA,
           complete cds.
          Length = 414

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 27/95 (28%), Positives = 38/95 (40%), Gaps = 1/95 (1%)
 Frame = -3

Query: 712 QVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPY 533
           QV C +++  G C+ G RC F H L  S   T                         C Y
Sbjct: 5   QVTCRYFLH-GVCREGSRCLFSHDLTTSKPSTI------------------------CKY 39

Query: 532 YMKTGICKFGATCKFDH-PPPGELIGGTSQVTSTS 431
           Y + G C +G  C++DH  PPG   G  +  ++ S
Sbjct: 40  YQR-GACAYGDRCRYDHIKPPGRGSGAPADHSNRS 73



>gb:BC073564_2557393 Xenopus laevis hypothetical protein LOC443666,
           mRNA (cDNA clone IMAGE:5511185), partial cds.
          Length = 320

 Score = 38.1 bits (87), Expect = 0.26
 Identities = 24/86 (27%), Positives = 34/86 (39%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  Y +TG CK+G +C+F H       +    +     +K  L           C  +  
Sbjct: 116 CRTYSETGTCKYGAKCQFAHG-----KIELREQNRHPKYKTEL-----------CHKFYL 159

Query: 523 TGICKFGATCKFDHPPPGELIGGTSQ 446
            G C +G  C F H P  +   GTSQ
Sbjct: 160 YGECPYGPRCNFIHHPREQ---GTSQ 182



 Score = 33.1 bits (74), Expect = 8.4
 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 13/65 (20%)
 Frame = -3

Query: 637 DHSLSVTSSMEGEQQNFKLSLAGLPRREGAIH-------------CPYYMKTGICKFGAT 497
           D S+S+T   EG +  F     G P  + A+              C  Y +TG CK+GA 
Sbjct: 74  DRSISLT---EGPRLAFPAPPPGFPPLKAALPALPTLSPRYKTELCRTYSETGTCKYGAK 130

Query: 496 CKFDH 482
           C+F H
Sbjct: 131 CQFAH 135



>gb:AB185115_2467124 Takifugu rubripes MKRN1 mRNA for makorin RING
           finger protein 1b, complete cds.
          Length = 344

 Score = 38.1 bits (87), Expect = 0.26
 Identities = 31/119 (26%), Positives = 51/119 (42%), Gaps = 4/119 (3%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHS----LSVTSSMEGEQQNFKLSLAGLPRREGAIH 542
           V C ++M  G CK G+ CR+ H L  S    + +   + G+    K  L    R++    
Sbjct: 22  VTCRYFMH-GLCKEGDNCRYSHDLTSSKPAAIPLIEELNGDATTDKEEL----RKQ---L 73

Query: 541 CPYYMKTGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEGYAKLVEAIQKQQQ*TF 365
           CP Y   G C++G  C + H    ++ G      + S    E     +EA +K  + +F
Sbjct: 74  CP-YAAVGECRYGVNCAYLHGDVCDMCGLQVLHPTDSSQRSEHTKACIEAHEKDMEISF 131



 Score = 33.5 bits (75), Expect = 6.5
 Identities = 31/104 (29%), Positives = 44/104 (42%), Gaps = 3/104 (2%)
 Frame = -3

Query: 946 LPIRLG---EVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTF 776
           LP+  G    V C +++  G CK G  CRY+H    T + PAA                 
Sbjct: 12  LPVTGGWTKHVTCRYFMH-GLCKEGDNCRYSHD--LTSSKPAA----------------- 51

Query: 775 DPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHH 644
              L + + G ATT   +   Q+ C  Y   GEC++G  C + H
Sbjct: 52  -IPLIEELNGDATTDKEELRKQL-CP-YAAVGECRYGVNCAYLH 92



>gb:AB083692_2463708 Seriola quinqueradiata gene for Makorin1,
           partial cds.
          Length = 418

 Score = 38.1 bits (87), Expect = 0.26
 Identities = 23/81 (28%), Positives = 35/81 (43%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYY 530
           V C ++M  G CK G+ CR+ H L +S                       +  A+ C ++
Sbjct: 5   VTCRYFMH-GLCKEGDNCRYSHDLTNS-----------------------KPAAMICKFF 40

Query: 529 MKTGICKFGATCKFDHPPPGE 467
            K G C FG  C+F+H  P +
Sbjct: 41  QK-GNCVFGDRCRFEHCKPAK 60



 Score = 34.3 bits (77), Expect = 3.8
 Identities = 25/94 (26%), Positives = 34/94 (36%)
 Frame = -3

Query: 925 VDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFG 746
           V C +++  G CK G  CRY+H                               LT +   
Sbjct: 5   VTCRYFMH-GLCKEGDNCRYSHD------------------------------LTNS--- 30

Query: 745 FATTIYPQRPGQVECDFYMKTGECKFGERCRFHH 644
                   +P  + C F+ K G C FG+RCRF H
Sbjct: 31  --------KPAAMICKFFQK-GNCVFGDRCRFEH 55



>gb:AB083365_2463700 Seriola quinqueradiata mRNA for Makorin1,
           partial cds.
          Length = 418

 Score = 38.1 bits (87), Expect = 0.26
 Identities = 23/81 (28%), Positives = 35/81 (43%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYY 530
           V C ++M  G CK G+ CR+ H L +S                       +  A+ C ++
Sbjct: 5   VTCRYFMH-GLCKEGDNCRYSHDLTNS-----------------------KPAAMICKFF 40

Query: 529 MKTGICKFGATCKFDHPPPGE 467
            K G C FG  C+F+H  P +
Sbjct: 41  QK-GNCVFGDRCRFEHCKPAK 60



 Score = 34.3 bits (77), Expect = 3.8
 Identities = 25/94 (26%), Positives = 34/94 (36%)
 Frame = -3

Query: 925 VDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFG 746
           V C +++  G CK G  CRY+H                               LT +   
Sbjct: 5   VTCRYFMH-GLCKEGDNCRYSHD------------------------------LTNS--- 30

Query: 745 FATTIYPQRPGQVECDFYMKTGECKFGERCRFHH 644
                   +P  + C F+ K G C FG+RCRF H
Sbjct: 31  --------KPAAMICKFFQK-GNCVFGDRCRFEH 55



>gb:AB073984_2463259 Seriola quinqueradiata MAKORIN1 mRNA for gene
           encoding protein featuring ring-finger, complete
           cds.>gb:AB073985_2463260 Seriola quinqueradiata MAKORIN1
           gene for gene encoding protein featuring ring-finger,
           complete cds.
          Length = 435

 Score = 38.1 bits (87), Expect = 0.26
 Identities = 23/81 (28%), Positives = 35/81 (43%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYY 530
           V C ++M  G CK G+ CR+ H L +S                       +  A+ C ++
Sbjct: 22  VTCRYFMH-GLCKEGDNCRYSHDLTNS-----------------------KPAAMICKFF 57

Query: 529 MKTGICKFGATCKFDHPPPGE 467
            K G C FG  C+F+H  P +
Sbjct: 58  QK-GNCVFGDRCRFEHCKPAK 77



 Score = 34.3 bits (77), Expect = 3.8
 Identities = 25/94 (26%), Positives = 34/94 (36%)
 Frame = -3

Query: 925 VDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFG 746
           V C +++  G CK G  CRY+H                               LT +   
Sbjct: 22  VTCRYFMH-GLCKEGDNCRYSHD------------------------------LTNS--- 47

Query: 745 FATTIYPQRPGQVECDFYMKTGECKFGERCRFHH 644
                   +P  + C F+ K G C FG+RCRF H
Sbjct: 48  --------KPAAMICKFFQK-GNCVFGDRCRFEH 72



>gb:AB182269_2466959 Takifugu rubripes MKRN1 mRNA for makorin RING
           zinc finger protein 1a, complete cds.
          Length = 429

 Score = 37.7 bits (86), Expect = 0.34
 Identities = 23/79 (29%), Positives = 33/79 (41%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYY 530
           V C ++M  G CK G+ CR+ H L  S                       +  A+ C ++
Sbjct: 22  VTCRYFMH-GLCKEGDNCRYSHDLTSS-----------------------KPAAMMCKFF 57

Query: 529 MKTGICKFGATCKFDHPPP 473
            K G C FG  C+F+H  P
Sbjct: 58  QK-GNCVFGERCRFEHCKP 75



 Score = 36.2 bits (82), Expect = 1.00
 Identities = 27/104 (25%), Positives = 36/104 (34%), Gaps = 3/104 (2%)
 Frame = -3

Query: 946 LPIRLG---EVDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTF 776
           LP+  G    V C +++  G CK G  CRY+H                            
Sbjct: 12  LPVTGGWTKHVTCRYFMH-GLCKEGDNCRYSHD--------------------------- 43

Query: 775 DPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHH 644
                         +   +P  + C F+ K G C FGERCRF H
Sbjct: 44  --------------LTSSKPAAMMCKFFQK-GNCVFGERCRFEH 72



>gb:AE016820_1749997 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VII, complete sequence.
          Length = 300

 Score = 37.7 bits (86), Expect = 0.34
 Identities = 21/74 (28%), Positives = 31/74 (41%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C+ +  TG CK+  +C+F H L H L      +     F+              C  + K
Sbjct: 191 CESFATTGACKYDNKCQFAHGL-HEL----KFKERSDKFRTK-----------PCINWSK 234

Query: 523 TGICKFGATCKFDH 482
           TG C++G  C F H
Sbjct: 235 TGYCRYGKRCCFKH 248



>pir|F86348|F86348 hypothetical protein F24J8.17 [imported] -
            Arabidopsis thaliana>gb:AE005172_891105 Arabidopsis
            thaliana chromosome 1, top arm complete
            sequence.>gb:AC015447_1538008 Arabidopsis thaliana
            chromosome I BAC F24J8 genomic sequence, complete
            sequence.
          Length = 2123

 Score = 37.7 bits (86), Expect = 0.34
 Identities = 41/163 (25%), Positives = 63/163 (38%), Gaps = 1/163 (0%)
 Frame = -3

Query: 964  LHNSKGLPIRLGEVDCPFYLKTGSC-KYGATCRYNHPDRYTINPPAAHLNVGVVNPTASL 788
            LHN++ L +   +  C F+ + G C K    C Y H D   I      LN    N    L
Sbjct: 1885 LHNAR-LRLAKKKKYCQFFTRFGKCNKDDGKCPYVH-DPSKIAVCTKFLNGLCANANCKL 1942

Query: 787  FQTFDPRLTQTMFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSM 608
                              + P+R    +C +Y++ G C   E C + H   H   +    
Sbjct: 1943 THK---------------VIPER--MPDCSYYLQ-GLCN-NEACPYRHV--HVNPIAPIC 1981

Query: 607  EGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDHP 479
            +G  + +  S     R++ + +CP +  TG C  G  CK  HP
Sbjct: 1982 DGFLKGY-CSEGDECRKKHSYNCPVFEATGSCSQGLKCKLHHP 2023



>sp|P26651|TTP_HUMAN Tristetraproline (TTP) (TIS11A protein) (TIS11)
           (Zinc finger protein 36 homolog) (Zfp-36) (Growth
           factor-inducible nuclear protein NUP475) (G0/G1 switch
           regulatory protein 24).>pir|S34427|S34427
           tristetraproline protein - human>gb:AX392426_1466837
           Sequence 10 from Patent WO0216416.>gb:AY771351_1962068
           Homo sapiens zinc finger protein 36, C3H type, homolog
           (mouse) (ZFP36) gene, complete cds.>gb:BC009693_1972182
           Homo sapiens zinc finger protein 36, C3H type, homolog
           (mouse), mRNA (cDNA clone MGC:9162 IMAGE:3900312),
           complete cds.>gb:HUMG0S24A_2031268 H.sapiens zinc finger
           transcriptional regulator mRNA, complete
           cds.>gb:HUMG0S24B_2031269 Homo sapiens zinc finger
           transcriptional regulator (GOS24) gene, complete
           cds.>gb:HUMTTP_2037940 Human tristetraproline (TTP)
           mRNA, complete cds.
          Length = 326

 Score = 37.7 bits (86), Expect = 0.34
 Identities = 23/93 (24%), Positives = 36/93 (38%)
 Frame = -3

Query: 742 ATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLP 563
           AT+  P R     C  + ++G C++G +C+F H L                +K  L    
Sbjct: 96  ATSTTPSRYKTELCRTFSESGRCRYGAKCQFAHGLGE-----LRQANRHPKYKTEL---- 146

Query: 562 RREGAIHCPYYMKTGICKFGATCKFDHPPPGEL 464
                  C  +   G C +G+ C F H P  +L
Sbjct: 147 -------CHKFYLQGRCPYGSRCHFIHNPSEDL 172



>pir|T31489|T31489 hypothetical protein Y116A8C.17 - Caenorhabditis
           elegans>gb:CEY116A8C_1369378 Caenorhabditis elegans YAC
           Y116A8C, complete sequence.
          Length = 205

 Score = 37.4 bits (85), Expect = 0.45
 Identities = 22/74 (29%), Positives = 33/74 (44%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + +   C +GE C+F H + H L    +    + N+K  L           C  +  
Sbjct: 98  CLSHKRGKTCIYGEACKFAHGV-HELRCQQTTRNHR-NYKTVL-----------CDKFTT 144

Query: 523 TGICKFGATCKFDH 482
           TG CK+GA C+F H
Sbjct: 145 TGYCKYGARCQFIH 158



>gb:BC081358_2562241 Xenopus tropicalis MGC89691 protein, mRNA (cDNA
           clone MGC:89691 IMAGE:7026471), complete cds.
          Length = 408

 Score = 37.0 bits (84), Expect = 0.58
 Identities = 32/138 (23%), Positives = 51/138 (36%), Gaps = 29/138 (21%)
 Frame = -3

Query: 892 CKYGATCRYNHPDRYTI-----------------NPPAAHLNVGVVNPTASLFQTF---- 776
           CK G  CR+ HPD   +                 N     LN   ++ T    + +    
Sbjct: 32  CKRGKRCRFKHPDADDVSDLGVQKNEFVFCHDFQNKECVRLNCRFIHGTKDDEEHYKKTG 91

Query: 775 --DPRLTQTM---FGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHH---PLDHSLSV 620
              PRL   +    G + T  P +     C  ++K G+C+ G+RC+F H     ++    
Sbjct: 92  ELPPRLRHKVAAGLGLSPTDLPNKDEVPICRDFLK-GDCQRGDRCKFRHLQREYENQYDY 150

Query: 619 TSSMEGEQQNFKLSLAGL 566
           +  M G   N  +S   L
Sbjct: 151 SCDMRGGMMNMGVSPGSL 168



>gb:AC098571_1736744 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1126_B10, complete
           sequence.>gb:AC098832_1736907 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OJ1268_B08, complete
           sequence.
          Length = 343

 Score = 37.0 bits (84), Expect = 0.58
 Identities = 24/92 (26%), Positives = 39/92 (42%), Gaps = 1/92 (1%)
 Frame = -3

Query: 754 MFGFATTIYPQRPGQVE-CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLS 578
           M G    +Y Q   + E C+ + +TG C +G++C+F H +     V      + Q  ++ 
Sbjct: 256 MGGLEFEVYNQGMFKTELCNKWEETGACPYGDQCQFAHGVAELRPVIRHPRYKTQVCRMV 315

Query: 577 LAGLPRREGAIHCPYYMKTGICKFGATCKFDH 482
           LAG                G+C +G  C F H
Sbjct: 316 LAG----------------GVCPYGHRCHFRH 331



>gb:CR382138_1670817 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 287

 Score = 37.0 bits (84), Expect = 0.58
 Identities = 21/74 (28%), Positives = 31/74 (41%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  Y+K G C +G +C+F H             GE +   L     P +  +  C  + K
Sbjct: 228 CASYIKMGICPYGNKCQFAH-------------GENE---LKSVSRPPKWRSKPCANWSK 271

Query: 523 TGICKFGATCKFDH 482
            G C++G  C F H
Sbjct: 272 FGSCRYGNRCCFKH 285



>gb:CR382126_1658712 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 210

 Score = 37.0 bits (84), Expect = 0.58
 Identities = 23/79 (29%), Positives = 33/79 (41%), Gaps = 3/79 (3%)
 Frame = -3

Query: 706 ECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAG---LPRREGAIHCP 536
           EC F+ K G C     C++ H +DH   +    E E  N     +G     +    + CP
Sbjct: 94  ECVFFTKNGYCTQSPECQYLH-VDHKSQLE---ECEDYNMGFCPSGPACTKKHVKKVLCP 149

Query: 535 YYMKTGICKFGATCKFDHP 479
            Y+  G C  G  C + HP
Sbjct: 150 RYL-VGFCPLGKDCDWSHP 167



>gb:BC073459_2557298 Xenopus laevis MGC80969 protein, mRNA (cDNA
           clone MGC:80969 IMAGE:5536566), complete cds.
          Length = 409

 Score = 36.6 bits (83), Expect = 0.76
 Identities = 32/138 (23%), Positives = 49/138 (35%), Gaps = 29/138 (21%)
 Frame = -3

Query: 892 CKYGATCRYNHPDRYTI-----------------NPPAAHLNVGVVNPTASLFQTF---- 776
           CK G  CR+ HPD   +                 N     LN   ++ T    + +    
Sbjct: 33  CKRGKRCRFKHPDAVDVSDLGVQKNEFVFCHDFQNKECVRLNCRFIHGTKDDDEYYKKTG 92

Query: 775 --DPRLTQTM---FGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHH---PLDHSLSV 620
              PRL   +    G + T    +     C  ++K G+C+ G+RC+F H     +H    
Sbjct: 93  ELPPRLRHKVAAGLGLSPTDLTNKDEVPICRDFLK-GDCQRGDRCKFRHLQREYEHQYDY 151

Query: 619 TSSMEGEQQNFKLSLAGL 566
              M G   N  +S   L
Sbjct: 152 PCDMRGGMMNMGVSPGSL 169



>gb:AF409139_1797022 Arabidopsis thaliana U2 auxiliary factor small
           subunit (AUSA) mRNA, complete cds.
          Length = 296

 Score = 36.6 bits (83), Expect = 0.76
 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 5/64 (7%)
 Frame = -3

Query: 925 VDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNV----GVVNP-TASLFQTFDPRLT 761
           V+CPFY K G+C++G  C   H +R TI+P     N+     ++ P   +  Q  DPR  
Sbjct: 16  VNCPFYFKIGACRHGDRCSRLH-NRPTISPTLLLSNMYQRPDMITPGVDAQGQPLDPRKI 74

Query: 760 QTMF 749
           Q  F
Sbjct: 75  QEHF 78



>gb:AK003361_1151814 Mus musculus 18-day embryo whole body cDNA,
           RIKEN full-length enriched library, clone:1110003I21
           product:hypothetical Zinc finger C-x8-C-x5-C-x3-H type
           containing protein, full insert
           sequence.>gb:AK007565_1154065 Mus musculus 10 day old
           male pancreas cDNA, RIKEN full-length enriched library,
           clone:1810020K22 product:hypothetical Zinc finger
           C-x8-C-x5-C-x3-H type containing protein, full insert
           sequence.>gb:AK012098_1156766 Mus musculus 10 days
           embryo whole body cDNA, RIKEN full-length enriched
           library, clone:2610510L01 product:hypothetical Zinc
           finger C-x8-C-x5-C-x3-H type containing protein, full
           insert sequence.>gb:AK013415_1157505 Mus musculus 10, 11
           days embryo whole body cDNA, RIKEN full-length enriched
           library, clone:2810477N24 product:hypothetical Zinc
           finger C-x8-C-x5-C-x3-H type containing protein, full
           insert sequence.>gb:AL606521_2071417 Mouse DNA sequence
           from clone RP23-280J3 on chromosome 11 Contains the 5'
           end of the Mtmr3 gene for myotubularin related protein
           3, two novel genes, the gene for a novel protein similar
           to human ASC-1 complex subunit P100, the gene for a
           novel protein similar to human ubiquinol-cytochrome C
           reductase complex 7.2 kDa protein UQCR10, the Cabp7 gene
           for calcium binding protein 7, the 3' end of the Nf2
           gene for neurofibromatosis 2 and two CpG islands,
           complete sequence.>gb:BC031796_2097248 Mus musculus
           RIKEN cDNA 2610510L01 gene, mRNA (cDNA clone MGC:19324
           IMAGE:4205598), complete cds.
          Length = 170

 Score = 36.6 bits (83), Expect = 0.76
 Identities = 22/67 (32%), Positives = 29/67 (43%), Gaps = 3/67 (4%)
 Frame = -3

Query: 754 MFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLD---HSLSVTSSMEGEQQNFK 584
           MF  A  I      +  C  ++ TG+C FG  CRF H  +     LSV    E   + + 
Sbjct: 40  MFRDAAAILLDEQNKRPCRKFLLTGQCDFGSNCRFSHMSEQDLQELSVQVEEERRAREWP 99

Query: 583 LSLAGLP 563
           L  A LP
Sbjct: 100 LETAELP 106



>gb:AE005172_891645 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC012375_1537595 Genomic sequence
           for Arabidopsis thaliana BAC T22C5 from chromosome I,
           complete sequence.>gb:AY065202_1566356 Arabidopsis
           thaliana putative U2 snRNP auxiliary factor (At1g27650)
           mRNA, complete cds.>gb:AY088540_1573558 Arabidopsis
           thaliana clone 7697 mRNA, complete
           sequence.>gb:AY090343_1574094 Arabidopsis thaliana
           At1g27650/T22C5_2 mRNA, complete
           cds.>gb:AY096507_1576049 Arabidopsis thaliana putative
           U2 snRNP auxiliary factor protein (At1g27650) mRNA,
           complete cds.>gb:AY122894_1579772 Arabidopsis thaliana
           At1g27650/T22C5_2 mRNA, complete cds.>gb:T17H3_1723559
           Arabidopsis thaliana chromosome 1 BAC T17H3 sequence,
           complete sequence.>gb:AF344324_1789758 Arabidopsis
           thaliana putative U2 snRNP auxiliary factor (At1g27650)
           mRNA, complete cds.
          Length = 296

 Score = 36.6 bits (83), Expect = 0.76
 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 5/64 (7%)
 Frame = -3

Query: 925 VDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNV----GVVNP-TASLFQTFDPRLT 761
           V+CPFY K G+C++G  C   H +R TI+P     N+     ++ P   +  Q  DPR  
Sbjct: 16  VNCPFYFKIGACRHGDRCSRLH-NRPTISPTLLLSNMYQRPDMITPGVDAQGQPLDPRKI 74

Query: 760 QTMF 749
           Q  F
Sbjct: 75  QEHF 78



>pir|T31503|T31503 hypothetical protein Y116A8C.35 - Caenorhabditis
           elegans>gb:CEY116A8C_1369399 Caenorhabditis elegans YAC
           Y116A8C, complete sequence.
          Length = 285

 Score = 36.6 bits (83), Expect = 0.76
 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%)
 Frame = -3

Query: 745 FATTIYPQRPGQVECDFYMKTGECKFGERC-RFHH 644
           +  +IY     +V C F+ KTG C+ G++C R HH
Sbjct: 12  YLASIYGTEKDKVNCSFFFKTGACRHGDKCSRAHH 46



>pir|T31492|T31492 hypothetical protein Y116A8C.20 - Caenorhabditis
           elegans>gb:CEY116A8C_1369381 Caenorhabditis elegans YAC
           Y116A8C, complete sequence.
          Length = 201

 Score = 36.6 bits (83), Expect = 0.76
 Identities = 21/74 (28%), Positives = 34/74 (45%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + +   C +GE+C+F H + H L    + +  + N+K  L           C  +  
Sbjct: 94  CLSHKRGKTCIYGEQCKFAHGV-HELRCQQAKKNHR-NYKTVL-----------CDKFTT 140

Query: 523 TGICKFGATCKFDH 482
           TG CK+G  C+F H
Sbjct: 141 TGYCKYGIRCQFIH 154



 Score = 33.5 bits (75), Expect = 6.5
 Identities = 20/66 (30%), Positives = 32/66 (48%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYY 530
           V CD +  TG CK+G RC+F H    + +VT  +  +  +FKL +     R  A+    +
Sbjct: 133 VLCDKFTTTGYCKYGIRCQFIHRSMDATNVTRPI--DTADFKLDVQSDLSRAFALDSSSF 190

Query: 529 MKTGIC 512
           +    C
Sbjct: 191 LPNWHC 196



>gb:BC044086_2548480 Xenopus laevis zinc finger protein 36, C3H
           type-like 2, mRNA (cDNA clone MGC:52716 IMAGE:4683750),
           complete cds.
          Length = 363

 Score = 36.2 bits (82), Expect = 1.00
 Identities = 20/74 (27%), Positives = 30/74 (40%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + ++G CK+GE+C+F H      S+T         +K  L           C  +  
Sbjct: 137 CRPFEESGACKYGEKCQFAHGFHELRSLT-----RHPKYKTEL-----------CRTFHT 180

Query: 523 TGICKFGATCKFDH 482
            G C +G  C F H
Sbjct: 181 IGFCPYGPRCHFIH 194



>gb:AF061981_2471354 Xenopus laevis CCCH zinc finger protein C3H-2
           (C3H-2) mRNA, complete cds.>gb:BC084197_2563587 Xenopus
           laevis CCCH zinc finger protein C3H-2, mRNA (cDNA clone
           MGC:79915 IMAGE:6866185), complete cds.
          Length = 345

 Score = 36.2 bits (82), Expect = 1.00
 Identities = 33/140 (23%), Positives = 49/140 (35%), Gaps = 12/140 (8%)
 Frame = -3

Query: 919 CPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFA 740
           C  + + GSCKYG  C++ H                 ++   SL                
Sbjct: 121 CRPFEENGSCKYGDKCQFAHG----------------IHELRSL---------------- 148

Query: 739 TTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDH------------SLSVTSSMEGEQ 596
            T +P+   ++ C  +   G C +G RC F H  +             SLS +S ME  +
Sbjct: 149 -TRHPKYKTEL-CRTFHTIGFCPYGPRCHFIHNAEERRLVSGRDQAHFSLSSSSKMERPR 206

Query: 595 QNFKLSLAGLPRREGAIHCP 536
                S AG P   G +  P
Sbjct: 207 LQHSFSFAGFPTTNGLLDSP 226



 Score = 35.8 bits (81), Expect = 1.3
 Identities = 19/74 (25%), Positives = 30/74 (40%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + + G CK+G++C+F H +    S+T         +K  L           C  +  
Sbjct: 121 CRPFEENGSCKYGDKCQFAHGIHELRSLT-----RHPKYKTEL-----------CRTFHT 164

Query: 523 TGICKFGATCKFDH 482
            G C +G  C F H
Sbjct: 165 IGFCPYGPRCHFIH 178



>gb:AF061980_2471353 Xenopus laevis CCCH zinc finger protein C3H-1
           (C3H-1) mRNA, complete cds.>gb:BC082435_2562670 Xenopus
           laevis CCCH zinc finger protein C3H-1, mRNA (cDNA clone
           MGC:83426 IMAGE:7009009), complete cds.
          Length = 313

 Score = 36.2 bits (82), Expect = 1.00
 Identities = 23/86 (26%), Positives = 34/86 (39%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + +TG CK+G +C+F H       +          +K  L           C  +  
Sbjct: 109 CRTFSETGTCKYGAKCQFAHG-----KIELREPNRHPKYKTEL-----------CHKFYL 152

Query: 523 TGICKFGATCKFDHPPPGELIGGTSQ 446
            G C +G+ C F H P  +   GTSQ
Sbjct: 153 YGECPYGSRCNFIHHPREQ---GTSQ 175



>gb:BC066091_2105715 Mus musculus expressed sequence AW494914, mRNA
           (cDNA clone MGC:90116 IMAGE:6841207), complete cds.
          Length = 1335

 Score = 36.2 bits (82), Expect = 1.00
 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 1/29 (3%)
 Frame = -3

Query: 541 CPYYMKTGICKFGATCKFDHP-PPGELIG 458
           C +Y+K G CKFG+ CKF H  PP ++IG
Sbjct: 252 CKFYLK-GNCKFGSKCKFKHEVPPHQMIG 279



 Score = 33.1 bits (74), Expect = 8.4
 Identities = 12/20 (60%), Positives = 15/20 (75%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHH 644
           C FY+K G CKFG +C+F H
Sbjct: 252 CKFYLK-GNCKFGSKCKFKH 270



>gb:BC065169_2105575 Mus musculus expressed sequence AW494914, mRNA
           (cDNA clone MGC:90052 IMAGE:6831314), complete cds.
          Length = 1388

 Score = 36.2 bits (82), Expect = 1.00
 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 1/29 (3%)
 Frame = -3

Query: 541 CPYYMKTGICKFGATCKFDHP-PPGELIG 458
           C +Y+K G CKFG+ CKF H  PP ++IG
Sbjct: 305 CKFYLK-GNCKFGSKCKFKHEVPPHQMIG 332



 Score = 33.1 bits (74), Expect = 8.4
 Identities = 12/20 (60%), Positives = 15/20 (75%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHH 644
           C FY+K G CKFG +C+F H
Sbjct: 305 CKFYLK-GNCKFGSKCKFKH 323



>gb:BC062952_2105094 Mus musculus expressed sequence AW494914, mRNA
           (cDNA clone MGC:77974 IMAGE:6853031), complete cds.
          Length = 1335

 Score = 36.2 bits (82), Expect = 1.00
 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 1/29 (3%)
 Frame = -3

Query: 541 CPYYMKTGICKFGATCKFDHP-PPGELIG 458
           C +Y+K G CKFG+ CKF H  PP ++IG
Sbjct: 252 CKFYLK-GNCKFGSKCKFKHEVPPHQMIG 279



 Score = 33.1 bits (74), Expect = 8.4
 Identities = 12/20 (60%), Positives = 15/20 (75%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHH 644
           C FY+K G CKFG +C+F H
Sbjct: 252 CKFYLK-GNCKFGSKCKFKH 270



>gb:HSU07802_2021823 Human Tis11d gene, complete cds.
          Length = 482

 Score = 36.2 bits (82), Expect = 1.00
 Identities = 20/74 (27%), Positives = 30/74 (40%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + ++G CK+GE+C+F H      S+T         +K  L           C  +  
Sbjct: 159 CRPFEESGTCKYGEKCQFAHGFHELRSLT-----RHPKYKTEL-----------CRTFHT 202

Query: 523 TGICKFGATCKFDH 482
            G C +G  C F H
Sbjct: 203 IGFCPYGPRCHFIH 216



>gb:D63484_1994818 Human mRNA for KIAA0150 gene, partial cds.
          Length = 944

 Score = 36.2 bits (82), Expect = 1.00
 Identities = 28/117 (23%), Positives = 48/117 (41%), Gaps = 3/117 (2%)
 Frame = -3

Query: 823 LNVGVVNPTASLFQTFDPRLTQTMFGFATTIYPQRPGQVE-CDFYMKTGECKFGERCRFH 647
           L  G ++P  S  ++   R  Q           +R  + E C +Y + G C  GERC + 
Sbjct: 628 LRTGRLDPAGSCSRSLASRAVQRSLAIIRQARQRREKRKEYCMYYNRFGRCNRGERCPYI 687

Query: 646 HPLDHSLSVTSSMEG--EQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDH 482
           H  +     T  + G  ++ +     +    +E    C Y++K GIC   + C + H
Sbjct: 688 HDPEKVAVCTRFVRGTCKKTDGTCPFSHHVSKEKMPVCSYFLK-GICS-NSNCPYSH 742



>gb:BC038670_1982377 Homo sapiens zinc finger CCCH type domain
           containing 3, mRNA (cDNA clone MGC:43116 IMAGE:5260824),
           complete cds.
          Length = 948

 Score = 36.2 bits (82), Expect = 1.00
 Identities = 28/117 (23%), Positives = 48/117 (41%), Gaps = 3/117 (2%)
 Frame = -3

Query: 823 LNVGVVNPTASLFQTFDPRLTQTMFGFATTIYPQRPGQVE-CDFYMKTGECKFGERCRFH 647
           L  G ++P  S  ++   R  Q           +R  + E C +Y + G C  GERC + 
Sbjct: 632 LRTGWLDPAGSCSRSLASRAVQRSLAIIRQARQRREKRKEYCMYYNRFGRCNRGERCPYI 691

Query: 646 HPLDHSLSVTSSMEG--EQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDH 482
           H  +     T  + G  ++ +     +    +E    C Y++K GIC   + C + H
Sbjct: 692 HDPEKVAVCTRFVRGTCKKTDGTCPFSHHVSKEKMRVCSYFLK-GICS-NSNCPYSH 746



>gb:BC005010_1969522 Homo sapiens zinc finger protein 36, C3H
           type-like 2, mRNA (cDNA clone MGC:10502 IMAGE:3640393),
           complete cds.
          Length = 497

 Score = 36.2 bits (82), Expect = 1.00
 Identities = 20/74 (27%), Positives = 30/74 (40%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + ++G CK+GE+C+F H      S+T         +K  L           C  +  
Sbjct: 159 CRPFEESGTCKYGEKCQFAHGFHELRSLT-----RHPKYKTEL-----------CRTFHT 202

Query: 523 TGICKFGATCKFDH 482
            G C +G  C F H
Sbjct: 203 IGFCPYGPRCHFIH 216



>gb:BC001974_1968014 Homo sapiens cDNA clone IMAGE:3457069, partial
           cds.
          Length = 498

 Score = 36.2 bits (82), Expect = 1.00
 Identities = 28/117 (23%), Positives = 48/117 (41%), Gaps = 3/117 (2%)
 Frame = -3

Query: 823 LNVGVVNPTASLFQTFDPRLTQTMFGFATTIYPQRPGQVE-CDFYMKTGECKFGERCRFH 647
           L  G ++P  S  ++   R  Q           +R  + E C +Y + G C  GERC + 
Sbjct: 182 LRTGRLDPAGSCSRSLASRAVQRSLAIIRQARQRREKRKEYCMYYNRFGRCNRGERCPYI 241

Query: 646 HPLDHSLSVTSSMEG--EQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDH 482
           H  +     T  + G  ++ +     +    +E    C Y++K GIC   + C + H
Sbjct: 242 HDPEKVAVCTRFVRGTCKKTDGTCPFSHHVSKEKMPVCSYFLK-GICS-NSNCPYSH 296



>gb:AC124143_1740429 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0053D02, complete sequence.
          Length = 304

 Score = 36.2 bits (82), Expect = 1.00
 Identities = 27/82 (32%), Positives = 41/82 (50%), Gaps = 8/82 (9%)
 Frame = -3

Query: 925 VDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNV----GVVNP-TASLFQTFDPRLT 761
           V+CPFY K G+C++G  C   H +R T++P     N+     ++ P   +  Q  DP   
Sbjct: 16  VNCPFYFKIGACRHGDRCSRLH-NRPTVSPTIVLANMYQRPDMITPGVDAQGQPIDPEKM 74

Query: 760 QTMF-GFATTIYPQ--RPGQVE 704
           Q  F  F   IY +  + G+VE
Sbjct: 75  QEHFEDFYEDIYEELSKFGEVE 96



>gb:OSA18348_1692369 Oryza sativa mRNA for U2 snRNP auxiliary
           factor, small subunit 35b.
          Length = 301

 Score = 36.2 bits (82), Expect = 1.00
 Identities = 27/82 (32%), Positives = 41/82 (50%), Gaps = 8/82 (9%)
 Frame = -3

Query: 925 VDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNV----GVVNP-TASLFQTFDPRLT 761
           V+CPFY K G+C++G  C   H +R T++P     N+     ++ P   +  Q  DP   
Sbjct: 16  VNCPFYFKIGACRHGDRCSRLH-NRPTVSPTIVLANMYQRPDMITPGVDAQGQPIDPEKM 74

Query: 760 QTMF-GFATTIYPQ--RPGQVE 704
           Q  F  F   IY +  + G+VE
Sbjct: 75  QEHFEDFYEDIYEELSKFGEVE 96



>gb:CR382135_1668460 Debaryomyces hansenii chromosome C of strain
           CBS767 of Debaryomyces hansenii.
          Length = 223

 Score = 36.2 bits (82), Expect = 1.00
 Identities = 24/76 (31%), Positives = 31/76 (40%)
 Frame = -3

Query: 706 ECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYM 527
           EC FY K G C     C + H +D  L +      E+           R    I CP ++
Sbjct: 98  ECLFYSKNGFCTQTPECLYLH-VDPQLKIPPCSSYEKGFCPDGPKCANRHIRKIMCPLWL 156

Query: 526 KTGICKFGATCKFDHP 479
            TG C  GA C + HP
Sbjct: 157 -TGFCPKGAECDYTHP 171



>gb:CR380951_1649987 Candida glabrata strain CBS138 chromosome E
           complete sequence.
          Length = 453

 Score = 36.2 bits (82), Expect = 1.00
 Identities = 29/112 (25%), Positives = 43/112 (38%), Gaps = 3/112 (2%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDH-SLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYM 527
           C+ +   G CK+G +C+F H L    L  TS+      NF+              C  + 
Sbjct: 345 CETFTTKGFCKYGNKCQFAHGLQELKLKKTSN------NFRTK-----------PCINWD 387

Query: 526 KTGICKFGATCKFDHPPPG--ELIGGTSQVTSTSVGEEEGYAKLVEAIQKQQ 377
           K G C +G  C F H      ++       T+   G +    KL E   KQ+
Sbjct: 388 KLGYCPYGKRCCFKHGDDRDIQIYKKAGTYTANPDGSDASERKLTEVQIKQK 439



>gb:AK053628_1170499 Mus musculus 0 day neonate eyeball cDNA, RIKEN
           full-length enriched library, clone:E130116A07
           product:weakly similar to ATP DEPENDENT HELICASE
           (FRAGMENT) [Talaromyces emersonii], full insert
           sequence.
          Length = 1025

 Score = 36.2 bits (82), Expect = 1.00
 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 1/29 (3%)
 Frame = -3

Query: 541 CPYYMKTGICKFGATCKFDHP-PPGELIG 458
           C +Y+K G CKFG+ CKF H  PP ++IG
Sbjct: 305 CKFYLK-GNCKFGSKCKFKHEVPPHQMIG 332



 Score = 33.1 bits (74), Expect = 8.4
 Identities = 12/20 (60%), Positives = 15/20 (75%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHH 644
           C FY+K G CKFG +C+F H
Sbjct: 305 CKFYLK-GNCKFGSKCKFKH 323



>gb:AK005006_1152753 Mus musculus adult male liver cDNA, RIKEN
           full-length enriched library, clone:1300014N17
           product:zinc finger protein 36, full insert sequence.
          Length = 307

 Score = 36.2 bits (82), Expect = 1.00
 Identities = 20/80 (25%), Positives = 31/80 (38%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  Y ++G C++G +C+F H L                +K  L           C  +  
Sbjct: 89  CRTYSESGRCRYGAKCQFAHGLGE-----LRQANRHPKYKTEL-----------CHKFYL 132

Query: 523 TGICKFGATCKFDHPPPGEL 464
            G C +G+ C F H P  +L
Sbjct: 133 QGRCPYGSRCHFIHNPTEDL 152



>pir|S49147|S49147 ERF-2 protein - human>gb:HSERF2_2013038 H.sapiens
           ERF-2 mRNA.
          Length = 492

 Score = 36.2 bits (82), Expect = 1.00
 Identities = 20/74 (27%), Positives = 30/74 (40%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + ++G CK+GE+C+F H      S+T         +K  L           C  +  
Sbjct: 159 CRPFEESGTCKYGEKCQFAHGFHELRSLT-----RHPKYKTEL-----------CRTFHT 202

Query: 523 TGICKFGATCKFDH 482
            G C +G  C F H
Sbjct: 203 IGFCPYGPRCHFIH 216



>pir|S04743|S04743 TPA-induced protein 11 - mouse>gb:MMTIS11_2117734
           Mouse TPA-induced TIS11 mRNA.
          Length = 183

 Score = 36.2 bits (82), Expect = 1.00
 Identities = 20/80 (25%), Positives = 31/80 (38%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  Y ++G C++G +C+F H L                +K  L           C  +  
Sbjct: 53  CRTYSESGRCRYGAKCQFAHGLGE-----LRQANRHPKYKTEL-----------CHKFYL 96

Query: 523 TGICKFGATCKFDHPPPGEL 464
            G C +G+ C F H P  +L
Sbjct: 97  QGRCPYGSRCHFIHNPTEDL 116



>sp|Q8IXZ2|ZCC3_HUMAN Zinc finger CCCH type domain containing
           protein 3.
          Length = 948

 Score = 36.2 bits (82), Expect = 1.00
 Identities = 28/117 (23%), Positives = 48/117 (41%), Gaps = 3/117 (2%)
 Frame = -3

Query: 823 LNVGVVNPTASLFQTFDPRLTQTMFGFATTIYPQRPGQVE-CDFYMKTGECKFGERCRFH 647
           L  G ++P  S  ++   R  Q           +R  + E C +Y + G C  GERC + 
Sbjct: 632 LRTGRLDPAGSCSRSLASRAVQRSLAIIRQARQRREKRKEYCMYYNRFGRCNRGERCPYI 691

Query: 646 HPLDHSLSVTSSMEG--EQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDH 482
           H  +     T  + G  ++ +     +    +E    C Y++K GIC   + C + H
Sbjct: 692 HDPEKVAVCTRFVRGTCKKTDGTCPFSHHVSKEKMPVCSYFLK-GICS-NSNCPYSH 746



>sp|P22893|TTP_MOUSE Tristetraproline (TTP) (TIS11A protein) (TIS11)
           (Zinc finger protein 36) (Zfp-36) (Growth
           factor-inducible nuclear protein NUP475) (TPA induced
           sequence 11).>pir|A36600|A36600 growth factor-inducible
           nuclear protein Nup475 - mouse>gb:BC021391_2093420 Mus
           musculus zinc finger protein 36, mRNA (cDNA clone
           MGC:29129 IMAGE:5053664), complete
           cds.>gb:MUSNPGFI_2129429 Mouse growth factor-inducible
           protein mRNA, complete cds.>gb:MUSTS11_2130711 Mouse
           TIS11 primary response gene, complete
           cds.>gb:MUSTTP45_2130727 Mouse tristetraproline (TTP)
           mRNA, complete cds.>gb:MUSZPF36G_2130885 Mus musculus
           tristetraprolin (zpf-36) gene, complete
           cds.>gb:BC086145_2564728 Xenopus laevis hypothetical
           LOC495765, mRNA (cDNA clone MGC:98560 IMAGE:7199257),
           complete cds.
          Length = 319

 Score = 36.2 bits (82), Expect = 1.00
 Identities = 20/80 (25%), Positives = 31/80 (38%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  Y ++G C++G +C+F H L                +K  L           C  +  
Sbjct: 101 CRTYSESGRCRYGAKCQFAHGLGE-----LRQANRHPKYKTEL-----------CHKFYL 144

Query: 523 TGICKFGATCKFDHPPPGEL 464
            G C +G+ C F H P  +L
Sbjct: 145 QGRCPYGSRCHFIHNPTEDL 164



>sp|P23949|TISD_MOUSE Butyrate response factor 2 (TIS11D
           protein).>pir|C39590|C39590 TPA-induced protein 11D -
           mouse>gb:MUSTIS11D_2130649 Mouse TIS11 primary response
           gene, complete cds.
          Length = 367

 Score = 36.2 bits (82), Expect = 1.00
 Identities = 20/74 (27%), Positives = 30/74 (40%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + ++G CK+GE+C+F H      S+T         +K  L           C  +  
Sbjct: 132 CRPFEESGTCKYGEKCQFAHGFHELRSLT-----RHPKYKTEL-----------CRTFHT 175

Query: 523 TGICKFGATCKFDH 482
            G C +G  C F H
Sbjct: 176 IGFCPYGPRCHFIH 189



>sp|P47974|TISD_HUMAN Butyrate response factor 2 (TIS11D protein)
           (EGF-response factor 2) (ERF-2).
          Length = 492

 Score = 36.2 bits (82), Expect = 1.00
 Identities = 20/74 (27%), Positives = 30/74 (40%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + ++G CK+GE+C+F H      S+T         +K  L           C  +  
Sbjct: 159 CRPFEESGTCKYGEKCQFAHGFHELRSLT-----RHPKYKTEL-----------CRTFHT 202

Query: 523 TGICKFGATCKFDH 482
            G C +G  C F H
Sbjct: 203 IGFCPYGPRCHFIH 216



>sp|P47977|CTH2_YEAST Zinc finger protein CTH2 (YTIS11
           protein).>pir|S59328|S59328 TIS11 protein - yeast
           (Saccharomyces cerevisiae)>gb:AY558210_1614437
           Saccharomyces cerevisiae clone FLH111043.01X YLR136C
           gene, complete cds.>gb:S76619_1704523
           YTIS11=non-essential glucose repressible gene
           [Saccharomyces cerevisiae, Genomic, 2084
           nt].>gb:SCX11RA_1710765 S.cerevisiae DNA from chromosome
           XII right arm including ACE2, CKI1, PDC5, SLS1, PUT1 and
           tRNA-Asp genes.>gb:SCYLR136C_1713558 S.cerevisiae
           chromosome XII reading frame ORF
           YLR136c.>gb:YSCL9606_1729728 Saccharomyces cerevisiae
           chromosome XII cosmid 9606.>gb:YSCZFPA_1730940
           Saccharomyces cerevisiae (clone pSK8A1) zinc finger
           protein (CTH2) gene, complete cds.
          Length = 285

 Score = 36.2 bits (82), Expect = 1.00
 Identities = 27/101 (26%), Positives = 40/101 (39%), Gaps = 5/101 (4%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C+ +   G C +G +C+F H L   L V  S     +NF+              C  + K
Sbjct: 175 CESFTLKGSCPYGSKCQFAHGLG-ELKVKKSC----KNFRTK-----------PCVNWEK 218

Query: 523 TGICKFGATCKFDHPPPGEL-----IGGTSQVTSTSVGEEE 416
            G C +G  C F H    ++      G    V+STS   +E
Sbjct: 219 LGYCPYGRRCCFKHGDDNDIAVYVKAGTYCNVSSTSKQSDE 259



>gb:FRNINE1_2572043 Fugu rubripes U2 small nuclear ribonucleoprotein
           auxiliary factor subunit-related protein (U2AF1-RS2), 19
           kDa Golgi adaptor protein adaptin (AP19), and
           phosphorylase kinase alpha 2 subunit (PHKA2) genes,
           complete cds; kelch protein (KELCH1) and kelch protein
           (KELCH2) genes, partial cds; and protein phosphatase 1
           (PPEF-1), X-linked juvenile retinoschisis precursor
           protein (XLRS1), and serine-threonine kinase 9 (STK9)
           genes, complete cds.
          Length = 605

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 12/21 (57%), Positives = 16/21 (76%)
 Frame = -3

Query: 922 DCPFYLKTGSCKYGATCRYNH 860
           +CPF+LKTGSC++G  C   H
Sbjct: 173 NCPFFLKTGSCRFGDRCSRKH 193



 Score = 34.3 bits (77), Expect = 3.8
 Identities = 11/20 (55%), Positives = 15/20 (75%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHH 644
           C F++KTG C+FG+RC   H
Sbjct: 174 CPFFLKTGSCRFGDRCSRKH 193



 Score = 33.1 bits (74), Expect = 8.4
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = -3

Query: 544 HCPYYMKTGICKFGATCKFDHPPP 473
           +CP+++KTG C+FG  C   H  P
Sbjct: 173 NCPFFLKTGSCRFGDRCSRKHVYP 196



>gb:BC084221_2563611 Xenopus laevis cDNA clone MGC:80832
           IMAGE:5514115, complete cds.
          Length = 335

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 20/74 (27%), Positives = 29/74 (39%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + + G CK+GE+C+F H      S+T         +K  L           C  +  
Sbjct: 110 CRPFEENGACKYGEKCQFAHGFHELRSLT-----RHPKYKTEL-----------CRTFHT 153

Query: 523 TGICKFGATCKFDH 482
            G C +G  C F H
Sbjct: 154 IGFCPYGPRCHFIH 167



>gb:AF061982_2471355 Xenopus laevis CCCH zinc finger protein C3H-3
           (C3H-3) mRNA, complete cds.
          Length = 364

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 20/74 (27%), Positives = 29/74 (39%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + + G CK+GE+C+F H      S+T         +K  L           C  +  
Sbjct: 139 CRPFEENGACKYGEKCQFAHGFHELRSLT-----RHPKYKTEL-----------CRTFHT 182

Query: 523 TGICKFGATCKFDH 482
            G C +G  C F H
Sbjct: 183 IGFCPYGPRCHFIH 196



>gb:AB097482_2464754 Xenopus laevis mRNA for hypothetical protein,
           complete cds.
          Length = 364

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 20/74 (27%), Positives = 29/74 (39%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + + G CK+GE+C+F H      S+T         +K  L           C  +  
Sbjct: 139 CRPFEENGACKYGEKCQFAHGFHELRSLT-----RHPKYKTEL-----------CRTFHT 182

Query: 523 TGICKFGATCKFDH 482
            G C +G  C F H
Sbjct: 183 IGFCPYGPRCHFIH 196



>gb:AF409140_1797023 Arabidopsis thaliana U2 auxiliary factor small
           subunit (AUSB) mRNA, complete cds.
          Length = 283

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 41/161 (25%), Positives = 66/161 (40%), Gaps = 13/161 (8%)
 Frame = -3

Query: 925 VDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNV----GVVNPTAS-LFQTFDPRLT 761
           V+CPFY K G+C++G  C   H +R TI+P     N+     ++ P      Q  DP   
Sbjct: 16  VNCPFYFKIGACRHGDRCSRLH-NRPTISPTLLLSNMYQRPDMITPGVDPQGQPLDPSKI 74

Query: 760 QTMF-GFATTIYPQ--RPGQVE-CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQ 593
           Q  F  F   I+ +  + G+VE  +  +   +   G         DH+ +   +++G   
Sbjct: 75  QDHFEDFYEDIFEELNKFGEVESLNVCVNLADHMIGNVYVLFKEEDHAAAALQALQGRFY 134

Query: 592 NFKLSLAGLPR----REGAIHCPYYMKTGICKFGATCKFDH 482
           + +  +A        RE    C  Y +   C  G  C F H
Sbjct: 135 SGRPIIADFSPVTDFREAT--CRQYEENS-CNRGGCCNFMH 172



>gb:CEF38B7_1363617 Caenorhabditis elegans cosmid F38B7, complete
           sequence.
          Length = 419

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 28/113 (24%), Positives = 42/113 (37%), Gaps = 3/113 (2%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  +M  G C +GERC++ H             GE +   +      + E    C  + +
Sbjct: 163 CRSWMDHGRCNYGERCQYAH-------------GELEKRPVPRHPKYKTEA---CQSFHQ 206

Query: 523 TGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEG---YAKLVEAIQKQQQ 374
           +G C +G  C F H  P       S   ST V  +     YA     +  +QQ
Sbjct: 207 SGYCPYGPRCHFIHNEPPSAQSQYSTPISTPVPHQTTPSLYASQYHNVTMKQQ 259



>gb:CEF38B7_1363616 Caenorhabditis elegans cosmid F38B7, complete
           sequence.
          Length = 460

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 28/113 (24%), Positives = 42/113 (37%), Gaps = 3/113 (2%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  +M  G C +GERC++ H             GE +   +      + E    C  + +
Sbjct: 204 CRSWMDHGRCNYGERCQYAH-------------GELEKRPVPRHPKYKTEA---CQSFHQ 247

Query: 523 TGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEG---YAKLVEAIQKQQQ 374
           +G C +G  C F H  P       S   ST V  +     YA     +  +QQ
Sbjct: 248 SGYCPYGPRCHFIHNEPPSAQSQYSTPISTPVPHQTTPSLYASQYHNVTMKQQ 300



>pir|T21955|T21955 hypothetical protein F38B7.1b - Caenorhabditis
           elegans
          Length = 373

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 28/113 (24%), Positives = 42/113 (37%), Gaps = 3/113 (2%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  +M  G C +GERC++ H             GE +   +      + E    C  + +
Sbjct: 163 CRSWMDHGRCNYGERCQYAH-------------GELEKRPVPRHPKYKTEA---CQSFHQ 206

Query: 523 TGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEG---YAKLVEAIQKQQQ 374
           +G C +G  C F H  P       S   ST V  +     YA     +  +QQ
Sbjct: 207 SGYCPYGPRCHFIHNEPPSAQSQYSTPISTPVPHQTTPSLYASQYHNVTMKQQ 259



>pir|T21954|T21954 hypothetical protein F38B7.1a - Caenorhabditis
           elegans
          Length = 414

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 28/113 (24%), Positives = 42/113 (37%), Gaps = 3/113 (2%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  +M  G C +GERC++ H             GE +   +      + E    C  + +
Sbjct: 204 CRSWMDHGRCNYGERCQYAH-------------GELEKRPVPRHPKYKTEA---CQSFHQ 247

Query: 523 TGICKFGATCKFDHPPPGELIGGTSQVTSTSVGEEEG---YAKLVEAIQKQQQ 374
           +G C +G  C F H  P       S   ST V  +     YA     +  +QQ
Sbjct: 248 SGYCPYGPRCHFIHNEPPSAQSQYSTPISTPVPHQTTPSLYASQYHNVTMKQQ 300



>pir|JC6068|JC6068 U2 auxiliary factor small chain - fission yeast
           (Schizosaccharomyces pombe)
          Length = 200

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 15/37 (40%), Positives = 18/37 (48%)
 Frame = -3

Query: 754 MFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHH 644
           M     +IY     +V C FY K G C+ GERC   H
Sbjct: 1   MASHLASIYGTEQDKVNCSFYYKIGACRHGERCSRKH 37



>sp|Q09176|U2AG_SCHPO Splicing factor U2AF 23 kDa subunit (U2
           auxiliary factor 23 kDa subunit) (U2 snRNP auxiliary
           factor small subunit) (U2AF23).>pir|T39243|T39243
           splicing factor u2af 35 kd subunit - fission yeast
           (Schizosaccharomyces pombe)>gb:SPAP8A3_1718609 S.pombe
           chromosome I p1 p8A3.>gb:SPU48234_1722208
           Schizosaccharomyces pombe small subunit of U2AF splicing
           factor spU2AF23 gene, complete cds.
          Length = 216

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 15/37 (40%), Positives = 18/37 (48%)
 Frame = -3

Query: 754 MFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHH 644
           M     +IY     +V C FY K G C+ GERC   H
Sbjct: 1   MASHLASIYGTEQDKVNCSFYYKIGACRHGERCSRKH 37



>sp|Q13434|MKR4_HUMAN Makorin 4 (Zinc finger protein 127-Xp)
           (ZNF127-Xp).>gb:HSU41315_2024156 Human ring zinc-finger
           protein (ZNF127-Xp) gene and 5' flanking sequence.
          Length = 485

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 27/107 (25%), Positives = 39/107 (36%), Gaps = 2/107 (1%)
 Frame = -3

Query: 712 QVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPY 533
           QV C  Y K G CK G+ CR+ H L   L                          + C Y
Sbjct: 93  QVTCR-YFKYGICKEGDNCRYSHDLSDRLC------------------------GVVCKY 127

Query: 532 YMKTGICKFGATCKFDHPPP--GELIGGTSQVTSTSVGEEEGYAKLV 398
           + + G C +G  C+ +H  P   E    T   T +S+      + +V
Sbjct: 128 FQR-GCCVYGDRCRCEHSKPLKQEEATATELTTKSSLAASSSLSSIV 173



>gb:BT019467_2151374 Synthetic construct Homo sapiens zinc finger
           protein 36, C3H type-like 1 mRNA, partial cds.
          Length = 339

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 19/74 (25%), Positives = 30/74 (40%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + + G CK+G++C+F H +    S+T         +K  L           C  +  
Sbjct: 120 CRPFEENGACKYGDKCQFAHGIHELRSLT-----RHPKYKTEL-----------CRTFHT 163

Query: 523 TGICKFGATCKFDH 482
            G C +G  C F H
Sbjct: 164 IGFCPYGPRCHFIH 177



>gb:HSBERG36_2011023 H.sapiens mRNA for early response gene, Berg36.
          Length = 338

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 19/74 (25%), Positives = 30/74 (40%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + + G CK+G++C+F H +    S+T         +K  L           C  +  
Sbjct: 120 CRPFEENGACKYGDKCQFAHGIHELRSLT-----RHPKYKTEL-----------CRTFHT 163

Query: 523 TGICKFGATCKFDH 482
            G C +G  C F H
Sbjct: 164 IGFCPYGPRCHFIH 177



>gb:BC060778_1985689 Homo sapiens DEAH (Asp-Glu-Ala-Asp/His) box
           polypeptide 57, mRNA (cDNA clone IMAGE:30338933),
           complete cds.
          Length = 556

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 1/29 (3%)
 Frame = -3

Query: 541 CPYYMKTGICKFGATCKFDHP-PPGELIG 458
           C +Y+K G CKFG+ C+F H  PP +++G
Sbjct: 203 CKFYLK-GNCKFGSKCRFKHEVPPNQIVG 230



 Score = 34.3 bits (77), Expect = 3.8
 Identities = 13/20 (65%), Positives = 15/20 (75%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHH 644
           C FY+K G CKFG +CRF H
Sbjct: 203 CKFYLK-GNCKFGSKCRFKH 221



>gb:BC009717_1972203 Homo sapiens U11/U12 snRNP 20K, transcript
           variant 2, mRNA (cDNA clone MGC:9510 IMAGE:3890730),
           complete cds.>gb:CR456353_1992644 Homo sapiens
           Em:AC005529.5 full length open reading frame (ORF) cDNA
           clone (cDNA clone
           C22ORF:pGEM.Em:AC005529.5.V2).>gb:CR457393_1993600 Homo
           sapiens full open reading frame cDNA clone
           RZPDo834F0710D for gene LOC55954, hypothetical protein
           LOC55954; complete cds, incl.
           stopcodon.>gb:HS0055295_1996415 Novel human gene mapping
           to chomosome 22.
          Length = 170

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 19/64 (29%), Positives = 27/64 (42%)
 Frame = -3

Query: 754 MFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSL 575
           MF  A  I      +  C  ++ TG+C FG  CRF H  +  L   S    E++  +  L
Sbjct: 40  MFRDAAAILLDEQNKRPCRKFLLTGQCDFGSNCRFSHMSERDLQELSIQVEEERRAREWL 99

Query: 574 AGLP 563
              P
Sbjct: 100 LDAP 103



>gb:AK057423_1912030 Homo sapiens cDNA FLJ32861 fis, clone
           TESTI2003589.
          Length = 433

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 1/29 (3%)
 Frame = -3

Query: 541 CPYYMKTGICKFGATCKFDHP-PPGELIG 458
           C +Y+K G CKFG+ C+F H  PP +++G
Sbjct: 203 CKFYLK-GNCKFGSKCRFKHEVPPNQIVG 230



 Score = 34.3 bits (77), Expect = 3.8
 Identities = 13/20 (65%), Positives = 15/20 (75%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHH 644
           C FY+K G CKFG +CRF H
Sbjct: 203 CKFYLK-GNCKFGSKCRFKH 221



>gb:SPBC337_1719947 S.pombe chromosome II cosmid c337.
          Length = 377

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 14/30 (46%), Positives = 18/30 (60%)
 Frame = -3

Query: 550 AIHCPYYMKTGICKFGATCKFDHPPPGELI 461
           A++C YY   GIC  GA C+F H P  + I
Sbjct: 206 AVYCRYYNANGICGKGAACRFVHEPTRKTI 235



>gb:AY136436_1581936 Arabidopsis thaliana U2 snRNP auxiliary factor
           small subunit (At5g42820) mRNA, complete
           cds.>gb:BT000219_1634497 Arabidopsis thaliana U2 snRNP
           auxiliary factor small subunit (At5g42820) mRNA,
           complete cds.
          Length = 283

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 15/30 (50%), Positives = 21/30 (70%)
 Frame = -3

Query: 925 VDCPFYLKTGSCKYGATCRYNHPDRYTINP 836
           V+CPFY K G+C++G  C   H +R TI+P
Sbjct: 16  VNCPFYFKIGACRHGDRCSRLH-NRPTISP 44



>gb:AX883668_1479428 Sequence 18573 from Patent EP1074617.
          Length = 338

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 19/74 (25%), Positives = 30/74 (40%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + + G CK+G++C+F H +    S+T         +K  L           C  +  
Sbjct: 120 CRPFEENGACKYGDKCQFAHGIHELRSLT-----RHPKYKTEL-----------CRTFHT 163

Query: 523 TGICKFGATCKFDH 482
            G C +G  C F H
Sbjct: 164 IGFCPYGPRCHFIH 177



>gb:CR860870_1184916 Pongo pygmaeus mRNA; cDNA DKFZp469G0620 (from
           clone DKFZp469G0620).
          Length = 338

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 19/74 (25%), Positives = 30/74 (40%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + + G CK+G++C+F H +    S+T         +K  L           C  +  
Sbjct: 120 CRPFEENGACKYGDKCQFAHGIHELRSLT-----RHPKYKTEL-----------CRTFHT 163

Query: 523 TGICKFGATCKFDH 482
            G C +G  C F H
Sbjct: 164 IGFCPYGPRCHFIH 177



>gb:CR857070_1181323 Pongo pygmaeus mRNA; cDNA DKFZp469I134 (from
           clone DKFZp469I134).
          Length = 316

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 19/74 (25%), Positives = 30/74 (40%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + + G CK+G++C+F H +    S+T         +K  L           C  +  
Sbjct: 98  CRPFEENGACKYGDKCQFAHGIHELRSLT-----RHPKYKTEL-----------CRTFHT 141

Query: 523 TGICKFGATCKFDH 482
            G C +G  C F H
Sbjct: 142 IGFCPYGPRCHFIH 155



>gb:AK014200_1157821 Mus musculus 13 days embryo head cDNA, RIKEN
           full-length enriched library, clone:3110050K21
           product:similar to HYPOTHETICAL 139.5 KDA PROTEIN [Homo
           sapiens], full insert sequence.
          Length = 424

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 14/23 (60%), Positives = 16/23 (69%)
 Frame = -3

Query: 928 EVDCPFYLKTGSCKYGATCRYNH 860
           E  C  +LKTGSC YG TCR+ H
Sbjct: 39  ETQCRNWLKTGSCLYGNTCRFIH 61



>pir|T40265|T40265 hypothetical zinc-finger protein - fission yeast 
           (Schizosaccharomyces pombe)
          Length = 356

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 14/30 (46%), Positives = 18/30 (60%)
 Frame = -3

Query: 550 AIHCPYYMKTGICKFGATCKFDHPPPGELI 461
           A++C YY   GIC  GA C+F H P  + I
Sbjct: 185 AVYCRYYNANGICGKGAACRFVHEPTRKTI 214



>pir|B39590|B39590 TPA-induced protein 11B - mouse
          Length = 339

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 19/74 (25%), Positives = 30/74 (40%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + + G CK+G++C+F H +    S+T         +K  L           C  +  
Sbjct: 120 CRPFEENGACKYGDKCQFAHGIHELRSLT-----RHPKYKTEL-----------CRTFHT 163

Query: 523 TGICKFGATCKFDH 482
            G C +G  C F H
Sbjct: 164 IGFCPYGPRCHFIH 177



>sp|P17431|TISB_RAT Butyrate response factor 1 (TIS11B protein)
           (EGF-inducible protein CMG1).>pir|S10471|S10471 cMG1
           protein - rat>gb:RNCMG1_2134654 Rat cMG1 mRNA.
          Length = 338

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 19/74 (25%), Positives = 30/74 (40%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + + G CK+G++C+F H +    S+T         +K  L           C  +  
Sbjct: 120 CRPFEENGACKYGDKCQFAHGIHELRSLT-----RHPKYKTEL-----------CRTFHT 163

Query: 523 TGICKFGATCKFDH 482
            G C +G  C F H
Sbjct: 164 IGFCPYGPRCHFIH 177



>sp|P23950|TISB_MOUSE Butyrate response factor 1 (TIS11B
           protein).>gb:AK036950_1164693 Mus musculus adult female
           vagina cDNA, RIKEN full-length enriched library,
           clone:9930029G08 product:zinc finger protein 36, C3H
           type-like 1, full insert sequence.>gb:AK051035_1169554
           Mus musculus 9 days embryo whole body cDNA, RIKEN
           full-length enriched library, clone:D030058A11
           product:zinc finger protein 36, C3H type-like 1, full
           insert sequence.>gb:MUSTIS11B_2130648 Mouse TIS11
           primary response gene, complete cds.
          Length = 338

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 19/74 (25%), Positives = 30/74 (40%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + + G CK+G++C+F H +    S+T         +K  L           C  +  
Sbjct: 120 CRPFEENGACKYGDKCQFAHGIHELRSLT-----RHPKYKTEL-----------CRTFHT 163

Query: 523 TGICKFGATCKFDH 482
            G C +G  C F H
Sbjct: 164 IGFCPYGPRCHFIH 177



>sp|Q07352|TISB_HUMAN Butyrate response factor 1 (TIS11B protein)
           (EGF-response factor 1) (ERF-1).>pir|S34854|S34854
           epidermal growth factor-response factor 1 -
           human>gb:BC018340_1976489 Homo sapiens zinc finger
           protein 36, C3H type-like 1, mRNA (cDNA clone MGC:9372
           IMAGE:3860353), complete cds.>gb:BT019468_1991081 Homo
           sapiens zinc finger protein 36, C3H type-like 1 mRNA,
           complete cds.>gb:HSERF15_2013037 H. sapiens ERF-1 mRNA
           5' end.
          Length = 338

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 19/74 (25%), Positives = 30/74 (40%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + + G CK+G++C+F H +    S+T         +K  L           C  +  
Sbjct: 120 CRPFEENGACKYGDKCQFAHGIHELRSLT-----RHPKYKTEL-----------CRTFHT 163

Query: 523 TGICKFGATCKFDH 482
            G C +G  C F H
Sbjct: 164 IGFCPYGPRCHFIH 177



>gb:BC045289_2549135 Danio rerio no arches, mRNA (cDNA clone
           MGC:55271 IMAGE:3817884), complete
           cds.>gb:DRU70479_2571367 Danio rerio no arches (nar)
           mRNA, complete cds.
          Length = 271

 Score = 35.0 bits (79), Expect = 2.2
 Identities = 27/87 (31%), Positives = 36/87 (41%)
 Frame = -3

Query: 706 ECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYM 527
           EC FY K GEC   + C F H +D    +      ++   K       R    + C  Y+
Sbjct: 95  ECYFYSKFGECS-NKECPFLH-IDPESKIKDCPWYDRGFCKHGPDCRHRHTRRVICVNYL 152

Query: 526 KTGICKFGATCKFDHPPPGELIGGTSQ 446
             G C  G +CKF HP     +G T Q
Sbjct: 153 -VGFCPEGKSCKFMHPRFELPMGATEQ 178



 Score = 34.7 bits (78), Expect = 2.9
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 3/79 (3%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHSLSVTS---SMEGEQQNFKLSLAGLPRREGAIHC 539
           V C  +++ G CK G++C F H  D +        S  GE  N +     +        C
Sbjct: 66  VVCKHWLR-GLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDC 124

Query: 538 PYYMKTGICKFGATCKFDH 482
           P+Y + G CK G  C+  H
Sbjct: 125 PWYDR-GFCKHGPDCRHRH 142



>gb:AF277173_2483901 Danio rerio Makorin RING zinc-finger protein 1
           (mkrn1) mRNA, partial cds.
          Length = 442

 Score = 35.0 bits (79), Expect = 2.2
 Identities = 21/81 (25%), Positives = 32/81 (39%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYY 530
           V C ++M  G CK GE CR+ H L                           +  + C ++
Sbjct: 25  VTCRYFMH-GLCKEGENCRYSHDLSSC------------------------KQTMICKFF 59

Query: 529 MKTGICKFGATCKFDHPPPGE 467
            K G C FG  C+++H  P +
Sbjct: 60  QK-GCCAFGDRCRYEHTKPSK 79



>gb:AB046743_2462205 Danio rerio nar gene for no arches, partial
           cds.
          Length = 190

 Score = 35.0 bits (79), Expect = 2.2
 Identities = 27/87 (31%), Positives = 36/87 (41%)
 Frame = -3

Query: 706 ECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYM 527
           EC FY K GEC   + C F H +D    +      ++   K       R    + C  Y+
Sbjct: 95  ECYFYTKFGECS-NKECPFLH-IDPESKIKDCPWYDRGFCKHGPDCRHRHTRRVICVNYL 152

Query: 526 KTGICKFGATCKFDHPPPGELIGGTSQ 446
             G C  G +CKF HP     +G T Q
Sbjct: 153 -VGFCPEGKSCKFMHPRFELPMGATEQ 178



 Score = 33.5 bits (75), Expect = 6.5
 Identities = 22/79 (27%), Positives = 34/79 (43%), Gaps = 3/79 (3%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHSLSVTS---SMEGEQQNFKLSLAGLPRREGAIHC 539
           V C  +++ G CK G++C F H  D +        +  GE  N +     +        C
Sbjct: 66  VVCKHWLR-GLCKKGDQCEFLHEYDMTKMPECYFYTKFGECSNKECPFLHIDPESKIKDC 124

Query: 538 PYYMKTGICKFGATCKFDH 482
           P+Y + G CK G  C+  H
Sbjct: 125 PWYDR-GFCKHGPDCRHRH 142



>gb:CR382136_1669337 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 391

 Score = 35.0 bits (79), Expect = 2.2
 Identities = 23/76 (30%), Positives = 28/76 (36%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYY 530
           V C FY + G C+ G  C F H  D SL+                         + C Y+
Sbjct: 42  VPCKFY-RQGVCQAGSSCPFSHNFDGSLAAEK----------------------LPCKYF 78

Query: 529 MKTGICKFGATCKFDH 482
            K G CKFG  C   H
Sbjct: 79  QK-GNCKFGLKCALAH 93



>gb:CR382128_1660853 Yarrowia lipolytica chromosome B of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 388

 Score = 35.0 bits (79), Expect = 2.2
 Identities = 25/89 (28%), Positives = 34/89 (38%), Gaps = 1/89 (1%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYY 530
           V C F+ + G C+ G+ C F H ++ SL                            C Y+
Sbjct: 24  VPCKFF-RQGACQAGDSCVFSHSVETSLQQAP------------------------CKYF 58

Query: 529 MKTGICKFGATCKFDH-PPPGELIGGTSQ 446
            K G CKFG  C   H  P G ++   SQ
Sbjct: 59  QK-GTCKFGVKCALAHILPDGRVLNPRSQ 86



>gb:AY099878_1576903 Arabidopsis thaliana unknown protein
           (At2g02160) mRNA, partial cds.
          Length = 618

 Score = 35.0 bits (79), Expect = 2.2
 Identities = 31/106 (29%), Positives = 42/106 (39%), Gaps = 13/106 (12%)
 Frame = -3

Query: 922 DCPFYLKTG-SCKYGATCRYNHPDRYTINPPAAH--LNVGVVNPTASLFQTFDPRLTQTM 752
           DC ++L +  +CK G  C Y H +   +NP   +  LN   +NP           L    
Sbjct: 34  DCVYFLASPLTCKKGPECEYRHSEYARMNPRDCYYWLNGNCLNPKCGFRHPPLEGLLGNQ 93

Query: 751 FG---------FATTIYPQRPGQ-VECDFYMKTGECKFGERCRFHH 644
            G          AT  +P    Q V C F+ K G C  G+ C F H
Sbjct: 94  GGAPAVSVQPIHATAQHPSVAKQPVPCLFFQK-GMCMKGDMCSFLH 138



>gb:AY059770_1564622 Arabidopsis thaliana unknown protein
           (At2g02160) mRNA, complete cds.
          Length = 669

 Score = 35.0 bits (79), Expect = 2.2
 Identities = 31/106 (29%), Positives = 42/106 (39%), Gaps = 13/106 (12%)
 Frame = -3

Query: 922 DCPFYLKTG-SCKYGATCRYNHPDRYTINPPAAH--LNVGVVNPTASLFQTFDPRLTQTM 752
           DC ++L +  +CK G  C Y H +   +NP   +  LN   +NP           L    
Sbjct: 34  DCVYFLASPLTCKKGPECEYRHSEYARMNPRDCYYWLNGNCLNPKCGFRHPPLEGLLGNQ 93

Query: 751 FG---------FATTIYPQRPGQ-VECDFYMKTGECKFGERCRFHH 644
            G          AT  +P    Q V C F+ K G C  G+ C F H
Sbjct: 94  GGAPAVSVQPIHATAQHPSVAKQPVPCLFFQK-GMCMKGDMCSFLH 138



>gb:DMTICC1_1380253 D.melanogaster TIScc1 mRNA.
          Length = 436

 Score = 35.0 bits (79), Expect = 2.2
 Identities = 18/74 (24%), Positives = 30/74 (40%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + + GECK+GE+C+F H      +V    + + +                +C  +  
Sbjct: 141 CRPFEEAGECKYGEKCQFAHGSHELRNVHRHPKYKTE----------------YCRTFHS 184

Query: 523 TGICKFGATCKFDH 482
            G C +G  C F H
Sbjct: 185 VGFCPYGPRCHFVH 198



>gb:AE014298_1125408 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003490_1212417 Drosophila melanogaster
           chromosome X, section 42 of 74 of the complete sequence.
          Length = 408

 Score = 35.0 bits (79), Expect = 2.2
 Identities = 18/74 (24%), Positives = 30/74 (40%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + + GECK+GE+C+F H      +V    + + +                +C  +  
Sbjct: 113 CRPFEEAGECKYGEKCQFAHGSHELRNVHRHPKYKTE----------------YCRTFHS 156

Query: 523 TGICKFGATCKFDH 482
            G C +G  C F H
Sbjct: 157 VGFCPYGPRCHFVH 170



>gb:AE014298_1125407 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003490_1212416 Drosophila melanogaster
           chromosome X, section 42 of 74 of the complete sequence.
          Length = 436

 Score = 35.0 bits (79), Expect = 2.2
 Identities = 18/74 (24%), Positives = 30/74 (40%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + + GECK+GE+C+F H      +V    + + +                +C  +  
Sbjct: 141 CRPFEEAGECKYGEKCQFAHGSHELRNVHRHPKYKTE----------------YCRTFHS 184

Query: 523 TGICKFGATCKFDH 482
            G C +G  C F H
Sbjct: 185 VGFCPYGPRCHFVH 198



>gb:AE005172_890036 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC005489_1532716 Genomic sequence
           for Arabidopsis thaliana BAC F14N23 from Chromosome 1,
           complete sequence.
          Length = 836

 Score = 35.0 bits (79), Expect = 2.2
 Identities = 12/26 (46%), Positives = 17/26 (65%)
 Frame = -3

Query: 544 HCPYYMKTGICKFGATCKFDHPPPGE 467
           HCP+++KTG C+FG  C   H  P +
Sbjct: 273 HCPFHLKTGACRFGQRCSRVHFYPNK 298



 Score = 35.0 bits (79), Expect = 2.2
 Identities = 12/27 (44%), Positives = 18/27 (66%)
 Frame = -3

Query: 940 IRLGEVDCPFYLKTGSCKYGATCRYNH 860
           I + +  CPF+LKTG+C++G  C   H
Sbjct: 267 IEMDKAHCPFHLKTGACRFGQRCSRVH 293



 Score = 33.1 bits (74), Expect = 8.4
 Identities = 11/23 (47%), Positives = 16/23 (69%)
 Frame = -3

Query: 712 QVECDFYMKTGECKFGERCRFHH 644
           +  C F++KTG C+FG+RC   H
Sbjct: 271 KAHCPFHLKTGACRFGQRCSRVH 293



>pir|F84433|F84433 hypothetical protein At2g02160 [imported] -
           Arabidopsis thaliana>gb:AC005936_1533217 Arabidopsis
           thaliana chromosome 2 clone F5O4 map CIC11A04, complete
           sequence.>gb:BT000894_1635149 Arabidopsis thaliana clone
           C104823 unknown protein (At2g02160) mRNA, complete cds.
          Length = 669

 Score = 35.0 bits (79), Expect = 2.2
 Identities = 31/106 (29%), Positives = 42/106 (39%), Gaps = 13/106 (12%)
 Frame = -3

Query: 922 DCPFYLKTG-SCKYGATCRYNHPDRYTINPPAAH--LNVGVVNPTASLFQTFDPRLTQTM 752
           DC ++L +  +CK G  C Y H +   +NP   +  LN   +NP           L    
Sbjct: 34  DCVYFLASPLTCKKGPECEYRHSEYARMNPRDCYYWLNGNCLNPKCGFRHPPLEGLLGNQ 93

Query: 751 FG---------FATTIYPQRPGQ-VECDFYMKTGECKFGERCRFHH 644
            G          AT  +P    Q V C F+ K G C  G+ C F H
Sbjct: 94  GGAPAVSVQPIHATAQHPSVAKQPVPCLFFQK-GMCMKGDMCSFLH 138



>sp|P53781|TTP_BOVIN Tristetraproline (TTP) (TIS11A protein) (TIS11)
           (Zinc finger protein 36 homolog)
           (Zfp-36).>gb:BOVZPF36G_1435950 Bos taurus (clone Sal3.8)
           tristetraprolin (zpf-36) gene, complete cds.
          Length = 324

 Score = 35.0 bits (79), Expect = 2.2
 Identities = 19/80 (23%), Positives = 32/80 (40%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + ++G C++G +C+F H L      +         +K  L           C  +  
Sbjct: 107 CRTFSESGRCRYGAKCQFAHGLGELRQAS-----RHPKYKTEL-----------CHKFYL 150

Query: 523 TGICKFGATCKFDHPPPGEL 464
            G C +G+ C F H P  +L
Sbjct: 151 QGRCPYGSRCHFIHNPSEDL 170



>sp|P47980|TIS1_DROME TIS11 protein (dTIS11).>gb:DMU13397_1380428
           Drosophila melanogaster DTIS11 protein mRNA, complete
           cds.
          Length = 437

 Score = 35.0 bits (79), Expect = 2.2
 Identities = 18/74 (24%), Positives = 30/74 (40%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + + GECK+GE+C+F H      +V    + + +                +C  +  
Sbjct: 142 CRPFEEAGECKYGEKCQFAHGSHELRNVHRHPKYKTE----------------YCRTFHS 185

Query: 523 TGICKFGATCKFDH 482
            G C +G  C F H
Sbjct: 186 VGFCPYGPRCHFVH 199



>gb:AE014134_1127518 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003575_1216082 Drosophila melanogaster
           chromosome 2L, section 16 of 83 of the complete
           sequence.
          Length = 446

 Score = 30.8 bits (68), Expect(2) = 2.8
 Identities = 9/20 (45%), Positives = 13/20 (65%)
 Frame = -3

Query: 919 CPFYLKTGSCKYGATCRYNH 860
           C F+ +T  C+YG  C +NH
Sbjct: 170 CEFFSRTNCCRYGHACTFNH 189



 Score = 22.7 bits (47), Expect(2) = 2.8
 Identities = 12/36 (33%), Positives = 17/36 (47%)
 Frame = -1

Query: 819 MLGLLIQLPHFFKHLTLD*LKQCLDLPQLSTHNGLD 712
           MLG ++ + HFF H  L   K+C      S    L+
Sbjct: 193 MLGRILLIRHFFNHSMLQ--KRCTHKEYASAEEHLE 226



>gb:BC080440_2561729 Xenopus tropicalis cpsf4-prov protein, mRNA
           (cDNA clone MGC:89186 IMAGE:7016767), complete cds.
          Length = 269

 Score = 34.7 bits (78), Expect = 2.9
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 3/79 (3%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHSLSVTS---SMEGEQQNFKLSLAGLPRREGAIHC 539
           V C  +++ G CK G++C F H  D +        S  GE  N +     +        C
Sbjct: 66  VVCKHWLR-GLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDC 124

Query: 538 PYYMKTGICKFGATCKFDH 482
           P+Y + G CK G  C+  H
Sbjct: 125 PWYDR-GFCKHGPLCRHRH 142



 Score = 33.5 bits (75), Expect = 6.5
 Identities = 27/87 (31%), Positives = 35/87 (40%)
 Frame = -3

Query: 706 ECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYM 527
           EC FY K GEC   + C F H +D    +      ++   K       R    + C  Y+
Sbjct: 95  ECYFYSKFGECS-NKECPFLH-IDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYL 152

Query: 526 KTGICKFGATCKFDHPPPGELIGGTSQ 446
             G C  G  CKF HP     +G T Q
Sbjct: 153 -VGFCIEGPNCKFMHPRFELPMGTTEQ 178



>gb:BC075128_2558241 Xenopus laevis MGC81862 protein, mRNA (cDNA
           clone MGC:81862 IMAGE:7008442), complete cds.
          Length = 269

 Score = 34.7 bits (78), Expect = 2.9
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 3/79 (3%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHSLSVTS---SMEGEQQNFKLSLAGLPRREGAIHC 539
           V C  +++ G CK G++C F H  D +        S  GE  N +     +        C
Sbjct: 66  VVCKHWLR-GLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDC 124

Query: 538 PYYMKTGICKFGATCKFDH 482
           P+Y + G CK G  C+  H
Sbjct: 125 PWYDR-GFCKHGPLCRHRH 142



 Score = 33.1 bits (74), Expect = 8.4
 Identities = 24/76 (31%), Positives = 31/76 (40%)
 Frame = -3

Query: 706 ECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYM 527
           EC FY K GEC   + C F H +D    +      ++   K       R    + C  Y+
Sbjct: 95  ECYFYSKFGECS-NKECPFLH-IDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYL 152

Query: 526 KTGICKFGATCKFDHP 479
             G C  G  CKF HP
Sbjct: 153 -VGFCIEGPNCKFMHP 167



>gb:BC074368_2557877 Xenopus laevis MGC84269 protein, mRNA (cDNA
           clone MGC:84269 IMAGE:6956408), complete cds.
          Length = 408

 Score = 34.7 bits (78), Expect = 2.9
 Identities = 27/101 (26%), Positives = 40/101 (39%), Gaps = 2/101 (1%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYY 530
           V C +++  G CK G  CR+ H L  S S                        A+ C Y+
Sbjct: 38  VTCRYFIH-GVCKEGINCRYSHDLATSRS------------------------AMICRYF 72

Query: 529 MKTGICKFGATCKFDHPPP--GELIGGTSQVTSTSVGEEEG 413
            + G C +G  C+++H  P   +  G T    S S+ E  G
Sbjct: 73  QR-GCCAYGDRCRYEHNKPLQEDPTGDTCTAPSESLPEPSG 112



>gb:BC063991_2553691 Danio rerio zgc:77882, mRNA (cDNA clone
           MGC:77882 IMAGE:6996576), complete
           cds.>gb:BX649319_2567748 Zebrafish DNA sequence from
           clone DKEYP-88E3 in linkage group 20 Contains two novel
           genes, complete sequence.
          Length = 348

 Score = 34.7 bits (78), Expect = 2.9
 Identities = 21/84 (25%), Positives = 32/84 (38%), Gaps = 7/84 (8%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + + G CK+G++C+F H +    S+          +K  L           C  +  
Sbjct: 143 CRPFEENGTCKYGDKCQFAHGMHELRSL-----NRHPKYKTEL-----------CRTFHS 186

Query: 523 TGICKFGATCKFDH-------PPP 473
            G C +G  C F H       PPP
Sbjct: 187 IGYCPYGPRCHFIHNAEERRGPPP 210



>gb:BC089824_2111022 Rattus norvegicus similar to CPSF4 protein,
           mRNA (cDNA clone MGC:108785 IMAGE:7309116), complete
           cds.
          Length = 243

 Score = 34.7 bits (78), Expect = 2.9
 Identities = 27/87 (31%), Positives = 36/87 (41%)
 Frame = -3

Query: 706 ECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYM 527
           EC FY K GEC   + C F H +D    +      ++   K       R    + C  Y+
Sbjct: 95  ECYFYSKFGECS-NKECPFLH-IDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYL 152

Query: 526 KTGICKFGATCKFDHPPPGELIGGTSQ 446
             G C  G +CKF HP     +G T Q
Sbjct: 153 -VGFCPEGPSCKFMHPRFELPMGTTEQ 178



 Score = 34.7 bits (78), Expect = 2.9
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 3/79 (3%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHSLSVTS---SMEGEQQNFKLSLAGLPRREGAIHC 539
           V C  +++ G CK G++C F H  D +        S  GE  N +     +        C
Sbjct: 66  VVCKHWLR-GLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDC 124

Query: 538 PYYMKTGICKFGATCKFDH 482
           P+Y + G CK G  C+  H
Sbjct: 125 PWYDR-GFCKHGPLCRHRH 142



>gb:BC057067_2102568 Mus musculus cleavage and polyadenylation
           specific factor 4, mRNA (cDNA clone MGC:67409
           IMAGE:5689404), complete cds.
          Length = 159

 Score = 34.7 bits (78), Expect = 2.9
 Identities = 27/87 (31%), Positives = 36/87 (41%)
 Frame = -3

Query: 706 ECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYM 527
           EC FY K GEC   + C F H +D    +      ++   K       R    + C  Y+
Sbjct: 42  ECYFYSKFGECS-NKECPFLH-IDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYL 99

Query: 526 KTGICKFGATCKFDHPPPGELIGGTSQ 446
             G C  G +CKF HP     +G T Q
Sbjct: 100 -VGFCPEGPSCKFMHPRFELPMGTTEQ 125



 Score = 34.7 bits (78), Expect = 2.9
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 3/79 (3%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHSLSVTS---SMEGEQQNFKLSLAGLPRREGAIHC 539
           V C  +++ G CK G++C F H  D +        S  GE  N +     +        C
Sbjct: 13  VVCKHWLR-GLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDC 71

Query: 538 PYYMKTGICKFGATCKFDH 482
           P+Y + G CK G  C+  H
Sbjct: 72  PWYDR-GFCKHGPLCRHRH 89



>gb:AF033201_2051666 Mus musculus clipper/cleavage and
           polyadenylation specificity factor 30 kDa subunit
           homolog mRNA, partial cds.
          Length = 208

 Score = 34.7 bits (78), Expect = 2.9
 Identities = 27/87 (31%), Positives = 36/87 (41%)
 Frame = -3

Query: 706 ECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYM 527
           EC FY K GEC   + C F H +D    +      ++   K       R    + C  Y+
Sbjct: 82  ECYFYSKFGECS-NKECPFLH-IDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYL 139

Query: 526 KTGICKFGATCKFDHPPPGELIGGTSQ 446
             G C  G +CKF HP     +G T Q
Sbjct: 140 -VGFCPEGPSCKFMHPRFELPMGTTEQ 165



 Score = 34.7 bits (78), Expect = 2.9
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 3/79 (3%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHSLSVTS---SMEGEQQNFKLSLAGLPRREGAIHC 539
           V C  +++ G CK G++C F H  D +        S  GE  N +     +        C
Sbjct: 53  VVCKHWLR-GLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDC 111

Query: 538 PYYMKTGICKFGATCKFDH 482
           P+Y + G CK G  C+  H
Sbjct: 112 PWYDR-GFCKHGPLCRHRH 129



>gb:HUMU2AF1RA_2037962 Homo sapiens U2AF1-RS1 mRNA, complete cds.
          Length = 479

 Score = 34.7 bits (78), Expect = 2.9
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = -3

Query: 712 QVECDFYMKTGECKFGERCRFHH 644
           +  C FY KTG C+FG+RC   H
Sbjct: 174 RANCPFYSKTGACRFGDRCSRKH 196



 Score = 33.9 bits (76), Expect = 4.9
 Identities = 11/21 (52%), Positives = 15/21 (71%)
 Frame = -3

Query: 922 DCPFYLKTGSCKYGATCRYNH 860
           +CPFY KTG+C++G  C   H
Sbjct: 176 NCPFYSKTGACRFGDRCSRKH 196



 Score = 33.5 bits (75), Expect = 6.5
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = -3

Query: 544 HCPYYMKTGICKFGATCKFDHPPP 473
           +CP+Y KTG C+FG  C   H  P
Sbjct: 176 NCPFYSKTGACRFGDRCSRKHNFP 199



>gb:BC050738_1984515 Homo sapiens cleavage and polyadenylation
           specific factor 4, 30kDa, mRNA (cDNA clone MGC:60384
           IMAGE:6199123), complete cds.
          Length = 243

 Score = 34.7 bits (78), Expect = 2.9
 Identities = 27/87 (31%), Positives = 36/87 (41%)
 Frame = -3

Query: 706 ECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYM 527
           EC FY K GEC   + C F H +D    +      ++   K       R    + C  Y+
Sbjct: 95  ECYFYSKFGECS-NKECPFLH-IDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYL 152

Query: 526 KTGICKFGATCKFDHPPPGELIGGTSQ 446
             G C  G +CKF HP     +G T Q
Sbjct: 153 -VGFCPEGPSCKFMHPRFELPMGTTEQ 178



 Score = 34.7 bits (78), Expect = 2.9
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 3/79 (3%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHSLSVTS---SMEGEQQNFKLSLAGLPRREGAIHC 539
           V C  +++ G CK G++C F H  D +        S  GE  N +     +        C
Sbjct: 66  VVCKHWLR-GLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDC 124

Query: 538 PYYMKTGICKFGATCKFDH 482
           P+Y + G CK G  C+  H
Sbjct: 125 PWYDR-GFCKHGPLCRHRH 142



>gb:BC050451_1984353 Homo sapiens U2(RNU2) small nuclear RNA
           auxiliary factor 1-like 2, mRNA (cDNA clone
           IMAGE:6499970), partial cds.
          Length = 487

 Score = 34.7 bits (78), Expect = 2.9
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = -3

Query: 712 QVECDFYMKTGECKFGERCRFHH 644
           +  C FY KTG C+FG+RC   H
Sbjct: 174 RANCPFYSKTGACRFGDRCSRKH 196



 Score = 33.9 bits (76), Expect = 4.9
 Identities = 11/21 (52%), Positives = 15/21 (71%)
 Frame = -3

Query: 922 DCPFYLKTGSCKYGATCRYNH 860
           +CPFY KTG+C++G  C   H
Sbjct: 176 NCPFYSKTGACRFGDRCSRKH 196



 Score = 33.5 bits (75), Expect = 6.5
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = -3

Query: 544 HCPYYMKTGICKFGATCKFDHPPP 473
           +CP+Y KTG C+FG  C   H  P
Sbjct: 176 NCPFYSKTGACRFGDRCSRKHNFP 199



>gb:BC034435_1981282 Homo sapiens zinc finger CCCH type domain
           containing 3, mRNA (cDNA clone IMAGE:5166541), complete
           cds.
          Length = 335

 Score = 34.7 bits (78), Expect = 2.9
 Identities = 27/114 (23%), Positives = 47/114 (41%), Gaps = 3/114 (2%)
 Frame = -3

Query: 814 GVVNPTASLFQTFDPRLTQTMFGFATTIYPQRPGQVE-CDFYMKTGECKFGERCRFHHPL 638
           G ++P  S  ++   R  Q           +R  + E C +Y + G C  GERC + H  
Sbjct: 22  GRLDPAGSCSRSLASRAVQRSLAIIRQARQRREKRKEYCMYYNRFGRCNRGERCPYIHDP 81

Query: 637 DHSLSVTSSMEG--EQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDH 482
           +     T  + G  ++ +     +    +E    C Y++K GIC   + C + H
Sbjct: 82  EKVAVCTRFVRGTCKKTDGTCPFSHHVSKEKMPVCSYFLK-GICS-NSNCPYSH 133



>gb:BC021186_1977403 Homo sapiens U2(RNU2) small nuclear RNA
           auxiliary factor 1-like 3, mRNA (cDNA clone MGC:33901
           IMAGE:5260387), complete cds.
          Length = 202

 Score = 34.7 bits (78), Expect = 2.9
 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 1/51 (1%)
 Frame = -3

Query: 754 MFGFATTIYPQRPGQVECDFYMKTGECKFGERC-RFHHPLDHSLSVTSSME 605
           M  +  +I+     +V C FY K G C+ G+RC R H+    S  V + ++
Sbjct: 1   MAEYLASIFGTEKDKVNCSFYFKIGVCRHGDRCSRLHNKPTFSQEVFTELQ 51



>gb:BC003101_1968687 Homo sapiens cleavage and polyadenylation
           specific factor 4, 30kDa, mRNA (cDNA clone MGC:1870
           IMAGE:3356071), complete cds.
          Length = 244

 Score = 34.7 bits (78), Expect = 2.9
 Identities = 27/87 (31%), Positives = 36/87 (41%)
 Frame = -3

Query: 706 ECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYM 527
           EC FY K GEC   + C F H +D    +      ++   K       R    + C  Y+
Sbjct: 95  ECYFYSKFGECS-NKECPFLH-IDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYL 152

Query: 526 KTGICKFGATCKFDHPPPGELIGGTSQ 446
             G C  G +CKF HP     +G T Q
Sbjct: 153 -VGFCPEGPSCKFMHPRFELPMGTTEQ 178



 Score = 34.7 bits (78), Expect = 2.9
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 3/79 (3%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHSLSVTS---SMEGEQQNFKLSLAGLPRREGAIHC 539
           V C  +++ G CK G++C F H  D +        S  GE  N +     +        C
Sbjct: 66  VVCKHWLR-GLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDC 124

Query: 538 PYYMKTGICKFGATCKFDH 482
           P+Y + G CK G  C+  H
Sbjct: 125 PWYDR-GFCKHGPLCRHRH 142



>gb:BTU96448_1437868 Bos taurus cleavage and polyadenylation
           specificity factor 30 kDa subunit mRNA, complete cds.
          Length = 243

 Score = 34.7 bits (78), Expect = 2.9
 Identities = 27/87 (31%), Positives = 36/87 (41%)
 Frame = -3

Query: 706 ECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYM 527
           EC FY K GEC   + C F H +D    +      ++   K       R    + C  Y+
Sbjct: 95  ECYFYSKFGECS-NKECPFLH-IDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYL 152

Query: 526 KTGICKFGATCKFDHPPPGELIGGTSQ 446
             G C  G +CKF HP     +G T Q
Sbjct: 153 -VGFCPEGPSCKFMHPRFELPMGTTEQ 178



 Score = 34.7 bits (78), Expect = 2.9
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 3/79 (3%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHSLSVTS---SMEGEQQNFKLSLAGLPRREGAIHC 539
           V C  +++ G CK G++C F H  D +        S  GE  N +     +        C
Sbjct: 66  VVCKHWLR-GLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDC 124

Query: 538 PYYMKTGICKFGATCKFDH 482
           P+Y + G CK G  C+  H
Sbjct: 125 PWYDR-GFCKHGPLCRHRH 142



>gb:AY462109_1430396 Ovis aries tristetraprolin mRNA, complete cds.
          Length = 325

 Score = 34.7 bits (78), Expect = 2.9
 Identities = 19/80 (23%), Positives = 31/80 (38%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  + ++G C++G +C+F H L                +K  L           C  +  
Sbjct: 107 CRTFSESGRCRYGAKCQFAHGLGE-----LRQPSRHPKYKTEL-----------CHKFYL 150

Query: 523 TGICKFGATCKFDHPPPGEL 464
            G C +G+ C F H P  +L
Sbjct: 151 QGRCPYGSRCHFIHNPSEDL 170



>pir|T26177|T26177 hypothetical protein W05B10.2 - Caenorhabditis
           elegans>gb:CEW05B10_1368920 Caenorhabditis elegans
           cosmid W05B10, complete sequence.
          Length = 200

 Score = 34.7 bits (78), Expect = 2.9
 Identities = 13/34 (38%), Positives = 23/34 (67%)
 Frame = -3

Query: 724 QRPGQVECDFYMKTGECKFGERCRFHHPLDHSLS 623
           ++  +  C  Y+K G+C+FG++CRF HP+ +  S
Sbjct: 132 RKKSKFTCKNYLK-GKCRFGDKCRFSHPVHNRSS 164



>pir|T26081|T26081 hypothetical protein W02A2.7 - Caenorhabditis
           elegans>gb:CEW02A2_1368816 Caenorhabditis elegans cosmid
           W02A2, complete sequence.
          Length = 468

 Score = 34.7 bits (78), Expect = 2.9
 Identities = 20/70 (28%), Positives = 26/70 (37%)
 Frame = -3

Query: 676 CKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGAT 497
           C  G RC+F H L    +  +        +K  L     R G         TG C +G  
Sbjct: 286 CDMGARCKFAHGLKELRATDAPARYPNNKYKTKLCKNFARGG---------TGFCPYGLR 336

Query: 496 CKFDHPPPGE 467
           C+F HP   E
Sbjct: 337 CEFVHPTDKE 346



>sp|Q62377|U2R2_MOUSE U2 small nuclear ribonucleoprotein auxiliary
           factor 35 kDa subunit related-protein 2 (U2(RNU2) small
           nuclear RNA auxillary factor 1-like
           2).>pir|A57120|A57120 small nuclear ribonucleoprotein
           auxiliary factor U2 - mouse>gb:MUSU2AF1R2_2130754 Mouse
           U2af1-rs2 mRNA, complete cds.
          Length = 462

 Score = 34.7 bits (78), Expect = 2.9
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = -3

Query: 712 QVECDFYMKTGECKFGERCRFHH 644
           +  C FY KTG C+FG+RC   H
Sbjct: 173 RANCPFYSKTGACRFGDRCSRKH 195



 Score = 34.3 bits (77), Expect = 3.8
 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 3/32 (9%)
 Frame = -3

Query: 946 LPIRLGEVD---CPFYLKTGSCKYGATCRYNH 860
           + IR+ E D   CPFY KTG+C++G  C   H
Sbjct: 164 MDIRVLEKDRANCPFYSKTGACRFGDRCSRKH 195



 Score = 33.5 bits (75), Expect = 6.5
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = -3

Query: 544 HCPYYMKTGICKFGATCKFDHPPP 473
           +CP+Y KTG C+FG  C   H  P
Sbjct: 175 NCPFYSKTGACRFGDRCSRKHNFP 198



>sp|Q15696|U2R2_HUMAN U2 small nuclear ribonucleoprotein auxiliary
           factor 35 kDa subunit related-protein 2 (U2(RNU2) small
           nuclear RNA auxillary factor 1-like
           2).>gb:HUMU2AF1RB_2037963 Homo sapiens U2AF1-RS2 mRNA,
           complete cds.
          Length = 482

 Score = 34.7 bits (78), Expect = 2.9
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = -3

Query: 712 QVECDFYMKTGECKFGERCRFHH 644
           +  C FY KTG C+FG+RC   H
Sbjct: 169 RANCPFYSKTGACRFGDRCSRKH 191



 Score = 33.9 bits (76), Expect = 4.9
 Identities = 11/21 (52%), Positives = 15/21 (71%)
 Frame = -3

Query: 922 DCPFYLKTGSCKYGATCRYNH 860
           +CPFY KTG+C++G  C   H
Sbjct: 171 NCPFYSKTGACRFGDRCSRKH 191



 Score = 33.5 bits (75), Expect = 6.5
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = -3

Query: 544 HCPYYMKTGICKFGATCKFDHPPP 473
           +CP+Y KTG C+FG  C   H  P
Sbjct: 171 NCPFYSKTGACRFGDRCSRKHNFP 194



>sp|Q15695|U2R1_HUMAN U2 small nuclear ribonucleoprotein auxiliary
           factor 35 kDa subunit related-protein 1 (U2(RNU2) small
           nuclear RNA auxillary factor 1-like
           1).>gb:HSU51224_2024691 Homo sapiens U2AFBPL (U2AFBPL)
           gene, complete cds.
          Length = 479

 Score = 34.7 bits (78), Expect = 2.9
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = -3

Query: 712 QVECDFYMKTGECKFGERCRFHH 644
           +  C FY KTG C+FG+RC   H
Sbjct: 174 RANCPFYSKTGACRFGDRCSRKH 196



 Score = 33.9 bits (76), Expect = 4.9
 Identities = 11/21 (52%), Positives = 15/21 (71%)
 Frame = -3

Query: 922 DCPFYLKTGSCKYGATCRYNH 860
           +CPFY KTG+C++G  C   H
Sbjct: 176 NCPFYSKTGACRFGDRCSRKH 196



 Score = 33.5 bits (75), Expect = 6.5
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = -3

Query: 544 HCPYYMKTGICKFGATCKFDHPPP 473
           +CP+Y KTG C+FG  C   H  P
Sbjct: 176 NCPFYSKTGACRFGDRCSRKHNFP 199



>sp|Q06053|DUS3_YEAST tRNA-dihydrouridine synthase 3 (EC
           1.-.-.-).>pir|S55957|S55957 hypothetical protein YLR401c
           - yeast (Saccharomyces cerevisiae)>gb:YSCL8084_1729534
           Saccharomyces cerevisiae chromosome XII cosmid 8084.
          Length = 609

 Score = 34.7 bits (78), Expect = 2.9
 Identities = 20/64 (31%), Positives = 26/64 (40%)
 Frame = -3

Query: 679 ECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGA 500
           +C FG+ CRF H ++  LS T   E E   F               CP +   G C  G 
Sbjct: 108 KCSFGDNCRFVHDINLYLS-TKKPEVESNIFP-------------SCPVFNSLGFCPMGF 153

Query: 499 TCKF 488
            C+F
Sbjct: 154 KCRF 157



>sp|O95639|CPSD_HUMAN Cleavage and polyadenylation specificity
           factor, 30 kDa subunit (CPSF 30 kDa subunit) (NS1
           effector domain-binding protein 1) (Neb-1) (No arches
           homolog).>gb:CR542161_1994387 Homo sapiens full open
           reading frame cDNA clone RZPDo834C0424D for gene CPSF4,
           cleavage and polyadenylation specific factor 4, 30kDa;
           complete cds, without stopcodon.>gb:HSU79569_2026262
           Human no arches (nar) mRNA, complete cds.
          Length = 269

 Score = 34.7 bits (78), Expect = 2.9
 Identities = 27/87 (31%), Positives = 36/87 (41%)
 Frame = -3

Query: 706 ECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYM 527
           EC FY K GEC   + C F H +D    +      ++   K       R    + C  Y+
Sbjct: 95  ECYFYSKFGECS-NKECPFLH-IDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYL 152

Query: 526 KTGICKFGATCKFDHPPPGELIGGTSQ 446
             G C  G +CKF HP     +G T Q
Sbjct: 153 -VGFCPEGPSCKFMHPRFELPMGTTEQ 178



 Score = 34.7 bits (78), Expect = 2.9
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 3/79 (3%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHSLSVTS---SMEGEQQNFKLSLAGLPRREGAIHC 539
           V C  +++ G CK G++C F H  D +        S  GE  N +     +        C
Sbjct: 66  VVCKHWLR-GLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDC 124

Query: 538 PYYMKTGICKFGATCKFDH 482
           P+Y + G CK G  C+  H
Sbjct: 125 PWYDR-GFCKHGPLCRHRH 142



>gb:AY122140_1301502 Drosophila melanogaster GM14666 full insert
           cDNA.
          Length = 321

 Score = 30.8 bits (68), Expect(2) = 2.9
 Identities = 9/20 (45%), Positives = 13/20 (65%)
 Frame = -3

Query: 919 CPFYLKTGSCKYGATCRYNH 860
           C F+ +T  C+YG  C +NH
Sbjct: 177 CEFFSRTNCCRYGHACTFNH 196



 Score = 22.7 bits (47), Expect(2) = 2.9
 Identities = 12/36 (33%), Positives = 17/36 (47%)
 Frame = -1

Query: 819 MLGLLIQLPHFFKHLTLD*LKQCLDLPQLSTHNGLD 712
           MLG ++ + HFF H  L   K+C      S    L+
Sbjct: 200 MLGRILLIRHFFNHSMLQ--KRCTHKEYASAEEHLE 233



>gb:AE014134_1127519 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003575_1216083 Drosophila melanogaster
           chromosome 2L, section 16 of 83 of the complete
           sequence.
          Length = 314

 Score = 30.8 bits (68), Expect(2) = 2.9
 Identities = 9/20 (45%), Positives = 13/20 (65%)
 Frame = -3

Query: 919 CPFYLKTGSCKYGATCRYNH 860
           C F+ +T  C+YG  C +NH
Sbjct: 170 CEFFSRTNCCRYGHACTFNH 189



 Score = 22.7 bits (47), Expect(2) = 2.9
 Identities = 12/36 (33%), Positives = 17/36 (47%)
 Frame = -1

Query: 819 MLGLLIQLPHFFKHLTLD*LKQCLDLPQLSTHNGLD 712
           MLG ++ + HFF H  L   K+C      S    L+
Sbjct: 193 MLGRILLIRHFFNHSMLQ--KRCTHKEYASAEEHLE 226



>gb:GGA291762_2572760 Gallus gallus U2AF1 gene for U2snRNP auxiliary
           factor small subunit, exons 1-8.>gb:GGA291763_2572761
           Gallus gallus mRNA for U2snRNP auxiliary factor small
           subunit class 1, (U2AF1 gene).>gb:GGA291764_2572762
           Gallus gallus mRNA for U2snRNP auxiliary factor small
           subunit class 2, (U2AF1 gene).
          Length = 237

 Score = 34.3 bits (77), Expect = 3.8
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
 Frame = -3

Query: 754 MFGFATTIYPQRPGQVECDFYMKTGECKFGERC-RFHHPLDHSLSVT-SSMEGEQQNFKL 581
           M  +  +I+     +V C FY K G C+ G+RC R H+    S ++   ++    QN   
Sbjct: 1   MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQ 60

Query: 580 SLAGL 566
           S  GL
Sbjct: 61  SADGL 65



>gb:BC058066_2552254 Danio rerio zgc:63779, mRNA (cDNA clone
           MGC:63779 IMAGE:2643345), complete cds.
          Length = 660

 Score = 34.3 bits (77), Expect = 3.8
 Identities = 17/63 (26%), Positives = 27/63 (42%)
 Frame = -3

Query: 676 CKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGAT 497
           C +GE+CRF H +   LS  ++  G+Q                  C  +   G C +G T
Sbjct: 103 CPYGEKCRFLHDVSEYLSTKAADLGDQ------------------CHLFNTLGKCPYGLT 144

Query: 496 CKF 488
           C++
Sbjct: 145 CRY 147



>gb:BC019000_1976692 Homo sapiens KIAA0853, mRNA (cDNA clone
           IMAGE:3607400), partial cds.
          Length = 283

 Score = 34.3 bits (77), Expect = 3.8
 Identities = 13/23 (56%), Positives = 16/23 (69%)
 Frame = -3

Query: 928 EVDCPFYLKTGSCKYGATCRYNH 860
           E  C  +LKTG+C YG TCR+ H
Sbjct: 39  ETQCRNWLKTGNCLYGNTCRFVH 61



>gb:AY283618_1941905 Homo sapiens hypothetical protein mRNA,
           complete cds.
          Length = 1564

 Score = 34.3 bits (77), Expect = 3.8
 Identities = 13/23 (56%), Positives = 16/23 (69%)
 Frame = -3

Query: 928 EVDCPFYLKTGSCKYGATCRYNH 860
           E  C  +LKTG+C YG TCR+ H
Sbjct: 39  ETQCRNWLKTGNCLYGNTCRFVH 61



>gb:AL157758_1921003 Human DNA sequence from clone RP11-106H11 on
           chromosome 13 Contains the 5' end of a novel gene
           (contains FLJ31860 and KIAA0853), possible ortholog of
           mouse 3110050K21Rik protein, the 3' end of the CPB2 gene
           for carboxypeptidase B2 (plasma, carboxypeptidase U) and
           a CpG island, complete sequence.
          Length = 115

 Score = 34.3 bits (77), Expect = 3.8
 Identities = 13/23 (56%), Positives = 16/23 (69%)
 Frame = -3

Query: 928 EVDCPFYLKTGSCKYGATCRYNH 860
           E  C  +LKTG+C YG TCR+ H
Sbjct: 39  ETQCRNWLKTGNCLYGNTCRFVH 61



>gb:AL157758_1921002 Human DNA sequence from clone RP11-106H11 on
           chromosome 13 Contains the 5' end of a novel gene
           (contains FLJ31860 and KIAA0853), possible ortholog of
           mouse 3110050K21Rik protein, the 3' end of the CPB2 gene
           for carboxypeptidase B2 (plasma, carboxypeptidase U) and
           a CpG island, complete sequence.>gb:AL445232_1927465
           Human DNA sequence from clone RP11-71J12 on chromosome
           13 Contains the 3' end of a novel gene (contains
           FLJ31860 and KIAA0853), possible ortholog of mouse
           3110050K21Rik protein, complete sequence.
          Length = 1668

 Score = 34.3 bits (77), Expect = 3.8
 Identities = 13/23 (56%), Positives = 16/23 (69%)
 Frame = -3

Query: 928 EVDCPFYLKTGSCKYGATCRYNH 860
           E  C  +LKTG+C YG TCR+ H
Sbjct: 39  ETQCRNWLKTGNCLYGNTCRFVH 61



>gb:AE017343_1755901 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 675

 Score = 34.3 bits (77), Expect = 3.8
 Identities = 26/81 (32%), Positives = 31/81 (38%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYY 530
           V C F+ K G C  GE C F H    S                      +RE    C ++
Sbjct: 149 VPCRFF-KAGACTAGESCPFSHAAPDSA---------------------KREV---CQWF 183

Query: 529 MKTGICKFGATCKFDHPPPGE 467
           +K G CKFG  C   H  PGE
Sbjct: 184 LK-GNCKFGHKCALAHVRPGE 203



>gb:OSJN00069_1694275 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0050O03, complete sequence.
          Length = 685

 Score = 34.3 bits (77), Expect = 3.8
 Identities = 18/64 (28%), Positives = 28/64 (43%), Gaps = 1/64 (1%)
 Frame = -3

Query: 676 CKFGERCRFHHPLDHSLS-VTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGA 500
           CK+G+ CRF H +D  L+   + +EG                    CP+     +C +G 
Sbjct: 105 CKYGDSCRFSHDIDAYLAQKPADLEGT-------------------CPFTNLDQLCPYGL 145

Query: 499 TCKF 488
           TC+F
Sbjct: 146 TCRF 149



>gb:CR382132_1665203 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 203

 Score = 34.3 bits (77), Expect = 3.8
 Identities = 14/37 (37%), Positives = 18/37 (48%)
 Frame = -3

Query: 754 MFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHH 644
           M     +IY     +V C FY K G C+ GE+C   H
Sbjct: 1   MASHLASIYGTENDKVNCSFYYKIGACRHGEKCSRKH 37



>gb:CR382122_1655230 Kluyveromyces lactis strain NRRL Y-1140
           chromosome B of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 431

 Score = 34.3 bits (77), Expect = 3.8
 Identities = 32/117 (27%), Positives = 44/117 (37%), Gaps = 4/117 (3%)
 Frame = -3

Query: 820 NVGVVNPTASLFQTFDPRLTQTMFGFATTIYPQRP----GQVECDFYMKTGECKFGERCR 653
           N G+    AS  Q F P+  + +           P      V C F+++ G C+ G+ C 
Sbjct: 49  NSGINIECASSEQGFTPQQQKAIIQHLLITKNSAPKKDYSHVPCKFFVQ-GNCQAGDSCP 107

Query: 652 FHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMKTGICKFGATCKFDH 482
           F H L++S S       EQ                  C Y+ K G CKFG  C   H
Sbjct: 108 FSHDLNNSTS-------EQV-----------------CKYFQK-GNCKFGMKCANAH 139



>gb:CR858742_1182896 Pongo pygmaeus mRNA; cDNA DKFZp469G0339 (from
           clone DKFZp469G0339).
          Length = 774

 Score = 34.3 bits (77), Expect = 3.8
 Identities = 13/23 (56%), Positives = 16/23 (69%)
 Frame = -3

Query: 928 EVDCPFYLKTGSCKYGATCRYNH 860
           E  C  +LKTG+C YG TCR+ H
Sbjct: 39  ETQCRNWLKTGNCLYGNTCRFVH 61



>gb:AK008332_1154520 Mus musculus adult male small intestine cDNA,
           RIKEN full-length enriched library, clone:2010107D16
           product:U2 small nuclear ribonucleoprotein auxiliary
           factor (U2AF),35 kDa, full insert sequence.
          Length = 239

 Score = 34.3 bits (77), Expect = 3.8
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
 Frame = -3

Query: 754 MFGFATTIYPQRPGQVECDFYMKTGECKFGERC-RFHHPLDHSLSVT-SSMEGEQQNFKL 581
           M  +  +I+     +V C FY K G C+ G+RC R H+    S ++   ++    QN   
Sbjct: 1   MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQ 60

Query: 580 SLAGL 566
           S  GL
Sbjct: 61  SADGL 65



>pir|S57977|S57977 CCCH zinc finger protein CTH1 - yeast
           (Saccharomyces cerevisiae)>gb:AY557690_1613917
           Saccharomyces cerevisiae clone FLH001724.01X YDR151C
           gene, complete cds.>gb:SC8358_1705628 S.cerevisiae
           chromosome IV cosmid 8358.
          Length = 325

 Score = 34.3 bits (77), Expect = 3.8
 Identities = 18/74 (24%), Positives = 30/74 (40%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C+ +   G CK+G +C+F H L+         + +  N++              C  + K
Sbjct: 210 CESFTIKGYCKYGNKCQFAHGLNE-----LKFKKKSNNYRTK-----------PCINWSK 253

Query: 523 TGICKFGATCKFDH 482
            G C +G  C F H
Sbjct: 254 LGYCPYGKRCCFKH 267



>pir|JC6125|JC6125 U2 small nuclear ribonucleoprotein auxiliary
           factor small chain - fruit fly (Drosophila
           melanogaster)>gb:DMU67066_1380983 Drosophila
           melanogaster U2 snRNP auxiliary factor (dU2AF38) mRNA,
           complete cds.
          Length = 264

 Score = 34.3 bits (77), Expect = 3.8
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 1/46 (2%)
 Frame = -3

Query: 754 MFGFATTIYPQRPGQVECDFYMKTGECKFGERC-RFHHPLDHSLSV 620
           M  +  +I+     +V C FY K G C+ G+RC R H+    S +V
Sbjct: 1   MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRIHNKPTFSQTV 46



>sp|Q9D883|U2AG_MOUSE Splicing factor U2AF 35 kDa subunit (U2
           auxiliary factor 35 kDa subunit) (U2 snRNP auxiliary
           factor small subunit).>gb:AK012849_1157201 Mus musculus
           10, 11 days embryo whole body cDNA, RIKEN full-length
           enriched library, clone:2810032C18 product:U2 small
           nuclear ribonucleoprotein auxiliary factor (U2AF),35
           kDa, full insert sequence.>gb:AK088979_1175734 Mus
           musculus 2 days neonate thymus thymic cells cDNA, RIKEN
           full-length enriched library, clone:E430034F20
           product:U2 small nuclear ribonucleoprotein auxiliary
           factor (U2AF),35 kDa, full insert sequence.
          Length = 239

 Score = 34.3 bits (77), Expect = 3.8
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
 Frame = -3

Query: 754 MFGFATTIYPQRPGQVECDFYMKTGECKFGERC-RFHHPLDHSLSVT-SSMEGEQQNFKL 581
           M  +  +I+     +V C FY K G C+ G+RC R H+    S ++   ++    QN   
Sbjct: 1   MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQ 60

Query: 580 SLAGL 566
           S  GL
Sbjct: 61  SADGL 65



>sp|Q01081|U2AG_HUMAN Splicing factor U2AF 35 kDa subunit (U2
           auxiliary factor 35 kDa subunit) (U2 snRNP auxiliary
           factor small subunit).>pir|A46179|A46179 U2 snRNP
           auxiliary factor small chain - human>gb:AP001748_1933548
           Homo sapiens genomic DNA, chromosome 21q, section
           92/105.>gb:BC001177_1967358 Homo sapiens U2(RNU2) small
           nuclear RNA auxiliary factor 1, mRNA (cDNA clone
           MGC:2223 IMAGE:3534272), complete
           cds.>gb:BC001923_1967965 Homo sapiens U2(RNU2) small
           nuclear RNA auxiliary factor 1, mRNA (cDNA clone
           MGC:3916 IMAGE:2823296), complete
           cds.>gb:HUMSNRNPAF_2036639 Homo sapiens U2 snRNP
           auxiliary factor small subunit, complete cds.
          Length = 240

 Score = 34.3 bits (77), Expect = 3.8
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
 Frame = -3

Query: 754 MFGFATTIYPQRPGQVECDFYMKTGECKFGERC-RFHHPLDHSLSVT-SSMEGEQQNFKL 581
           M  +  +I+     +V C FY K G C+ G+RC R H+    S ++   ++    QN   
Sbjct: 1   MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQ 60

Query: 580 SLAGL 566
           S  GL
Sbjct: 61  SADGL 65



>sp|Q94535|U2AG_DROME Splicing factor U2af 38 kDa subunit (U2
           auxiliary factor 38 kDa subunit) (U2 snRNP auxiliary
           factor small subunit).>gb:AE014134_1126842 Drosophila
           melanogaster chromosome 2L, complete
           sequence.>gb:AE003590_1216850 Drosophila melanogaster
           chromosome 2L, section 1 of 83 of the complete
           sequence.>gb:AY058537_1291691 Drosophila melanogaster
           LD24048 full length cDNA.
          Length = 264

 Score = 34.3 bits (77), Expect = 3.8
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 1/46 (2%)
 Frame = -3

Query: 754 MFGFATTIYPQRPGQVECDFYMKTGECKFGERC-RFHHPLDHSLSV 620
           M  +  +I+     +V C FY K G C+ G+RC R H+    S +V
Sbjct: 1   MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRIHNKPTFSQTV 46



>sp|P47976|CTH1_YEAST Zinc finger protein CTH1.>gb:YSCCTH1_1728643
           Saccharomyces cerevisiae (clone pSK11D) zinc finger
           protein (CTH1) gene, complete cds.
          Length = 325

 Score = 34.3 bits (77), Expect = 3.8
 Identities = 18/74 (24%), Positives = 30/74 (40%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C+ +   G CK+G +C+F H L+         + +  N++              C  + K
Sbjct: 210 CESFTIKGYCKYGNKCQFAHGLNE-----LKFKKKSNNYRTK-----------PCINWSK 253

Query: 523 TGICKFGATCKFDH 482
            G C +G  C F H
Sbjct: 254 LGYCPYGKRCCFKH 267



>gb:GGA291765_2572763 Gallus gallus mRNA for U2snRNP auxiliary
           factor small subunit class 3, (truncated), (U2AF1 gene).
          Length = 49

 Score = 33.9 bits (76), Expect = 4.9
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%)
 Frame = -3

Query: 754 MFGFATTIYPQRPGQVECDFYMKTGECKFGERC-RFHH 644
           M  +  +I+     +V C FY K G C+ G+RC R H+
Sbjct: 1   MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHN 38



>gb:BC084660_2563960 Xenopus laevis hypothetical LOC495238, mRNA
           (cDNA clone MGC:98870 IMAGE:4056514), complete cds.
          Length = 503

 Score = 33.9 bits (76), Expect = 4.9
 Identities = 27/105 (25%), Positives = 43/105 (40%), Gaps = 11/105 (10%)
 Frame = -3

Query: 919 CPFYLKTGSCKYGATCRYNHPDRYTINPPAA---HLNVGVVNPTASLFQTFDPRLTQTMF 749
           C FY+  GSC   + C++NH  R   N       HL+   ++    L    DP L   + 
Sbjct: 82  CRFYI-LGSCNR-SPCKFNHCIRNAHNLSVLQKFHLDSMPIDELRQLLLQNDPNLLPDIC 139

Query: 748 GF--------ATTIYPQRPGQVECDFYMKTGECKFGERCRFHHPL 638
                      +  Y  +  ++    +   G+CKFGE+C+  H L
Sbjct: 140 SHYNRGDGPHGSCTYKNKCNKLHVCQHFLQGDCKFGEKCKRCHDL 184



>gb:AF506202_2498536 Danio rerio U2 small nuclear RNA auxiliary
           factor small subunit (u2af1) mRNA, complete cds.
          Length = 249

 Score = 33.9 bits (76), Expect = 4.9
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%)
 Frame = -3

Query: 754 MFGFATTIYPQRPGQVECDFYMKTGECKFGERC-RFHH 644
           M  +  +I+     +V C FY K G C+ G+RC R H+
Sbjct: 1   MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHN 38



>gb:AF090120_2472563 Fugu rubripes beta-amyloid precursor protein,
           transcription factor E4TF1, splicing factor U2AF35, and
           cystathionine beta-synthetase genes, complete cds.
          Length = 211

 Score = 33.9 bits (76), Expect = 4.9
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%)
 Frame = -3

Query: 754 MFGFATTIYPQRPGQVECDFYMKTGECKFGERC-RFHH 644
           M  +  +I+     +V C FY K G C+ G+RC R H+
Sbjct: 1   MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHN 38



>gb:BC002184_2088941 Mus musculus U2 small nuclear ribonucleoprotein
           auxiliary factor (U2AF) 1, mRNA (cDNA clone
           IMAGE:3487573), partial cds.
          Length = 238

 Score = 33.9 bits (76), Expect = 4.9
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 2/62 (3%)
 Frame = -3

Query: 745 FATTIYPQRPGQVECDFYMKTGECKFGERC-RFHHPLDHSLSVT-SSMEGEQQNFKLSLA 572
           +  +I+     +V C FY K G C+ G+RC R H+    S ++   ++    QN   S  
Sbjct: 3   YLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQSAD 62

Query: 571 GL 566
           GL
Sbjct: 63  GL 64



>gb:AJ627978_1907108 Homo sapiens mRNA for U2 snRNP auxiliary factor
           small subunit (U2AF1 gene), splice variant b.
          Length = 240

 Score = 33.9 bits (76), Expect = 4.9
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%)
 Frame = -3

Query: 754 MFGFATTIYPQRPGQVECDFYMKTGECKFGERC-RFHH 644
           M  +  +I+     +V C FY K G C+ G+RC R H+
Sbjct: 1   MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHN 38



>gb:AE017349_1758637 Cryptococcus neoformans var. neoformans JEC21
           chromosome 9, complete sequence.
          Length = 223

 Score = 33.9 bits (76), Expect = 4.9
 Identities = 13/37 (35%), Positives = 18/37 (48%)
 Frame = -3

Query: 754 MFGFATTIYPQRPGQVECDFYMKTGECKFGERCRFHH 644
           M      I+     +V C FY+K G C+ G+RC   H
Sbjct: 1   MASHLANIFGTEQDRVNCSFYLKIGACRHGDRCSRKH 37



>gb:AY088484_1573503 Arabidopsis thaliana clone 7104 mRNA, complete
           sequence.
          Length = 540

 Score = 33.9 bits (76), Expect = 4.9
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)
 Frame = -3

Query: 553 GAIHCPYYMKTGICKFGATCKFDHPPPG-ELIGGTSQV 443
           G + C Y+ + G CK GA+C+F H   G +L+G  S++
Sbjct: 150 GGVPCSYFAR-GFCKNGASCRFVHSDGGADLVGSPSRI 186



>gb:AY080846_1568538 Arabidopsis thaliana unknown protein
           (At3g51950) mRNA, complete cds.
          Length = 540

 Score = 33.9 bits (76), Expect = 4.9
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)
 Frame = -3

Query: 553 GAIHCPYYMKTGICKFGATCKFDHPPPG-ELIGGTSQV 443
           G + C Y+ + G CK GA+C+F H   G +L+G  S++
Sbjct: 150 GGVPCSYFAR-GFCKNGASCRFVHSDGGADLVGSPSRI 186



>gb:AX885379_1480832 Sequence 1242 from Patent EP1033401.
          Length = 89

 Score = 33.9 bits (76), Expect = 4.9
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%)
 Frame = -3

Query: 754 MFGFATTIYPQRPGQVECDFYMKTGECKFGERC-RFHH 644
           M  +  +I+     +V C FY K G C+ G+RC R H+
Sbjct: 1   MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHN 38



>gb:HSM803975_1187071 Homo sapiens mRNA; cDNA DKFZp313J1712 (from
           clone DKFZp313J1712).
          Length = 67

 Score = 33.9 bits (76), Expect = 4.9
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%)
 Frame = -3

Query: 754 MFGFATTIYPQRPGQVECDFYMKTGECKFGERC-RFHH 644
           M  +  +I+     +V C FY K G C+ G+RC R H+
Sbjct: 1   MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHN 38



>gb:AY325238_1177907 Rattus norvegicus Cb2-807 mRNA, complete
           cds.>gb:AF419339_2065383 Mus musculus U2 auxiliary
           factor 26 (U2af26) mRNA, complete
           cds.>gb:AF419340_2065384 Mus musculus U2 auxiliary
           factor 26 (U2af26) gene, complete
           cds.>gb:BC060972_2104210 Mus musculus U2 small nuclear
           RNA auxiliary factor 1-like 4, mRNA (cDNA clone
           MGC:74063 IMAGE:6593404), complete cds.
          Length = 220

 Score = 33.9 bits (76), Expect = 4.9
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%)
 Frame = -3

Query: 754 MFGFATTIYPQRPGQVECDFYMKTGECKFGERC-RFHH 644
           M  +  +I+     +V C FY K G C+ G+RC R H+
Sbjct: 1   MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHN 38



>pir|T49074|T49074 hypothetical protein F4F15.60 - Arabidopsis
           thaliana>gb:ATF4F15_1550661 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F4F15.>gb:AY150500_1585065
           Arabidopsis thaliana unknown protein (At3g51950) mRNA,
           complete cds.
          Length = 540

 Score = 33.9 bits (76), Expect = 4.9
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)
 Frame = -3

Query: 553 GAIHCPYYMKTGICKFGATCKFDHPPPG-ELIGGTSQV 443
           G + C Y+ + G CK GA+C+F H   G +L+G  S++
Sbjct: 150 GGVPCSYFAR-GFCKNGASCRFVHSDGGADLVGSPSRI 186



>sp|Q29350|U2AG_PIG Splicing factor U2AF 35 kDa subunit (U2
           auxiliary factor 35 kDa subunit) (U2 snRNP auxiliary
           factor small subunit) (Fragment).
          Length = 82

 Score = 33.9 bits (76), Expect = 4.9
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%)
 Frame = -3

Query: 754 MFGFATTIYPQRPGQVECDFYMKTGECKFGERC-RFHH 644
           M  +  +I+     +V C FY K G C+ G+RC R H+
Sbjct: 1   MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHN 38



>sp|P47973|TTP_RAT Tristetraproline (TTP) (TIS11A protein) (TIS11)
           (Zinc finger protein 36) (Zfp-36).>pir|JC1255|JC1255
           TIS11 protein - rat>gb:AB025017_2044352 Rattus
           norvegicus gene for TIS11, complete
           cds.>gb:BC060308_2103986 Rattus norvegicus zinc finger
           protein 36, mRNA (cDNA clone MGC:72649 IMAGE:6922188),
           complete cds.>gb:RRTIS11_2138236 R.rattus TIS 11 mRNA.
          Length = 320

 Score = 33.9 bits (76), Expect = 4.9
 Identities = 21/80 (26%), Positives = 36/80 (45%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYYMK 524
           C  Y ++G C++G +C+F H            E  Q N        P+ +  +   +Y++
Sbjct: 102 CRTYSESGRCRYGAKCQFAH---------GPGELRQANRH------PKYKTELCHKFYLQ 146

Query: 523 TGICKFGATCKFDHPPPGEL 464
            G C +G+ C F H P  +L
Sbjct: 147 -GRCPYGSRCHFIHNPTEDL 165



>sp|P41000|SCP3_SCHPO Protein scp3.>pir|T11624|T11624 spindle poison
           sensitivity protein - fission yeast
           (Schizosaccharomyces pombe)>gb:SPAC3A11_1717781 S.pombe
           chromosome I cosmid c3A11.
          Length = 583

 Score = 33.9 bits (76), Expect = 4.9
 Identities = 23/85 (27%), Positives = 32/85 (37%)
 Frame = -3

Query: 727 PQRPGQVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGA 548
           P+    V C F+ + G C  G+ C F H L+ +   T                       
Sbjct: 33  PKSLQHVPCKFF-RQGTCTSGKNCIFSHDLELATEKTI---------------------- 69

Query: 547 IHCPYYMKTGICKFGATCKFDHPPP 473
             C Y+ K G CKFG+ C  +H  P
Sbjct: 70  --CKYFQK-GNCKFGSKCALEHVLP 91



>gb:S69507_2139024 U2afbp-rs=U2 small nuclear ribonucleoprotein
           auxiliary factor binding protein homolog [Mus
           musculus=mice, ssp. musculus, PWK, liver, mRNA, 2831
           nt].
          Length = 428

 Score = 33.5 bits (75), Expect = 6.5
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = -3

Query: 952 KGLPIRLGEVDCPFYLKTGSCKYGATCRYNH 860
           K L +      CPFY KTG+C++G  C   H
Sbjct: 152 KDLRLEKYRPSCPFYNKTGACRFGNRCSRKH 182



 Score = 33.1 bits (74), Expect = 8.4
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = -3

Query: 541 CPYYMKTGICKFGATCKFDHPPP 473
           CP+Y KTG C+FG  C   H  P
Sbjct: 163 CPFYNKTGACRFGNRCSRKHDFP 185



 Score = 33.1 bits (74), Expect = 8.4
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHH 644
           C FY KTG C+FG RC   H
Sbjct: 163 CPFYNKTGACRFGNRCSRKH 182



>gb:BC086322_2109517 Rattus norvegicus cDNA clone MGC:105652
           IMAGE:7301896, complete cds.
          Length = 428

 Score = 33.5 bits (75), Expect = 6.5
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = -3

Query: 952 KGLPIRLGEVDCPFYLKTGSCKYGATCRYNH 860
           K L +      CPFY KTG+C++G  C   H
Sbjct: 153 KDLRLEKYRPSCPFYNKTGACRFGNRCSRKH 183



 Score = 33.1 bits (74), Expect = 8.4
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = -3

Query: 541 CPYYMKTGICKFGATCKFDHPPP 473
           CP+Y KTG C+FG  C   H  P
Sbjct: 164 CPFYNKTGACRFGNRCSRKHDFP 186



 Score = 33.1 bits (74), Expect = 8.4
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHH 644
           C FY KTG C+FG RC   H
Sbjct: 164 CPFYNKTGACRFGNRCSRKH 183



>gb:AP003507_1830059 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0468A12.>gb:AP003543_1830677 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0592B08.
          Length = 368

 Score = 33.5 bits (75), Expect = 6.5
 Identities = 16/31 (51%), Positives = 20/31 (64%)
 Frame = -3

Query: 919 CPFYLKTGSCKYGATCRYNHPDRYTINPPAA 827
           C FY K GSC YG+ CRY+H  + + NP  A
Sbjct: 36  CTFYQK-GSCSYGSRCRYDHV-KVSRNPTVA 64



>gb:OSJN00091_1694741 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0087O24, complete sequence.
          Length = 309

 Score = 33.5 bits (75), Expect = 6.5
 Identities = 24/93 (25%), Positives = 33/93 (35%), Gaps = 1/93 (1%)
 Frame = -3

Query: 919 CPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNVGVVNPTASLFQTFDPRLTQTMFGFA 740
           C  +  T  C +G  C ++H         A  LN+G  NP         P          
Sbjct: 43  CTKFFSTIGCPFGEGCHFSHFVPGGYQAVAKTLNLG--NPAVPA-----PARAPMDHAAG 95

Query: 739 TTIYPQRPGQVE-CDFYMKTGECKFGERCRFHH 644
              +P   G+   C  Y     CKFG++C F H
Sbjct: 96  GNSHPASSGKTRMCTKYNTAEGCKFGDKCHFAH 128



>gb:CR380959_1653970 Candida glabrata strain CBS138 chromosome M
           complete sequence.
          Length = 109

 Score = 33.5 bits (75), Expect = 6.5
 Identities = 23/72 (31%), Positives = 29/72 (40%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYY 530
           + C FYM  G C+ G+ C F H        T ++E               R  +  C YY
Sbjct: 50  IPCKFYM-VGSCQAGQSCPFSHQ-------TQTIE---------------RAYSTPCKYY 86

Query: 529 MKTGICKFGATC 494
            K G CKFG  C
Sbjct: 87  QK-GYCKFGDRC 97



>gb:AB024035_1515823 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MHM17.
          Length = 675

 Score = 33.5 bits (75), Expect = 6.5
 Identities = 22/82 (26%), Positives = 33/82 (40%), Gaps = 8/82 (9%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHHPLDHS--------LSVTSSMEGEQQNFKLSLAGLPRREGA 548
           C  Y+K G C  G++C+F H              +  S M+G+   F   L+  P     
Sbjct: 356 CRHYLK-GRCHEGDKCKFSHDTIPETKCSPCCYFATQSCMKGDDCPFDHDLSKYP----- 409

Query: 547 IHCPYYMKTGICKFGATCKFDH 482
             C  ++  G C  G +C F H
Sbjct: 410 --CNNFITKGFCYRGDSCLFSH 429



>gb:AK030552_1162060 Mus musculus adult male pituitary gland cDNA,
           RIKEN full-length enriched library, clone:5330430M06
           product:U2 small nuclear ribonucleoprotein auxiliary
           factor (U2AF), 35 kDa, related sequence 1, full insert
           sequence.
          Length = 428

 Score = 33.5 bits (75), Expect = 6.5
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = -3

Query: 952 KGLPIRLGEVDCPFYLKTGSCKYGATCRYNH 860
           K L +      CPFY KTG+C++G  C   H
Sbjct: 152 KDLRLEKYRPSCPFYNKTGACRFGNRCSRKH 182



 Score = 33.1 bits (74), Expect = 8.4
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = -3

Query: 541 CPYYMKTGICKFGATCKFDHPPP 473
           CP+Y KTG C+FG  C   H  P
Sbjct: 163 CPFYNKTGACRFGNRCSRKHDFP 185



 Score = 33.1 bits (74), Expect = 8.4
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHH 644
           C FY KTG C+FG RC   H
Sbjct: 163 CPFYNKTGACRFGNRCSRKH 182



>sp|Q64707|U2R1_MOUSE U2 small nuclear ribonucleoprotein auxiliary
           factor 35 kDa subunit related-protein 1 (U2(RNU2) small
           nuclear RNA auxillary factor 1-like 1)
           (SP2).>pir|S41485|S41485 sp2 protein -
           mouse>gb:AB089806_2047927 Mus musculus Murr1 and
           U2af1-rs1 genes, partial and complete
           cds.>gb:AF309654_2062399 Mus musculus U2AF small
           subunit-related protein (U2af1-rs1) gene, complete
           cds.>gb:AL772364_2073026 Mouse DNA sequence from clone
           RP23-242C19 on chromosome 11 Contains a ribosomal
           protein S16 (Rps16) pseudogene, the B3gnt1 gene for
           beta-1,3-N-acetylglucosaminyltransferase 1, the Murr1
           gene for U2af1-rs1 region 1, the U2af1-rs1 gene for U2
           small nuclear ribonucleoprotein auxiliary factor (U2AF)
           1 (related sequence 1) and two CpG islands, complete
           sequence.>gb:MUSSP2_2130036 Mus musculus SP2 mRNA,
           complete cds.>gb:MUSSP2A_2130037 Mouse SP2 gene for U2
           small nuclear ribonucleoprotein auxiliary factor (U2AF)
           small subunit-related protein, complete cds.
          Length = 428

 Score = 33.5 bits (75), Expect = 6.5
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = -3

Query: 952 KGLPIRLGEVDCPFYLKTGSCKYGATCRYNH 860
           K L +      CPFY KTG+C++G  C   H
Sbjct: 152 KDLRLEKYRPSCPFYNKTGACRFGNRCSRKH 182



 Score = 33.1 bits (74), Expect = 8.4
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = -3

Query: 541 CPYYMKTGICKFGATCKFDHPPP 473
           CP+Y KTG C+FG  C   H  P
Sbjct: 163 CPFYNKTGACRFGNRCSRKHDFP 185



 Score = 33.1 bits (74), Expect = 8.4
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = -3

Query: 703 CDFYMKTGECKFGERCRFHH 644
           C FY KTG C+FG RC   H
Sbjct: 163 CPFYNKTGACRFGNRCSRKH 182



>gb:BC084352_2563733 Xenopus laevis hypothetical LOC495149, mRNA
           (cDNA clone IMAGE:5078020), partial cds.
          Length = 1029

 Score = 33.1 bits (74), Expect = 8.4
 Identities = 12/23 (52%), Positives = 16/23 (69%)
 Frame = -3

Query: 928 EVDCPFYLKTGSCKYGATCRYNH 860
           E  C  ++KTG+C YG TCR+ H
Sbjct: 39  ETQCRNWMKTGNCIYGNTCRFIH 61



>gb:BC074559_2558054 Xenopus tropicalis makorin, ring finger
           protein, 2, mRNA (cDNA clone MGC:69367 IMAGE:5309402),
           complete cds.
          Length = 418

 Score = 33.1 bits (74), Expect = 8.4
 Identities = 22/79 (27%), Positives = 31/79 (39%)
 Frame = -3

Query: 709 VECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPYY 530
           V C +++  G C+ G RC F H L  S   T                         C +Y
Sbjct: 6   VTCRYFLH-GVCREGGRCLFSHDLATSKPSTV------------------------CRFY 40

Query: 529 MKTGICKFGATCKFDHPPP 473
            + G C +GA C++DH  P
Sbjct: 41  QR-GQCAYGARCRYDHVKP 58



>gb:AB182270_2466960 Takifugu rubripes MKRN2 mRNA for makorin RING
           finger protein 2, complete cds.
          Length = 402

 Score = 33.1 bits (74), Expect = 8.4
 Identities = 21/77 (27%), Positives = 33/77 (42%)
 Frame = -3

Query: 712 QVECDFYMKTGECKFGERCRFHHPLDHSLSVTSSMEGEQQNFKLSLAGLPRREGAIHCPY 533
           QV C +++  G C+ G  C+F H  D S S  S++                      C +
Sbjct: 5   QVTCRYFLH-GVCREGNHCQFSH--DPSSSKPSTI----------------------CKF 39

Query: 532 YMKTGICKFGATCKFDH 482
           Y + G C +G  C++DH
Sbjct: 40  YQR-GTCAYGERCRYDH 55



>gb:BC003883_2089426 Mus musculus mRNA similar to RIKEN cDNA
           2010107D16 gene (cDNA clone MGC:6653 IMAGE:3496988),
           complete cds.
          Length = 310

 Score = 33.1 bits (74), Expect = 8.4
 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 5/64 (7%)
 Frame = -3

Query: 925 VDCPFYLKTGSCKYGATCRYNHPDRYTINPPAAHLNV----GVVNPTAS-LFQTFDPRLT 761
           V+CPFY K G+C++G  C   H  + +I+P     N+     ++ P      Q  DPR  
Sbjct: 16  VNCPFYFKIGACRHGDRCSRLH-TKPSISPTLLLANMYQRPDMITPGVDPQGQPLDPRKI 74

Query: 760 QTMF 749
           Q  F
Sbjct: 75  QQHF 78


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,011,499,796
Number of Sequences: 1806583
Number of extensions: 21299925
Number of successful extensions: 49402
Number of sequences better than 10.0: 245
Number of HSP's better than 10.0 without gapping: 45145
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 48703
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 70506631551
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)