BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10855
         (715 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AF428329_1799259 Arabidopsis thaliana AT3g23810/MYM9_15 mRNA,...   313   1e-84   
gb:AY094404_1575709 Arabidopsis thaliana AT3g23810/MYM9_15 mRNA,...   313   1e-84   
gb:AY059888_1564732 Arabidopsis thaliana S-adenosyl L-homocystei...   313   1e-84   
gb:AY224544_1590741 Oryza sativa (japonica cultivar-group) isola...   312   3e-84   
gb:AJ853475_1814921 Nicotiana glauca partial mRNA for putative a...   311   7e-84   
sp|P50248|SAHH_TOBAC|SAHH_TOBAC Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   311   7e-84   Nicotiana tabacum [American tobacco]
gb:AY050783_1562292 Arabidopsis thaliana putative S-adenosyl-L-h...   310   1e-83   
gb:TOBCBP57B_1725376 Tobacco mRNA for cytokinin binding protein ...   310   2e-83   
gb:A57643_1449818 Sequence 1 from Patent WO9632488.                   308   5e-83   
sp|P93253|SAHH_MESCR|SAHH_MESCR Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   308   5e-83   Mesembryanthemum crystallinum
sp|P35007|SAHH_CATRO|SAHH_CATRO Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   308   5e-83   Catharanthus roseus [chatas]
sp|P50249|SAHH_PHASS|SAHH_PHASS Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   308   6e-83   Phalaenopsis sp.
sp|O23255|SAHH_ARATH|SAHH_ARATH Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   308   6e-83   Arabidopsis thaliana [mouse-ear cress]
gb:AY224189_1590621 Medicago truncatula adenosylhomocysteinase (...   307   1e-82   
sp|Q9SWF5|SAHH_LYCES|SAHH_LYCES Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   307   1e-82   Solanum lycopersicum
gb:AY085669_1570736 Arabidopsis thaliana clone 16846 mRNA, compl...   306   2e-82   
sp|Q01781|SAHH_PETCR|SAHH_PETCR Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   306   2e-82   Petroselinum crispum
sp|P50246|SAHH_MEDSA|SAHH_MEDSA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   306   2e-82   Medicago sativa [alfalfa]
sp|P32112|SAHH_WHEAT|SAHH_WHEAT Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   306   3e-82   Triticum aestivum [Canadian hard winter wheat]
gb:AY224188_1590620 Medicago truncatula adenosylhomocysteinase (...   305   7e-82   
gb:ATSADLHH_1554140 Arabidopsis thaliana mRNA for S-adenosyl-L-h...   305   7e-82   
sp|Q9SP37|SAHH_LUPLU|SAHH_LUPLU Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   302   4e-81   Lupinus luteus
pir|T15035|T15035 adenosylhomocysteinase (EC 3.3.1.1) - parsley>...   300   2e-80   Petroselinum crispum
gb:AF307335_1784661 Petunia x hybrida cytokinin binding protein ...   277   2e-73   
gb:AP006841_574982 Bacteroides fragilis YCH46 DNA, complete genome.   224   9e-58   
sp|Q8A407|SAHH_BACTN|SAHH_BACTN Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   221   1e-56   Bacteroides thetaiotaomicron
sp|Q8EXV1|SAHH_LEPIN|SAHH_LEPIN Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   216   2e-55   
gb:AE013598_297499 Xanthomonas oryzae pv. oryzae KACC10331, comp...   216   4e-55   
sp|Q8PCH5|SAHH_XANCP|SAHH_XANCP Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   216   4e-55   Xanthomonas campestris pv. campestris
sp|Q8PP84|SAHH_XANAC|SAHH_XANAC Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   216   4e-55   Xanthomonas citri
sp|Q7NZF7|SAHH_CHRVO|SAHH_CHRVO Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   214   9e-55   Chromobacterium violaceum
pir|D82730|D82730 adenosylhomocysteinase XF1037 [imported] - Xyl...   211   8e-54   Xylella fastidiosa
sp|Q87EI8|SAHH_XYLFT|SAHH_XYLFT Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   211   8e-54   Xylella fastidiosa
sp|Q9PEJ1|SAHH_XYLFA|SAHH_XYLFA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   211   8e-54   Xylella fastidiosa
sp|Q8KEG8|SAHH_CHLTE|SAHH_CHLTE Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   210   2e-53   Chlorobaculum tepidum
sp|Q7TTZ5|SAHH_RHOBA|SAHH_RHOBA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   208   7e-53   Rhodopirellula baltica
gb:BX248345_760633 Mycobacterium bovis subsp. bovis AF2122/97 co...   207   1e-52   
pir|B70593|B70593 adenosylhomocysteinase (EC 3.3.1.1) - Mycobact...   207   1e-52   Mycobacterium tuberculosis
sp|P60176|SAHH_MYCTU|SAHH_MYCTU Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   207   1e-52   Mycobacterium tuberculosis
sp|Q7TWW7|SAHH_MYCBO|SAHH_MYCBO Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   207   1e-52   Mycobacterium tuberculosis variant bovis
sp|Q9ABH0|SAHH_CAUCR|SAHH_CAUCR Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   206   4e-52   Caulobacter vibrioides
gb:AY233397_1311518 Trypanosoma cruzi S-adenosylhomocysteine hyd...   205   6e-52   
sp|P51540|SAHH_TRIVA|SAHH_TRIVA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   205   6e-52   Trichomonas vaginalis
gb:AE008692_239920 Zymomonas mobilis subsp. mobilis ZM4, complet...   205   7e-52   
gb:AP006618_561013 Nocardia farcinica IFM 10152 DNA, complete ge...   204   1e-51   
gb:AE017354_460376 Legionella pneumophila subsp. pneumophila str...   203   2e-51   
gb:CR628337_115202 Legionella pneumophila str. Lens complete gen...   203   2e-51   
gb:CR628336_112119 Legionella pneumophila str. Paris complete ge...   203   2e-51   
gb:AB088224_11530 Streptomyces rochei plasmid pSLA2-L DNA, compl...   202   4e-51   
gb:AE017282_426974 Methylococcus capsulatus str. Bath, complete ...   202   5e-51   
sp|Q8GGL7|SAHH_STRAZ|SAHH_STRAZ Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   202   5e-51   Streptomyces atroolivaceus
sp|Q7V926|SAHH_PROMM|SAHH_PROMM Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   201   8e-51   Prochlorococcus marinus
sp|Q89HP6|SAHH_BRAJA|SAHH_BRAJA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   201   8e-51   Bradyrhizobium japonicum
sp|Q82DC9|SAHH_STRAW|SAHH_STRAW Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   200   2e-50   Streptomyces avermitilis
sp|Q9CCJ4|SAHH_MYCLE|SAHH_MYCLE Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   200   2e-50   Mycobacterium leprae
sp|Q8Y387|SAHH_RALSO|SAHH_RALSO Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   199   3e-50   Ralstonia solanacearum
gb:BX572606_803628 Rhodopseudomonas palustris CGA009 complete ge...   198   7e-50   
sp|Q9KZM1|SAHH_STRCO|SAHH_STRCO Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   198   7e-50   
sp|Q7UZN3|SAHH_PROMP|SAHH_PROMP Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   198   7e-50   Prochlorococcus marinus subsp. pastoris [high-light adapted Prochlorococcus]
sp|Q7U9Y3|SAHH_SYNPX|SAHH_SYNPX Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   198   9e-50   Synechococcus sp.
sp|Q936D6|SAHH_STRAA|SAHH_STRAA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   198   9e-50   Streptomyces argillaceus
sp|Q98CM3|SAHH_RHILO|SAHH_RHILO Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   198   9e-50   Mesorhizobium loti
gb:AY161083_1305326 Cryptosporidium parvum adenosylhomocysteinas...   197   1e-49   
gb:AE017239_414067 Mycobacterium avium subsp. paratuberculosis s...   197   1e-49   
sp|Q83A77|SAHH_COXBU|SAHH_COXBU Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   197   2e-49   Coxiella burnetii
gb:AY398307_2531837 Danio rerio clone RK113A3C03 S-adenosylhomoc...   197   2e-49   
gb:CR555306_106425 Azoarcus sp. EbN1 complete genome.                 197   2e-49   
sp|P61617|SAHH_GEOSL|SAHH_GEOSL Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   197   2e-49   Geobacter sulfurreducens
gb:CP000031_87847 Silicibacter pomeroyi DSS-3, complete genome.       196   3e-49   
sp|P36889|SAHH_LEIDO|SAHH_LEIDO Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   196   3e-49   Leishmania donovani
sp|Q7WQX5|SAHH_BORBR|SAHH_BORBR Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   196   3e-49   Bordetella bronchiseptica
gb:BX571965_793091 Burkholderia pseudomallei strain K96243, chro...   195   6e-49   
sp|Q82WL1|SAHH_NITEU|SAHH_NITEU Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   195   6e-49   Nitrosomonas europaea
gb:BX897699_826667 Bartonella henselae strain Houston-1, complet...   194   1e-48   
sp|Q9ZNA5|SAHH_ROSDE|SAHH_ROSDE Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   194   1e-48   
sp|Q7VUL8|SAHH_BORPE|SAHH_BORPE Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   194   2e-48   Bordetella pertussis
pir|AG3505|AG3505 adenosylhomocysteinase (EC 3.3.1.1) [imported]...   193   2e-48   Brucella melitensis
sp|Q8FXZ7|SAHH_BRUSU|SAHH_BRUSU Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   193   2e-48   Brucella suis bv. 1
sp|Q8YE49|SAHH_BRUME|SAHH_BRUME Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   193   2e-48   
pir|A45569|A45569 adenosylhomocysteinase (EC 3.3.1.1) - Leishman...   193   3e-48   Leishmania donovani
sp|Q8FRJ4|SAHH_COREF|SAHH_COREF Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   192   4e-48   Corynebacterium efficiens
sp|P27604|SAHH_CAEEL|SAHH_CAEEL Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   191   8e-48   Caenorhabditis elegans [roundworm]
gb:AE008921_246378 Uncultured proteobacterium clone EBAC000-60D0...   191   1e-47   
sp|Q7V9P3|SAHH_PROMA|SAHH_PROMA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   191   1e-47   Prochlorococcus marinus
gb:AF525293_1279200 Plasmodium falciparum 3D7 S-adenosyl-L-homoc...   190   2e-47   
sp|P50250|SAHH_PLAF7|SAHH_PLAF7 Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   190   2e-47   Plasmodium falciparum
gb:CP000009_863091 Gluconobacter oxydans 621H, complete genome.       190   2e-47   
gb:AY178804_595226 Agrobacterium tumefaciens S-adenosyl-L-homocy...   189   5e-47   
gb:AX397890_1467047 Sequence 1 from Patent WO0220806.                 188   7e-47   
gb:BX927150_832335 Corynebacterium glutamicum ATCC 13032, IS fin...   188   7e-47   
gb:AE017311_438861 Desulfovibrio vulgaris subsp. vulgaris str. H...   188   7e-47   
sp|O13639|SAHH_SCHPO|SAHH_SCHPO Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   188   7e-47   Schizosaccharomyces pombe
sp|Q8NSC4|SAHH_CORGL|SAHH_CORGL Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   188   7e-47   Corynebacterium glutamicum
sp|Q8UJ99|SAHH_AGRT5|SAHH_AGRT5 Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   188   9e-47   Agrobacterium tumefaciens
pir|A46035|A46035 adenosylhomocysteinase (EC 3.3.1.1) - Rhodobac...   187   1e-46   Rhodobacter capsulatus
sp|P28183|SAHH_RHOCA|SAHH_RHOCA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   187   1e-46   Rhodobacter capsulatus
gb:AY278950_1315439 Branchiostoma belcheri tsingtaunese adenosyl...   187   2e-46   
gb:AY593479_630666 Collimonas fungivorans fosmid CFUFOS19, compl...   186   4e-46   
pir|A26583|A26583 adenosylhomocysteinase (EC 3.3.1.1) - rat>gb:R...   186   4e-46   Rattus norvegicus [brown rat]
sp|Q92TC1|SAHH_RHIME|SAHH_RHIME Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   186   4e-46   Sinorhizobium meliloti
sp|P10760|SAHH_RAT|SAHH_RAT Adenosylhomocysteinase (EC 3.3.1.1) (S-adenos...   186   4e-46   Rattus norvegicus [brown rat]
sp|P51893|SAH1_XENLA|SAH1_XENLA Adenosylhomocysteinase 1 (EC 3.3.1.1) (S-ad...   186   4e-46   Xenopus laevis [clawed frog]
gb:MUSSAHH_2129955 Mus musculus (clone C7/B9) S-adenosyl homocys...   186   5e-46   
gb:BC086781_2109794 Mus musculus cDNA clone MGC:102079 IMAGE:682...   186   5e-46   
gb:BC015304_2092144 Mus musculus S-adenosylhomocysteine hydrolas...   186   5e-46   
gb:AK075629_1170915 Mus musculus 18-day embryo whole body cDNA, ...   186   5e-46   
sp|O50562|SAHH_RHOSH|SAHH_RHOSH Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   186   5e-46   Rhodobacter sphaeroides
sp|P50247|SAHH_MOUSE|SAHH_MOUSE Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   186   5e-46   Mus musculus [mouse]
sp|O76757|SAHH_ANOGA|SAHH_ANOGA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   185   8e-46   Anopheles gambiae
sp|O93477|SAH2_XENLA|SAH2_XENLA Adenosylhomocysteinase 2 (EC 3.3.1.1) (S-ad...   185   8e-46   Xenopus laevis [clawed frog]
gb:AE014298_1125742 Drosophila melanogaster chromosome X, comple...   184   2e-45   
gb:BX897700_828277 Bartonella quintana str. Toulouse, complete g...   183   3e-45   
gb:SSC427478_1445205 Sus scrofa ASIP gene for agouti signalling ...   182   4e-45   
sp|Q12663|SAHH_PNECA|SAHH_PNECA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   182   4e-45   Pneumocystis carinii
sp|P61456|SAHH_CORDI|SAHH_CORDI Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   182   4e-45   Corynebacterium diphtheriae
gb:BX842649_824262 Bdellovibrio bacteriovorus complete genome, s...   182   7e-45   
gb:BT007625_2150557 Synthetic construct Homo sapiens S-adenosylh...   181   9e-45   
gb:HUMAHCY_2029084 Human S-adenosylhomocysteine hydrolase (AHCY)...   181   9e-45   
sp|P23526|SAHH_HUMAN|SAHH_HUMAN Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   181   9e-45   Homo sapiens [man]
gb:AY102668_1299071 Drosophila melanogaster GM02466 full insert ...   179   6e-44   
sp|P10819|SAHH_DICDI|SAHH_DICDI Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   178   7e-44   Dictyostelium discoideum
sp|Q27580|SAHH_DROME|SAHH_DROME Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   178   1e-43   Drosophila melanogaster
gb:CR382121_1654313 Kluyveromyces lactis strain NRRL Y-1140 chro...   175   8e-43   
gb:AE017344_1755987 Cryptococcus neoformans var. neoformans JEC2...   173   2e-42   
gb:AE016819_1749078 Ashbya gossypii (= Eremothecium gossypii) AT...   172   4e-42   
gb:CR382132_1665432 Yarrowia lipolytica chromosome F of strain C...   172   7e-42   
sp|P39954|SAHH_YEAST|SAHH_YEAST Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   172   7e-42   Saccharomyces cerevisiae [brewer's yeast]
gb:CR380949_1649503 Candida glabrata strain CBS138 chromosome C ...   169   5e-41   
gb:AY442190_1606331 Pichia pastoris S-adenosylhomocysteine hydro...   167   2e-40   
gb:DDAHCH_1376851 D. discoideum mRNA fragment for S-adenosyl-L-h...   164   2e-39   
gb:CR382139_1672908 Debaryomyces hansenii chromosome G of strain...   161   1e-38   
gb:CR859865_1183966 Pongo pygmaeus mRNA; cDNA DKFZp469J024 (from...   146   3e-34   
gb:AK130743_1917676 Homo sapiens cDNA FLJ27233 fis, clone SYN064...   145   5e-34   
gb:BC079660_2107648 Mus musculus RIKEN cDNA 4631427C17 gene, mRN...   145   7e-34   
gb:BC051504_2100775 Mus musculus mRNA similar to KIAA0828 protei...   145   7e-34   
gb:AK122382_2069047 Mus musculus mRNA for mKIAA0828 protein.          145   7e-34   
gb:AB020635_1865233 Homo sapiens mRNA for KIAA0828 protein, part...   145   7e-34   
gb:AK053527_1170463 Mus musculus 0 day neonate eyeball cDNA, RIK...   145   7e-34   
sp|Q96HN2|SAH3_HUMAN|SAH3_HUMAN Putative adenosylhomocysteinase 3 (EC 3.3.1...   145   7e-34   Homo sapiens [man]
gb:BC054614_2551024 Danio rerio S-adenosylhomocysteine hydrolase...   144   1e-33   
gb:BC065254_1986785 Homo sapiens cDNA clone IMAGE:6138596, parti...   144   2e-33   
gb:BC003631_1968941 Homo sapiens S-adenosylhomocysteine hydrolas...   144   2e-33   
gb:AL772411_1932843 Human DNA sequence from clone RP11-180N18 on...   144   2e-33   
gb:AF315687_1896429 Homo sapiens S-adenosylhomocysteine hydrolas...   144   2e-33   
gb:AF035319_1877930 Homo sapiens clone 23931 mRNA, partial cds.       144   2e-33   
gb:AF105295_1768303 Alexandrium fundyense S-adenosyl-homocystein...   144   2e-33   
gb:AX029176_1457188 Sequence 1 from Patent WO9814562.                 144   2e-33   
gb:HSM800298_1185800 Homo sapiens mRNA; cDNA DKFZp564A1523 (from...   144   2e-33   
pir|T08681|T08681 adenosylhomocysteinase (EC 3.3.1.1) DKFZp564A1...   144   2e-33   Homo sapiens [man]
sp|O43865|SAH2_HUMAN|SAH2_HUMAN Putative adenosylhomocysteinase 2 (EC 3.3.1...   144   2e-33   Homo sapiens [man]
pir|S22958|S22958 adenosylhomocysteinase (EC 3.3.1.1) - Streptom...   144   2e-33   Streptomyces fradiae
sp|P26799|SAHH_STRFR|SAHH_STRFR Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   144   2e-33   Streptomyces fradiae
gb:BC077247_2559964 Xenopus laevis MGC79134 protein, mRNA (cDNA ...   143   3e-33   
gb:BC059517_2552494 Danio rerio S-adenosylhomocysteine hydrolase...   143   3e-33   
gb:BC080079_2561511 Xenopus laevis MGC84148 protein, mRNA (cDNA ...   142   6e-33   
gb:BC081269_2562161 Xenopus laevis MGC86404 protein, mRNA (cDNA ...   141   1e-32   
gb:AE014296_1134419 Drosophila melanogaster chromosome 3L, compl...   140   2e-32   
gb:BT010277_1357568 Drosophila melanogaster RE06911 full insert ...   139   7e-32   
sp|P50245|SAH2_DROME|SAH2_DROME Putative adenosylhomocysteinase (EC 3.3.1.1...   137   1e-31   Drosophila melanogaster
gb:AE014297_1139957 Drosophila melanogaster chromosome 3R, compl...   135   9e-31   
sp|Q9I685|SAHH_PSEAE|SAHH_PSEAE Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   134   2e-30   Pseudomonas aeruginosa
gb:AF410884_508053 Mycobacterium avium subsp. paratuberculosis S...   132   5e-30   
gb:AE017340_456250 Idiomarina loihiensis L2TR, complete genome.       132   5e-30   
gb:CR543861_104166 Acinetobacter sp. ADP1 complete genome.            132   5e-30   
gb:AX063941_1458884 Sequence 223 from Patent WO0100843.>gb:AX244...   129   4e-29   
sp|Q87V73|SAHH_PSESM|SAHH_PSESM Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   128   9e-29   Pseudomonas syringae pv. tomato
pir|S01302|S01302 adenosylhomocysteinase (EC 3.3.1.1) - fruit fl...   128   1e-28   Drosophila melanogaster
pir|C90224|C90224 s-adenosyl-L-homocysteine hydrolase (ahcY) [im...   119   4e-26   Saccharolobus solfataricus
sp|P50252|SAHH_SULSO|SAHH_SULSO Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   119   4e-26   Saccharolobus solfataricus
sp|Q7NGI6|SAHH_GLOVI|SAHH_GLOVI Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   118   9e-26   Gloeobacter violaceus
gb:AP008231_580601 Synechococcus elongatus PCC 6301 DNA, complet...   117   2e-25   
sp|P74008|SAHH_SYNY3|SAHH_SYNY3 Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   115   6e-25   Synechocystis sp.
sp|Q975T0|SAHH_SULTO|SAHH_SULTO Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   115   1e-24   Sulfurisphaera tokodaii
gb:CP000027_79518 Dehalococcoides ethenogenes 195, complete genome.   109   6e-23   
sp|O67240|SAHH_AQUAE|SAHH_AQUAE Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   108   9e-23   Aquifex aeolicus
gb:BX957221_844173 Methanococcus maripaludis S2 complete genome;...   108   1e-22   
pir|B72649|B72649 probable adenosylhomocysteinase APE0624 - Aero...   108   1e-22   Aeropyrum pernix
sp|O28279|SAHH_ARCFU|SAHH_ARCFU Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   108   1e-22   Archaeoglobus fulgidus
sp|Q9YEF2|SAHH_AERPE|SAHH_AERPE Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   108   1e-22   Aeropyrum pernix
sp|Q8ZTQ7|SAHH_PYRAE|SAHH_PYRAE Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   107   2e-22   Pyrobaculum aerophilum
sp|Q8YX05|SAHH_ANASP|SAHH_ANASP Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   107   2e-22   Anabaena sp.
sp|Q8DGC8|SAHH_SYNEL|SAHH_SYNEL Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   105   8e-22   Synechococcus elongatus
sp|P58855|SAHH_METKA|SAHH_METKA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   103   4e-21   Methanopyrus kandleri
sp|Q58783|SAHH_METJA|SAHH_METJA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...   102   9e-21   Methanocaldococcus jannaschii
gb:AY142857_592040 Heliobacillus mobilis Adenosylhomocysteinase ...   101   1e-20   
gb:AP006840_568886 Symbiobacterium thermophilum DNA, complete ge...   101   2e-20   
gb:AP006878_575180 Thermococcus kodakaraensis strain KOD1 DNA, c...    98   1e-19   
gb:AF013268_468780 Thermotoga maritima S adenosylhomocysteine hy...    97   4e-19   
sp|O51933|SAHH_THEMA|SAHH_THEMA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...    97   4e-19   Thermotoga maritima
gb:AE017261_420287 Picrophilus torridus DSM 9790, complete genome.     94   2e-18   
pir|H71167|H71167 probable S-adenosyl-L-homocysteine hydrolase -...    92   7e-18   Pyrococcus horikoshii
sp|O58275|SAHH_PYRHO|SAHH_PYRHO Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...    92   7e-18   Pyrococcus horikoshii
sp|Q8PUQ4|SAHH_METMA|SAHH_METMA Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...    92   9e-18   Methanosarcina mazei
sp|P50251|SAHH_PYRFU|SAHH_PYRFU Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...    91   2e-17   Pyrococcus furiosus
sp|Q9UYK5|SAHH_PYRAB|SAHH_PYRAB Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...    90   5e-17   Pyrococcus abyssi
sp|Q8TRA5|SAHH_METAC|SAHH_METAC Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...    87   2e-16   Methanosarcina acetivorans
sp|Q979Z4|SAHH_THEVO|SAHH_THEVO Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...    87   4e-16   Thermoplasma volcanium
sp|O27673|SAHH_METTH|SAHH_METTH Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...    84   3e-15   Methanothermobacter thermautotrophicus
gb:AY596297_634056 Haloarcula marismortui ATCC 43049 chromosome ...    82   1e-14   
sp|Q9HKX4|SAHH_THEAC|SAHH_THEAC Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...    81   2e-14   Thermoplasma acidophilum
sp|Q9HN50|SAHH_HALN1|SAHH_HALN1 Adenosylhomocysteinase (EC 3.3.1.1) (S-aden...    72   7e-12   Halobacterium sp.
gb:AF178115_485818 Mycobacterium bovis S-adenosyl-L-homocysteine...    61   2e-08   
gb:AK131563_1918085 Homo sapiens cDNA FLJ16815 fis, clone THYMU3...    59   7e-08   
gb:AF129871_1770694 Gossypium hirsutum S-adenosyl-L-homocysteine...    50   5e-05   
gb:AX063939_1458883 Sequence 221 from Patent WO0100843.>gb:AX244...    49   9e-05   
gb:AE014295_311497 Bifidobacterium longum NCC2705, complete genome.    44   0.002   
gb:AE014296_1135677 Drosophila melanogaster chromosome 3L, compl...    33   3.9     


>gb:AF428329_1799259 Arabidopsis thaliana AT3g23810/MYM9_15 mRNA,
           complete cds.
          Length = 485

 Score =  313 bits (803), Expect = 1e-84
 Identities = 149/163 (91%), Positives = 157/163 (96%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+YPGVKRITIKPQTDR+VFPD
Sbjct: 323 TTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPD 382

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EKSSGKYEKKVY+LPKH
Sbjct: 383 TNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKH 442

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVAALHLGKLGARLTKLT +QS Y+SIPVEGPYKP HYRY
Sbjct: 443 LDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY 485



>gb:AY094404_1575709 Arabidopsis thaliana AT3g23810/MYM9_15 mRNA,
           complete cds.
          Length = 485

 Score =  313 bits (803), Expect = 1e-84
 Identities = 149/163 (91%), Positives = 157/163 (96%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+YPGVKRITIKPQTDR+VFPD
Sbjct: 323 TTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPD 382

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EKSSGKYEKKVY+LPKH
Sbjct: 383 TNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKH 442

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVAALHLGKLGARLTKLT +QS Y+SIPVEGPYKP HYRY
Sbjct: 443 LDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY 485



>gb:AY059888_1564732 Arabidopsis thaliana S-adenosyl L-homocystein
           hydrolase (MYM9.16) mRNA, complete
           cds.>gb:AY093385_1575339 Arabidopsis thaliana S-adenosyl
           L-homocystein hydrolase (MYM9.16) mRNA, complete
           cds.>gb:AY150471_1585036 Arabidopsis thaliana putative
           S-adenosyl-L-homocysteinase (At3g23810) mRNA, complete
           cds.>gb:AP000377_1819855 Arabidopsis thaliana genomic
           DNA, chromosome 3, P1 clone: MYM9.
          Length = 485

 Score =  313 bits (803), Expect = 1e-84
 Identities = 149/163 (91%), Positives = 157/163 (96%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+YPGVKRITIKPQTDR+VFPD
Sbjct: 323 TTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPD 382

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EKSSGKYEKKVY+LPKH
Sbjct: 383 TNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKH 442

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVAALHLGKLGARLTKLT +QS Y+SIPVEGPYKP HYRY
Sbjct: 443 LDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY 485



>gb:AY224544_1590741 Oryza sativa (japonica cultivar-group) isolate
           23829 wheat adenosylhomocysteinase-like protein mRNA,
           complete cds.
          Length = 485

 Score =  312 bits (800), Expect = 3e-84
 Identities = 148/163 (90%), Positives = 158/163 (96%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+YPGVKRITIKPQTDR+VFP+
Sbjct: 323 TTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPE 382

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKS+GKYEKKVY+LPKH
Sbjct: 383 TNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKH 442

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVAALHLGKLGARLTKL+  Q+ YIS+PVEGPYKPAHYRY
Sbjct: 443 LDEKVAALHLGKLGARLTKLSKSQADYISVPVEGPYKPAHYRY 485



>gb:AJ853475_1814921 Nicotiana glauca partial mRNA for putative
           adenosylhomocysteinase (ahc gene).
          Length = 264

 Score =  311 bits (797), Expect = 7e-84
 Identities = 147/163 (90%), Positives = 158/163 (96%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+YPGVKRITIKPQTDR+VFPD
Sbjct: 102 TTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPD 161

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EKSSGKYEKKVY+LPKH
Sbjct: 162 TNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKH 221

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVAALHLGKLGA+LTKL+ +Q+ YIS+PVEGPYKPAHYRY
Sbjct: 222 LDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY 264



>sp|P50248|SAHH_TOBAC Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase)
           (Cytokinin binding protein CBP57).>gb:D49804_1674629
           Nicotiana tabacum gene for S-adenosyl-L-homocysteine
           hydrolase, complete cds.>gb:TOBCBP57A_1725375 Tobacco
           mRNA for cytokinin binding protein CBP57
           (S-adenosyl-L-homocystein hydrolase), complete
           cds.>gb:TOBSALHHH_1725541 Nicotiana tabacum mRNA for
           S-adenosyl-L-homocysteine hydrolase, complete cds.
          Length = 485

 Score =  311 bits (797), Expect = 7e-84
 Identities = 147/163 (90%), Positives = 158/163 (96%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+YPGVKRITIKPQTDR+VFPD
Sbjct: 323 TTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPD 382

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EKSSGKYEKKVY+LPKH
Sbjct: 383 TNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKH 442

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVAALHLGKLGA+LTKL+ +Q+ YIS+PVEGPYKPAHYRY
Sbjct: 443 LDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY 485



>gb:AY050783_1562292 Arabidopsis thaliana putative
           S-adenosyl-L-homocysteinas protein (At3g23810) mRNA,
           complete cds.
          Length = 485

 Score =  310 bits (795), Expect = 1e-83
 Identities = 148/163 (90%), Positives = 156/163 (95%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+YPGVKRITIKPQTDR+VFPD
Sbjct: 323 TTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPD 382

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EKSSGKYEKKVY+LPK 
Sbjct: 383 TNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKR 442

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVAALHLGKLGARLTKLT +QS Y+SIPVEGPYKP HYRY
Sbjct: 443 LDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY 485



>gb:TOBCBP57B_1725376 Tobacco mRNA for cytokinin binding protein
           CBP57, complete cds.
          Length = 450

 Score =  310 bits (793), Expect = 2e-83
 Identities = 146/163 (89%), Positives = 158/163 (96%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE++PGVKRITIKPQTDR+VFPD
Sbjct: 288 TTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRWVFPD 347

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKS+GKYEKKVY+LPKH
Sbjct: 348 TNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTGKYEKKVYVLPKH 407

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVAALHLGKLGARLTKL+ +Q+ YIS+PVEGPYKP HYRY
Sbjct: 408 LDEKVAALHLGKLGARLTKLSKDQADYISVPVEGPYKPPHYRY 450



>gb:A57643_1449818 Sequence 1 from Patent WO9632488.
          Length = 485

 Score =  308 bits (790), Expect = 5e-83
 Identities = 143/163 (87%), Positives = 157/163 (96%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIM++HMRKMKNNAIVCNIGHFDNEIDM GLE+YPG+KRITIKPQTDR+VFP+
Sbjct: 323 TTTGNKDIIMLDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGIKRITIKPQTDRWVFPE 382

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK+SGKYEKKVY+LPKH
Sbjct: 383 TNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKH 442

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVAALHLGKLGA+LTKL+P Q+ YIS+P+EGPYKP HYRY
Sbjct: 443 LDEKVAALHLGKLGAKLTKLSPSQADYISVPIEGPYKPPHYRY 485



>sp|P93253|SAHH_MESCR Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:MCU79766_1685874 Mesembryanthemum
           crystallinum S-adenosyl-L-homocystein hydrolase mRNA,
           complete cds.
          Length = 485

 Score =  308 bits (790), Expect = 5e-83
 Identities = 145/163 (88%), Positives = 157/163 (96%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+YPGVKRITIKPQTDRFVFP+
Sbjct: 323 TTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRITIKPQTDRFVFPE 382

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           T TGII+LAEGRLM LGCATGHPSFVMSCSFTNQVIAQLELW E++SGKYEKKVY+LPKH
Sbjct: 383 TNTGIIVLAEGRLMKLGCATGHPSFVMSCSFTNQVIAQLELWNERASGKYEKKVYVLPKH 442

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVAALHLGKLGA+LTKL+ +Q+ YIS+PVEGPYKPAHYRY
Sbjct: 443 LDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY 485



>sp|P35007|SAHH_CATRO Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>pir|S38379|S38379 adenosylhomocysteinase
           (EC 3.3.1.1) - Madagascar periwinkle>gb:CRSAHH1_1673557
           C.roseus SAHH gene for S-adenosyl-L-homocysteine
           hydrolase.
          Length = 485

 Score =  308 bits (790), Expect = 5e-83
 Identities = 144/163 (88%), Positives = 157/163 (96%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+YPGVKRITIKPQTDR+VFPD
Sbjct: 323 TTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPD 382

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +GKYEKKVY+LPKH
Sbjct: 383 TNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTGKYEKKVYVLPKH 442

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVAALHLGKLGA+LTKLT +Q+ YIS+P+EGPYKPAHYRY
Sbjct: 443 LDEKVAALHLGKLGAKLTKLTKDQADYISVPIEGPYKPAHYRY 485



>sp|P50249|SAHH_PHASS Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>pir|S71621|S71621 adenosylhomocysteinase
           (EC 3.3.1.1) - Phalaenopsis sp.>gb:PSSADHY_1702392
           Phalaenopsis sp. 'pSPORT1' mRNA for
           S-adenosyhomocysteine hydrolase.
          Length = 485

 Score =  308 bits (789), Expect = 6e-83
 Identities = 146/163 (89%), Positives = 157/163 (96%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLES+PGVKRITIKPQTDR VFPD
Sbjct: 323 TTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLESFPGVKRITIKPQTDRRVFPD 382

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           T +GI++LAEGRLMNLGCATGHPSFVMS SFTNQVIAQLELWKE++SGKYEKKVY+LPKH
Sbjct: 383 TNSGILVLAEGRLMNLGCATGHPSFVMSSSFTNQVIAQLELWKERASGKYEKKVYVLPKH 442

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVAALHLGKLGA+LTKLTP Q+ YIS+PVEGPYKPAHYRY
Sbjct: 443 LDEKVAALHLGKLGAKLTKLTPSQADYISVPVEGPYKPAHYRY 485



>sp|O23255|SAHH_ARATH Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>pir|C71400|C71400 adenosylhomocysteinase
           (EC 3.3.1.1) [similarity] - Arabidopsis
           thaliana>gb:ATCHRIV37_1545158 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 37.>gb:ATFCA0_1551444
           Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
           fragment No. 0.>gb:AY042866_1560931 Arabidopsis thaliana
           adenosylhomocysteinase (Z97335.3) mRNA, complete
           cds.>gb:AY049279_1561921 Arabidopsis thaliana
           AT4g13940/dl3010w mRNA, complete
           cds.>gb:AY081468_1568728 Arabidopsis thaliana
           adenosylhomocysteinase (Z97335.3) mRNA, complete
           cds.>gb:AY090284_1574036 Arabidopsis thaliana
           AT4g13940/dl3010w mRNA, complete
           cds.>gb:BT002404_1636007 Arabidopsis thaliana
           adenosylhomocysteinase (At4g13940) mRNA, complete
           cds.>gb:AF059581_1765051 Arabidopsis thaliana
           S-adenosyl-L-homocysteine hydrolase (SAHH) mRNA,
           complete cds.>gb:AF325037_1786491 Arabidopsis thaliana
           AT4g13940 (AT4g13940/dl3010w) mRNA, complete cds.
          Length = 485

 Score =  308 bits (789), Expect = 6e-83
 Identities = 145/163 (88%), Positives = 156/163 (95%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+YPGVKRITIKPQTDR+VFP+
Sbjct: 323 TTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPE 382

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           TK GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK+SGKYEKKVY+LPKH
Sbjct: 383 TKAGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKH 442

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHLGKLGARLTKL+ +QS Y+SIP+EGPYKP HYRY
Sbjct: 443 LDEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY 485



>gb:AY224189_1590621 Medicago truncatula adenosylhomocysteinase
           (AHC2) gene, complete cds.
          Length = 485

 Score =  307 bits (787), Expect = 1e-82
 Identities = 144/163 (88%), Positives = 159/163 (97%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIMV+ M+KMKNNAIVCNIGHFDNEIDM GLE+YPGVKRITIKPQTDR+VFP+
Sbjct: 323 TTTGNKDIIMVSDMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPE 382

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ+ELWKEK+SGKYEKKVY+LPKH
Sbjct: 383 TKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQIELWKEKTSGKYEKKVYVLPKH 442

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVAALHLG+LGARLTKL+ +Q+ YIS+PVEGPYKPAHYRY
Sbjct: 443 LDEKVAALHLGQLGARLTKLSKDQADYISVPVEGPYKPAHYRY 485



>sp|Q9SWF5|SAHH_LYCES Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:AF161705_1773413 Lycopersicon esculentum
           S-adenosyl-l-homocysteine hydrolase (SAHH) mRNA,
           complete cds.
          Length = 485

 Score =  307 bits (786), Expect = 1e-82
 Identities = 144/163 (88%), Positives = 156/163 (95%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE++PGVKRITIKPQTDR+VFPD
Sbjct: 323 TTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRITIKPQTDRWVFPD 382

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+SSGKYEKKVY+LPKH
Sbjct: 383 TNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERSSGKYEKKVYVLPKH 442

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVAALHLGK GA+LTKLT +Q+ YI +PVEGPYKPAHYRY
Sbjct: 443 LDEKVAALHLGKFGAKLTKLTKDQADYIYVPVEGPYKPAHYRY 485



>gb:AY085669_1570736 Arabidopsis thaliana clone 16846 mRNA, complete
           sequence.
          Length = 485

 Score =  306 bits (785), Expect = 2e-82
 Identities = 144/163 (88%), Positives = 155/163 (95%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+YPGVKRITIKPQTDR+VFP+
Sbjct: 323 TTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPE 382

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           TK GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK+SGKYEKKVY+LPKH
Sbjct: 383 TKAGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKH 442

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHLGKLGARLTKL+ +Q  Y+SIP+EGPYKP HYRY
Sbjct: 443 LDEKVALLHLGKLGARLTKLSKDQXDYVSIPIEGPYKPPHYRY 485



>sp|Q01781|SAHH_PETCR Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:PUMSHHB_1702881 Parsley
           S-adenosylhomocysteine hydrolase (SHH) mRNA, complete
           cds.
          Length = 485

 Score =  306 bits (785), Expect = 2e-82
 Identities = 147/163 (90%), Positives = 156/163 (95%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIMV+ MRKMKNNAIVCNIGHFDNEIDM GLE+YPGVKRITIKPQTDR+VFPD
Sbjct: 323 TTTGNKDIIMVSDMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPD 382

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           T  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EKSSGKYEKKVY+LPKH
Sbjct: 383 TGRGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKH 442

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVAALHLGKLGA+LTKL+ +Q+ YIS+PVEGPYKPAHYRY
Sbjct: 443 LDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY 485



>sp|P50246|SAHH_MEDSA Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:ALFMSA2S_1818989 Medicago sativa
           adenosylhomocysteinase mRNA, complete cds.
          Length = 485

 Score =  306 bits (784), Expect = 2e-82
 Identities = 143/163 (87%), Positives = 159/163 (97%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIMV+ M+KMKNNAIVCNIGHFDNEIDM GLE+YPGVKRITIKPQTDR+VFP+
Sbjct: 323 TTTGNKDIIMVSDMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITIKPQTDRWVFPE 382

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ+ELWKEK+SGKYEKKVY+LPKH
Sbjct: 383 TKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQIELWKEKTSGKYEKKVYVLPKH 442

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVAALHLG+LGA+LTKL+ +Q+ YIS+PVEGPYKPAHYRY
Sbjct: 443 LDEKVAALHLGQLGAKLTKLSKDQADYISVPVEGPYKPAHYRY 485



>sp|P32112|SAHH_WHEAT Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>pir|T06764|T06764 adenosylhomocysteinase
           (EC 3.3.1.1) - wheat>gb:WHTSHH_1727713 Triticum aestivum
           S-adenosyl-L-homocysteine hydrolase (SH6.2) mRNA,
           complete cds.
          Length = 485

 Score =  306 bits (783), Expect = 3e-82
 Identities = 147/163 (90%), Positives = 155/163 (95%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+YPGVKRITIKPQTDR+VFP+
Sbjct: 323 TTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETYPGVKRITIKPQTDRWVFPE 382

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK+SGKYEKKVY+LPKH
Sbjct: 383 TKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKH 442

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVAALHLGKLGARLTKLT  QS YISIP+EGPYK   YRY
Sbjct: 443 LDEKVAALHLGKLGARLTKLTKSQSDYISIPIEGPYKLRLYRY 485



>gb:AY224188_1590620 Medicago truncatula adenosylhomocysteinase
           (AHC1) gene, complete cds.
          Length = 485

 Score =  305 bits (780), Expect = 7e-82
 Identities = 143/163 (87%), Positives = 155/163 (95%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIMV+ MRKMKNNAIVCNIGHFDNEIDM GLE+YPGVKR+TIKPQTDR+VFP+
Sbjct: 323 TTTGNKDIIMVDDMRKMKNNAIVCNIGHFDNEIDMSGLENYPGVKRVTIKPQTDRWVFPE 382

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ SGKYEKKVY+LPKH
Sbjct: 383 TNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSGKYEKKVYVLPKH 442

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVAALHLGKLGA+LTKL+  Q+ YIS+PVEGPYKPAHYRY
Sbjct: 443 LDEKVAALHLGKLGAKLTKLSQSQADYISVPVEGPYKPAHYRY 485



>gb:ATSADLHH_1554140 Arabidopsis thaliana mRNA for
           S-adenosyl-L-homocysteine hydrolase.
          Length = 467

 Score =  305 bits (780), Expect = 7e-82
 Identities = 143/163 (87%), Positives = 155/163 (95%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+YPGVKRITIKPQTDR+VFP+
Sbjct: 305 TTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPE 364

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           TK GII+LA+GRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK+SGKYEKKVY+LPKH
Sbjct: 365 TKAGIIVLAQGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASGKYEKKVYVLPKH 424

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHLGKLGARL KL+ +QS Y+SIP+EGPYKP HYRY
Sbjct: 425 LDEKVALLHLGKLGARLRKLSKDQSDYVSIPIEGPYKPPHYRY 467



>sp|Q9SP37|SAHH_LUPLU Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:AF185635_1775127 Lupinus luteus
           S-adenosyl-L-homocysteinase (SHH) mRNA, complete cds.
          Length = 485

 Score =  302 bits (773), Expect = 4e-81
 Identities = 143/163 (87%), Positives = 156/163 (95%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIM++HM+KMKNNAIVCNIGHFDNEIDM GLE++PGVKRITIKPQTDR+VFP+
Sbjct: 323 TTTGNKDIIMLDHMKKMKNNAIVCNIGHFDNEIDMLGLETHPGVKRITIKPQTDRWVFPE 382

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           T TGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EKSSGKYEKKVY+LPKH
Sbjct: 383 TNTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKH 442

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVAALHL KLGA+LTKL+ +Q+ YIS+PVEGPYKP HYRY
Sbjct: 443 LDEKVAALHLEKLGAKLTKLSKDQADYISVPVEGPYKPFHYRY 485



>pir|T15035|T15035 adenosylhomocysteinase (EC 3.3.1.1) -
           parsley>gb:PUMSHHA_1702880 Parsley
           S-adenosylhomocysteine hydrolase (SHH) mRNA, complete
           cds.
          Length = 227

 Score =  300 bits (768), Expect = 2e-80
 Identities = 145/163 (88%), Positives = 154/163 (94%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIMV+ MRKMKNNAIV NIGHFDNEIDM GLE+YPGVKRITIKPQTDR+VFPD
Sbjct: 65  TTTGNKDIIMVSDMRKMKNNAIVDNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPD 124

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           T  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EKSSGKYEKKVY+ PKH
Sbjct: 125 TGRGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVCPKH 184

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVAALHLGKLGA+LTKL+ +Q+ YIS+PVEGPYKPAHYRY
Sbjct: 185 LDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY 227



>gb:AF307335_1784661 Petunia x hybrida cytokinin binding protein
           (PETCBP) mRNA, complete cds.
          Length = 431

 Score =  277 bits (708), Expect = 2e-73
 Identities = 129/163 (79%), Positives = 148/163 (90%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG KDIIMV+H+RK+KNN  +CNIGHF +EIDM GL+++PGVKRITIKPQT R+VFPD
Sbjct: 269 TTTGTKDIIMVHHIRKIKNNGALCNIGHFHHEIDMLGLQTFPGVKRITIKPQTHRWVFPD 328

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           T +GII+LAEGRL+NLGCATGHP FVMSCSFT+QVIAQ  LWKEKS+GKY+KKVY+LPKH
Sbjct: 329 TNSGIIVLAEGRLINLGCATGHPRFVMSCSFTHQVIAQSSLWKEKSTGKYQKKVYVLPKH 388

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           L EKVAALHLGKLGARLTKL  +QS YI +PV+GPYKPAHYRY
Sbjct: 389 LHEKVAALHLGKLGARLTKLRKDQSDYIRVPVQGPYKPAHYRY 431



>gb:AP006841_574982 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 487

 Score =  224 bits (572), Expect = 9e-58
 Identities = 108/163 (66%), Positives = 132/163 (80%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGN DII ++HM +MK+ AIVCNIGHFDNEI +  L+ YPG+KR+ IKPQ DR+ FPD
Sbjct: 330 TTTGNIDIIRIDHMEQMKDQAIVCNIGHFDNEIQVDALKHYPGIKRVNIKPQVDRYYFPD 389

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
             + II+LA+GRL+NLGCATGHPSFVMS SFTNQ +AQ+EL+ +    KY+  VY LPKH
Sbjct: 390 GHS-IILLADGRLVNLGCATGHPSFVMSNSFTNQTLAQIELFNK----KYDINVYRLPKH 444

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE+VA LHL K+G +LTKLTPEQ+AYI + V+GPYK  HYRY
Sbjct: 445 LDEEVARLHLEKIGVKLTKLTPEQAAYIGVSVDGPYKADHYRY 487



>sp|Q8A407|SAHH_BACTN Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:AE016937_362164 Bacteroides
           thetaiotaomicron VPI-5482, section 12 of 21 of the
           complete genome.>gb:AE015928_988652 Bacteroides
           thetaiotaomicron VPI-5482, complete genome.
          Length = 476

 Score =  221 bits (563), Expect = 1e-56
 Identities = 107/163 (65%), Positives = 130/163 (79%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGN DII ++HM KMK+ AIVCNIGHFDNEI +  L+ Y G+K + IKPQ DR+ FPD
Sbjct: 319 TTTGNIDIIRIDHMEKMKDQAIVCNIGHFDNEIQVDALKHYSGIKCVNIKPQVDRYYFPD 378

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
             + I++LA+GRL+NLGCATGHPSFVMS SFTNQ +AQ+EL+ +    KYE  VY LPKH
Sbjct: 379 GHS-ILLLADGRLVNLGCATGHPSFVMSNSFTNQTLAQIELFNK----KYEVNVYRLPKH 433

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE+VA LHL K+G +LTKLTPEQ+AYI + V+GPYK  HYRY
Sbjct: 434 LDEEVARLHLEKIGVKLTKLTPEQAAYIGVSVDGPYKAEHYRY 476



>sp|Q8EXV1|SAHH_LEPIN Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:AE011599_274702 Leptospira interrogans
           serovar lai str. 56601 chromosome II, section 11 of 34
           of the complete sequence.>gb:AE016824_341445 Leptospira
           interrogans serovar Copenhageni str. Fiocruz L1-130,
           chromosome II, complete sequence.>gb:AE010301_1003376
           Leptospira interrogans serovar lai str. 56601 chromosome
           II, complete sequence.
          Length = 436

 Score =  216 bits (551), Expect = 2e-55
 Identities = 105/163 (64%), Positives = 127/163 (77%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN DII + HM+ MK+ AI+CNIGHFD EI M  L +  GV +  IKPQ D++ FPD
Sbjct: 279 TATGNDDIITLEHMKAMKDGAILCNIGHFDTEIQMSRLNNEKGVTKKEIKPQVDKYTFPD 338

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K+ II+LAEGRL+NLGCATGHPSFVMSCSFTNQV+AQ+EL+    + KYE  VY LPKH
Sbjct: 339 GKS-IIVLAEGRLVNLGCATGHPSFVMSCSFTNQVLAQIELY----NNKYELGVYTLPKH 393

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVAALHL +LG RLTKL  +Q+ Y+ +P+ GP+KP HYRY
Sbjct: 394 LDEKVAALHLEQLGVRLTKLNQKQADYLGVPINGPFKPDHYRY 436



>gb:AE013598_297499 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 511

 Score =  216 bits (549), Expect = 4e-55
 Identities = 102/163 (62%), Positives = 130/163 (79%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDII V H++ MK+ AIVCNIGHFDNEI +  L++   V++I IKPQ D++VFP+
Sbjct: 352 TTTGNKDIITVEHLQAMKDQAIVCNIGHFDNEIQVDALKALKDVQKINIKPQVDKYVFPN 411

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
               I +LA+GRL+NLGCATGHPSFVMS SF NQ +AQ++LW+++ +  YEKKVYILPKH
Sbjct: 412 -GNAIFLLADGRLVNLGCATGHPSFVMSNSFANQTLAQIDLWEKRDT--YEKKVYILPKH 468

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE+VA LHL K+G +LT LT +Q+ Y+ + V GPYKP HYRY
Sbjct: 469 LDEEVARLHLEKIGVKLTTLTKDQADYLGVDVAGPYKPDHYRY 511



>sp|Q8PCH5|SAHH_XANCP Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:AE012174_280023 Xanthomonas campestris
           pv. campestris str. ATCC 33913, section 82 of 460 of the
           complete genome.>gb:AE008922_913305 Xanthomonas
           campestris pv. campestris str. ATCC 33913, complete
           genome.
          Length = 480

 Score =  216 bits (549), Expect = 4e-55
 Identities = 103/163 (63%), Positives = 129/163 (79%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDII V H++ MK+ AIVCNIGHFDNEI +  L +  GV++I IKPQ D++VF +
Sbjct: 321 TTTGNKDIITVEHLQAMKDQAIVCNIGHFDNEIQVDALNALKGVEKINIKPQVDKYVFGN 380

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
               I +LA+GRL+NLGCATGHPSFVMS SF NQ +AQ++LW+++ S  YEKKVYILPKH
Sbjct: 381 GNA-IFLLADGRLVNLGCATGHPSFVMSNSFANQTLAQIDLWEKRDS--YEKKVYILPKH 437

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE+VA LHL K+G +LT LT +Q+ Y+ + V GPYKP HYRY
Sbjct: 438 LDEEVARLHLEKIGVKLTTLTKDQADYLGVDVAGPYKPDHYRY 480



>sp|Q8PP84|SAHH_XANAC Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:AE011711_275763 Xanthomonas axonopodis
           pv. citri str. 306, section 89 of 469 of the complete
           genome.>gb:AE008923_917538 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 480

 Score =  216 bits (549), Expect = 4e-55
 Identities = 102/163 (62%), Positives = 130/163 (79%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDII V H++ MK+ AIVCNIGHFDNEI +  L++   V++I IKPQ D++VFP+
Sbjct: 321 TTTGNKDIITVEHLQAMKDQAIVCNIGHFDNEIQVDALKALKDVQKINIKPQVDKYVFPN 380

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
               I +LA+GRL+NLGCATGHPSFVMS SF NQ +AQ++LW+++ +  YEKKVYILPKH
Sbjct: 381 -GNAIFLLADGRLVNLGCATGHPSFVMSNSFANQTLAQIDLWEKRDT--YEKKVYILPKH 437

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE+VA LHL K+G +LT LT +Q+ Y+ + V GPYKP HYRY
Sbjct: 438 LDEEVARLHLEKIGVKLTTLTKDQADYLGVDVAGPYKPDHYRY 480



>sp|Q7NZF7|SAHH_CHRVO Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:AE016913_355926 Chromobacterium
           violaceum ATCC 12472 section 4 of 16 of the complete
           genome.>gb:AE016825_1041080 Chromobacterium violaceum
           ATCC 12472 complete genome.
          Length = 466

 Score =  214 bits (546), Expect = 9e-55
 Identities = 105/163 (64%), Positives = 129/163 (79%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN  +I   HM+KM+NNAI+CNIGHFD+EI++  L  Y       IKPQ D  +FPD
Sbjct: 310 TATGNVGVITHEHMKKMRNNAIICNIGHFDSEIEVASLRQYQWEN---IKPQVDHIIFPD 366

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  +I+LAEGRL+NLGCATGHPSFVMS SFTNQV+AQ+EL+   +  KYEKKVY+LPKH
Sbjct: 367 GKR-VILLAEGRLVNLGCATGHPSFVMSNSFTNQVLAQIELFA--NGHKYEKKVYVLPKH 423

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHL ++GARLT+L+ +Q+AYIS+P +GPYKP HYRY
Sbjct: 424 LDEKVARLHLARIGARLTELSDQQAAYISVPKQGPYKPDHYRY 466



>pir|D82730|D82730 adenosylhomocysteinase XF1037 [imported] -
           Xylella fastidiosa (strain 9a5c)>gb:AE003941_48676
           Xylella fastidiosa 9a5c, section 87 of 229 of the
           complete genome.>gb:AE003849_1115886 Xylella fastidiosa
           9a5c, complete genome.
          Length = 446

 Score =  211 bits (538), Expect = 8e-54
 Identities = 101/163 (61%), Positives = 124/163 (76%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKD+I + HM  MK+  IVCNIGHFDNEI +  L +  GV++I IKPQ D+F+ P+
Sbjct: 287 TTTGNKDVIRIEHMTAMKDQVIVCNIGHFDNEIQVDALNALAGVQKINIKPQVDKFILPN 346

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
             T + +LAEGRL+NLGCATGHPSFVMS SF NQ +AQ++LW+ K    YEK VY LPK 
Sbjct: 347 GNT-LFLLAEGRLVNLGCATGHPSFVMSNSFANQTLAQIDLWQNKD--VYEKNVYRLPKK 403

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE+VA LHL K+G +LT LT  Q+AY+ I VEGP+KP HYRY
Sbjct: 404 LDEEVARLHLEKIGVKLTTLTANQAAYLGISVEGPFKPEHYRY 446



>sp|Q87EI8|SAHH_XYLFT Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:AE012554_283751 Xylella fastidiosa
           Temecula1, section 2 of 9 of the complete
           genome.>gb:AE009442_960327 Xylella fastidiosa Temecula1,
           complete genome.
          Length = 480

 Score =  211 bits (538), Expect = 8e-54
 Identities = 101/163 (61%), Positives = 124/163 (76%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKD+I + HM  MK+  IVCNIGHFDNEI +  L +  GV++I IKPQ D+F+ P+
Sbjct: 321 TTTGNKDVIRIEHMTAMKDQVIVCNIGHFDNEIQVDALNALTGVQKINIKPQVDKFILPN 380

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
             T + +LAEGRL+NLGCATGHPSFVMS SF NQ +AQ++LW+ K    YEK VY LPK 
Sbjct: 381 GNT-LFLLAEGRLVNLGCATGHPSFVMSNSFANQTLAQIDLWQNKD--VYEKNVYRLPKK 437

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE+VA LHL K+G +LT LT  Q+AY+ I VEGP+KP HYRY
Sbjct: 438 LDEEVARLHLEKIGVKLTTLTANQAAYLGISVEGPFKPEHYRY 480



>sp|Q9PEJ1|SAHH_XYLFA Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase).
          Length = 480

 Score =  211 bits (538), Expect = 8e-54
 Identities = 101/163 (61%), Positives = 124/163 (76%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKD+I + HM  MK+  IVCNIGHFDNEI +  L +  GV++I IKPQ D+F+ P+
Sbjct: 321 TTTGNKDVIRIEHMTAMKDQVIVCNIGHFDNEIQVDALNALAGVQKINIKPQVDKFILPN 380

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
             T + +LAEGRL+NLGCATGHPSFVMS SF NQ +AQ++LW+ K    YEK VY LPK 
Sbjct: 381 GNT-LFLLAEGRLVNLGCATGHPSFVMSNSFANQTLAQIDLWQNKD--VYEKNVYRLPKK 437

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE+VA LHL K+G +LT LT  Q+AY+ I VEGP+KP HYRY
Sbjct: 438 LDEEVARLHLEKIGVKLTTLTANQAAYLGISVEGPFKPEHYRY 480



>sp|Q8KEG8|SAHH_CHLTE Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:AE012843_286200 Chlorobium tepidum TLS
           section 64 of 194 of the complete
           genome.>gb:AE006470_933368 Chlorobium tepidum TLS
           complete genome.
          Length = 471

 Score =  210 bits (535), Expect = 2e-53
 Identities = 101/163 (61%), Positives = 127/163 (77%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNKD+I ++H+++M++ AIVCNIGHFDNEI +  L ++ G  RI IKPQ D++VF +
Sbjct: 314 TATGNKDVITLDHIKQMRDEAIVCNIGHFDNEIQVDALNNFKGATRINIKPQVDKYVFEN 373

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
               I +LAEGRL+NLGCATGHPSFVMS SFTNQ +AQ+ELW+      Y+  VY LPK 
Sbjct: 374 GNC-IYLLAEGRLVNLGCATGHPSFVMSNSFTNQTLAQIELWQND----YKVGVYRLPKK 428

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE+VA LHLG++GA+LT LT EQ+ YI +PVEGPYKP HYRY
Sbjct: 429 LDEEVARLHLGQIGAKLTTLTKEQADYIGVPVEGPYKPEHYRY 471



>sp|Q7TTZ5|SAHH_RHOBA Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:BX294143_768505 Pirellula sp. strain 1
           complete genome; segment 11/24.
          Length = 448

 Score =  208 bits (530), Expect = 7e-53
 Identities = 105/170 (61%), Positives = 127/170 (74%), Gaps = 7/170 (4%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRIT---IKPQ----T 555
           TTTGNKDII+  HM++M N+AI+CNIGHFD EID+   E      + T   IKP      
Sbjct: 279 TTTGNKDIILGEHMKQMPNDAILCNIGHFDTEIDIAWAEQQVADGKATVSEIKPSDIGAV 338

Query: 554 DRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKK 375
           DRF F DT   IIILA+GRL+NLGCATGHPSFVMS SFTNQV+AQ+EL++ + + KY  +
Sbjct: 339 DRFTFNDTGRSIIILAKGRLVNLGCATGHPSFVMSSSFTNQVLAQMELYQNRDNDKYGVQ 398

Query: 374 VYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           VY+LPK LDE+VA LHL  +G +LTKLT EQ+ YI +PVEGPYKP HYRY
Sbjct: 399 VYLLPKELDEEVARLHLEAIGVKLTKLTQEQADYIGVPVEGPYKPNHYRY 448



>gb:BX248345_760633 Mycobacterium bovis subsp. bovis AF2122/97
           complete genome; segment 12/14.
          Length = 495

 Score =  207 bits (528), Expect = 1e-52
 Identities = 102/163 (62%), Positives = 125/163 (76%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNKDIIM+ H++ MK++AI+ NIGHFDNEIDM GLE   G  R+ +KPQ D + F D
Sbjct: 336 TATGNKDIIMLEHIKAMKDHAILGNIGHFDNEIDMAGLER-SGATRVNVKPQVDLWTFGD 394

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           T   II+L+EGRL+NLG ATGHPSFVMS SF NQ IAQ+ELW +  + +Y+ +VY LPKH
Sbjct: 395 TGRSIIVLSEGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTK--NDEYDNEVYRLPKH 452

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA +H+  LG  LTKLT EQ+ Y+ + VEGPYKP HYRY
Sbjct: 453 LDEKVARIHVEALGGHLTKLTKEQAEYLGVDVEGPYKPDHYRY 495



>pir|B70593|B70593 adenosylhomocysteinase (EC 3.3.1.1) -
           Mycobacterium tuberculosis (strain
           H37RV)>gb:AE000516_23458 Mycobacterium tuberculosis
           CDC1551, complete genome.>gb:AF262755_493518
           Mycobacterium bovis S-adenosyl-L-homocysteine hydrolase
           gene, complete cds.>gb:BX842582_821352 Mycobacterium
           tuberculosis H37Rv complete genome; segment
           11/13.>gb:AX023852_1456779 Sequence 23 from Patent
           WO0021983.
          Length = 495

 Score =  207 bits (528), Expect = 1e-52
 Identities = 102/163 (62%), Positives = 125/163 (76%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNKDIIM+ H++ MK++AI+ NIGHFDNEIDM GLE   G  R+ +KPQ D + F D
Sbjct: 336 TATGNKDIIMLEHIKAMKDHAILGNIGHFDNEIDMAGLER-SGATRVNVKPQVDLWTFGD 394

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           T   II+L+EGRL+NLG ATGHPSFVMS SF NQ IAQ+ELW +  + +Y+ +VY LPKH
Sbjct: 395 TGRSIIVLSEGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTK--NDEYDNEVYRLPKH 452

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA +H+  LG  LTKLT EQ+ Y+ + VEGPYKP HYRY
Sbjct: 453 LDEKVARIHVEALGGHLTKLTKEQAEYLGVDVEGPYKPDHYRY 495



>sp|P60176|SAHH_MYCTU Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase).
          Length = 494

 Score =  207 bits (528), Expect = 1e-52
 Identities = 102/163 (62%), Positives = 125/163 (76%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNKDIIM+ H++ MK++AI+ NIGHFDNEIDM GLE   G  R+ +KPQ D + F D
Sbjct: 335 TATGNKDIIMLEHIKAMKDHAILGNIGHFDNEIDMAGLER-SGATRVNVKPQVDLWTFGD 393

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           T   II+L+EGRL+NLG ATGHPSFVMS SF NQ IAQ+ELW +  + +Y+ +VY LPKH
Sbjct: 394 TGRSIIVLSEGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTK--NDEYDNEVYRLPKH 451

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA +H+  LG  LTKLT EQ+ Y+ + VEGPYKP HYRY
Sbjct: 452 LDEKVARIHVEALGGHLTKLTKEQAEYLGVDVEGPYKPDHYRY 494



>sp|Q7TWW7|SAHH_MYCBO Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase).
          Length = 494

 Score =  207 bits (528), Expect = 1e-52
 Identities = 102/163 (62%), Positives = 125/163 (76%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNKDIIM+ H++ MK++AI+ NIGHFDNEIDM GLE   G  R+ +KPQ D + F D
Sbjct: 335 TATGNKDIIMLEHIKAMKDHAILGNIGHFDNEIDMAGLER-SGATRVNVKPQVDLWTFGD 393

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           T   II+L+EGRL+NLG ATGHPSFVMS SF NQ IAQ+ELW +  + +Y+ +VY LPKH
Sbjct: 394 TGRSIIVLSEGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTK--NDEYDNEVYRLPKH 451

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA +H+  LG  LTKLT EQ+ Y+ + VEGPYKP HYRY
Sbjct: 452 LDEKVARIHVEALGGHLTKLTKEQAEYLGVDVEGPYKPDHYRY 494



>sp|Q9ABH0|SAHH_CAUCR Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>pir|H87280|H87280 adenosylhomocysteinase
           [imported] - Caulobacter crescentus>gb:AE005699_74274
           Caulobacter crescentus CB15 section 25 of 359 of the
           complete genome.>gb:AE005673_921306 Caulobacter
           crescentus CB15 complete genome.
          Length = 463

 Score =  206 bits (523), Expect = 4e-52
 Identities = 105/163 (64%), Positives = 124/163 (76%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNKD+I V+ MRKMKNNAIVCNIGHFD+EI + GL ++   K   IKPQ     FPD
Sbjct: 307 TATGNKDVITVDDMRKMKNNAIVCNIGHFDSEIQIAGLRNF---KWDEIKPQVHHVEFPD 363

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  +I+L+EGRL+NLG ATGHPSFVMS SFTNQ +AQ+ELW  K+  KYE +VY LPKH
Sbjct: 364 GKK-LIVLSEGRLVNLGNATGHPSFVMSASFTNQTLAQIELWTNKA--KYENQVYTLPKH 420

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHL KLGA+LT L  +Q+ YI +P  GP+KP HYRY
Sbjct: 421 LDEKVAFLHLEKLGAKLTTLRKDQADYIGVPEAGPFKPDHYRY 463



>gb:AY233397_1311518 Trypanosoma cruzi S-adenosylhomocysteine
           hydrolase (SAHH) gene, complete cds.
          Length = 437

 Score =  205 bits (522), Expect = 6e-52
 Identities = 102/167 (61%), Positives = 130/167 (77%), Gaps = 4/167 (2%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGN DII   H  +M+++AIVCNIGHFD EI +  L++    +R+ +KPQ DR+   +
Sbjct: 273 TTTGNDDIITAEHFPRMQDDAIVCNIGHFDTEIQVSWLKAN-AKERVEVKPQVDRYTMHN 331

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEK----KVYI 366
            +  II+LAEGRL+NLGCA+GHPSFVMS SF+NQV+AQ+ELW ++ SGKY +    +VY 
Sbjct: 332 GRH-IILLAEGRLVNLGCASGHPSFVMSNSFSNQVLAQIELWTQRESGKYPRGEKAQVYF 390

Query: 365 LPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LPK LDEKVAALHLGKLGA+LTKLT  Q+ YI+ PV+GP+KP HYRY
Sbjct: 391 LPKKLDEKVAALHLGKLGAKLTKLTARQADYINCPVDGPFKPDHYRY 437



>sp|P51540|SAHH_TRIVA Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:TVU40872_1401280 Trichomonas vaginalis
           S-adenosyl-L-homocysteine hydrolase gene, complete cds.
          Length = 486

 Score =  205 bits (522), Expect = 6e-52
 Identities = 104/163 (63%), Positives = 124/163 (76%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN DII V+ M +MK+ AIV NIGHFDNEID  GL  YPG+K I IKP+ D + FPD
Sbjct: 327 TCTGNCDIISVDMMAQMKDKAIVGNIGHFDNEIDTDGLMKYPGIKHIPIKPEYDMWEFPD 386

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
               I++LAEGRL+NLGCATGHPSFVMS SFTNQ +AQL+L++++  G  E KVY LPKH
Sbjct: 387 GH-AILLLAEGRLLNLGCATGHPSFVMSMSFTNQTLAQLDLYEKR--GNLEMKVYTLPKH 443

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE+V  LHLG L   LTKLT +Q+ YI++PVEGPYK   YRY
Sbjct: 444 LDEEVVRLHLGSLDVHLTKLTQKQADYINVPVEGPYKSDAYRY 486



>gb:AE008692_239920 Zymomonas mobilis subsp. mobilis ZM4, complete
           genome.
          Length = 464

 Score =  205 bits (521), Expect = 7e-52
 Identities = 105/163 (64%), Positives = 127/163 (77%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN DII ++HMR MK +AIVCNIGHFD+EI +  L +   +K   IKPQ D   FPD
Sbjct: 308 TCTGNADIITLDHMRAMKQHAIVCNIGHFDSEIQINSLAN---MKWTEIKPQVDLVKFPD 364

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  II+LA+GRL+NLGCATGHPSFVMS SFTNQV+AQ+EL+   ++ KY+K VY+LPKH
Sbjct: 365 GKE-IIVLAKGRLVNLGCATGHPSFVMSASFTNQVLAQIELFC--NTDKYQKDVYMLPKH 421

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVAALHL KLG  L+KLT +Q+ YI +PV GP+KP HYRY
Sbjct: 422 LDEKVAALHLPKLGVHLSKLTQKQADYIGVPVNGPFKPDHYRY 464



>gb:AP006618_561013 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 494

 Score =  204 bits (520), Expect = 1e-51
 Identities = 102/163 (62%), Positives = 125/163 (76%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNKDII ++HM+ MK+ AI+ NIGHFDNEIDM  LE   G  R+TIKPQ D + F +
Sbjct: 335 TATGNKDIITLDHMKAMKDQAILGNIGHFDNEIDMAALER-SGATRLTIKPQVDLWTFGE 393

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           +   II+L+EGRL+NLG ATGHPSFVMS SF+NQVIAQ+ELW +    +Y+ +VY LPKH
Sbjct: 394 SGKSIIVLSEGRLLNLGNATGHPSFVMSNSFSNQVIAQIELWTKPE--EYDNEVYRLPKH 451

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA +H+  LG  LTKLT +Q+ YI + VEGPYKP HYRY
Sbjct: 452 LDEKVARIHVEALGGTLTKLTKDQAEYIGVDVEGPYKPEHYRY 494



>gb:AE017354_460376 Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1, complete genome.
          Length = 441

 Score =  203 bits (517), Expect = 2e-51
 Identities = 100/163 (61%), Positives = 128/163 (78%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN  ++  +HM++M+N AI+CNIGHFD+EID+Q L+ Y       IKPQ D  +FPD
Sbjct: 285 TATGNYHVVTHDHMKRMRNQAILCNIGHFDSEIDIQSLKQYQWEN---IKPQVDHVIFPD 341

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  IIILAEGRL+NLGCATGHPSFVMS SFTNQV+AQ+EL++  +S +Y+ +VY+LPK 
Sbjct: 342 GKR-IIILAEGRLVNLGCATGHPSFVMSASFTNQVLAQIELFQ--NSSQYQNQVYVLPKV 398

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHLG++GA+LT+L+ EQ+ YI +   GPYKP HYRY
Sbjct: 399 LDEKVARLHLGRIGAKLTQLSNEQADYIGVDKNGPYKPDHYRY 441



>gb:CR628337_115202 Legionella pneumophila str. Lens complete
           genome.
          Length = 441

 Score =  203 bits (517), Expect = 2e-51
 Identities = 100/163 (61%), Positives = 128/163 (78%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN  ++  +HM++M+N AI+CNIGHFD+EID+Q L+ Y       IKPQ D  +FPD
Sbjct: 285 TATGNYHVVTHDHMKRMRNQAILCNIGHFDSEIDIQSLKQYQWEN---IKPQVDHVIFPD 341

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  IIILAEGRL+NLGCATGHPSFVMS SFTNQV+AQ+EL++  +S +Y+ +VY+LPK 
Sbjct: 342 GKR-IIILAEGRLVNLGCATGHPSFVMSASFTNQVLAQIELFQ--NSSQYQNQVYVLPKV 398

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHLG++GA+LT+L+ EQ+ YI +   GPYKP HYRY
Sbjct: 399 LDEKVARLHLGRIGAKLTQLSNEQADYIGVDKNGPYKPDHYRY 441



>gb:CR628336_112119 Legionella pneumophila str. Paris complete
           genome.
          Length = 441

 Score =  203 bits (517), Expect = 2e-51
 Identities = 100/163 (61%), Positives = 128/163 (78%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN  ++  +HM++M+N AI+CNIGHFD+EID+Q L+ Y       IKPQ D  +FPD
Sbjct: 285 TATGNYHVVTHDHMKRMRNQAILCNIGHFDSEIDIQSLKQYQWEN---IKPQVDHVIFPD 341

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  IIILAEGRL+NLGCATGHPSFVMS SFTNQV+AQ+EL++  +S +Y+ +VY+LPK 
Sbjct: 342 GKR-IIILAEGRLVNLGCATGHPSFVMSASFTNQVLAQIELFQ--NSSQYQNQVYVLPKV 398

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHLG++GA+LT+L+ EQ+ YI +   GPYKP HYRY
Sbjct: 399 LDEKVARLHLGRIGAKLTQLSNEQADYIGVDKNGPYKPDHYRY 441



>gb:AB088224_11530 Streptomyces rochei plasmid pSLA2-L DNA, complete
           sequence.
          Length = 476

 Score =  202 bits (515), Expect = 4e-51
 Identities = 103/163 (63%), Positives = 122/163 (74%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIM + M +MK+ AIV NIGHFDNEIDM GL   PG+ +  +KPQ   + FPD
Sbjct: 317 TTTGNKDIIMASDMARMKHQAIVGNIGHFDNEIDMAGLARVPGIVKDEVKPQVHTWTFPD 376

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  II+L+EGRL+NLG ATGHPSFVMS SF +Q +AQ+EL+ +    +Y   VY LPKH
Sbjct: 377 GKV-IIVLSEGRLLNLGNATGHPSFVMSNSFADQTLAQIELFTKPD--QYPTGVYTLPKH 433

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHL  LG +LT L PEQ+AYI + VEGPYKP HYRY
Sbjct: 434 LDEKVARLHLDALGVKLTTLRPEQAAYIGVEVEGPYKPDHYRY 476



>gb:AE017282_426974 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 472

 Score =  202 bits (514), Expect = 5e-51
 Identities = 103/163 (63%), Positives = 123/163 (75%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN  +I  +HM KMK+ AIVCNIGHFD+EI++  +  Y       IKPQ D  V P+
Sbjct: 316 TATGNVGVITHDHMVKMKDQAIVCNIGHFDSEIEVAAMRQYTWEN---IKPQVDHIVLPN 372

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  II+LAEGRL+NLGCATGHPSFVMS SFTNQ +AQ+EL+      KYE KVY+LPKH
Sbjct: 373 GRR-IILLAEGRLVNLGCATGHPSFVMSNSFTNQTLAQIELFCH--GAKYENKVYVLPKH 429

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHL K+GARLT+L+ EQ+AYI +P EGPYKP HYRY
Sbjct: 430 LDEKVARLHLKKIGARLTELSDEQAAYIGVPKEGPYKPDHYRY 472



>sp|Q8GGL7|SAHH_STRAZ Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:AF484556_514900 Streptomyces
           atroolivaceus leinamycin biosynthetic gene cluster,
           complete sequence.
          Length = 469

 Score =  202 bits (514), Expect = 5e-51
 Identities = 101/163 (61%), Positives = 123/163 (75%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIM + M KMK+ AIV NIGHFDNEIDM GL   PG+ +  +KPQ   + FPD
Sbjct: 310 TTTGNKDIIMASDMAKMKHQAIVGNIGHFDNEIDMAGLAQIPGIVKDEVKPQVHTWKFPD 369

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  +I+L+EGRL+NLG ATGHPSFVMS SF +Q +AQ+EL+ +    +Y   VY+LPKH
Sbjct: 370 GKV-LIVLSEGRLLNLGNATGHPSFVMSNSFADQTLAQIELFTKPD--EYPTDVYVLPKH 426

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHL  LG +LT L PEQ++YI + V+GPYKP HYRY
Sbjct: 427 LDEKVARLHLDALGVKLTTLRPEQASYIGVEVDGPYKPDHYRY 469



>sp|Q7V926|SAHH_PROMM Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:BX572095_797480 Prochlorococcus marinus
           MIT9313 complete genome; segment 1/7.
          Length = 476

 Score =  201 bits (512), Expect = 8e-51
 Identities = 102/163 (62%), Positives = 123/163 (75%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T+TGN  +I   H+ +MK+ AIVCNIGHFDNEID+  L+ YP      IKPQ D    P 
Sbjct: 320 TSTGNFQVIRHEHLIRMKDEAIVCNIGHFDNEIDVASLKDYPWEN---IKPQVDHITLPS 376

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
               II+LAEGRL+NLGCATGHPSFVMS SFTNQV+AQ+EL+ +    +Y  +VY+LPKH
Sbjct: 377 GNK-IILLAEGRLVNLGCATGHPSFVMSNSFTNQVLAQIELFSK--GDQYADQVYVLPKH 433

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE VA LHL K+GARLT+LT +Q+ YIS+PVEGPYKP HYRY
Sbjct: 434 LDEMVARLHLEKIGARLTELTKQQADYISVPVEGPYKPDHYRY 476



>sp|Q89HP6|SAHH_BRAJA Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:BA000040_734204 Bradyrhizobium japonicum
           USDA 110 DNA, complete genome.
          Length = 473

 Score =  201 bits (512), Expect = 8e-51
 Identities = 101/163 (61%), Positives = 121/163 (74%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNKDII + HMR MK+ AIVCNIGHFDNEI + GL +   +K   IKPQ D   FPD
Sbjct: 315 TATGNKDIITIEHMRAMKDRAIVCNIGHFDNEIQIAGLRN---LKWTNIKPQVDEIEFPD 371

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  II+L+EGRL+NLG A GHPSFVMS SFTNQ +AQ+EL+     GKY+K+VY+LPK 
Sbjct: 372 -KHRIIMLSEGRLVNLGNAMGHPSFVMSASFTNQTLAQIELFANNKDGKYKKEVYVLPKT 430

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHL K+G +LT+L  +Q+ YI +  EGPYK  HYRY
Sbjct: 431 LDEKVARLHLAKIGVKLTELRKDQADYIGVKQEGPYKSDHYRY 473



>sp|Q82DC9|SAHH_STRAW Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:BA000030_702940 Streptomyces avermitilis
           MA-4680 genomic DNA, complete genome.
          Length = 485

 Score =  200 bits (509), Expect = 2e-50
 Identities = 101/163 (61%), Positives = 122/163 (74%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIM + M KMK+ AIV NIGHFDNEIDM GL   PG+ +  +KPQ   + FPD
Sbjct: 326 TTTGNKDIIMASDMAKMKHQAIVGNIGHFDNEIDMAGLAQIPGIVKDEVKPQVHTWKFPD 385

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  +I+L+EGRL+NLG ATGHPSFVMS SF +Q +AQ+EL+ +    +Y   VY+LPKH
Sbjct: 386 GKV-LIVLSEGRLLNLGNATGHPSFVMSNSFADQTLAQIELFTKPD--EYPTDVYVLPKH 442

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHL  LG +LT L PEQ+AYI + VEGP+K  HYRY
Sbjct: 443 LDEKVARLHLDSLGVKLTTLRPEQAAYIGVEVEGPFKSDHYRY 485



>sp|Q9CCJ4|SAHH_MYCLE Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>pir|D87005|D87005 probable
           S-adenosyl-L-homocysteine hydrolase [imported] -
           Mycobacterium leprae>gb:MLEPRTN3_146572 Mycobacterium
           leprae strain TN complete genome; segment 3/10.
          Length = 492

 Score =  200 bits (508), Expect = 2e-50
 Identities = 98/163 (60%), Positives = 123/163 (75%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNKDII++ HM+ MK++AI+ NIGHFDNEIDM  LE   G  R+ IKPQ D + F D
Sbjct: 333 TATGNKDIILLEHMKAMKDHAILGNIGHFDNEIDMAALER-SGATRLNIKPQVDLWTFGD 391

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           +   II+L+EGRL+NLG ATGHPSFVMS SF NQ IAQ+ELW +     Y+ +VY LPKH
Sbjct: 392 SGKSIIVLSEGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTKNDD--YDNEVYRLPKH 449

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA +H+  LG +LTKLT +Q+ Y+ + V+GP+KP HYRY
Sbjct: 450 LDEKVARVHVEALGGQLTKLTKDQAEYLGVDVDGPFKPDHYRY 492



>sp|Q8Y387|SAHH_RALSO Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:AL646057_545021 Ralstonia solanacearum
           GMI1000 chromosome, complete sequence; segment 1/19.
          Length = 474

 Score =  199 bits (507), Expect = 3e-50
 Identities = 105/165 (63%), Positives = 120/165 (72%), Gaps = 2/165 (1%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN  +I  +HM KMK+ AIVCNIGHFDNEID+  +E Y   +   IKPQ D  +FPD
Sbjct: 314 TCTGNYHVITHDHMAKMKDQAIVCNIGHFDNEIDIASVEQYQWEE---IKPQVDHVIFPD 370

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE--KSSGKYEKKVYILP 360
            K  IIILA+GRL+NLGCATGHPS+VMS SF NQ IAQ+ELW E  K S KY   VY LP
Sbjct: 371 GKK-IIILAKGRLVNLGCATGHPSYVMSSSFANQTIAQIELWTEAQKGSSKYPVGVYTLP 429

Query: 359 KHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           KHLDEKVA L L KL A+LT LT +Q+AYI +  EGPYK  HYRY
Sbjct: 430 KHLDEKVARLQLKKLNAQLTVLTDKQAAYIGVSKEGPYKADHYRY 474



>gb:BX572606_803628 Rhodopseudomonas palustris CGA009 complete
           genome; segment 14/16.
          Length = 469

 Score =  198 bits (504), Expect = 7e-50
 Identities = 101/163 (61%), Positives = 124/163 (76%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNKDII + HMR MK+ AIVCNIGHFDNEI +  L++   +K   IKPQ D   FPD
Sbjct: 313 TATGNKDIITIEHMRAMKDRAIVCNIGHFDNEIQVATLKN---MKWDNIKPQVDEITFPD 369

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  +I+L+EGRL+NLG A GHPSFVMS SFTNQ +AQ+EL++ +  GKYEKKVY+LPK 
Sbjct: 370 GKR-MILLSEGRLVNLGNAMGHPSFVMSASFTNQTLAQIELFQNQ--GKYEKKVYVLPKT 426

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHL K+G +LT+L  +Q+ YI + VEGP+K  HYRY
Sbjct: 427 LDEKVARLHLAKIGVKLTELRKDQADYIGVKVEGPFKADHYRY 469



>sp|Q9KZM1|SAHH_STRCO Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:SCO939114_176696 Streptomyces coelicolor
           A3(2) complete genome; segment 11/29.
          Length = 485

 Score =  198 bits (504), Expect = 7e-50
 Identities = 100/163 (61%), Positives = 120/163 (73%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIM   M KMK+ AIV NIGHFDNEIDM GL   PG+ +  +KPQ   + +PD
Sbjct: 326 TTTGNKDIIMAKDMAKMKHQAIVGNIGHFDNEIDMAGLAQTPGIVKDEVKPQVHTWTYPD 385

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  +I+L+EGRL+NLG ATGHPSFVMS SF +Q +AQ+EL+ +    +Y   VY+LPKH
Sbjct: 386 GKV-LIVLSEGRLLNLGNATGHPSFVMSNSFADQTLAQIELFTKPD--EYPTDVYVLPKH 442

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHL  LG +LT L PEQ+ YI + VEGPYK  HYRY
Sbjct: 443 LDEKVARLHLDSLGVKLTTLRPEQADYIGVKVEGPYKADHYRY 485



>sp|Q7UZN3|SAHH_PROMP Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:BX572094_797251 Prochlorococcus marinus
           MED4 complete genome; segment 5/5.
          Length = 472

 Score =  198 bits (504), Expect = 7e-50
 Identities = 101/163 (61%), Positives = 123/163 (75%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN  +I  +++ KMK+ AIVCNIGHFDNEID+  L+ YP      IKPQ D    P 
Sbjct: 316 TATGNYQVITNDNLIKMKDEAIVCNIGHFDNEIDVASLKDYPWEN---IKPQVDHITLPS 372

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
               II+LAEGRL+NLGCATGHPSFVMS SFTNQV+AQ+EL+ +  S +Y K+VY+LPKH
Sbjct: 373 GNK-IILLAEGRLVNLGCATGHPSFVMSNSFTNQVLAQIELFNK--SDEYSKEVYVLPKH 429

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE VA LHL K+GA+LTKLT +Q+ YI++ VEGPYKP  YRY
Sbjct: 430 LDEMVARLHLDKIGAKLTKLTKDQADYINVSVEGPYKPEQYRY 472



>sp|Q7U9Y3|SAHH_SYNPX Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:BX569689_775021 Synechococcus sp. WH8102
           complete genome; segment 1/7.
          Length = 476

 Score =  198 bits (503), Expect = 9e-50
 Identities = 99/163 (60%), Positives = 123/163 (75%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN  +I   H+ KMK+ AIVCNIGHFDNEID+  L+ Y   +   IKPQ D    P 
Sbjct: 320 TATGNYQVIRNEHLEKMKDEAIVCNIGHFDNEIDVASLKGY---EWDNIKPQVDHITLPS 376

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
               II+LAEGRL+NLGCATGHPSFVMS SFTNQV+AQ+EL+ +    +Y K+VY+LPKH
Sbjct: 377 GNR-IILLAEGRLVNLGCATGHPSFVMSNSFTNQVLAQIELFTK--GNEYGKEVYVLPKH 433

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE VA LHL ++GA+LT+L+ +Q+ YI++PVEGPYKP HYRY
Sbjct: 434 LDEMVARLHLDRIGAKLTELSKDQADYINVPVEGPYKPDHYRY 476



>sp|Q936D6|SAHH_STRAA Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:SAR416377_171813 Streptomyces
           argillaceus mtmZ gene, mtmA gene and mtmH gene.
          Length = 482

 Score =  198 bits (503), Expect = 9e-50
 Identities = 102/163 (62%), Positives = 120/163 (73%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDIIM   M +MK+ AIV NIGHFDNEIDM GL   PG+ +  IKPQ   + FPD
Sbjct: 323 TTTGNKDIIMAADMARMKHQAIVGNIGHFDNEIDMAGLAKVPGIVKDEIKPQVHTWTFPD 382

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  II+L+EGRL+NLG ATGHPSFVMS SF +Q +AQ+EL+ +   G Y   VY LPKH
Sbjct: 383 GKK-IIVLSEGRLLNLGNATGHPSFVMSNSFADQTLAQIELFTK--PGDYPTGVYTLPKH 439

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHL  LG +LT L PEQ++YI + V+GPYK  HYRY
Sbjct: 440 LDEKVARLHLDALGVKLTTLRPEQASYIGVDVDGPYKSDHYRY 482



>sp|Q98CM3|SAHH_RHILO Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:BA000012_669885 Mesorhizobium loti
           MAFF303099 DNA, complete genome.
          Length = 466

 Score =  198 bits (503), Expect = 9e-50
 Identities = 99/163 (60%), Positives = 126/163 (77%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKD++ ++HMR MK+  IV NIGHFDNEI +  L +   +K   +KPQ D   FPD
Sbjct: 310 TTTGNKDVVTLDHMRSMKDMVIVGNIGHFDNEIQVASLRN---LKWTNVKPQVDMITFPD 366

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  +I+L+EGRL+NLG ATGHPSFVMS SFTNQV+AQ+EL+ +    +Y+ +VY+LPKH
Sbjct: 367 GKR-MILLSEGRLLNLGNATGHPSFVMSASFTNQVLAQIELFTKGE--QYQNQVYVLPKH 423

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHL KLGARLT+L+ EQ+AYI +  +GP+KP HYRY
Sbjct: 424 LDEKVARLHLDKLGARLTELSGEQAAYIGVTPQGPFKPEHYRY 466



>gb:AY161083_1305326 Cryptosporidium parvum adenosylhomocysteinase
           gene, complete cds.
          Length = 493

 Score =  197 bits (502), Expect = 1e-49
 Identities = 96/167 (57%), Positives = 118/167 (70%), Gaps = 4/167 (2%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNKD+I V HMRKMK NA + NIGHFD+EID+ GLE+YPG+K I +K    +F FPD
Sbjct: 327 TATGNKDVITVEHMRKMKENAYIANIGHFDDEIDVYGLENYPGIKVIEVKQNVHKFTFPD 386

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKK----VYI 366
           T+  +I+L +GRL+NLGCATGHP  VMS SFTNQV+AQ++LWK +      K     V  
Sbjct: 387 TQKSVILLCKGRLVNLGCATGHPPLVMSMSFTNQVLAQMDLWKSRELVDRSKNTRFFVKK 446

Query: 365 LPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           L K LDE VA LHL  LG +LTKLT  Q+ YI++ + GPYK   YRY
Sbjct: 447 LSKELDEYVARLHLDVLGIKLTKLTETQAKYINVSINGPYKSEDYRY 493



>gb:AE017239_414067 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 13 of 16 of the complete
           genome.>gb:AE016958_1057471 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 496

 Score =  197 bits (502), Expect = 1e-49
 Identities = 99/163 (60%), Positives = 122/163 (74%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNKDII + HM+ MK+ AI+ NIGHFDNEI +  LE    +K   I+PQ D + FPD
Sbjct: 337 TATGNKDIITLEHMKAMKDKAILGNIGHFDNEIQIARLEKSGAIKT-NIRPQVDLWTFPD 395

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           T   II+L+EGRL+NLG ATGHPSFVMS SF+NQVIAQ+ELW +  + +Y+ +VY LPKH
Sbjct: 396 TGKSIIVLSEGRLLNLGNATGHPSFVMSNSFSNQVIAQIELWTK--NDEYDNEVYRLPKH 453

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA +H+  LG  LTKLT EQ+ YI + V+GPYK  HYRY
Sbjct: 454 LDEKVARIHVEALGGELTKLTKEQAEYIGVDVDGPYKADHYRY 496



>sp|Q83A77|SAHH_COXBU Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:AE016966_369208 Coxiella burnetii strain
           RSA 493, section 7 of 7 of the complete
           genome.>gb:AE016828_1009944 Coxiella burnetii strain RSA
           493, complete genome.
          Length = 429

 Score =  197 bits (501), Expect = 2e-49
 Identities = 99/163 (60%), Positives = 122/163 (74%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN DII   HM KMK+ AIVCNIGHFDNEID+  L+ Y   + + IKPQ D+ +FPD
Sbjct: 273 TATGNTDIITHEHMLKMKDQAIVCNIGHFDNEIDIASLQDY---QWMNIKPQVDQVIFPD 329

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  + +LA+GRL+NLGCATGHPSFVMS SFTNQV+AQ+ELW+     KY   VY+LPKH
Sbjct: 330 GKR-LTVLAQGRLVNLGCATGHPSFVMSNSFTNQVLAQIELWQYPE--KYPIGVYVLPKH 386

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE+VA LHL ++G +LT LT +Q+ YI +  EGP+K  HYRY
Sbjct: 387 LDEEVARLHLERVGGKLTTLTEKQADYIGVDPEGPFKSEHYRY 429



>gb:AY398307_2531837 Danio rerio clone RK113A3C03
           S-adenosylhomocysteine hydrolase (AHCY) mRNA, complete
           cds.>gb:BC044200_2548588 Danio rerio
           S-adenosylhomocysteine hydrolase, mRNA (cDNA clone
           MGC:55617 IMAGE:2644517), complete cds.
          Length = 433

 Score =  197 bits (500), Expect = 2e-49
 Identities = 100/163 (61%), Positives = 123/163 (75%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG +DI++  H   MK+++IVCNIGHFD EIDM+ L  +   K+I IKPQ DR+   +
Sbjct: 275 TTTGCEDILLGRHFEHMKDDSIVCNIGHFDCEIDMKWLNEH-AAKKINIKPQVDRYRMKN 333

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELWK  S  KY   VY LPK 
Sbjct: 334 GRH-IIVLAEGRLVNLGCAMGHPSFVMSNSFTNQVLAQIELWKNNS--KYPLGVYFLPKK 390

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE+VAA HL KLG +LTKLT +Q+ Y+ +P EGP+KP HYRY
Sbjct: 391 LDEEVAAAHLDKLGVKLTKLTEKQAKYLGLPSEGPFKPDHYRY 433



>gb:CR555306_106425 Azoarcus sp. EbN1 complete genome.
          Length = 470

 Score =  197 bits (500), Expect = 2e-49
 Identities = 101/163 (61%), Positives = 121/163 (74%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN  +I  +HM +MK+ AIVCNIGHFDNEID+  +E Y   +   IKPQ D  +FPD
Sbjct: 314 TCTGNYHVIRHDHMARMKDQAIVCNIGHFDNEIDVASIEGYEWEE---IKPQVDHVIFPD 370

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  II+LA+GRL+NLGCATGHPS+VMS SF NQ IAQ+EL+   +   Y   VY LPKH
Sbjct: 371 GKR-IILLAKGRLVNLGCATGHPSYVMSSSFANQTIAQIELFTRTAD--YPVGVYTLPKH 427

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA L L KL A+LT+L P+Q+AYI +PVEGPYK AHYRY
Sbjct: 428 LDEKVARLQLKKLNAQLTELRPDQAAYIGVPVEGPYKSAHYRY 470



>sp|P61617|SAHH_GEOSL Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:AE017180_400170 Geobacter sulfurreducens
           PCA, complete genome.
          Length = 475

 Score =  197 bits (500), Expect = 2e-49
 Identities = 101/163 (61%), Positives = 123/163 (75%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGN ++I  +HM+ M++NAIVCNIGHFDNEI++  L+ Y       IKPQ D  +FPD
Sbjct: 319 TTTGNINVITHDHMKAMRHNAIVCNIGHFDNEIEVAALKQYQWEN---IKPQVDHIIFPD 375

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           +K  II+LAEGRL+NLGCATGHPS+VMS SF NQ +AQ+EL+   + GKY   VY+LPK 
Sbjct: 376 SKR-IILLAEGRLVNLGCATGHPSYVMSSSFANQTLAQIELFC--NPGKYPVGVYMLPKE 432

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA L L  LGA LT+LT EQ+AYI +P  GPYK AHYRY
Sbjct: 433 LDEKVARLQLKTLGAMLTELTDEQAAYIGVPKNGPYKSAHYRY 475



>gb:CP000031_87847 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 462

 Score =  196 bits (498), Expect = 3e-49
 Identities = 99/163 (60%), Positives = 124/163 (76%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKD+I + HMR+MKN AIV NIGHFDNEI +  L+++   K   IK Q D    P 
Sbjct: 306 TTTGNKDVIRIEHMREMKNMAIVGNIGHFDNEIQVAALKNH---KWTNIKEQVDMIEMPS 362

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
               II+L+EGRL+NLG ATGHPSFVMS SFTNQV+AQ+EL+ +    +YE KVYILPKH
Sbjct: 363 GNK-IILLSEGRLLNLGNATGHPSFVMSASFTNQVLAQIELFTK--GDQYENKVYILPKH 419

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHL ++G +LT+L+P+Q++YI +  EGP+KP HYRY
Sbjct: 420 LDEKVARLHLARIGVKLTQLSPDQASYIGVKPEGPFKPEHYRY 462



>sp|P36889|SAHH_LEIDO Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:LEISADSH_1387444 L.donovani
           S-adenosylhomocysteine hydrolase gene, complete cds.
          Length = 437

 Score =  196 bits (498), Expect = 3e-49
 Identities = 99/167 (59%), Positives = 125/167 (74%), Gaps = 4/167 (2%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGN DII   H   M+++AIVCNIGHFD EI +  LE+    + + IKPQ DR+   +
Sbjct: 273 TTTGNDDIITSEHFPHMRDDAIVCNIGHFDTEIQVGWLEAN-AKEHVEIKPQVDRYTMEN 331

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKK----VYI 366
            +  II+LA+GRL+NLGCA+GHPSFVMS SFTNQV+AQ+ELW  + +GKY +     V+ 
Sbjct: 332 GRH-IILLAKGRLVNLGCASGHPSFVMSNSFTNQVLAQIELWSNRDNGKYPRGDKAGVFF 390

Query: 365 LPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LPK LDEKVAALHL  +GA+LTKLTP+Q+ YI+ PV GP+KP HYRY
Sbjct: 391 LPKALDEKVAALHLAHVGAKLTKLTPKQAEYINCPVNGPFKPDHYRY 437



>sp|Q7WQX5|SAHH_BORBR Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>sp|Q7W1Z7|SAHH_BORPA Adenosylhomocysteinase
           (EC 3.3.1.1) (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:BX640423_808449 Bordetella parapertussis
           strain 12822, complete genome; segment
           1/14.>gb:BX640437_812851 Bordetella bronchiseptica
           strain RB50, complete genome; segment 1/16.
          Length = 472

 Score =  196 bits (498), Expect = 3e-49
 Identities = 100/163 (61%), Positives = 122/163 (74%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN  +I   HM  MK+ AIVCNIGHFDNEID+ GLE+    +   IKPQ D  +FPD
Sbjct: 315 TATGNYHVITRQHMEAMKDQAIVCNIGHFDNEIDVAGLENCQWEE---IKPQVDHVIFPD 371

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  II+LA+GRL+NLGCATGHPSFVMS SF NQ IAQ+EL+  ++      +VY+LPKH
Sbjct: 372 GKR-IILLAKGRLVNLGCATGHPSFVMSSSFANQTIAQIELFT-RNEAYTTGQVYVLPKH 429

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHL KLGA+L+ L+ +Q+ YI +PVEGP+KP HYRY
Sbjct: 430 LDEKVARLHLKKLGAKLSTLSKQQADYIGVPVEGPFKPGHYRY 472



>gb:BX571965_793091 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.>gb:CP000010_866967
           Burkholderia mallei ATCC 23344 chromosome 1, complete
           sequence.
          Length = 473

 Score =  195 bits (496), Expect = 6e-49
 Identities = 96/163 (58%), Positives = 122/163 (74%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN  +I  +HM+ M++NAIVCNIGHFD+EID+     Y       IKPQ D  +FPD
Sbjct: 317 TATGNYHVINHDHMKAMRHNAIVCNIGHFDSEIDVASTRQYQWEN---IKPQVDHIIFPD 373

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  +I+LAEGRL+NLGCATGHPSFVMS SFTNQ +AQ+EL+     G+Y  KVY+LPKH
Sbjct: 374 GKR-VILLAEGRLVNLGCATGHPSFVMSNSFTNQTLAQIELFTR--GGEYANKVYVLPKH 430

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHL ++GA+L++L+ +Q+AYI +   GP+KP HYRY
Sbjct: 431 LDEKVARLHLARIGAQLSELSDDQAAYIGVSKAGPFKPDHYRY 473



>sp|Q82WL1|SAHH_NITEU Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:BX321858_772988 Nitrosomonas europaea
           ATCC 19718, complete genome; segment 3/10.
          Length = 478

 Score =  195 bits (496), Expect = 6e-49
 Identities = 99/164 (60%), Positives = 124/164 (75%), Gaps = 1/164 (0%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN  +I  +HM KMK+ +I+CNIGHFD+EID+  ++ Y       IKPQ D  +FP 
Sbjct: 322 TATGNLRVITHDHMLKMKDQSIICNIGHFDSEIDIASVQKYQWEN---IKPQVDHVIFP- 377

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGK-YEKKVYILPK 357
           T   II+LA+GRL+NLGCATGHPSFVMS SFTNQV+AQ+ELW+   +GK Y+KKVY+LPK
Sbjct: 378 TGRRIIVLAQGRLVNLGCATGHPSFVMSSSFTNQVLAQIELWQ---NGKDYQKKVYVLPK 434

Query: 356 HLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
            LDE VA LHLGKLG +LT+LT EQ+ Y+++   GPYKP  YRY
Sbjct: 435 RLDEMVARLHLGKLGVKLTELTDEQAHYLNLDKNGPYKPEMYRY 478



>gb:BX897699_826667 Bartonella henselae strain Houston-1, complete
           genome.
          Length = 465

 Score =  194 bits (493), Expect = 1e-48
 Identities = 99/163 (60%), Positives = 124/163 (76%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKDI+ ++HMRK+K+  I+ NIGHFDNEI +  L++ P      IKPQ D   FPD
Sbjct: 309 TTTGNKDIVRLDHMRKVKDMCILGNIGHFDNEIQVAALQNLPWTN---IKPQVDMITFPD 365

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  II+L+EGRL+NLG ATGHPSFVMS SFTNQV+AQ+EL+    SG Y+ +V +LPK+
Sbjct: 366 GKR-IILLSEGRLLNLGNATGHPSFVMSASFTNQVLAQIELFTR--SGHYKNEVTVLPKY 422

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHL +LG +LT L+ EQ+AYI +  +GPYKP HYRY
Sbjct: 423 LDEKVARLHLDQLGIKLTTLSQEQAAYIGVTPQGPYKPDHYRY 465



>sp|Q9ZNA5|SAHH_ROSDE Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:AB020211_3549 Roseobacter denitrificans
           gene for S-adenosyl L-homocystein hydrolase and 4 ORFs,
           complete cds.
          Length = 462

 Score =  194 bits (493), Expect = 1e-48
 Identities = 98/163 (60%), Positives = 121/163 (74%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKD+I + HMR MK+ AIV NIGHFDNEI +  L+++   K   IK Q D    P+
Sbjct: 306 TTTGNKDVIRIEHMRAMKDMAIVGNIGHFDNEIQVAALKNH---KWTNIKEQVDMIEMPN 362

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
               +I+L+EGRL+NLG ATGHPSFVMS SFTNQV+AQ+ELW    +  Y+ +VYILPKH
Sbjct: 363 GNR-LILLSEGRLLNLGNATGHPSFVMSASFTNQVLAQIELWTRADA--YDNEVYILPKH 419

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHL ++G +LT L PEQ+AYI +  EGP+KP HYRY
Sbjct: 420 LDEKVARLHLDRIGVKLTPLDPEQAAYIGVKPEGPFKPEHYRY 462



>sp|Q7VUL8|SAHH_BORPE Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:BX640420_807465 Bordetella pertussis
           strain Tohama I, complete genome; segment 10/12.
          Length = 472

 Score =  194 bits (492), Expect = 2e-48
 Identities = 99/163 (60%), Positives = 121/163 (74%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN  +I   HM  MK+ AIVCNIGHFDNEID+ GLE+    +   IKPQ D  +FPD
Sbjct: 315 TATGNYHVITRQHMEAMKDQAIVCNIGHFDNEIDVAGLENCQWEE---IKPQVDHVIFPD 371

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  II+LA+GRL+NLGCATGHPSFVMS SF NQ IAQ+EL+  ++      +VY+LPKH
Sbjct: 372 GKR-IILLAKGRLVNLGCATGHPSFVMSSSFANQTIAQIELFT-RNEAYTTGQVYVLPKH 429

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHL KLG +L+ L+ +Q+ YI +PVEGP+KP HYRY
Sbjct: 430 LDEKVARLHLKKLGVKLSTLSKQQADYIGVPVEGPFKPDHYRY 472



>pir|AG3505|AG3505 adenosylhomocysteinase (EC 3.3.1.1) [imported] -
           Brucella melitensis (strain 16M)>gb:AE009636_253947
           Brucella melitensis 16M chromosome I, section 193 of 195
           of the complete sequence.>gb:AE008917_979859 Brucella
           melitensis 16M chromosome I, complete sequence.
          Length = 481

 Score =  193 bits (491), Expect = 2e-48
 Identities = 98/163 (60%), Positives = 123/163 (75%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKD+I ++HMRKMK+  IV NIGHFDNEI +  L +   +K   +KPQ D   FPD
Sbjct: 325 TTTGNKDVITIDHMRKMKDMCIVGNIGHFDNEIQVAALRN---LKWTNVKPQVDLIEFPD 381

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  +I+L+EGRL+NLG ATGHPSFVMS SFTNQV+ Q+EL+    +  Y+ +VY+LPKH
Sbjct: 382 GKR-LILLSEGRLLNLGNATGHPSFVMSASFTNQVLGQIELFTRTDA--YKNEVYVLPKH 438

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHL KLGA+LT L+ EQ+AYI +  +GP+K  HYRY
Sbjct: 439 LDEKVARLHLDKLGAKLTVLSEEQAAYIGVTPQGPFKSEHYRY 481



>sp|Q8FXZ7|SAHH_BRUSU Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:AE014291_309501 Brucella suis 1330
           chromosome I, complete sequence.
          Length = 466

 Score =  193 bits (491), Expect = 2e-48
 Identities = 98/163 (60%), Positives = 123/163 (75%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKD+I ++HMRKMK+  IV NIGHFDNEI +  L +   +K   +KPQ D   FPD
Sbjct: 310 TTTGNKDVITIDHMRKMKDMCIVGNIGHFDNEIQVAALRN---LKWTNVKPQVDLIEFPD 366

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  +I+L+EGRL+NLG ATGHPSFVMS SFTNQV+ Q+EL+    +  Y+ +VY+LPKH
Sbjct: 367 GKR-LILLSEGRLLNLGNATGHPSFVMSASFTNQVLGQIELFTRTDA--YKNEVYVLPKH 423

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHL KLGA+LT L+ EQ+AYI +  +GP+K  HYRY
Sbjct: 424 LDEKVARLHLDKLGAKLTVLSEEQAAYIGVTPQGPFKSEHYRY 466



>sp|Q8YE49|SAHH_BRUME Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase).
          Length = 466

 Score =  193 bits (491), Expect = 2e-48
 Identities = 98/163 (60%), Positives = 123/163 (75%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKD+I ++HMRKMK+  IV NIGHFDNEI +  L +   +K   +KPQ D   FPD
Sbjct: 310 TTTGNKDVITIDHMRKMKDMCIVGNIGHFDNEIQVAALRN---LKWTNVKPQVDLIEFPD 366

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  +I+L+EGRL+NLG ATGHPSFVMS SFTNQV+ Q+EL+    +  Y+ +VY+LPKH
Sbjct: 367 GKR-LILLSEGRLLNLGNATGHPSFVMSASFTNQVLGQIELFTRTDA--YKNEVYVLPKH 423

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHL KLGA+LT L+ EQ+AYI +  +GP+K  HYRY
Sbjct: 424 LDEKVARLHLDKLGAKLTVLSEEQAAYIGVTPQGPFKSEHYRY 466



>pir|A45569|A45569 adenosylhomocysteinase (EC 3.3.1.1) - Leishmania
           donovani
          Length = 437

 Score =  193 bits (490), Expect = 3e-48
 Identities = 98/167 (58%), Positives = 124/167 (74%), Gaps = 4/167 (2%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGN DII   H   M+++AIVCNIGHFD EI +  LE+    + + IKPQ D +   +
Sbjct: 273 TTTGNDDIITSEHFPHMRDDAIVCNIGHFDTEIQVGWLEAN-AKEHVEIKPQVDFYTMEN 331

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKK----VYI 366
            +  II+LA+GRL+NLGCA+GHPSFVMS SFTNQV+AQ+ELW  + +GKY +     V+ 
Sbjct: 332 GRH-IILLAKGRLVNLGCASGHPSFVMSNSFTNQVLAQIELWSNRDNGKYPRGDKAGVFF 390

Query: 365 LPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LPK LDEKVAALHL  +GA+LTKLTP+Q+ YI+ PV GP+KP HYRY
Sbjct: 391 LPKALDEKVAALHLAHVGAKLTKLTPKQAEYINCPVNGPFKPDHYRY 437



>sp|Q8FRJ4|SAHH_COREF Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:BA000035_715552 Corynebacterium
           efficiens YS-314 DNA, complete genome.
          Length = 478

 Score =  192 bits (489), Expect = 4e-48
 Identities = 99/163 (60%), Positives = 122/163 (74%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNKDII    M KMK++A++ NIGHFDNEIDM  L     V R TIKPQ D F FP+
Sbjct: 319 TATGNKDIISYEQMLKMKDHALLGNIGHFDNEIDMHSLLHRDDVIRTTIKPQVDEFTFPN 378

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K+ II+L+EGRL+NLG ATGHPSFVMS SF +Q IAQ+EL++ +  G+YE +VY LPK 
Sbjct: 379 GKS-IIVLSEGRLLNLGNATGHPSFVMSTSFADQTIAQIELFQNE--GQYENQVYRLPKI 435

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA +H+  LG +LT+LT EQ+ YI + V GP+KP HYRY
Sbjct: 436 LDEKVARIHVEALGGKLTELTKEQAEYIGVDVAGPFKPEHYRY 478



>sp|P27604|SAHH_CAEEL Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>pir|T32918|T32918 adenosylhomocysteinase
           (EC 3.3.1.1) - Caenorhabditis
           elegans>gb:AF043699_1235954 Caenorhabditis elegans
           cosmid K02F2, complete sequence.>gb:CELHHG_1365962
           Caenorhabditis elegans s-adenosylhomocysteine hydrolase
           gene, complete cds.>gb:S57284_1396642 dpy-14 region:
           S-adenosylhomocysteine hydrolase [Caenorhabditis
           elegans, Genomic, 1728 nt].
          Length = 437

 Score =  191 bits (486), Expect = 8e-48
 Identities = 96/164 (58%), Positives = 125/164 (76%), Gaps = 1/164 (0%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG KDI+   H   + N+AIVCN+GHFD EID++ L +    K+ TIKPQ DR+   +
Sbjct: 276 TTTGCKDIVTGKHFELLPNDAIVCNVGHFDCEIDVKWLNTN-ATKKDTIKPQVDRYTLKN 334

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW-KEKSSGKYEKKVYILPK 357
            +  +I+LAEGRL+NLGCATGHPSFVMS SFTNQV+AQ+ELW K  +  +Y+  +Y+LPK
Sbjct: 335 GRH-VILLAEGRLVNLGCATGHPSFVMSNSFTNQVLAQVELWTKFGTPQEYKLGLYVLPK 393

Query: 356 HLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
            LDE+VA LHL +LG +LTKL+ EQ++Y+ +PV GPYKP HYRY
Sbjct: 394 TLDEEVAYLHLAQLGVKLTKLSDEQASYLGVPVAGPYKPDHYRY 437



>gb:AE008921_246378 Uncultured proteobacterium clone EBAC000-60D04
           complete sequence.
          Length = 463

 Score =  191 bits (485), Expect = 1e-47
 Identities = 97/163 (59%), Positives = 120/163 (73%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKD+I + HMR MK+ AIV NIGHFDNEI +  L+++   K   IK Q D    P+
Sbjct: 307 TTTGNKDVIRIEHMRDMKDMAIVGNIGHFDNEIQVASLKNH---KWTNIKEQVDMIEMPN 363

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
               +I+L+EGRL+NLG ATGHPSFVMS SFTNQV+AQ+ELW +     Y  +VYILPKH
Sbjct: 364 GNR-LILLSEGRLLNLGNATGHPSFVMSASFTNQVLAQIELWTKGDD--YSNEVYILPKH 420

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHL ++G +L+KL  EQ+AYI +  EGP+KP HYRY
Sbjct: 421 LDEKVARLHLDRIGVKLSKLNDEQAAYIGVSSEGPFKPEHYRY 463



>sp|Q7V9P3|SAHH_PROMA Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:AE017166_396241 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 section 6 of 6 of the
           complete genome.>gb:AE017126_1031910 Prochlorococcus
           marinus subsp. marinus str. CCMP1375 complete genome.
          Length = 476

 Score =  191 bits (484), Expect = 1e-47
 Identities = 98/163 (60%), Positives = 120/163 (73%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN  +I  +H+ +MK+ AIV NIGHFDNEID+  L+SY       IKPQ D    P 
Sbjct: 320 TATGNFQVICHDHLIRMKDEAIVSNIGHFDNEIDVASLKSYQWEN---IKPQVDHITLPS 376

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
               II+LAEGRL+NLGCATGHPSFVMS SFTNQV+AQ+EL+K+  S  Y+  VY+LPKH
Sbjct: 377 GNK-IILLAEGRLVNLGCATGHPSFVMSNSFTNQVLAQIELFKKGDS--YQNNVYVLPKH 433

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE VA LHL K+GA LT+L+ EQ+ YI++P+EGPYK   YRY
Sbjct: 434 LDEMVARLHLDKIGANLTELSKEQADYINVPIEGPYKSEQYRY 476



>gb:AF525293_1279200 Plasmodium falciparum 3D7
           S-adenosyl-L-homocysteine hydrolase gene, complete
           cds.>gb:PFA929353_1393112 Plasmodium falciparum strain
           3D7, chromosome 5, segment 3/4.
          Length = 479

 Score =  190 bits (483), Expect = 2e-47
 Identities = 92/163 (56%), Positives = 114/163 (69%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN D+I + H+ KMKNNA+V NIGHFD+EI +  L +Y G+    +KPQ DR   P+
Sbjct: 318 TCTGNVDVIKLEHLLKMKNNAVVGNIGHFDDEIQVNELFNYKGIHIENVKPQVDRITLPN 377

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
               II+LA GRL+NLGCATGHP+FVMS SF NQ  AQL+LW+ K + KYE KVY+LPKH
Sbjct: 378 GNK-IIVLARGRLLNLGCATGHPAFVMSFSFCNQTFAQLDLWQNKDTNKYENKVYLLPKH 436

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA  HL KL A LT+L   Q  ++ +   GP+K   YRY
Sbjct: 437 LDEKVALYHLKKLNASLTELDDNQCQFLGVNKSGPFKSNEYRY 479



>sp|P50250|SAHH_PLAF7 Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>pir|A54040|A54040 adenosylhomocysteinase
           (EC 3.3.1.1) - malaria parasite  (Plasmodium
           falciparum)>gb:PFU07365_1394999 Plasmodium falciparum
           S-adenosylhomocysteine hydrolase mRNA, complete cds.
          Length = 479

 Score =  190 bits (483), Expect = 2e-47
 Identities = 92/163 (56%), Positives = 114/163 (69%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN D+I + H+ KMKNNA+V NIGHFD+EI +  L +Y G+    +KPQ DR   P+
Sbjct: 318 TCTGNVDVIKLEHLLKMKNNAVVGNIGHFDDEIQVNELFNYKGIHIENVKPQVDRITLPN 377

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
               II+LA GRL+NLGCATGHP+FVMS SF NQ  AQL+LW+ K + KYE KVY+LPKH
Sbjct: 378 GNK-IIVLARGRLLNLGCATGHPAFVMSFSFCNQTFAQLDLWQNKDTNKYENKVYLLPKH 436

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA  HL KL A LT+L   Q  ++ +   GP+K   YRY
Sbjct: 437 LDEKVALYHLKKLNASLTELDDNQCQFLGVNKSGPFKSNEYRY 479



>gb:CP000009_863091 Gluconobacter oxydans 621H, complete genome.
          Length = 438

 Score =  190 bits (482), Expect = 2e-47
 Identities = 97/163 (59%), Positives = 121/163 (74%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN DII ++HMR+MK+ AIVCNIGHFD+EI ++ L +Y   +   IKPQ D      
Sbjct: 281 TCTGNVDIITIDHMREMKDRAIVCNIGHFDSEIQVEALRNY---RWNNIKPQVDEIELAP 337

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  II+L+EGRL+NLG ATGHPSFVMS SFTNQ +AQ+ELW  K  G+YE KVY LPK 
Sbjct: 338 NRR-IILLSEGRLVNLGNATGHPSFVMSASFTNQTLAQIELWTAKP-GQYEVKVYTLPKA 395

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVAALHL K+GA L+K++ +Q+ YI +PV GP+K   YRY
Sbjct: 396 LDEKVAALHLAKVGAELSKMSQKQADYIDVPVNGPFKHEEYRY 438



>gb:AY178804_595226 Agrobacterium tumefaciens
           S-adenosyl-L-homocysteine hydrolase (ahcY) and putative
           two-component sensor histidine kinase genes, partial
           cds.
          Length = 429

 Score =  189 bits (479), Expect = 5e-47
 Identities = 96/163 (58%), Positives = 123/163 (75%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           +TTGNKD+I ++HMR MK+ AIV NIGHFDNEI +  L +   +K   +KPQ D   F  
Sbjct: 273 STTGNKDVIRIDHMRAMKDMAIVGNIGHFDNEIQVAALRN---LKWTNVKPQVDLIEFAK 329

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
               II+L+EGRL+NLG ATGHPSFVMS SFTNQ +AQ+EL+ +   G+Y+ +VY+LPKH
Sbjct: 330 GNR-IILLSEGRLLNLGNATGHPSFVMSASFTNQTLAQIELFTKP--GQYQNQVYVLPKH 386

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHLGKLG +LT+L+ EQ+AYI +  +GP+K  HYRY
Sbjct: 387 LDEKVARLHLGKLGVKLTELSGEQAAYIGVTPQGPFKSDHYRY 429



>gb:AX397890_1467047 Sequence 1 from Patent WO0220806.
          Length = 498

 Score =  188 bits (478), Expect = 7e-47
 Identities = 98/163 (60%), Positives = 119/163 (73%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNKDII    M KMK++A++ NIGHFDNEIDM  L     V R TIKPQ D F F  
Sbjct: 339 TATGNKDIISFEQMLKMKDHALLGNIGHFDNEIDMHSLLHRDDVTRTTIKPQVDEFTF-S 397

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           T   II+L+EGRL+NLG ATGHPSFVMS SF +Q IAQ+EL++ +  G+YE +VY LPK 
Sbjct: 398 TGRSIIVLSEGRLLNLGNATGHPSFVMSNSFADQTIAQIELFQNE--GQYENEVYRLPKV 455

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA +H+  LG +LT+LT EQ+ YI + V GP+KP HYRY
Sbjct: 456 LDEKVARIHVEALGGQLTELTKEQAEYIGVDVAGPFKPEHYRY 498



>gb:BX927150_832335 Corynebacterium glutamicum ATCC 13032, IS
           fingerprint type 4-5, complete genome; segment
           3/10.>gb:AX063937_1458882 Sequence 219 from Patent
           WO0100843.>gb:AX244105_1464643 Sequence 97 from Patent
           WO0166573.
          Length = 478

 Score =  188 bits (478), Expect = 7e-47
 Identities = 98/163 (60%), Positives = 119/163 (73%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNKDII    M KMK++A++ NIGHFDNEIDM  L     V R TIKPQ D F F  
Sbjct: 319 TATGNKDIISFEQMLKMKDHALLGNIGHFDNEIDMHSLLHRDDVTRTTIKPQVDEFTF-S 377

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           T   II+L+EGRL+NLG ATGHPSFVMS SF +Q IAQ+EL++ +  G+YE +VY LPK 
Sbjct: 378 TGRSIIVLSEGRLLNLGNATGHPSFVMSNSFADQTIAQIELFQNE--GQYENEVYRLPKV 435

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA +H+  LG +LT+LT EQ+ YI + V GP+KP HYRY
Sbjct: 436 LDEKVARIHVEALGGQLTELTKEQAEYIGVDVAGPFKPEHYRY 478



>gb:AE017311_438861 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 3 of 12 of the complete
           genome.>gb:AE017285_1072022 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 479

 Score =  188 bits (478), Expect = 7e-47
 Identities = 95/163 (58%), Positives = 120/163 (73%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN ++I   HM  MK+ AIVCNIGHFDNEIDM  LE+  G   + IKPQ D++    
Sbjct: 321 TATGNCNVITGAHMEAMKDEAIVCNIGHFDNEIDMHYLENTEGCVCLNIKPQVDKWTLRS 380

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            ++ II+LAEGRL+NLGCATGHPSFVMS SFTNQ +AQ+EL    ++   E+KVY LPK 
Sbjct: 381 GRS-IIVLAEGRLVNLGCATGHPSFVMSASFTNQTLAQIEL---ATNPDLERKVYTLPKK 436

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE+VA LHL +LG +LT+L+ +Q+ YI +  EGP+KP HYRY
Sbjct: 437 LDEEVARLHLDRLGVKLTRLSKDQADYIGVSPEGPFKPDHYRY 479



>sp|O13639|SAHH_SCHPO Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>pir|T40763|T40763 adenosylhomocysteinase -
           fission yeast (Schizosaccharomyces
           pombe)>gb:AB004537_1509125 Schizosaccharomyces pombe 37
           kb genomic DNA, clone c213.>gb:SPBC8D2_1720514 S.pombe
           chromosome II cosmid c8D2.
          Length = 433

 Score =  188 bits (478), Expect = 7e-47
 Identities = 99/165 (60%), Positives = 122/165 (73%), Gaps = 2/165 (1%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG +DII   H  +MK ++IVCNIGHFD EID+  L++      + IKPQ DR+   +
Sbjct: 275 TTTGCRDIIRGEHFNEMKEDSIVCNIGHFDVEIDVAWLKAN-AKDVVNIKPQVDRY---E 330

Query: 533 TKTG--IIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILP 360
            K G  II+LA+GRL+NLGCATGHPSFVMSCSFTNQV+AQ+ LW + +S  Y   V++LP
Sbjct: 331 LKNGRHIILLADGRLVNLGCATGHPSFVMSCSFTNQVLAQIALWTDNTS--YPLGVHMLP 388

Query: 359 KHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           K LDE+VA LHLGKLG +LT LT  QS Y+ IPV+GPYK  HYRY
Sbjct: 389 KKLDEEVARLHLGKLGVKLTTLTSVQSDYLGIPVDGPYKADHYRY 433



>sp|Q8NSC4|SAHH_CORGL Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:BA000036_718479 Corynebacterium
           glutamicum ATCC 13032 DNA, complete genome.
          Length = 474

 Score =  188 bits (478), Expect = 7e-47
 Identities = 98/163 (60%), Positives = 119/163 (73%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNKDII    M KMK++A++ NIGHFDNEIDM  L     V R TIKPQ D F F  
Sbjct: 315 TATGNKDIISFEQMLKMKDHALLGNIGHFDNEIDMHSLLHRDDVTRTTIKPQVDEFTF-S 373

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           T   II+L+EGRL+NLG ATGHPSFVMS SF +Q IAQ+EL++ +  G+YE +VY LPK 
Sbjct: 374 TGRSIIVLSEGRLLNLGNATGHPSFVMSNSFADQTIAQIELFQNE--GQYENEVYRLPKV 431

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA +H+  LG +LT+LT EQ+ YI + V GP+KP HYRY
Sbjct: 432 LDEKVARIHVEALGGQLTELTKEQAEYIGVDVAGPFKPEHYRY 474



>sp|Q8UJ99|SAHH_AGRT5 Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>pir|AF2580|AF2580 S-adenosylhomocysteine
           hydrolase ahcY [imported] - Agrobacterium tumefaciens
           (strain C58, Dupont)>pir|D97362|D97362
           adenosylhomocysteinase (S-adenosyl-l-homocysteine
           hydrolase) (adohcyase) [imported] - Agrobacterium
           tumefaciens (strain C58, Cereon)>gb:AE007946_231793
           Agrobacterium tumefaciens str. C58 circular chromosome,
           section 4 of 254 of the complete
           sequence.>gb:AE008977_247087 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 3 of 256 of the
           complete sequence.>gb:AE007869_1081462 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.>gb:AE008688_1084930 Agrobacterium tumefaciens
           str. C58 circular chromosome, complete sequence.
          Length = 466

 Score =  188 bits (477), Expect = 9e-47
 Identities = 98/163 (60%), Positives = 121/163 (74%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKD+I + HMR+MK+ AIV NIGHFDNEI +  L +   +K   IKPQ D   FP 
Sbjct: 310 TTTGNKDVIRIEHMREMKDMAIVGNIGHFDNEIQVASLRN---LKWTNIKPQVDMIEFPK 366

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
               II+L+EGRL+NLG ATGHPSFVMS SFTNQV+ Q+EL+ +   G+Y+ +VY+LPKH
Sbjct: 367 GNR-IILLSEGRLLNLGNATGHPSFVMSASFTNQVLGQIELFTKP--GEYKNEVYVLPKH 423

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHL KLG RLT+L+  Q+ YI I  +GP+K  HYRY
Sbjct: 424 LDEKVARLHLEKLGVRLTELSDLQADYIGISKQGPFKAEHYRY 466



>pir|A46035|A46035 adenosylhomocysteinase (EC 3.3.1.1) - Rhodobacter
           capsulatus
          Length = 462

 Score =  187 bits (476), Expect = 1e-46
 Identities = 97/163 (59%), Positives = 120/163 (73%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKD+I + HMR+MK+ AIV NIGHFDNEI +  L+++   K   IK Q D    P 
Sbjct: 306 TTTGNKDVIRIEHMREMKDMAIVGNIGHFDNEIQVAALKNH---KWTNIKDQVDMIEMP- 361

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           +   II+L+EGRL+NLG ATGHPSFVMS SFTNQV+AQ+ELW +    +Y+  VYILPK 
Sbjct: 362 SGARIILLSEGRLLNLGNATGHPSFVMSASFTNQVLAQIELWTK--GAEYQPGVYILPKS 419

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHL K+G +LT L P+Q+ YI + VEGP+K  HYRY
Sbjct: 420 LDEKVARLHLKKIGVKLTTLRPDQAEYIGVTVEGPFKSDHYRY 462



>sp|P28183|SAHH_RHOCA Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:RCAAHCY_162417 Rhodobacter capsulatus
           adenosyl homocysteine hydrolase (ahcY) gene, complete
           cds.
          Length = 463

 Score =  187 bits (476), Expect = 1e-46
 Identities = 97/163 (59%), Positives = 120/163 (73%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKD+I + HMR+MK+ AIV NIGHFDNEI +  L+++   K   IK Q D    P 
Sbjct: 307 TTTGNKDVIRIEHMREMKDMAIVGNIGHFDNEIQVAALKNH---KWTNIKDQVDMIEMP- 362

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           +   II+L+EGRL+NLG ATGHPSFVMS SFTNQV+AQ+ELW +    +Y+  VYILPK 
Sbjct: 363 SGARIILLSEGRLLNLGNATGHPSFVMSASFTNQVLAQIELWTK--GAEYQPGVYILPKS 420

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHL K+G +LT L P+Q+ YI + VEGP+K  HYRY
Sbjct: 421 LDEKVARLHLKKIGVKLTTLRPDQAEYIGVTVEGPFKSDHYRY 463



>gb:AY278950_1315439 Branchiostoma belcheri tsingtaunese
           adenosylhomocysteinase mRNA, complete cds.
          Length = 434

 Score =  187 bits (475), Expect = 2e-46
 Identities = 95/163 (58%), Positives = 120/163 (73%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TG  DII   H ++MK +AIVCNIGHFD E++++ L      K+ TIKPQ DR+  P 
Sbjct: 277 TATGCADIITAKHFQEMKEDAIVCNIGHFDCELEVKWLNE--NAKKDTIKPQVDRYTLPS 334

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  II+LAEGRL+NLGCATGHPSFVMS SFTNQV+AQ+ELW +    +Y+  V++LPK 
Sbjct: 335 GRH-IILLAEGRLVNLGCATGHPSFVMSNSFTNQVLAQIELWTKPD--QYKIGVFVLPKK 391

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE+VA  HL +LG +LTKLT +Q+ Y+ IP EGPYKP  YRY
Sbjct: 392 LDEEVAEAHLEQLGVKLTKLTDDQAGYLGIPKEGPYKPDFYRY 434



>gb:AY593479_630666 Collimonas fungivorans fosmid CFUFOS19, complete
           sequence.
          Length = 480

 Score =  186 bits (472), Expect = 4e-46
 Identities = 98/163 (60%), Positives = 115/163 (70%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN  +I   HM+KMK+ AIVCNIGHFDNEI++  L+ Y       IKPQ D  +FPD
Sbjct: 324 TCTGNYHVITHAHMQKMKDQAIVCNIGHFDNEIEVAALKQYTWEN---IKPQVDHIIFPD 380

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  II+LAEGRL+NLGC TGHPS+VMS SF NQ IAQ+EL+    +  Y   VY LPKH
Sbjct: 381 GKR-IILLAEGRLVNLGCGTGHPSYVMSSSFANQTIAQIELFVNTKA--YPVGVYTLPKH 437

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA L L KL A+L+ LT EQ+AYI +   GPYKP HYRY
Sbjct: 438 LDEKVARLQLKKLNAQLSVLTEEQAAYIGVKQTGPYKPEHYRY 480



>pir|A26583|A26583 adenosylhomocysteinase (EC 3.3.1.1) -
           rat>gb:RATAHHA_2131427 Rat S-adenosyl-L-homocysteine
           hydrolase mRNA, complete cds.>gb:RNU14937_2136895 Rattus
           norvegicus S-adenosyl-L-homocysteine hydrolase gene,
           complete cds.
          Length = 432

 Score =  186 bits (472), Expect = 4e-46
 Identities = 95/163 (58%), Positives = 119/163 (73%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG  DII+  H  +MK++AIVCNIGHFD EID++ L     V+++ IKPQ DR++  +
Sbjct: 274 TTTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNEN-AVEKVNIKPQVDRYLLKN 332

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
               II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW      KY   V+ LPK 
Sbjct: 333 GHR-IILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPD--KYPVGVHFLPKK 389

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE VA  HLGKL  +LTKLT +Q+ Y+ +P+ GP+KP HYRY
Sbjct: 390 LDEAVAEAHLGKLNVKLTKLTEKQAQYLGMPINGPFKPDHYRY 432



>sp|Q92TC1|SAHH_RHIME Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:SME591782_184057 Sinorhizobium meliloti
           1021 complete chromosome; segment 1/12.
          Length = 466

 Score =  186 bits (472), Expect = 4e-46
 Identities = 95/163 (58%), Positives = 122/163 (74%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKD+I + HMR MK+ AIV NIGHFDNEI +  L +   +K   +KPQ D   FP 
Sbjct: 310 TTTGNKDVIRIEHMRAMKDMAIVGNIGHFDNEIQVSALRN---LKWTNVKPQVDLIEFPK 366

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
               II+L+EGRL+NLG ATGHPSFVMS SF+NQV+AQ+EL+ +    +Y+ +VY+LPK 
Sbjct: 367 GNR-IILLSEGRLLNLGNATGHPSFVMSASFSNQVLAQIELFTKGE--QYKNEVYVLPKQ 423

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHL KLGA+LT+L+ EQ++YI +  +GP+K  HYRY
Sbjct: 424 LDEKVARLHLAKLGAKLTELSEEQASYIGVKQQGPFKAEHYRY 466



>sp|P10760|SAHH_RAT Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase).
          Length = 431

 Score =  186 bits (472), Expect = 4e-46
 Identities = 95/163 (58%), Positives = 119/163 (73%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG  DII+  H  +MK++AIVCNIGHFD EID++ L     V+++ IKPQ DR++  +
Sbjct: 273 TTTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNEN-AVEKVNIKPQVDRYLLKN 331

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
               II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW      KY   V+ LPK 
Sbjct: 332 GHR-IILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPD--KYPVGVHFLPKK 388

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE VA  HLGKL  +LTKLT +Q+ Y+ +P+ GP+KP HYRY
Sbjct: 389 LDEAVAEAHLGKLNVKLTKLTEKQAQYLGMPINGPFKPDHYRY 431



>sp|P51893|SAH1_XENLA Adenosylhomocysteinase 1 (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase 1) (ADOHCYASE
           1).>pir|JC2480|JC2480 adenosylhomocysteinase (EC
           3.3.1.1) - African clawed frog>gb:BC060432_2552900
           Xenopus laevis adenosylhomocysteinase, mRNA (cDNA clone
           MGC:68782 IMAGE:4201976), complete
           cds.>gb:BC073400_2557242 Xenopus laevis cDNA clone
           MGC:80855 IMAGE:5514637, complete cds.>gb:XELAHH_2581742
           Xenopus laevis adenine homocysteine hydrolase mRNA,
           complete cds.
          Length = 433

 Score =  186 bits (472), Expect = 4e-46
 Identities = 95/163 (58%), Positives = 120/163 (73%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG  DI+   H   MK+++IVCNIGHFD E+D++ L     VK++ IKPQ DR++  +
Sbjct: 275 TTTGCADIVEGRHFENMKDDSIVCNIGHFDIELDVKWLNEN-AVKKVNIKPQVDRYLLKN 333

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW   ++ KY   VY LPK 
Sbjct: 334 GRH-IILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWT--NTDKYPVGVYFLPKK 390

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE VAA HL KLG +LTKLT +Q+ Y+ +  EGP+KP HYRY
Sbjct: 391 LDEAVAAAHLDKLGVKLTKLTDKQAKYLGLDKEGPFKPDHYRY 433



>gb:MUSSAHH_2129955 Mus musculus (clone C7/B9) S-adenosyl
           homocysteine hydrolase (ahcy) mRNA, complete cds.
          Length = 432

 Score =  186 bits (471), Expect = 5e-46
 Identities = 95/163 (58%), Positives = 119/163 (73%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG  DII+  H  +MK++AIVCNIGHFD EID++ L     V+++ IKPQ DR+   +
Sbjct: 274 TTTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNEN-AVEKVNIKPQVDRYWLKN 332

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW      KY   V+ LPK 
Sbjct: 333 GRR-IILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPD--KYPVGVHFLPKK 389

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE VA  HLGKL  +LTKLT +Q+ Y+ +P+ GP+KP HYRY
Sbjct: 390 LDEAVAEAHLGKLNVKLTKLTEKQAQYLGMPINGPFKPDHYRY 432



>gb:BC086781_2109794 Mus musculus cDNA clone MGC:102079
           IMAGE:6828058, complete cds.
          Length = 432

 Score =  186 bits (471), Expect = 5e-46
 Identities = 95/163 (58%), Positives = 119/163 (73%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG  DII+  H  +MK++AIVCNIGHFD EID++ L     V+++ IKPQ DR+   +
Sbjct: 274 TTTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNEN-AVEKVNIKPQVDRYWLKN 332

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW      KY   V+ LPK 
Sbjct: 333 GRR-IILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPD--KYPVGVHFLPKK 389

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE VA  HLGKL  +LTKLT +Q+ Y+ +P+ GP+KP HYRY
Sbjct: 390 LDEAVAEAHLGKLNVKLTKLTEKQAQYLGMPINGPFKPDHYRY 432



>gb:BC015304_2092144 Mus musculus S-adenosylhomocysteine hydrolase,
           mRNA (cDNA clone MGC:19228 IMAGE:4241917), complete
           cds.>gb:BC061841_2104700 Rattus norvegicus
           S-adenosylhomocysteine hydrolase, mRNA (cDNA clone
           MGC:72509 IMAGE:5599994), complete
           cds.>gb:BC086108_2564695 Xenopus laevis hypothetical
           LOC495745, mRNA (cDNA clone MGC:98492 IMAGE:7198568),
           complete cds.
          Length = 432

 Score =  186 bits (471), Expect = 5e-46
 Identities = 95/163 (58%), Positives = 119/163 (73%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG  DII+  H  +MK++AIVCNIGHFD EID++ L     V+++ IKPQ DR+   +
Sbjct: 274 TTTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNEN-AVEKVNIKPQVDRYWLKN 332

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW      KY   V+ LPK 
Sbjct: 333 GRR-IILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPD--KYPVGVHFLPKK 389

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE VA  HLGKL  +LTKLT +Q+ Y+ +P+ GP+KP HYRY
Sbjct: 390 LDEAVAEAHLGKLNVKLTKLTEKQAQYLGMPINGPFKPDHYRY 432



>gb:AK075629_1170915 Mus musculus 18-day embryo whole body cDNA,
           RIKEN full-length enriched library, clone:1110019K01
           product:S-adenosylhomocysteine hydrolase, full insert
           sequence.
          Length = 324

 Score =  186 bits (471), Expect = 5e-46
 Identities = 95/163 (58%), Positives = 119/163 (73%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG  DII+  H  +MK++AIVCNIGHFD EID++ L     V+++ IKPQ DR+   +
Sbjct: 166 TTTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNEN-AVEKVNIKPQVDRYWLKN 224

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW      KY   V+ LPK 
Sbjct: 225 GRR-IILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPD--KYPVGVHFLPKK 281

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE VA  HLGKL  +LTKLT +Q+ Y+ +P+ GP+KP HYRY
Sbjct: 282 LDEAVAEAHLGKLNVKLTKLTEKQAQYLGMPINGPFKPDHYRY 324



>sp|O50562|SAHH_RHOSH Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:RSU76671_168375 Rhodobacter sphaeroides
           photosynthetic regulatory protein (spb) gene and
           S-adenosyl L-homocystein hydrolase gene, complete cds.
          Length = 463

 Score =  186 bits (471), Expect = 5e-46
 Identities = 96/163 (58%), Positives = 121/163 (74%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGN+D+I + HMR+MK+ AIV NIGHFDNEI +  L+++   K   IK Q D    P 
Sbjct: 307 TTTGNRDVIRIEHMREMKDMAIVGNIGHFDNEIQVAALKNH---KWTNIKDQVDMIEMP- 362

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
           + + II+L+EGRL+NLG ATGHPSFVMS SFTNQV+AQ+ELW + +   Y+  VYILPK 
Sbjct: 363 SGSRIILLSEGRLLNLGNATGHPSFVMSASFTNQVLAQIELWTKGAD--YQPGVYILPKA 420

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHL K+G +LT + PEQ+ YI + VEGP+K  HYRY
Sbjct: 421 LDEKVARLHLKKIGVKLTDVRPEQADYIGVKVEGPFKAEHYRY 463



>sp|P50247|SAHH_MOUSE Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Liver
           copper binding protein) (CUBP).
          Length = 431

 Score =  186 bits (471), Expect = 5e-46
 Identities = 95/163 (58%), Positives = 119/163 (73%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG  DII+  H  +MK++AIVCNIGHFD EID++ L     V+++ IKPQ DR+   +
Sbjct: 273 TTTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNEN-AVEKVNIKPQVDRYWLKN 331

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW      KY   V+ LPK 
Sbjct: 332 GRR-IILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPD--KYPVGVHFLPKK 388

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE VA  HLGKL  +LTKLT +Q+ Y+ +P+ GP+KP HYRY
Sbjct: 389 LDEAVAEAHLGKLNVKLTKLTEKQAQYLGMPINGPFKPDHYRY 431



>sp|O76757|SAHH_ANOGA Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:AF080546_1239575 Anopheles gambiae
           S-adenosyl-L-homocysteine hydrolase mRNA, complete cds.
          Length = 432

 Score =  185 bits (469), Expect = 8e-46
 Identities = 95/163 (58%), Positives = 121/163 (74%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG  DIIM  H   MK+++IVCNIGHFD EI++  L+    V+++ IKPQ DR+   +
Sbjct: 274 TTTGCTDIIMGEHFLNMKDDSIVCNIGHFDCEINVTWLQEN-AVEKVNIKPQVDRYRLAN 332

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
               II+LAEGRL+NLGCA GH SFVMS SFTNQV+AQ+ELW  +   +Y   V++LPK 
Sbjct: 333 GNH-IILLAEGRLVNLGCAMGHSSFVMSNSFTNQVLAQIELWTNRE--QYAIGVHVLPKK 389

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LD++VAALHL KLG +LTKL+  Q  Y+++PVEGPYKP HYRY
Sbjct: 390 LDDEVAALHLDKLGVKLTKLSARQPEYLNLPVEGPYKPEHYRY 432



>sp|O93477|SAH2_XENLA Adenosylhomocysteinase 2 (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase 2) (ADOHCYASE
           2).>gb:BC074224_2557740 Xenopus laevis cDNA clone
           MGC:83407 IMAGE:7008476, complete
           cds.>gb:XLA7835_2582631 Xenopus Laevis mRNA for
           S-adenosyl-L-homocysteine hydrolase, alternate isoform.
          Length = 433

 Score =  185 bits (469), Expect = 8e-46
 Identities = 95/163 (58%), Positives = 119/163 (73%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG  DI+   H   MK+++IVCNIGHFD E+D++ L      K+I IKPQ DR++  +
Sbjct: 275 TTTGCADIVEGRHFENMKDDSIVCNIGHFDVELDVKWLNDN-AAKKINIKPQVDRYLLKN 333

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW   ++ KY   VY LPK 
Sbjct: 334 GRH-IILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWT--NTDKYPVGVYFLPKK 390

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE VAA HL KLG +LTKLT +Q+ Y+ +  EGP+KP HYRY
Sbjct: 391 LDEAVAAAHLDKLGVKLTKLTDKQAKYLGLDKEGPFKPDHYRY 433



>gb:AE014298_1125742 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003499_1212751 Drosophila melanogaster
           chromosome X, section 51 of 74 of the complete sequence.
          Length = 432

 Score =  184 bits (466), Expect = 2e-45
 Identities = 94/163 (57%), Positives = 122/163 (74%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG +DII   H+++M ++AIVCNIGHFD EID+  L +    +++ +KPQ DR+    
Sbjct: 274 TTTGCRDIITSVHLQQMPDDAIVCNIGHFDIEIDVDWLNAN-AKEKVNVKPQVDRYTMQS 332

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW +  S KY   V++LPK 
Sbjct: 333 GKH-IILLAEGRLVNLGCAHGHPSFVMSNSFTNQVLAQIELWTK--SDKYAVGVHVLPKI 389

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE+VA+LHL KLG +LTKLT +Q+ Y+ +   GP+KP HYRY
Sbjct: 390 LDEEVASLHLEKLGVKLTKLTEKQATYLGVSQTGPFKPDHYRY 432



>gb:BX897700_828277 Bartonella quintana str. Toulouse, complete
           genome.
          Length = 465

 Score =  183 bits (464), Expect = 3e-45
 Identities = 93/163 (57%), Positives = 119/163 (73%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNKD++ ++HMR++K+  I+ NIGHFDNEI +  L + P      IKPQ D   FPD
Sbjct: 309 TTTGNKDVVRLDHMRQVKDMCILGNIGHFDNEIQVSALRNLPWTN---IKPQVDIVTFPD 365

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  II+L+EGRL+NLG ATGHPSFVMS SFTNQV+AQ+EL+       Y+ +V +LPK 
Sbjct: 366 GKR-IILLSEGRLLNLGNATGHPSFVMSASFTNQVLAQIELFTRAEH--YKNEVTVLPKR 422

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA LHL +LG +L+ L+ EQ+ YI +  +GPYKP HYRY
Sbjct: 423 LDEKVARLHLDRLGVKLSVLSEEQAVYIGVTPQGPYKPNHYRY 465



>gb:SSC427478_1445205 Sus scrofa ASIP gene for agouti signalling
           protein and AHCY gene for S-adenosylhomocysteine
           hydrolase.
          Length = 432

 Score =  182 bits (463), Expect = 4e-45
 Identities = 95/163 (58%), Positives = 118/163 (72%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG  DII+  H  +MK++AIVCNIGHFD EID++ L     V+++ IKPQ DR++  +
Sbjct: 274 TTTGCIDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNEN-AVEKVNIKPQVDRYLLKN 332

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
               II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW      KY   V+ LPK 
Sbjct: 333 GHR-IILLAEGRLVNLGCAMGHPSFVMSNSFTNQVLAQIELWTHPD--KYPVGVHFLPKK 389

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE VA  HLGKL  +LTKLT +Q+ Y+ +  EGP+KP HYRY
Sbjct: 390 LDEAVAEAHLGKLNVKLTKLTEKQAQYLGMSREGPFKPDHYRY 432



>sp|Q12663|SAHH_PNECA Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase)
           (Fragment).>gb:PCU57795_1699482 Pneumocystis carinii f.
           sp. ratti S-adenosylhomocysteine hydrolase (SAHH) mRNA,
           partial cds.
          Length = 440

 Score =  182 bits (463), Expect = 4e-45
 Identities = 98/167 (58%), Positives = 120/167 (71%), Gaps = 4/167 (2%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRIT----IKPQTDRF 546
           T TG KDII   H   MKN+AI+CNIGHFD EID+  L     +K+ +    IKPQ DR+
Sbjct: 282 TATGCKDIICERHFEAMKNDAIICNIGHFDVEIDVAWL-----IKKCSSISNIKPQVDRY 336

Query: 545 VFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYI 366
           +  + +  II+LAEGRL+NLGCATGH S VMS SFTNQV+AQ+ LW  +  G+Y   V+ 
Sbjct: 337 LLGNGRN-IILLAEGRLVNLGCATGHSSMVMSMSFTNQVLAQIALWTAQ-EGQYPLGVHF 394

Query: 365 LPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LPK LDE+VA LHL KLG +LT LTPEQSAY+ IP++GPYK  HYRY
Sbjct: 395 LPKKLDEEVARLHLSKLG-KLTSLTPEQSAYLDIPIDGPYKSEHYRY 440



>sp|P61456|SAHH_CORDI Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:BX248355_761984 Corynebacterium
           diphtheriae gravis NCTC13129, complete genome; segment
           2/8.
          Length = 478

 Score =  182 bits (463), Expect = 4e-45
 Identities = 93/163 (57%), Positives = 117/163 (71%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN  II    M  MK++A++ NIGHFDNEIDM  L     V R+TIKPQ D F  P+
Sbjct: 319 TATGNMGIISFEQMLAMKDHAVLGNIGHFDNEIDMASLLHRDDVSRVTIKPQVDEFTLPN 378

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K+ I++L+EGRL+NLG ATGHPSFVMS SF +Q IAQ+EL++  + G+Y  +VY LPK 
Sbjct: 379 GKS-IVVLSEGRLLNLGNATGHPSFVMSTSFADQTIAQIELFQ--NDGRYVNEVYRLPKI 435

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDEKVA +H+  LG  +T+LT EQ+ YI + V GPYKP HYRY
Sbjct: 436 LDEKVARIHVEALGGTITELTKEQAEYIGVDVAGPYKPEHYRY 478



>gb:BX842649_824262 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 4/11.
          Length = 471

 Score =  182 bits (461), Expect = 7e-45
 Identities = 98/164 (59%), Positives = 118/164 (71%), Gaps = 1/164 (0%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TG  DII   H  KMKNNAIVCNIGHFD EIDM  L     ++ +  KPQ D     +
Sbjct: 313 TATGCCDIITDKHFMKMKNNAIVCNIGHFDIEIDMAWLNKNSKMREV--KPQVDIHTLKN 370

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEK-KVYILPK 357
            K  +IILA+GRL+NLGCATGHPSFVMS SFTNQV+AQ+EL+  +   KY+   VY LPK
Sbjct: 371 GKQ-VIILAKGRLVNLGCATGHPSFVMSNSFTNQVLAQMELFNNRD--KYQDIAVYRLPK 427

Query: 356 HLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           HLDEKVAALHL KLG +LTKL+ +Q+ Y+ +  +GP+KP HYRY
Sbjct: 428 HLDEKVAALHLDKLGVKLTKLSSKQAKYLHMSPQGPFKPEHYRY 471



>gb:BT007625_2150557 Synthetic construct Homo sapiens
           S-adenosylhomocysteine hydrolase mRNA, partial cds.
          Length = 433

 Score =  181 bits (460), Expect = 9e-45
 Identities = 94/163 (57%), Positives = 118/163 (72%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG  DII+  H  +MK++AIVCNIGHFD EID++ L     V+++ IKPQ DR+   +
Sbjct: 274 TTTGCIDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNEN-AVEKVNIKPQVDRYRLKN 332

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW      KY   V+ LPK 
Sbjct: 333 GRR-IILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPD--KYPVGVHFLPKK 389

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE VA  HLGKL  +LTKLT +Q+ Y+ +  +GP+KP HYRY
Sbjct: 390 LDEAVAEAHLGKLNVKLTKLTEKQAQYLGMSCDGPFKPDHYRY 432



>gb:HUMAHCY_2029084 Human S-adenosylhomocysteine hydrolase (AHCY)
           mRNA, complete cds.
          Length = 432

 Score =  181 bits (460), Expect = 9e-45
 Identities = 94/163 (57%), Positives = 118/163 (72%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG  DII+  H  +MK++AIVCNIGHFD EID++ L     V+++ IKPQ DR+   +
Sbjct: 274 TTTGCIDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNEN-AVEKVNIKPQVDRYRLKN 332

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW      KY   V+ LPK 
Sbjct: 333 GRR-IILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPD--KYPVGVHFLPKK 389

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE VA  HLGKL  +LTKLT +Q+ Y+ +  +GP+KP HYRY
Sbjct: 390 LDEAVAEAHLGKLNVKLTKLTEKQAQYLGMSCDGPFKPDHYRY 432



>sp|P23526|SAHH_HUMAN Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>pir|A43629|A43629 adenosylhomocysteinase
           (EC 3.3.1.1) - human>gb:AL356299_1924403 Human DNA
           sequence from clone CTD-3216D2 on chromosome 20 Contains
           the AHCY gene encoding S-adenosylhomocysteine hydrolase,
           the 5' end of the ITCH gene for itchy homolog E3
           ubiquitin protein ligase (mouse), the CDC42P1 gene for
           cell division cycle 42 pseudogene 1, a pseudogene
           similar to part of laminin receptor 1 (ribosomal protein
           SA, 67kDa) (LAMR1) and two CpG islands, complete
           sequence.>gb:BC010018_1972428 Homo sapiens
           S-adenosylhomocysteine hydrolase, mRNA (cDNA clone
           MGC:19639 IMAGE:2905378), complete
           cds.>gb:BC011606_1973071 Homo sapiens
           S-adenosylhomocysteine hydrolase, mRNA (cDNA clone
           MGC:2319 IMAGE:3139231), complete
           cds.>gb:BT006697_1990135 Homo sapiens
           S-adenosylhomocysteine hydrolase mRNA, complete
           cds.>gb:HUMAHCY2_2029085 Human S-adenosylhomocysteine
           hydrolase (AHCY) mRNA, complete cds.
          Length = 432

 Score =  181 bits (460), Expect = 9e-45
 Identities = 94/163 (57%), Positives = 118/163 (72%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG  DII+  H  +MK++AIVCNIGHFD EID++ L     V+++ IKPQ DR+   +
Sbjct: 274 TTTGCIDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNEN-AVEKVNIKPQVDRYRLKN 332

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW      KY   V+ LPK 
Sbjct: 333 GRR-IILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPD--KYPVGVHFLPKK 389

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE VA  HLGKL  +LTKLT +Q+ Y+ +  +GP+KP HYRY
Sbjct: 390 LDEAVAEAHLGKLNVKLTKLTEKQAQYLGMSCDGPFKPDHYRY 432



>gb:AY102668_1299071 Drosophila melanogaster GM02466 full insert
           cDNA.
          Length = 432

 Score =  179 bits (453), Expect = 6e-44
 Identities = 93/163 (57%), Positives = 120/163 (73%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG +DII   H+++M ++AIVCNIGHFD EID+  L +    +++ +KPQ  R     
Sbjct: 274 TTTGCRDIITSVHLQQMPDDAIVCNIGHFDIEIDVDWLNAN-AKEKVNVKPQVIRHTMQS 332

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW +  S KY   V++LPK 
Sbjct: 333 GKH-IILLAEGRLVNLGCAHGHPSFVMSNSFTNQVLAQIELWTK--SDKYAVGVHVLPKI 389

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE+VA+LHL KLG +LTKLT +Q+ Y+ +   GP+KP HYRY
Sbjct: 390 LDEEVASLHLEKLGVKLTKLTEKQATYLGVSQTGPFKPDHYRY 432



>sp|P10819|SAHH_DICDI Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>pir|A27655|A27655 adenosylhomocysteinase
           (EC 3.3.1.1) - slime mold  (Dictyostelium
           discoideum)>gb:DDIAHHA_1377016 Slime mold (D.discoideum)
           S-adenosyl-L-homocysteine hydrolase mRNA, complete cds.
          Length = 430

 Score =  178 bits (452), Expect = 7e-44
 Identities = 93/163 (57%), Positives = 116/163 (71%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG +DI+   H   MK +AIVCNIGHFD EID+  L +    K+ T+KPQ DR+   +
Sbjct: 273 TTTGCRDIVRGEHFAVMKEDAIVCNIGHFDCEIDVAWLNA--NAKKDTVKPQVDRYTLAN 330

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
               II+LAEGRL+NLGC TGHPSFVMS SF NQ +AQ+ LW +    +Y   V++LPK 
Sbjct: 331 G-VHIILLAEGRLVNLGCGTGHPSFVMSNSFCNQTLAQIALWTKTE--EYPLGVHLLPKI 387

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE+VA LHL +LGA+LT LT +QS Y+S+PV GPYK  HYRY
Sbjct: 388 LDEEVARLHLDQLGAKLTTLTEKQSEYLSVPVAGPYKVDHYRY 430



>sp|Q27580|SAHH_DROME Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:DMAHCYGEN_1378034 D.melanogaster mRNA
           for S-adenosyl-L-homocysteine hydrolase.
          Length = 431

 Score =  178 bits (451), Expect = 1e-43
 Identities = 93/165 (56%), Positives = 121/165 (73%), Gaps = 2/165 (1%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG +DII   H+++M ++ IVCNIGHFD EID+  L +    +++ +KPQ DR+    
Sbjct: 274 TTTGCRDIITSVHLQQMPDDRIVCNIGHFDIEIDVDWLNAN-AKEKVNVKPQVDRYTMKS 332

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW--KEKSSGKYEKKVYILP 360
            K  II+LAEGRL+NLGCA GHPSFVMS SFTNQV+AQ+ELW   +KS G     V++LP
Sbjct: 333 GKH-IILLAEGRLVNLGCADGHPSFVMSNSFTNQVLAQIELWTKSDKSVG-----VHVLP 386

Query: 359 KHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           K LDE+VA+LHL KLG +LTKLT +Q+ Y+ +   GP+KP HYRY
Sbjct: 387 KILDEEVASLHLEKLGVKLTKLTEKQATYLGVSQTGPFKPDHYRY 431



>gb:CR382121_1654313 Kluyveromyces lactis strain NRRL Y-1140
           chromosome A of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 449

 Score =  175 bits (443), Expect = 8e-43
 Identities = 93/175 (53%), Positives = 119/175 (68%), Gaps = 12/175 (6%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG +DII   H  +M  +AIVCNIGHFD EID+  L++    + I IKPQ DR++ P 
Sbjct: 277 TTTGCRDIITKEHFLQMPEDAIVCNIGHFDIEIDVAWLKAN-ATEVINIKPQVDRYLLPS 335

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKS------------SG 390
            K  +I+LA+GRL+NLGCATGH SFVMSCSF+NQV+AQ+ L+K +             +G
Sbjct: 336 GKH-VILLADGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKAQDKAFREKYIEFQKTG 394

Query: 389 KYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
            ++  V++LPK LDE VA  HL  LG +LTKL+  QS Y+ IP EGPYK  HYRY
Sbjct: 395 PFDIGVHVLPKILDEAVAKFHLDNLGVKLTKLSDVQSEYLGIPEEGPYKADHYRY 449



>gb:AE017344_1755987 Cryptococcus neoformans var. neoformans JEC21
           chromosome 4, complete sequence.
          Length = 431

 Score =  173 bits (439), Expect = 2e-42
 Identities = 89/163 (54%), Positives = 113/163 (69%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG +DII   H   M  +AIV NIGHFD EID+  L++    + + IKPQ DRF    
Sbjct: 273 TTTGCRDIITGAHFEAMPEDAIVSNIGHFDVEIDVAWLKAN-AAECVNIKPQVDRFTMKS 331

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  +I+LAEGRL+NLGC TGHPSFVMSCSF NQV+AQ+ LW    +  Y   V++LPK 
Sbjct: 332 GRH-VILLAEGRLVNLGCGTGHPSFVMSCSFANQVLAQIALWTNPEA--YPLGVHMLPKS 388

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE+VA  HL +LG +LT +T  Q+ Y+ +PV+GPYKP HYRY
Sbjct: 389 LDEEVARAHLAQLGIKLTTMTKVQADYLGLPVQGPYKPDHYRY 431



>gb:AE016819_1749078 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 449

 Score =  172 bits (437), Expect = 4e-42
 Identities = 91/175 (52%), Positives = 119/175 (68%), Gaps = 12/175 (6%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG +DII   H   M  +AIVCNIGHFD EID+  L++   V+ + IKPQ DR++   
Sbjct: 277 TTTGCRDIIKKEHFLAMPEDAIVCNIGHFDIEIDVAWLKAN-AVEAVNIKPQVDRYLLSS 335

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE------------KSSG 390
            +  +I+LA+GRL+NLGCATGH SFVMSCSF+NQV+AQ+ L+K             + +G
Sbjct: 336 GRH-VILLADGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKANDEAFRQKYIEFQKTG 394

Query: 389 KYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
            ++  V++LPK LDE VA  HL KLG +LTKL+  QS Y+ IP EGP+K  HYRY
Sbjct: 395 PFDIGVHVLPKILDEAVAKFHLDKLGVKLTKLSSTQSEYLGIPEEGPFKADHYRY 449



>gb:CR382132_1665432 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 449

 Score =  172 bits (435), Expect = 7e-42
 Identities = 94/175 (53%), Positives = 118/175 (67%), Gaps = 12/175 (6%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG +DII   H  +M N+AIVCNIGHFD EID+  L++      + IKPQ DRF  P 
Sbjct: 277 TTTGCRDIITGEHFSQMPNDAIVCNIGHFDIEIDVAWLKAN-AKNVVNIKPQVDRFEMPS 335

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKS------------SG 390
            +  +I+LAEGRL+NLGCATGH SFVMSCSFTNQV+AQ+ L+  K+            SG
Sbjct: 336 GRH-VILLAEGRLVNLGCATGHSSFVMSCSFTNQVLAQIALFNAKNDEFRKKHVEFAKSG 394

Query: 389 KYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
            +E  V++LPK LDE+VA LHL  LG +L+KL+  Q+ Y+ I  EGPYK   YRY
Sbjct: 395 PFEVGVHVLPKILDEEVARLHLDHLGVKLSKLSDVQAEYLGIAQEGPYKADIYRY 449



>sp|P39954|SAHH_YEAST Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>pir|S50546|S50546 adenosylhomocysteinase
           (EC 3.3.1.1) - yeast (Saccharomyces
           cerevisiae)>gb:AY692801_1622848 Saccharomyces cerevisiae
           clone FLH112851.01X YER043C gene, complete
           cds.>gb:SCE9379_1708091 Saccharomyces cerevisiae
           chromosome V cosmids 9379, 9581, and lambda clone 4678.
          Length = 449

 Score =  172 bits (435), Expect = 7e-42
 Identities = 93/175 (53%), Positives = 117/175 (66%), Gaps = 12/175 (6%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG +DII   H   M  +AIVCNIGHFD EID+  L++    + I IKPQ DR++   
Sbjct: 277 TTTGCRDIINGEHFINMPEDAIVCNIGHFDIEIDVAWLKAN-AKECINIKPQVDRYLLSS 335

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE------------KSSG 390
            +  +I+LA GRL+NLGCATGH SFVMSCSF+NQV+AQ+ L+K             + +G
Sbjct: 336 GRH-VILLANGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKSNDKSFREKHIEFQKTG 394

Query: 389 KYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
            +E  V++LPK LDE VA  HLG LG RLTKL+  QS Y+ IP EGP+K  HYRY
Sbjct: 395 PFEVGVHVLPKILDEAVAKFHLGNLGVRLTKLSKVQSEYLGIPEEGPFKADHYRY 449



>gb:CR380949_1649503 Candida glabrata strain CBS138 chromosome C
           complete sequence.
          Length = 449

 Score =  169 bits (428), Expect = 5e-41
 Identities = 91/175 (52%), Positives = 116/175 (66%), Gaps = 12/175 (6%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG +DII   H  KM  +AIVCNIGHFD EID+  L+     + I IKPQ DR++   
Sbjct: 277 TTTGCRDIIKGEHFEKMPEDAIVCNIGHFDIEIDVAWLKEN-AKECINIKPQVDRYLLSS 335

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE------------KSSG 390
            +  +I+LA GRL+NLGCATGH SFVMSCSF+NQV+AQ+ L+K             + +G
Sbjct: 336 GRH-VILLANGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKSDDKAFRTKFVEFEKTG 394

Query: 389 KYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
            +E  V++LPK LDE VA  HL KLG +LT L+  QS Y+ IP +GP+K  HYRY
Sbjct: 395 PFEVGVHVLPKILDEAVAKFHLEKLGVKLTTLSDVQSEYLGIPQQGPFKADHYRY 449



>gb:AY442190_1606331 Pichia pastoris S-adenosylhomocysteine
           hydrolase (SAHH) mRNA, complete cds.
          Length = 445

 Score =  167 bits (423), Expect = 2e-40
 Identities = 91/175 (52%), Positives = 118/175 (67%), Gaps = 12/175 (6%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG +DII   H  +M  +AIV NIGHFD EID+  L++        IKPQ DR++  +
Sbjct: 273 TTTGCRDIITGKHFEQMPEDAIVSNIGHFDIEIDVAWLKAN-AQDVSNIKPQVDRYLMKN 331

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE------------KSSG 390
            +  +I+LA+GRL+NLGCATGH SFVMSCSF+NQV+AQ+ L+K             + SG
Sbjct: 332 GRH-VILLADGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKSNDSEFRKQFVEFEKSG 390

Query: 389 KYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
            ++  V++LPK LDE VA  HL  LGA+LTKL+  QS Y+ IPVEGP+K  HYRY
Sbjct: 391 PFDVGVHVLPKILDETVARCHLAHLGAKLTKLSSVQSEYLGIPVEGPFKVDHYRY 445



>gb:DDAHCH_1376851 D. discoideum mRNA fragment for
           S-adenosyl-L-homocysteine hydrolase (EC 3.3.1.1).
          Length = 176

 Score =  164 bits (414), Expect = 2e-39
 Identities = 89/163 (54%), Positives = 111/163 (68%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG +DI+   H   MK +AIVCNIGHFD EID+  L      K+ T+KPQ  R+   +
Sbjct: 20  TTTGCRDIVRGEHFAVMKEDAIVCNIGHFDCEIDVAWLNG--NAKKDTVKPQVSRYTLAN 77

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
               II+LAEGRL+NLGC TGHPSFVMS S   + +AQ+ LW +    +Y   V+ LPK 
Sbjct: 78  G-VHIILLAEGRLVNLGCGTGHPSFVMSNSSVTK-LAQIALWTKTE--EYPLGVHFLPKI 133

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           LDE+VA LHL +LGA+LT LT +QS Y+S+PV GPYK  HYRY
Sbjct: 134 LDEEVARLHLDQLGAKLTTLTEKQSEYLSVPVAGPYKVDHYRY 176



>gb:CR382139_1672908 Debaryomyces hansenii chromosome G of strain
           CBS767 of Debaryomyces hansenii.
          Length = 449

 Score =  161 bits (407), Expect = 1e-38
 Identities = 89/175 (50%), Positives = 117/175 (66%), Gaps = 12/175 (6%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG +DII   H  +M  +AIVCNIGHFD EID+  L++      + IKPQ DRF+  +
Sbjct: 277 TTTGCRDIITGVHFEQMPEDAIVCNIGHFDIEIDVAWLKAN-SESVVEIKPQVDRFLMKN 335

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK------------SSG 390
            +  +I+LAEGRL+NLGCATGH SFVMSCSF+NQV+AQ+ L+K +             S 
Sbjct: 336 GRH-VILLAEGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKAEDKEFLAKFPEFGKSD 394

Query: 389 KYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           K++  V++LPK LDE VA  HL  LGA+LT L+  Q+ Y+ IP EGP+K   Y+Y
Sbjct: 395 KFDIGVHLLPKVLDETVAKCHLDHLGAKLTVLSDVQAEYLGIPKEGPFKADIYKY 449



>gb:CR859865_1183966 Pongo pygmaeus mRNA; cDNA DKFZp469J024 (from
           clone DKFZp469J024).
          Length = 508

 Score =  146 bits (369), Expect = 3e-34
 Identities = 75/163 (46%), Positives = 111/163 (68%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK+++   H+ +MKN+ IVCNIGH + EID+  L + P +    ++ Q D  ++PD
Sbjct: 350 TCTGNKNVVTREHLDRMKNSCIVCNIGHSNTEIDVASLRT-PELTWERVRSQVDHVIWPD 408

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  I++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ VY+LPK 
Sbjct: 409 GKR-IVLLAEGRLLNLSCSTV-PTFVLSITATTQALALIELYNAPE-GRYKQDVYLLPKK 465

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           +DE VA+LHL    A LT+LT EQ+ Y+ +   GP+KP +YRY
Sbjct: 466 MDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY 508



>gb:AK130743_1917676 Homo sapiens cDNA FLJ27233 fis, clone SYN06481,
           highly similar to Adenosylhomocysteinase (EC 3.3.1.1).
          Length = 530

 Score =  145 bits (367), Expect = 5e-34
 Identities = 74/163 (45%), Positives = 111/163 (68%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L + P +    ++ Q D  ++PD
Sbjct: 372 TCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRT-PELTWERVRSQVDHVIWPD 430

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  I++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ VY+LPK 
Sbjct: 431 GKR-IVLLAEGRLLNLSCST-MPTFVLSITATTQALALIELYNAPE-GRYKQDVYLLPKK 487

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           +DE VA+LHL    A LT+LT EQ+ Y+ +   GP+KP +YRY
Sbjct: 488 MDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY 530



>gb:BC079660_2107648 Mus musculus RIKEN cDNA 4631427C17 gene, mRNA
           (cDNA clone MGC:90656 IMAGE:6853550), complete cds.
          Length = 613

 Score =  145 bits (366), Expect = 7e-34
 Identities = 74/163 (45%), Positives = 111/163 (68%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L + P +    ++ Q D  ++PD
Sbjct: 455 TCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRT-PELTWERVRSQVDHVIWPD 513

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  I++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ VY+LPK 
Sbjct: 514 GKR-IVLLAEGRLLNLSCSTV-PTFVLSITATTQALALIELYNAPE-GRYKQDVYLLPKK 570

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           +DE VA+LHL    A LT+LT EQ+ Y+ +   GP+KP +YRY
Sbjct: 571 MDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY 613



>gb:BC051504_2100775 Mus musculus mRNA similar to KIAA0828 protein
           (cDNA clone IMAGE:1348339).
          Length = 188

 Score =  145 bits (366), Expect = 7e-34
 Identities = 74/163 (45%), Positives = 111/163 (68%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L + P +    ++ Q D  ++PD
Sbjct: 30  TCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRT-PELTWERVRSQVDHVIWPD 88

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  I++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ VY+LPK 
Sbjct: 89  GKR-IVLLAEGRLLNLSCSTV-PTFVLSITATTQALALIELYNAPE-GRYKQDVYLLPKK 145

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           +DE VA+LHL    A LT+LT EQ+ Y+ +   GP+KP +YRY
Sbjct: 146 MDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY 188



>gb:AK122382_2069047 Mus musculus mRNA for mKIAA0828 protein.
          Length = 478

 Score =  145 bits (366), Expect = 7e-34
 Identities = 74/163 (45%), Positives = 111/163 (68%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L + P +    ++ Q D  ++PD
Sbjct: 320 TCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRT-PELTWERVRSQVDHVIWPD 378

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  I++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ VY+LPK 
Sbjct: 379 GKR-IVLLAEGRLLNLSCSTV-PTFVLSITATTQALALIELYNAPE-GRYKQDVYLLPKK 435

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           +DE VA+LHL    A LT+LT EQ+ Y+ +   GP+KP +YRY
Sbjct: 436 MDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY 478



>gb:AB020635_1865233 Homo sapiens mRNA for KIAA0828 protein, partial
           cds.
          Length = 619

 Score =  145 bits (366), Expect = 7e-34
 Identities = 74/163 (45%), Positives = 111/163 (68%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L + P +    ++ Q D  ++PD
Sbjct: 461 TCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRT-PELTWERVRSQVDHVIWPD 519

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  I++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ VY+LPK 
Sbjct: 520 GKR-IVLLAEGRLLNLSCSTV-PTFVLSITATTQALALIELYNAPE-GRYKQDVYLLPKK 576

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           +DE VA+LHL    A LT+LT EQ+ Y+ +   GP+KP +YRY
Sbjct: 577 MDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY 619



>gb:AK053527_1170463 Mus musculus 0 day neonate eyeball cDNA, RIKEN
           full-length enriched library, clone:E130105J10
           product:SIMILAR TO S-ADENOSYLHOMOCYSTEINE HYDROLASE-LIKE
           1 (FRAGMENT) homolog [Homo sapiens], full insert
           sequence.
          Length = 508

 Score =  145 bits (366), Expect = 7e-34
 Identities = 74/163 (45%), Positives = 111/163 (68%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L + P +    ++ Q D  ++PD
Sbjct: 350 TCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRT-PELTWERVRSQVDHVIWPD 408

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  I++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ VY+LPK 
Sbjct: 409 GKR-IVLLAEGRLLNLSCSTV-PTFVLSITATTQALALIELYNAPE-GRYKQDVYLLPKK 465

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           +DE VA+LHL    A LT+LT EQ+ Y+ +   GP+KP +YRY
Sbjct: 466 MDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY 508



>sp|Q96HN2|SAH3_HUMAN Putative adenosylhomocysteinase 3 (EC 3.3.1.1)
           (S-adenosyl-L- homocysteine hydrolase)
           (AdoHcyase).>gb:BC008349_1971319 Homo sapiens KIAA0828
           protein, mRNA (cDNA clone MGC:15925 IMAGE:3536052),
           complete cds.>gb:BC024325_1978344 Homo sapiens KIAA0828
           protein, mRNA (cDNA clone MGC:21525 IMAGE:3907552),
           complete cds.
          Length = 611

 Score =  145 bits (366), Expect = 7e-34
 Identities = 74/163 (45%), Positives = 111/163 (68%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L + P +    ++ Q D  ++PD
Sbjct: 453 TCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRT-PELTWERVRSQVDHVIWPD 511

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  I++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ VY+LPK 
Sbjct: 512 GKR-IVLLAEGRLLNLSCSTV-PTFVLSITATTQALALIELYNAPE-GRYKQDVYLLPKK 568

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           +DE VA+LHL    A LT+LT EQ+ Y+ +   GP+KP +YRY
Sbjct: 569 MDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY 611



>gb:BC054614_2551024 Danio rerio S-adenosylhomocysteine
           hydrolase-like 1, mRNA (cDNA clone MGC:64088
           IMAGE:6794782), complete cds.
          Length = 512

 Score =  144 bits (364), Expect = 1e-33
 Identities = 74/163 (45%), Positives = 110/163 (67%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK+++   H+ +MKN  IVCN+GH + EID+  L + P +    ++ Q D  ++PD
Sbjct: 354 TCTGNKNVVTREHLDRMKNGCIVCNMGHSNTEIDVASLRT-PELTWERVRSQVDHVIWPD 412

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  +I+LAEGRL+NL C+T  PSFV+S + T Q +A +EL+     G+Y++ VY+LPK 
Sbjct: 413 GKR-VILLAEGRLLNLSCSTV-PSFVLSITATTQALALIELYNAPE-GRYKQDVYLLPKK 469

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           +DE VA+LHL    A LT+L+ EQ+ Y+ +   GP+KP +YRY
Sbjct: 470 MDEYVASLHLPNFDAHLTELSDEQAKYMGLNKNGPFKPNYYRY 512



>gb:BC065254_1986785 Homo sapiens cDNA clone IMAGE:6138596, partial
           cds.
          Length = 623

 Score =  144 bits (363), Expect = 2e-33
 Identities = 72/163 (44%), Positives = 111/163 (68%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L + P +    ++ Q D  ++PD
Sbjct: 465 TCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRT-PELTWERVRSQVDHVIWPD 523

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  +++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ VY+LPK 
Sbjct: 524 GKR-VVLLAEGRLLNLSCSTV-PTFVLSITATTQALALIELYNAPE-GRYKQDVYLLPKK 580

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           +DE VA+LHL    A LT+LT +Q+ Y+ +   GP+KP +YRY
Sbjct: 581 MDEYVASLHLPSFDAHLTELTDDQAKYLGLNKNGPFKPNYYRY 623



>gb:BC003631_1968941 Homo sapiens S-adenosylhomocysteine
           hydrolase-like 1, mRNA (cDNA clone IMAGE:3010755),
           partial cds.
          Length = 199

 Score =  144 bits (363), Expect = 2e-33
 Identities = 72/163 (44%), Positives = 111/163 (68%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L + P +    ++ Q D  ++PD
Sbjct: 41  TCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRT-PELTWERVRSQVDHVIWPD 99

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  +++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ VY+LPK 
Sbjct: 100 GKR-VVLLAEGRLLNLSCSTV-PTFVLSITATTQALALIELYNAPE-GRYKQDVYLLPKK 156

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           +DE VA+LHL    A LT+LT +Q+ Y+ +   GP+KP +YRY
Sbjct: 157 MDEYVASLHLPSFDAHLTELTDDQAKYLGLNKNGPFKPNYYRY 199



>gb:AL772411_1932843 Human DNA sequence from clone RP11-180N18 on
           chromosome 1 Contains the AHCYL1 S-adenosylhomocysteine
           hydrolase-like 1 and the 5' end of gene KIAA1761
           (FLJ14743), complete sequence.
          Length = 483

 Score =  144 bits (363), Expect = 2e-33
 Identities = 72/163 (44%), Positives = 111/163 (68%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L + P +    ++ Q D  ++PD
Sbjct: 325 TCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRT-PELTWERVRSQVDHVIWPD 383

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  +++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ VY+LPK 
Sbjct: 384 GKR-VVLLAEGRLLNLSCSTV-PTFVLSITATTQALALIELYNAPE-GRYKQDVYLLPKK 440

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           +DE VA+LHL    A LT+LT +Q+ Y+ +   GP+KP +YRY
Sbjct: 441 MDEYVASLHLPSFDAHLTELTDDQAKYLGLNKNGPFKPNYYRY 483



>gb:AF315687_1896429 Homo sapiens S-adenosylhomocysteine
           hydrolase-like protein mRNA, complete
           cds.>gb:AL772411_1932842 Human DNA sequence from clone
           RP11-180N18 on chromosome 1 Contains the AHCYL1
           S-adenosylhomocysteine hydrolase-like 1 and the 5' end
           of gene KIAA1761 (FLJ14743), complete
           sequence.>gb:AB092504_2047971 Mus musculus Irbit mRNA
           for IP3R binding protein released with inositol
           1,4,5-trisphosphate, complete cds.>gb:BC018218_2092584
           Mus musculus S-adenosylhomocysteine hydrolase-like 1,
           mRNA (cDNA clone MGC:18748 IMAGE:4007102), complete cds.
          Length = 530

 Score =  144 bits (363), Expect = 2e-33
 Identities = 72/163 (44%), Positives = 111/163 (68%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L + P +    ++ Q D  ++PD
Sbjct: 372 TCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRT-PELTWERVRSQVDHVIWPD 430

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  +++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ VY+LPK 
Sbjct: 431 GKR-VVLLAEGRLLNLSCSTV-PTFVLSITATTQALALIELYNAPE-GRYKQDVYLLPKK 487

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           +DE VA+LHL    A LT+LT +Q+ Y+ +   GP+KP +YRY
Sbjct: 488 MDEYVASLHLPSFDAHLTELTDDQAKYLGLNKNGPFKPNYYRY 530



>gb:AF035319_1877930 Homo sapiens clone 23931 mRNA, partial cds.
          Length = 218

 Score =  144 bits (363), Expect = 2e-33
 Identities = 72/163 (44%), Positives = 111/163 (68%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L + P +    ++ Q D  ++PD
Sbjct: 60  TCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRT-PELTWERVRSQVDHVIWPD 118

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  +++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ VY+LPK 
Sbjct: 119 GKR-VVLLAEGRLLNLSCSTV-PTFVLSITATTQALALIELYNAPE-GRYKQDVYLLPKK 175

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           +DE VA+LHL    A LT+LT +Q+ Y+ +   GP+KP +YRY
Sbjct: 176 MDEYVASLHLPSFDAHLTELTDDQAKYLGLNKNGPFKPNYYRY 218



>gb:AF105295_1768303 Alexandrium fundyense S-adenosyl-homocysteine
           hydrolase like protein mRNA, partial cds.
          Length = 195

 Score =  144 bits (363), Expect = 2e-33
 Identities = 72/101 (71%), Positives = 80/101 (79%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGN  II + HM+KMKNNAIV NIGHFDNEI+M  LE  PG+K   IK Q DRF+FPD
Sbjct: 94  TTTGNFKIITLEHMKKMKNNAIVGNIGHFDNEIEMAELEGMPGIKVENIKAQVDRFIFPD 153

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL 411
              GII+LA GRL+NLGCATGHPSFVMSCSFTNQV+  L L
Sbjct: 154 GH-GIIVLASGRLLNLGCATGHPSFVMSCSFTNQVLDNLTL 193



>gb:AX029176_1457188 Sequence 1 from Patent WO9814562.
          Length = 614

 Score =  144 bits (363), Expect = 2e-33
 Identities = 72/163 (44%), Positives = 111/163 (68%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L + P +    ++ Q D  ++PD
Sbjct: 456 TCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRT-PELTWERVRSQVDHVIWPD 514

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  +++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ VY+LPK 
Sbjct: 515 GKR-VVLLAEGRLLNLSCSTV-PTFVLSITATTQALALIELYNAPE-GRYKQDVYLLPKK 571

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           +DE VA+LHL    A LT+LT +Q+ Y+ +   GP+KP +YRY
Sbjct: 572 MDEYVASLHLPSFDAHLTELTDDQAKYLGLNKNGPFKPNYYRY 614



>gb:HSM800298_1185800 Homo sapiens mRNA; cDNA DKFZp564A1523 (from
           clone DKFZp564A1523).
          Length = 484

 Score =  144 bits (363), Expect = 2e-33
 Identities = 72/163 (44%), Positives = 111/163 (68%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L + P +    ++ Q D  ++PD
Sbjct: 326 TCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRT-PELTWERVRSQVDHVIWPD 384

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  +++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ VY+LPK 
Sbjct: 385 GKR-VVLLAEGRLLNLSCSTV-PTFVLSITATTQALALIELYNAPE-GRYKQDVYLLPKK 441

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           +DE VA+LHL    A LT+LT +Q+ Y+ +   GP+KP +YRY
Sbjct: 442 MDEYVASLHLPSFDAHLTELTDDQAKYLGLNKNGPFKPNYYRY 484



>pir|T08681|T08681 adenosylhomocysteinase (EC 3.3.1.1) DKFZp564A1523
           - human  (fragment)
          Length = 597

 Score =  144 bits (363), Expect = 2e-33
 Identities = 72/163 (44%), Positives = 111/163 (68%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L + P +    ++ Q D  ++PD
Sbjct: 439 TCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRT-PELTWERVRSQVDHVIWPD 497

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  +++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ VY+LPK 
Sbjct: 498 GKR-VVLLAEGRLLNLSCSTV-PTFVLSITATTQALALIELYNAPE-GRYKQDVYLLPKK 554

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           +DE VA+LHL    A LT+LT +Q+ Y+ +   GP+KP +YRY
Sbjct: 555 MDEYVASLHLPSFDAHLTELTDDQAKYLGLNKNGPFKPNYYRY 597



>sp|O43865|SAH2_HUMAN Putative adenosylhomocysteinase 2 (EC 3.3.1.1)
           (S-adenosyl-L- homocysteine hydrolase)
           (AdoHcyase).>gb:BC007576_1970826 Homo sapiens,
           S-adenosylhomocysteine hydrolase-like 1, clone MGC:15558
           IMAGE:3139729, mRNA, complete cds.>gb:BC010681_1972755
           Homo sapiens, S-adenosylhomocysteine hydrolase-like 1,
           clone MGC:8936 IMAGE:3853747, mRNA, complete
           cds.>gb:BC016942_1975812 Homo sapiens,
           S-adenosylhomocysteine hydrolase-like 1, clone MGC:21453
           IMAGE:3450568, mRNA, complete cds.>gb:HSU82761_2026635
           Homo sapiens S-adenosyl homocysteine hydrolase homolog
           (XPVkona) mRNA, complete cds.
          Length = 500

 Score =  144 bits (363), Expect = 2e-33
 Identities = 72/163 (44%), Positives = 111/163 (68%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L + P +    ++ Q D  ++PD
Sbjct: 342 TCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRT-PELTWERVRSQVDHVIWPD 400

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  +++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ VY+LPK 
Sbjct: 401 GKR-VVLLAEGRLLNLSCSTV-PTFVLSITATTQALALIELYNAPE-GRYKQDVYLLPKK 457

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           +DE VA+LHL    A LT+LT +Q+ Y+ +   GP+KP +YRY
Sbjct: 458 MDEYVASLHLPSFDAHLTELTDDQAKYLGLNKNGPFKPNYYRY 500



>pir|S22958|S22958 adenosylhomocysteinase (EC 3.3.1.1) -
           Streptomyces fradiae  (fragment)
          Length = 120

 Score =  144 bits (362), Expect = 2e-33
 Identities = 72/122 (59%), Positives = 89/122 (72%)
 Frame = -3

Query: 590 PGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL 411
           PG+ +  +KPQ   + F D K  II+L+EGRL+NLG ATGHPSFVMS SF +Q +AQ+EL
Sbjct: 2   PGIVKDEVKPQVHTWTFADGKK-IIVLSEGRLLNLGNATGHPSFVMSNSFADQTLAQIEL 60

Query: 410 WKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHY 231
           + +    +Y   VY+LPKHLDEKVA LHL  LG +LT L PEQ+ YI + VEGPYKP HY
Sbjct: 61  YTKPE--QYPTDVYVLPKHLDEKVARLHLDALGVKLTTLRPEQAEYIGVEVEGPYKPDHY 118

Query: 230 RY 225
           RY
Sbjct: 119 RY 120



>sp|P26799|SAHH_STRFR Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase)
           (Fragment).
          Length = 120

 Score =  144 bits (362), Expect = 2e-33
 Identities = 72/122 (59%), Positives = 89/122 (72%)
 Frame = -3

Query: 590 PGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLEL 411
           PG+ +  +KPQ   + F D K  II+L+EGRL+NLG ATGHPSFVMS SF +Q +AQ+EL
Sbjct: 2   PGIVKDEVKPQVHTWTFADGKK-IIVLSEGRLLNLGNATGHPSFVMSNSFADQTLAQIEL 60

Query: 410 WKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHY 231
           + +    +Y   VY+LPKHLDEKVA LHL  LG +LT L PEQ+ YI + VEGPYKP HY
Sbjct: 61  YTKPE--QYPTDVYVLPKHLDEKVARLHLDALGVKLTTLRPEQAEYIGVEVEGPYKPDHY 118

Query: 230 RY 225
           RY
Sbjct: 119 RY 120



>gb:BC077247_2559964 Xenopus laevis MGC79134 protein, mRNA (cDNA
           clone MGC:79134 IMAGE:5073029), complete cds.
          Length = 583

 Score =  143 bits (361), Expect = 3e-33
 Identities = 73/163 (44%), Positives = 110/163 (67%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK+++   H+ +MKN  IVCN+GH + EID+  L + P +    ++ Q D  ++PD
Sbjct: 425 TCTGNKNVVTREHLDRMKNGCIVCNMGHSNTEIDVASLRT-PELTWERVRSQVDHVIWPD 483

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  I++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ VY+LPK 
Sbjct: 484 GKR-IVLLAEGRLLNLSCSTV-PTFVLSITATTQALALIELYNAPE-GRYKQDVYLLPKK 540

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           +DE VA+LHL    A LT+L+ EQ+ Y+ +   GP+KP +YRY
Sbjct: 541 MDEYVASLHLPTFDAHLTELSDEQAKYLGLNKNGPFKPNYYRY 583



>gb:BC059517_2552494 Danio rerio S-adenosylhomocysteine
           hydrolase-like 2, mRNA (cDNA clone MGC:73164
           IMAGE:4145939), complete cds.
          Length = 591

 Score =  143 bits (360), Expect = 3e-33
 Identities = 73/163 (44%), Positives = 111/163 (68%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK++++  +M +MKN  IVCN+GH + EID+  L + P +    ++ Q D  ++PD
Sbjct: 433 TCTGNKNVVVREYMDRMKNGCIVCNMGHSNTEIDVASLRT-PELTWERVRSQVDHVIWPD 491

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  I++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ VY+LPK 
Sbjct: 492 GKR-IVLLAEGRLLNLSCSTV-PTFVLSITATTQALALIELYNAPE-GRYKQDVYLLPKK 548

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           +DE VA+LHL    A LT+L+ EQ+ Y+ +   GP+KP +YRY
Sbjct: 549 MDEYVASLHLPTFDAHLTELSDEQAKYLGLNKNGPFKPNYYRY 591



>gb:BC080079_2561511 Xenopus laevis MGC84148 protein, mRNA (cDNA
           clone MGC:84148 IMAGE:6951579), complete cds.
          Length = 588

 Score =  142 bits (358), Expect = 6e-33
 Identities = 72/163 (44%), Positives = 110/163 (67%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK+++   H+ +MKN  IVCN+GH + EID+  L + P +    ++ Q D  ++PD
Sbjct: 430 TCTGNKNVVTREHLDRMKNGCIVCNMGHSNTEIDVASLRT-PELTWERVRSQVDHVIWPD 488

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  +++LAEGRL+NL C+T  P+FV+S + T Q +A +EL+     G+Y++ VY+LPK 
Sbjct: 489 GKR-MVLLAEGRLLNLSCSTV-PTFVLSITATTQALALIELYNAPE-GRYKQDVYLLPKK 545

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           +DE VA+LHL    A LT+L+ EQ+ Y+ +   GP+KP +YRY
Sbjct: 546 MDEYVASLHLPTFDAHLTELSDEQAKYLGLNKNGPFKPNYYRY 588



>gb:BC081269_2562161 Xenopus laevis MGC86404 protein, mRNA (cDNA
           clone MGC:86404 IMAGE:7011535), complete cds.
          Length = 520

 Score =  141 bits (356), Expect = 1e-32
 Identities = 73/163 (44%), Positives = 109/163 (66%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK+++   H+ +MKN  IVCN+GH + EID+  L + P +    I+ Q D  ++PD
Sbjct: 362 TCTGNKNVVNREHLDRMKNGCIVCNMGHSNTEIDVTSLHT-PELTWERIRSQVDHIIWPD 420

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  I++LAEGRL+NL C+T  P+FV S + T + +A +EL+     G+Y++ VY+LPK 
Sbjct: 421 GKR-IVLLAEGRLLNLSCST-IPTFVHSITATTEALALIELYNAPE-GRYKQDVYLLPKK 477

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           +DE VA+LHL    A LT+LT +Q+ Y+ +   GP+KP +YRY
Sbjct: 478 MDEYVASLHLPTFDAHLTELTEDQAKYLGLNKNGPFKPNYYRY 520



>gb:AE014296_1134419 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003476_1211718 Drosophila melanogaster
           chromosome 3L, section 10 of 83 of the complete
           sequence.
          Length = 521

 Score =  140 bits (353), Expect = 2e-32
 Identities = 73/163 (44%), Positives = 109/163 (66%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK++++  HM KMK+  IVCN+GH + EID+ GL + P +    ++ Q D  ++P+
Sbjct: 363 TATGNKNVVVREHMDKMKSGCIVCNMGHSNTEIDVNGLRT-PDLTWEKVRSQVDHIIWPE 421

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  II+LAEGRL+NL C++  PSF +S +   Q +A +EL+     G+Y+  VY+LPK 
Sbjct: 422 GKY-IILLAEGRLVNLSCSS-IPSFAVSITSATQALALIELFNAPP-GRYKSDVYLLPKK 478

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           +DE VA+LHL    A LT+L+ EQ+ Y+ +   GP+KP +YRY
Sbjct: 479 MDEYVASLHLPTFDAHLTELSDEQAKYMGLNKAGPFKPNYYRY 521



>gb:BT010277_1357568 Drosophila melanogaster RE06911 full insert
           cDNA.
          Length = 521

 Score =  139 bits (349), Expect = 7e-32
 Identities = 72/163 (44%), Positives = 109/163 (66%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK++++  HM KMK+  IVCN+GH + EID+ GL + P +    ++ Q D  ++P+
Sbjct: 363 TATGNKNVVVREHMDKMKSGCIVCNMGHSNTEIDVNGLRT-PDLTWEKVRSQVDHIIWPE 421

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  II+LAEGRL+NL C++  PSF +S +   Q +A +EL+     G+Y+  VY+LPK 
Sbjct: 422 GKY-IILLAEGRLVNLSCSS-IPSFAVSITSATQALALIELFNAPP-GRYKSDVYLLPKK 478

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           +DE VA+LHL    A LT+L+ E++ Y+ +   GP+KP +YRY
Sbjct: 479 MDEYVASLHLPTFDAHLTELSDEKAKYMGLNKAGPFKPNYYRY 521



>sp|P50245|SAH2_DROME Putative adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L- homocysteine hydrolase)
           (AdoHcyase).>gb:AE014297_1139956 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE003715_1221949
           Drosophila melanogaster chromosome 3R, section 53 of 118
           of the complete sequence.>gb:AY113501_1299449 Drosophila
           melanogaster RE58316 full insert cDNA.
          Length = 492

 Score =  137 bits (346), Expect = 1e-31
 Identities = 74/163 (45%), Positives = 109/163 (66%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK++I  +HM +MKN  I+CN+GH  +EID+ GL + P +    ++ Q D   +PD
Sbjct: 335 TATGNKNVITRDHMNRMKNGCILCNMGHSCSEIDVNGLHT-PELTWERVRSQVDHIRWPD 393

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  II+LAEGRL+NL C+T   SFV+S + + Q +A +EL+   + G+Y+  VY+LPK 
Sbjct: 394 GRM-IILLAEGRLVNLSCST-ISSFVVSVASSTQALALIELFS--APGRYKSDVYLLPKK 449

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           +DE VA+LHL    A LT+LT EQS ++ +   GP+K  +YRY
Sbjct: 450 MDEYVASLHLATFDAHLTELTDEQSKFMGLNKAGPFKANYYRY 492



>gb:AE014297_1139957 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003715_1221950 Drosophila melanogaster
           chromosome 3R, section 53 of 118 of the complete
           sequence.>gb:DMU31961_1380629 Drosophila melanogaster
           bithorax complex (BX-C), complete sequence.
          Length = 504

 Score =  135 bits (339), Expect = 9e-31
 Identities = 73/162 (45%), Positives = 108/162 (66%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK++I  +HM +MKN  I+CN+GH  +EID+ GL + P +    ++ Q D   +PD
Sbjct: 335 TATGNKNVITRDHMNRMKNGCILCNMGHSCSEIDVNGLHT-PELTWERVRSQVDHIRWPD 393

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  II+LAEGRL+NL C+T   SFV+S + + Q +A +EL+   + G+Y+  VY+LPK 
Sbjct: 394 GRM-IILLAEGRLVNLSCST-ISSFVVSVASSTQALALIELFS--APGRYKSDVYLLPKK 449

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYR 228
           +DE VA+LHL    A LT+LT EQS ++ +   GP+K  +YR
Sbjct: 450 MDEYVASLHLATFDAHLTELTDEQSKFMGLNKAGPFKANYYR 491



>sp|Q9I685|SAHH_PSEAE Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>pir|H83591|H83591 S-adenosyl-L-homocysteine
           hydrolase PA0432 [imported] - Pseudomonas aeruginosa
           (strain PAO1)>gb:AE004480_54667 Pseudomonas aeruginosa
           PAO1, section 41 of 529 of the complete
           genome.>gb:AE004091_968767 Pseudomonas aeruginosa PAO1,
           complete genome.
          Length = 469

 Score =  134 bits (336), Expect = 2e-30
 Identities = 78/177 (44%), Positives = 111/177 (62%), Gaps = 14/177 (7%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGN ++   N ++ +K  A+VCNIGHFDNEID   +      + +  KPQ  + +   
Sbjct: 296 TTTGNVNVCDANMLKALKKRAVVCNIGHFDNEIDTAFMRKNWAWEEV--KPQVHK-IHRT 352

Query: 533 TKTG--------IIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK-----SS 393
            K G        +I+LAEGRL+NLG ATGHPS +M  SF NQV+AQ+ L+++K     ++
Sbjct: 353 GKDGFDAHNDDYLILLAEGRLVNLGNATGHPSRIMDGSFANQVLAQIHLFEQKYADLPAA 412

Query: 392 GKYEK-KVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
            K ++  V +LPK LDE+VA   +   G  +T+LTP+Q+ YI + VEGP+KP  YRY
Sbjct: 413 EKAKRLSVEVLPKKLDEEVALEMVKGFGGVVTQLTPKQAEYIGVSVEGPFKPDTYRY 469



>gb:AF410884_508053 Mycobacterium avium subsp. paratuberculosis
           S-adenosyl-L-homocysteine hydrolase (sahH) gene, partial
           cds; and thimidylate kinase (tmk), MtrA (mtrA), MtrB
           (mtrB), and LpqB (lpqB) genes, complete cds.
          Length = 96

 Score =  132 bits (333), Expect = 5e-30
 Identities = 64/98 (65%), Positives = 78/98 (79%)
 Frame = -3

Query: 518 IILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKHLDEKV 339
           I+L+EGRL+NLG ATGHPSFVMS SF+NQVIAQ+ELW +    +Y+ +VY LPKHLDEKV
Sbjct: 1   IVLSEGRLLNLGNATGHPSFVMSNSFSNQVIAQIELWTKND--EYDNEVYRLPKHLDEKV 58

Query: 338 AALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           A +H+  LG  LTKLT EQ+ YI + V+GPYK  HYRY
Sbjct: 59  ARIHVEALGGELTKLTKEQAEYIGVDVDGPYKADHYRY 96



>gb:AE017340_456250 Idiomarina loihiensis L2TR, complete genome.
          Length = 459

 Score =  132 bits (333), Expect = 5e-30
 Identities = 77/170 (45%), Positives = 103/170 (60%), Gaps = 7/170 (4%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGN D+     +  +K  A+VCNIGHFDNEID   +      +   IKPQ  +    D
Sbjct: 292 TTTGNMDVCDRYMLAALKPTALVCNIGHFDNEIDTAFMRK--NWRWEEIKPQVHKIYRSD 349

Query: 533 TKTG-IIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEK------K 375
                +I+LAEGRL+NLG ATGHPS +M  SF NQV+AQ+ L+++K +    K      +
Sbjct: 350 DDNDYLILLAEGRLVNLGNATGHPSRIMDGSFANQVLAQIHLFEQKFADMEIKQQEEYLR 409

Query: 374 VYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           V +LPK LDE+VA   +   G  +TKLT +Q+ YI + VEGP+K   YRY
Sbjct: 410 VEVLPKQLDEEVARYMVQGFGGVITKLTADQANYIHVDVEGPFKTDEYRY 459



>gb:CR543861_104166 Acinetobacter sp. ADP1 complete genome.
          Length = 467

 Score =  132 bits (333), Expect = 5e-30
 Identities = 76/170 (44%), Positives = 104/170 (61%), Gaps = 7/170 (4%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGN  +     +  +K  A+VCNIGHFD EID   L  Y   K + +KPQ  +    +
Sbjct: 301 TTTGNYHVCDSAMLDTLKAGAVVCNIGHFDTEIDTNYLRGY---KWVEVKPQVHQVYRSE 357

Query: 533 TKTG-IIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK------SSGKYEKK 375
            +   +I+L+EGRL+NLG ATGHPS VM  SF NQV+ Q+ L++EK      S    + +
Sbjct: 358 NENDYLILLSEGRLVNLGNATGHPSRVMDGSFANQVLGQIHLFQEKFADLPASEKAAQIR 417

Query: 374 VYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           V +LPK LDE+VAA  +   G  LT+LT  Q+ Y+ +PVEGP+K   Y+Y
Sbjct: 418 VEVLPKKLDEEVAAAMVLGFGGVLTQLTSVQADYLGVPVEGPFKSDAYKY 467



>gb:AX063941_1458884 Sequence 223 from Patent
           WO0100843.>gb:AX244109_1464645 Sequence 101 from Patent
           WO0166573.
          Length = 432

 Score =  129 bits (325), Expect = 4e-29
 Identities = 70/117 (59%), Positives = 84/117 (71%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNKDII    M KMK++A++ NIGHFDNEIDM  L     V R TIKPQ D F F  
Sbjct: 319 TATGNKDIISFEQMLKMKDHALLGNIGHFDNEIDMHSLLHRDDVTRTTIKPQVDEFTF-S 377

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYIL 363
           T   II+L+EGRL+NLG ATGHPSFVMS SF +Q IAQ+EL+  ++ G+YE +VY L
Sbjct: 378 TGRSIIVLSEGRLLNLGNATGHPSFVMSNSFADQTIAQIELF--QNEGQYENEVYRL 432



>sp|Q87V73|SAHH_PSESM Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:AE016874_354407 Pseudomonas syringae pv.
           tomato str. DC3000 section 19 of 21 of the complete
           genome.>gb:AE016853_1039582 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 469

 Score =  128 bits (322), Expect = 9e-29
 Identities = 78/180 (43%), Positives = 105/180 (58%), Gaps = 17/180 (9%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGN ++   N ++ +K  A+VCNIGHFDNEID   +      + +  KPQ  +     
Sbjct: 296 TTTGNVNVCDSNMLKALKKRAVVCNIGHFDNEIDTAFMRKNWAWEEV--KPQVHKI---- 349

Query: 533 TKTG-----------IIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGK 387
            +TG           +I+LAEGRL+NLG ATGHPS +M  SF NQV+AQ+ L+ +K +  
Sbjct: 350 HRTGAGAFDAQNDDYLILLAEGRLVNLGNATGHPSRIMDGSFANQVLAQIFLFDQKYADL 409

Query: 386 YEKK------VYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
              K      V +LPK LDE+VA   +   G  +TKLT  Q+ YI + VEGP+KP  YRY
Sbjct: 410 APAKKAERLTVEVLPKKLDEEVALEMVRGFGGVVTKLTKTQADYIGVTVEGPFKPDAYRY 469



>pir|S01302|S01302 adenosylhomocysteinase (EC 3.3.1.1) - fruit fly
           (Drosophila melanogaster)>gb:DMBX200_1378257 Drosophila
           pH200 gene of distal BX-C region (bithorax complex).
          Length = 527

 Score =  128 bits (321), Expect = 1e-28
 Identities = 71/158 (44%), Positives = 104/158 (65%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK++I  +HM +MKN  I+CN+GH  +EID+ GL + P +    ++ Q D   +PD
Sbjct: 335 TATGNKNVITRDHMNRMKNGCILCNMGHSCSEIDVNGLHT-PELTWERVRSQVDHIRWPD 393

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  II+LAEGRL+NL C+T   SFV+S + + Q +A +EL+   + G+Y+  VY+LPK 
Sbjct: 394 GRM-IILLAEGRLVNLSCST-ISSFVVSVASSTQALALIELFS--APGRYKSDVYLLPKK 449

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKP 240
           +DE VA+LHL    A LT+LT EQS ++ +   G  KP
Sbjct: 450 MDEYVASLHLATFDAHLTELTDEQSKFMGLNKAGLLKP 487



>pir|C90224|C90224 s-adenosyl-L-homocysteine hydrolase (ahcY)
           [imported] - Sulfolobus solfataricus>gb:SSU18930_191174
           Sulfolobus solfataricus 281 kb genomic DNA fragment,
           strain P2.>gb:AE006699_221648 Sulfolobus solfataricus P2
           section 58 of 272 of the complete
           genome.>gb:AE006641_1107496 Sulfolobus solfataricus P2,
           complete genome.
          Length = 442

 Score =  119 bits (299), Expect = 4e-26
 Identities = 67/148 (45%), Positives = 91/148 (61%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN   I V HM  MK+ AI+ N GHF+ E+D++GL+    VK   I+P  D +  P+
Sbjct: 292 TATGNTKAIRVEHMLNMKDGAILSNAGHFNVEVDVKGLKE-TAVKVRNIRPYVDEYTLPN 350

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  + +LA+GRL+NL  A GHPS VM  SF NQ +A   L K +  GK EKKVY +P  
Sbjct: 351 GKR-VYLLADGRLVNLAAAEGHPSEVMDMSFANQALAVEYLVKNR--GKLEKKVYNMPME 407

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYI 270
           LD +VA + L  +G ++ +LT EQ  Y+
Sbjct: 408 LDYEVARIKLKSMGIQIDELTEEQKEYL 435



>sp|P50252|SAHH_SULSO Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>pir|JC5156|S58193 adenosylhomocysteinase
           (EC 3.3.1.1) [validated] - Sulfolobus
           solfataricus>gb:SSAHCYGN_190487 S.solfataricus ahcY gene
           for S-adenosylhomocysteine hydrolase.
          Length = 417

 Score =  119 bits (299), Expect = 4e-26
 Identities = 67/148 (45%), Positives = 91/148 (61%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN   I V HM  MK+ AI+ N GHF+ E+D++GL+    VK   I+P  D +  P+
Sbjct: 267 TATGNTKAIRVEHMLNMKDGAILSNAGHFNVEVDVKGLKE-TAVKVRNIRPYVDEYTLPN 325

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  + +LA+GRL+NL  A GHPS VM  SF NQ +A   L K +  GK EKKVY +P  
Sbjct: 326 GKR-VYLLADGRLVNLAAAEGHPSEVMDMSFANQALAVEYLVKNR--GKLEKKVYNMPME 382

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYI 270
           LD +VA + L  +G ++ +LT EQ  Y+
Sbjct: 383 LDYEVARIKLKSMGIQIDELTEEQKEYL 410



>sp|Q7NGI6|SAHH_GLOVI Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:BA000045_743258 Gloeobacter violaceus
           PCC 7421 DNA, complete genome.
          Length = 428

 Score =  118 bits (296), Expect = 9e-26
 Identities = 67/154 (43%), Positives = 91/154 (59%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK +I   H   MK+ AIVCN GHFD EID+  L      +R+ ++P T+ +    
Sbjct: 277 TVTGNKHVIRREHFAMMKDGAIVCNSGHFDIEIDLVALGELSSERRM-VRPFTEEYTLEG 335

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K+ +I+L EGRL+NL  A GHP+ VM  SF NQ +A   L   K+ GK    +Y +P+ 
Sbjct: 336 GKS-VIVLGEGRLINLAAAEGHPASVMDMSFANQALAVEYL--IKNQGKLSPGIYNIPEE 392

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEG 252
           LD ++AAL L  +G  +  LTP+Q  YIS   EG
Sbjct: 393 LDRQIAALKLAAMGIAIDTLTPDQLHYISSWDEG 426



>gb:AP008231_580601 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 426

 Score =  117 bits (293), Expect = 2e-25
 Identities = 64/149 (42%), Positives = 91/149 (61%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK +I   H   MK+ AIVCN GHFD EID+ GL++     R T++P T+ +    
Sbjct: 276 TVTGNKHVIRTEHFAAMKDGAIVCNSGHFDIEIDIAGLKTLSSEVR-TVRPFTEEYRLAS 334

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K+ +I+L EGRL+NL  A GHPS VM  SF NQ +A   L   +  G+ E  ++ +P+ 
Sbjct: 335 GKS-VIVLGEGRLVNLAAAEGHPSAVMDMSFANQALAVEHLVTNR--GRLEPGIHSIPED 391

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYIS 267
           LD ++A L L  +G  +  LT +Q+AYI+
Sbjct: 392 LDRQIATLKLQAMGIVIDSLTEDQTAYIN 420



>sp|P74008|SAHH_SYNY3 Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>pir|S75518|S75518 adenosylhomocysteinase
           (EC 3.3.1.1) - Synechocystis sp.  (strain PCC
           6803)>gb:BA000022_688858 Synechocystis sp. PCC 6803 DNA,
           complete genome.
          Length = 425

 Score =  115 bits (289), Expect = 6e-25
 Identities = 66/150 (44%), Positives = 93/150 (62%), Gaps = 1/150 (0%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGL-ESYPGVKRITIKPQTDRFVFP 537
           T TGNK +I   H   MK+ AIVCN GHFD EID++ L E    VK   ++  T++++ P
Sbjct: 275 TVTGNKHVIRPEHFAVMKDGAIVCNSGHFDIEIDLKSLKEQAKEVKE--VRNFTEQYILP 332

Query: 536 DTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPK 357
           + K+ II++ EGRL+NL  A GHPS VM  SF NQ +A   L K K  G+ E  ++ +P 
Sbjct: 333 NGKS-IIVIGEGRLVNLAAAEGHPSAVMDMSFANQALACEHLVKNK--GQLEPGMHSIPV 389

Query: 356 HLDEKVAALHLGKLGARLTKLTPEQSAYIS 267
            +D+++A L L  +G  +  LTPEQ  YI+
Sbjct: 390 EVDQEIARLKLQAMGIAIDSLTPEQVEYIN 419



>sp|Q975T0|SAHH_SULTO Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:BA000023_690902 Sulfolobus tokodaii str.
           7 DNA, complete genome.
          Length = 415

 Score =  115 bits (287), Expect = 1e-24
 Identities = 63/148 (42%), Positives = 93/148 (62%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN ++I   H+ KMK+ AI+ N GHF+ EID++GL+      R+ I+P  + +  P+
Sbjct: 265 TATGNINVIRKEHILKMKDGAILANSGHFNVEIDVKGLKEMAKSSRL-IRPNLEEYELPN 323

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  I +LAEGRL+NL  A GHPS VM  SF+NQ ++   +++ +  GK E KVY +P+ 
Sbjct: 324 GKR-IYLLAEGRLVNLAAAEGHPSEVMDLSFSNQALSVKYIYENR--GKLENKVYNVPQE 380

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYI 270
           +DE VA L L  +G  +  +T EQ  Y+
Sbjct: 381 IDETVAKLKLNGMGIEIEPMTQEQIEYM 408



>gb:CP000027_79518 Dehalococcoides ethenogenes 195, complete genome.
          Length = 418

 Score =  109 bits (272), Expect = 6e-23
 Identities = 65/154 (42%), Positives = 91/154 (59%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TG+K +I  NH + MK+ A + N GHF++EI++  LE+    K  TI+P  + +   D
Sbjct: 268 TVTGDKHVIDANHFKLMKDGATLANSGHFNSEINIPALETLACGKE-TIRPSVEEYKMKD 326

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  I +L EGRL+NL  A GHP+ VM  SF NQ ++ LE +  K+  K EKKVY +P+ 
Sbjct: 327 GRR-IYLLGEGRLINLAAAEGHPAAVMDMSFANQALS-LE-YLVKNHTKLEKKVYAVPEE 383

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEG 252
           +D  VAA  L  L   +  LT EQ  Y+S   EG
Sbjct: 384 IDRAVAATKLSSLNVSIDTLTEEQIKYLSSWQEG 417



>sp|O67240|SAHH_AQUAE Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>pir|E70401|E70401 S-adenosylhomocysteine
           hydrolase - Aquifex aeolicus>gb:AE000727_26592 Aquifex
           aeolicus VF5 section 59 of 109 of the complete
           genome.>gb:AE000657_977123 Aquifex aeolicus VF5 complete
           genome.
          Length = 418

 Score =  108 bits (270), Expect = 9e-23
 Identities = 64/149 (42%), Positives = 87/149 (58%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN  +I   H   MK+ AIV N GHF+ EID+  LE     KR  I+ +   +   D
Sbjct: 268 TVTGNIHVIRREHFEVMKDGAIVANSGHFNVEIDIPALEEMAVEKR-EIRKEVTEYKLKD 326

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  I +LAEGRL+NL  A GHP+ VM  SF+NQ ++   + K     + EKKVY +P+ 
Sbjct: 327 GRR-IYLLAEGRLVNLAAAEGHPASVMDMSFSNQALSAEYIVKHHK--ELEKKVYRVPRE 383

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYIS 267
           +DE VA L L  LG ++ +LT EQ  Y+S
Sbjct: 384 IDEAVARLKLNALGIKIDELTEEQKKYLS 412



>gb:BX957221_844173 Methanococcus maripaludis S2 complete genome;
           segment 3/5.
          Length = 415

 Score =  108 bits (269), Expect = 1e-22
 Identities = 64/157 (40%), Positives = 90/157 (57%), Gaps = 3/157 (1%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTG KDI+ + H   MK+ A++ N GHFDNEI+   L      K ++   +  RF   +
Sbjct: 266 TTTGCKDILRMEHFLLMKDGAVLSNAGHFDNEINKNDL------KELSKSVKEARFNIEE 319

Query: 533 TKTG---IIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYIL 363
              G   I +L EGRL+NL CA GHP  VM  SF NQ ++   +  +++ GK E +VY +
Sbjct: 320 YDLGNKKIYLLGEGRLVNLACADGHPCEVMDMSFANQALSAKFI--KENKGKLENEVYEI 377

Query: 362 PKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEG 252
           P   D K+A L L  +GA + +L+PEQ  Y+S   EG
Sbjct: 378 PYEQDFKIALLKLHSMGADIDELSPEQRKYLSDWKEG 414



>pir|B72649|B72649 probable adenosylhomocysteinase APE0624 -
           Aeropyrum pernix  (strain K1)>gb:BA000002_651338
           Aeropyrum pernix K1 DNA, complete genome.
          Length = 399

 Score =  108 bits (269), Expect = 1e-22
 Identities = 62/148 (41%), Positives = 90/148 (60%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN ++I   HM KMK+ AI+ N GHF+ EI++  LE     KR  ++   D +  PD
Sbjct: 252 TATGNINVIDARHMEKMKDGAILANAGHFNVEINVAALEEMSVSKR-RVRRYLDEYRLPD 310

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  + ++ EGRL+NL  A GHPS VM  SF+NQ +A L++  E+  G+ EK+V+ + + 
Sbjct: 311 GRR-LYLIGEGRLVNLVAAEGHPSEVMDMSFSNQALAVLKIAGER--GRLEKRVHRVERI 367

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYI 270
            DE VA L L  +G R+  LT EQ  Y+
Sbjct: 368 QDEMVARLKLETMGVRIDSLTEEQKLYL 395



>sp|O28279|SAHH_ARCFU Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>pir|G69499|G69499 adenosylhomocysteinase
           (EC 3.3.1.1) homolog ahcY-2 - Archaeoglobus
           fulgidus>gb:AE000964_29905 Archaeoglobus fulgidus DSM
           4304 section 143 of 172 of the complete
           genome.>gb:AE000782_975876 Archaeoglobus fulgidus DSM
           4304 complete genome.
          Length = 405

 Score =  108 bits (269), Expect = 1e-22
 Identities = 67/152 (44%), Positives = 88/152 (57%), Gaps = 3/152 (1%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN+DII   H+R MK+ AI+ N GHF+ EID+  LE     KR   K  T+ +   D
Sbjct: 256 TATGNRDIIREEHIRLMKDGAILANAGHFNVEIDIPALERMAKAKREARKYVTE-YDLGD 314

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ---LELWKEKSSGKYEKKVYIL 363
            +  + +LAEGRL+NL  A GHP  VM  SF NQ +A     E W+     K E+KVY L
Sbjct: 315 KR--VYLLAEGRLVNLVAADGHPVEVMDMSFANQALAAKYIAENWQ-----KLERKVYRL 367

Query: 362 PKHLDEKVAALHLGKLGARLTKLTPEQSAYIS 267
           P+ LD  VA + L  +G  + +LT EQ  Y+S
Sbjct: 368 PEELDRMVARMKLESMGVEIDQLTEEQVRYLS 399



>sp|Q9YEF2|SAHH_AERPE Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase).
          Length = 416

 Score =  108 bits (269), Expect = 1e-22
 Identities = 62/148 (41%), Positives = 90/148 (60%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN ++I   HM KMK+ AI+ N GHF+ EI++  LE     KR  ++   D +  PD
Sbjct: 269 TATGNINVIDARHMEKMKDGAILANAGHFNVEINVAALEEMSVSKR-RVRRYLDEYRLPD 327

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  + ++ EGRL+NL  A GHPS VM  SF+NQ +A L++  E+  G+ EK+V+ + + 
Sbjct: 328 GRR-LYLIGEGRLVNLVAAEGHPSEVMDMSFSNQALAVLKIAGER--GRLEKRVHRVERI 384

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYI 270
            DE VA L L  +G R+  LT EQ  Y+
Sbjct: 385 QDEMVARLKLETMGVRIDSLTEEQKLYL 412



>sp|Q8ZTQ7|SAHH_PYRAE Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:AE009913_257327 Pyrobaculum aerophilum
           strain IM2 section 168 of 201 of the complete
           genome.>gb:AE009441_899953 Pyrobaculum aerophilum strain
           IM2 complete genome.
          Length = 437

 Score =  107 bits (268), Expect = 2e-22
 Identities = 65/149 (43%), Positives = 86/149 (57%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN   I + H+ KMK+ A++ N GHF+ EID+ GLE     KR  I+P  + +  P+
Sbjct: 289 TATGNIRAISLGHIFKMKDGAVLANAGHFNVEIDVAGLERVAVAKR-RIRPYLEEYTLPN 347

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  + ++ EGRL+NL  A GHPS VM  SF NQ +A   L K K S      VY LP  
Sbjct: 348 GKR-VYLIGEGRLVNLVAAEGHPSEVMDLSFANQALAAEFLAKNKLS----VDVYKLPDE 402

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYIS 267
           +D +VA L L  +G  + +LT EQ  YIS
Sbjct: 403 IDREVARLKLKTMGIEIEELTEEQRRYIS 431



>sp|Q8YX05|SAHH_ANASP Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>pir|AC1983|AC1983 adenosylhomocysteinase
           [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_682405 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 425

 Score =  107 bits (267), Expect = 2e-22
 Identities = 61/150 (40%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRI-TIKPQTDRFVFP 537
           T TGNK ++   H   MK+ AIVCN GHFD E+D++ L +    K I  ++P T+ +   
Sbjct: 275 TVTGNKHVVRGEHFDVMKDGAIVCNSGHFDLELDLKYLAA--NAKEIKEVRPFTEEYKLT 332

Query: 536 DTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPK 357
           + K+ +++L +GRL+NL  A GHPS VM  SF NQ +A   L K K  GK    ++ +P 
Sbjct: 333 NGKS-VVVLGQGRLINLAAAEGHPSAVMDMSFANQALACEYLVKNK--GKLAPGLHSIPV 389

Query: 356 HLDEKVAALHLGKLGARLTKLTPEQSAYIS 267
            +D+++A L L  +G  +  LTPEQ  YI+
Sbjct: 390 EVDQEIARLKLQAMGIYIDSLTPEQIEYIN 419



>sp|Q8DGC8|SAHH_SYNEL Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:BA000039_728174 Thermosynechococcus
           elongatus BP-1 DNA, complete genome.
          Length = 429

 Score =  105 bits (262), Expect = 8e-22
 Identities = 59/149 (39%), Positives = 88/149 (59%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK +I   H   MK+ A+V N GHFD EID+  L++     R+ ++  T+ ++ P 
Sbjct: 279 TVTGNKHVIRAEHFAVMKDGAMVANSGHFDIEIDLATLKTLAKQVRV-VRNFTEEYILPS 337

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K+ II+L EGRL+NL  A GHP+ VM  SF NQ +    L K K  G+    ++ +P  
Sbjct: 338 GKS-IIVLGEGRLINLAAAEGHPASVMDMSFANQALGCEYLVKNK--GQLAAGIHPIPAA 394

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYIS 267
           +D+++A L L  +G  +  LTPEQ  Y++
Sbjct: 395 VDQEIARLKLQAMGIAIDTLTPEQVEYMN 423



>sp|P58855|SAHH_METKA Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:AE010334_262000 Methanopyrus kandleri
           AV19 section 33 of 157 of the complete
           genome.>gb:AE009439_902781 Methanopyrus kandleri AV19,
           complete genome.
          Length = 424

 Score =  103 bits (256), Expect = 4e-21
 Identities = 62/154 (40%), Positives = 85/154 (55%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN+D+I   H+ KMK+  I+ N GHFD EID + LE +   K          +  PD
Sbjct: 273 TATGNRDVIRGEHIEKMKDGVILANAGHFDVEIDKEYLEEHCEEKIDRRGGLVTEYRMPD 332

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            K  + ++AEGRL+NL    GHP  +M  SF  Q ++   L KE    + E  VY +PK 
Sbjct: 333 GKR-VYLIAEGRLVNLAAGEGHPIEIMDISFALQALSVEVLAKE--GKEMEPGVYKVPKD 389

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEG 252
           +D++VA L L  +G  L +LTPEQ  Y+    EG
Sbjct: 390 VDKRVAELKLESMGIELEELTPEQREYMKSWEEG 423



>sp|Q58783|SAHH_METJA Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>pir|C64473|C64473 adenosylhomocysteinase
           (EC 3.3.1.1) - Methanococcus jannaschii>gb:U67578_207502
           Methanocaldococcus jannaschii DSM 2661 section 120 of
           150 of the complete genome.>gb:L77117_1100260
           Methanocaldococcus jannaschii DSM 2661, complete genome.
          Length = 415

 Score =  102 bits (253), Expect = 9e-21
 Identities = 64/155 (41%), Positives = 86/155 (55%), Gaps = 1/155 (0%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRI-TIKPQTDRFVFP 537
           TTTG KD+I   H+ KM+N AI+ N GHFDNEI+ + LE     K I  ++     +   
Sbjct: 266 TTTGCKDVIRKEHILKMRNGAILANAGHFDNEINKKHLEEL--AKSIKEVRNCVTEYDLG 323

Query: 536 DTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPK 357
           + K  I +L EGRL+NL CA GHP  VM  SF NQ +A   + K     K E +VY +P 
Sbjct: 324 NKK--IYLLGEGRLVNLACADGHPCEVMDMSFANQALAAEYILKNHE--KLEPRVYNIPY 379

Query: 356 HLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEG 252
             D  +A+L L  +G  + +LT EQ  Y+    EG
Sbjct: 380 EQDLMIASLKLKAMGIEIDELTKEQKKYLEDWREG 414



>gb:AY142857_592040 Heliobacillus mobilis Adenosylhomocysteinase
           gene, partial cds.
          Length = 425

 Score =  101 bits (252), Expect = 1e-20
 Identities = 55/149 (36%), Positives = 87/149 (58%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN+DI+   H+  +K+ AI+CN GHFD E++ + L +     RI  +   + + F D
Sbjct: 277 TVTGNRDIVRREHLEVIKDKAILCNAGHFDVEVNKEDLRALSTSVRIA-RNNIEEYTFRD 335

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  + +L EGRL+NL C  GHP+ VM  +F  Q ++   ++  +   + E KVY +P+ 
Sbjct: 336 GRK-VYLLGEGRLVNLACGDGHPAEVMDLTFALQAMSLEYVFTNRE--QLEPKVYPVPEE 392

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYIS 267
           +D KVA L L  LG  + +LT  QS Y++
Sbjct: 393 IDRKVAQLRLQALGVSIDELTEVQSKYLN 421



>gb:AP006840_568886 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 421

 Score =  101 bits (251), Expect = 2e-20
 Identities = 55/148 (37%), Positives = 83/148 (56%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TG + +I   H   M++ AI+ N GHFD EI    LE++ G + + ++P  D +  PD
Sbjct: 273 TVTGCEKVIRREHFEVMRDGAILANAGHFDVEIWKPDLEAFGG-QPVRVRPHVDAYTAPD 331

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  + ++ EGRL NL    GHP+ VM  SF  Q++    LW  ++ G+ E +V  +P  
Sbjct: 332 GRR-LYLIGEGRLANLAAGDGHPAEVMDLSFGVQLLT--HLWLVENRGRLENRVIEVPPE 388

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYI 270
           +D +VA   L  LG  + +LTPEQ  YI
Sbjct: 389 IDTRVAETRLRALGVEIDRLTPEQERYI 416



>gb:AP006878_575180 Thermococcus kodakaraensis strain KOD1 DNA,
           complete genome.
          Length = 421

 Score = 98.2 bits (243), Expect = 1e-19
 Identities = 56/148 (37%), Positives = 85/148 (57%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TG+ + I   H   MK+ AI+ N GHFD EI    LE+   V+    +P    +   D
Sbjct: 271 TATGDINCIRKEHFELMKDGAILANAGHFDVEISKPDLEAL-AVEISEPRPNITEYKMAD 329

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  + +LAEGRL+NL  A GHP+ +M  SF  Q  A+   + +++ G+ E KVY+LP+ 
Sbjct: 330 GRR-LYLLAEGRLVNLAAADGHPAEIMDMSFALQ--AKAAEYIKENRGRLEPKVYVLPRE 386

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYI 270
           +DE VA + L  +G ++ +LT EQ  Y+
Sbjct: 387 IDEMVARIKLASMGIKIEELTEEQKKYL 414



>gb:AF013268_468780 Thermotoga maritima S adenosylhomocysteine
           hydrolase and reverse gyrase (TmTopR) genes, complete
           cds; and inorganic pyrophosphatase gene, partial cds.
          Length = 404

 Score = 96.7 bits (239), Expect = 4e-19
 Identities = 53/148 (35%), Positives = 84/148 (56%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T +GN D++    +  +K+ A++ N GHF+ EI ++ LE    V++   +P    +   +
Sbjct: 257 TASGNTDVLSKEDILSLKDGAVLANAGHFNVEIPVRVLEEI-AVEKFEARPNVTGYTLEN 315

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            KT + +LAEGRL+NL    GHP  +M  SF  Q+ A L L +     K   KVY+LP  
Sbjct: 316 GKT-VFLLAEGRLVNLAAGDGHPVEIMDLSFALQIFAVLYLLENHR--KMSPKVYMLPDE 372

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYI 270
           +DE+VA + L  LG ++ +LT +Q  Y+
Sbjct: 373 IDERVARMKLDSLGVKIDELTEKQRRYL 400



>sp|O51933|SAHH_THEMA Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>pir|B72409|B72409 adenosylhomocysteinase -
           Thermotoga maritima (strain MSB8)>gb:AE001702_38093
           Thermotoga maritima MSB8 section 14 of 136 of the
           complete genome.>gb:AE000512_1112566 Thermotoga maritima
           MSB8, complete genome.
          Length = 404

 Score = 96.7 bits (239), Expect = 4e-19
 Identities = 53/148 (35%), Positives = 84/148 (56%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T +GN D++    +  +K+ A++ N GHF+ EI ++ LE    V++   +P    +   +
Sbjct: 257 TASGNTDVLSKEDILSLKDGAVLANAGHFNVEIPVRVLEEI-AVEKFEARPNVTGYTLEN 315

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            KT + +LAEGRL+NL    GHP  +M  SF  Q+ A L L +     K   KVY+LP  
Sbjct: 316 GKT-VFLLAEGRLVNLAAGDGHPVEIMDLSFALQIFAVLYLLENHR--KMSPKVYMLPDE 372

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYI 270
           +DE+VA + L  LG ++ +LT +Q  Y+
Sbjct: 373 IDERVARMKLDSLGVKIDELTEKQRRYL 400



>gb:AE017261_420287 Picrophilus torridus DSM 9790, complete genome.
          Length = 408

 Score = 94.0 bits (232), Expect = 2e-18
 Identities = 57/156 (36%), Positives = 89/156 (57%), Gaps = 2/156 (1%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TG K+++  + + K KN  I+ N GHF+NEIDM+ +ES    K I+ +   D      
Sbjct: 258 TATGMKNVVPYSALLKAKNGIILGNAGHFNNEIDMESIES----KNISKERVRDYITEYR 313

Query: 533 TKTG--IIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILP 360
            + G  I I+++GRL+NL    GHP  +M  SF+ Q +    +   K+  + EK+VY +P
Sbjct: 314 LENGNRINIISDGRLLNLAAGQGHPIEIMDLSFSIQALTAEYI--VKNHDRLEKRVYPVP 371

Query: 359 KHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEG 252
           + +D+ VA + L  LG ++ KLT EQ  Y++   EG
Sbjct: 372 EDIDKNVAEIKLNALGIKIDKLTDEQIMYMNSFKEG 407



>pir|H71167|H71167 probable S-adenosyl-L-homocysteine hydrolase -
           Pyrococcus horikoshii>gb:BA000001_649191 Pyrococcus
           horikoshii OT3 DNA, complete genome.
          Length = 425

 Score = 92.4 bits (228), Expect = 7e-18
 Identities = 56/148 (37%), Positives = 81/148 (54%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TG+   I   H   MK+ AI+ N GHFD EI    LE    V+    +P    +   D
Sbjct: 275 TATGDIKCIRREHFELMKDGAIMANAGHFDVEIWKPDLEEL-AVEISNPRPNVTEYKLKD 333

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  + +LA+GRL+NL  A GHP+ +M  SF  Q  A+   + + + GK E +VYILP+ 
Sbjct: 334 GRR-LYLLADGRLVNLVAADGHPAEIMDMSFALQ--AKAAEYIKDNHGKLEPRVYILPRE 390

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYI 270
           +DE VA + L  +G  + +LT EQ  Y+
Sbjct: 391 IDEMVARIKLASMGIEIEELTEEQKKYL 418



>sp|O58275|SAHH_PYRHO Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase).
          Length = 421

 Score = 92.4 bits (228), Expect = 7e-18
 Identities = 56/148 (37%), Positives = 81/148 (54%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TG+   I   H   MK+ AI+ N GHFD EI    LE    V+    +P    +   D
Sbjct: 271 TATGDIKCIRREHFELMKDGAIMANAGHFDVEIWKPDLEEL-AVEISNPRPNVTEYKLKD 329

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  + +LA+GRL+NL  A GHP+ +M  SF  Q  A+   + + + GK E +VYILP+ 
Sbjct: 330 GRR-LYLLADGRLVNLVAADGHPAEIMDMSFALQ--AKAAEYIKDNHGKLEPRVYILPRE 386

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYI 270
           +DE VA + L  +G  + +LT EQ  Y+
Sbjct: 387 IDEMVARIKLASMGIEIEELTEEQKKYL 414



>sp|Q8PUQ4|SAHH_METMA Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:AE013469_292608 Methanosarcina mazei
           strain Goe1, section 251 of 379 of the complete
           genome.>gb:AE008384_966717 Methanosarcina mazei strain
           Goe1, complete genome.
          Length = 411

 Score = 92.0 bits (227), Expect = 9e-18
 Identities = 57/150 (38%), Positives = 86/150 (57%), Gaps = 1/150 (0%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN+DI+  ++ + MK+ AI+ N GHF+ EIDM+ L+S     R T++     +   +
Sbjct: 264 TATGNRDILTADNFKVMKDGAILANSGHFNVEIDMEALDSLAKSTR-TVRHNIKEYDIGN 322

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK-SSGKYEKKVYILPK 357
            +  I ++AEGRL+NL    GHP+ VM  SF NQ +    + + K SSG     V+ +P+
Sbjct: 323 RR--INVIAEGRLVNLAAGDGHPAEVMDMSFANQALCVRYIAENKLSSG-----VHGVPR 375

Query: 356 HLDEKVAALHLGKLGARLTKLTPEQSAYIS 267
            LD  VA L L  +G    +LT +Q  Y+S
Sbjct: 376 ELDTYVAKLKLESMGIATDELTSKQECYMS 405



>sp|P50251|SAHH_PYRFU Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:AE010158_259910 Pyrococcus furiosus DSM
           3638, section 33 of 173 of the complete
           genome.>gb:AE009950_900691 Pyrococcus furiosus DSM 3638,
           complete genome.
          Length = 421

 Score = 90.9 bits (224), Expect = 2e-17
 Identities = 56/148 (37%), Positives = 81/148 (54%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN   I   H   MK+ AI+ N GHFD EI    LE    V+    +P    +   D
Sbjct: 271 TATGNIKCIRREHFELMKDGAIMANAGHFDVEIWKPDLEKL-AVEINNPRPNVTEYKLKD 329

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  + +LA+GRL+NL  A GHP+ +M  SF  Q  A+   + + +  + E KVYILP+ 
Sbjct: 330 GRR-LYLLADGRLVNLVAADGHPAEIMDMSFALQ--AKAAEYIKDNHERLEPKVYILPRE 386

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYI 270
           +DE VA + L  +G ++ +LT EQ  Y+
Sbjct: 387 IDEMVARIKLESMGIKIEELTEEQKKYL 414



>sp|Q9UYK5|SAHH_PYRAB Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>pir|B75064|B75064 adenosylhomocysteinase
           (ahcy) PAB1372 - Pyrococcus abyssi  (strain
           Orsay)>gb:CNSPAX05_850265 Pyrococcus abyssi complete
           genome; segment 5/6.
          Length = 422

 Score = 89.7 bits (221), Expect = 5e-17
 Identities = 57/148 (38%), Positives = 79/148 (53%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGN   I   H   MK+ AI+ N GHFD EI    LE    V+    +P    +   D
Sbjct: 272 TATGNIKCIRREHFELMKDGAIMANAGHFDVEIWKPDLEEL-AVEISNPRPNVTEYKLKD 330

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
            +  + +LA+GRL+NL  A GHP+ +M  SF  Q  A  E  KE    + E +VY+LP+ 
Sbjct: 331 GRR-LYLLADGRLVNLVAADGHPAEIMDMSFALQAKAA-EYIKENHE-RLEPRVYVLPRE 387

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYI 270
           +DE VA + L  +G  + +LT EQ  Y+
Sbjct: 388 IDEMVARIKLQSMGINIEELTEEQKKYL 415



>sp|Q8TRA5|SAHH_METAC Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:AE010796_266630 Methanosarcina
           acetivorans str. C2A, section 141 of 534 of the complete
           genome.>gb:AE010299_907189 Methanosarcina acetivorans
           str. C2A, complete genome.
          Length = 411

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 53/150 (35%), Positives = 82/150 (54%), Gaps = 1/150 (0%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESY-PGVKRITIKPQTDRFVFP 537
           TTTGN+DI+   H + M + A++ N GHF+ EIDM+ L S    VK  T++     +   
Sbjct: 264 TTTGNRDILTAEHFKVMPDGAVLANSGHFNVEIDMEALTSLAKSVK--TVRHNIKEYDIG 321

Query: 536 DTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPK 357
           D +  I ++AEGRL+NL    GHP+ VM  SF NQ +    +    +       V+ +P+
Sbjct: 322 DRR--INVIAEGRLVNLAAGDGHPAEVMDMSFANQALCVRYI----AENTLLNGVHGVPR 375

Query: 356 HLDEKVAALHLGKLGARLTKLTPEQSAYIS 267
            +D  VA L L  +G  + +LT +Q  Y++
Sbjct: 376 GIDTYVAKLKLESMGISIDELTSKQECYMT 405



>sp|Q979Z4|SAHH_THEVO Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:BA000011_665458 Thermoplasma volcanium
           GSS1 DNA, complete genome.
          Length = 410

 Score = 86.7 bits (213), Expect = 4e-16
 Identities = 52/154 (33%), Positives = 80/154 (51%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TG KD++        K N ++ N GHFDNE+ ++ +E +   KR  ++    R+   +
Sbjct: 260 TATGMKDVVKYEDALVAKKNIVLANAGHFDNEVAVKEIEKHSLEKR-EVREFVKRYRLEN 318

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
             T + ++A+GRL+NL    GHP  +M  SF  Q +    L K   +   EKKVY +P  
Sbjct: 319 GNT-VDVIADGRLVNLAAGQGHPVEIMDLSFALQALTAEYLVKNHQN--LEKKVYPVPPE 375

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEG 252
           +D  VA + L + G  L  LT +Q  Y++   EG
Sbjct: 376 IDRYVAEIRLKQFGGELDTLTEDQIKYLNSWDEG 409



>sp|O27673|SAHH_METTH Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>pir|F69085|F69085 adenosylhomocysteinase
           (EC 3.3.1.1) - Methanobacterium thermoautotrophicum
           (strain Delta H)>gb:AE000922_29305 Methanobacterium
           thermoautotrophicum from bases 1493200 to 1503470
           (section 128 of 148) of the complete
           genome.>gb:AE000666_926387 Methanobacterium
           thermoautotrophicum str. Delta H complete genome.
          Length = 417

 Score = 83.6 bits (205), Expect = 3e-15
 Identities = 54/158 (34%), Positives = 83/158 (52%), Gaps = 4/158 (2%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRIT--IKPQTDRFVF 540
           T TGN D++  +    MK+  ++ N GHF+ EI+ + LE    + R T  +K   + F+ 
Sbjct: 267 TATGNTDVVSESEFMNMKDGCVMANSGHFNVEINREALEE---LSRETGKVKEDIEVFIM 323

Query: 539 PDTKTGIIILAEGRLMNLGC--ATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYI 366
           PD +  I +LAEGRL+NL      GHP+ +M  SF  Q ++   L +EK     +  VY 
Sbjct: 324 PDGRK-IYLLAEGRLVNLASERGQGHPAEIMDMSFAMQALSARHLLQEKP----DPGVYR 378

Query: 365 LPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEG 252
            P  +D  VA + L  +G  + +LT +Q  Y+    EG
Sbjct: 379 APDEIDLMVARMKLDAMGIEIDELTEKQRLYLENWEEG 416



>gb:AY596297_634056 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 425

 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 52/150 (34%), Positives = 77/150 (51%), Gaps = 2/150 (1%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGN+D+I+  H   M++  ++ N GHFD E+D+  L     V     +     +   D
Sbjct: 273 TTTGNRDVIVEEHFEAMQDGVLLANAGHFDVEVDLDALSDL-AVDTYEARNGVQTYEMAD 331

Query: 533 TKTGIIILAEGRLMNLG--CATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILP 360
            +  + +LAEGRL+NL    A GHP  VM  SF  Q +   EL   ++   YE  V+ +P
Sbjct: 332 GRR-LNVLAEGRLVNLATPIALGHPVEVMDQSFGVQAVCVREL--VENGDDYEAGVHAVP 388

Query: 359 KHLDEKVAALHLGKLGARLTKLTPEQSAYI 270
             LD++VA + L   G     LT  Q+ Y+
Sbjct: 389 DRLDKEVAEIKLDAEGVDFDSLTDTQAEYM 418



>sp|Q9HKX4|SAHH_THEAC Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>gb:TACID2_196241 Thermoplasma acidophilum
           complete genome; segment 2/5.
          Length = 410

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 50/154 (32%), Positives = 79/154 (51%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TG KD++        K N ++ N GHF+NE+ +  +E    ++   ++    R+   +
Sbjct: 260 TATGMKDVVKYEDALVAKKNIVLANAGHFNNEVAVSEIEK-RSLEVNEVREFVKRYRLEN 318

Query: 533 TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPKH 354
             T + I+A+GRL+NL    GHP  +M  SF  Q +    L   K+  K E+KVY +P  
Sbjct: 319 GNT-VDIIADGRLVNLAAGQGHPVEIMDLSFALQALTAEYL--VKNHDKLERKVYPVPAD 375

Query: 353 LDEKVAALHLGKLGARLTKLTPEQSAYISIPVEG 252
           +D  VA + L + G  L +L  EQ  Y++   EG
Sbjct: 376 IDRYVAEIRLKQFGGELDQLNEEQIKYLNSWDEG 409



>sp|Q9HN50|SAHH_HALN1 Adenosylhomocysteinase (EC 3.3.1.1)
           (S-adenosyl-L-homocysteine hydrolase)
           (AdoHcyase).>pir|G84375|G84375 adenosylhomocysteinase
           [imported] - Halobacterium sp. NRC-1>gb:AE005110_63531
           Halobacterium sp. NRC-1 section 141 of 170 of the
           complete genome.>gb:AE004437_888450 Halobacterium sp.
           NRC-1 complete genome.
          Length = 427

 Score = 72.4 bits (176), Expect = 7e-12
 Identities = 49/150 (32%), Positives = 75/150 (50%), Gaps = 2/150 (1%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           TTTGNK++I   H  +M +  ++ N GHFD E+++  L S   V     +     +   D
Sbjct: 275 TTTGNKNVITRAHFERMDDGVVLANAGHFDVEVNLDHL-SELAVSEREAREGVREYELAD 333

Query: 533 TKTGIIILAEGRLMNLG--CATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILP 360
            +  + +LAEGRL+NL      GHP  VM  SF  Q +   EL   +   +Y   V+ +P
Sbjct: 334 GRR-LNVLAEGRLVNLASPIGLGHPVGVMDQSFGVQAVCVRELVANRE--EYAAGVHNVP 390

Query: 359 KHLDEKVAALHLGKLGARLTKLTPEQSAYI 270
             LD ++A + L   G     LT +Q+ Y+
Sbjct: 391 DELDIEIAEIKLAAEGVEYDALTDDQAEYM 420



>gb:AF178115_485818 Mycobacterium bovis S-adenosyl-L-homocysteine
           hydrolase gene, partial cds.
          Length = 181

 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 27/38 (71%), Positives = 33/38 (86%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGL 600
           T TGNKDIIM+ H++ MK++AI+ NIGHFDNEIDM GL
Sbjct: 144 TATGNKDIIMLEHIKAMKDHAILGNIGHFDNEIDMAGL 181



>gb:AK131563_1918085 Homo sapiens cDNA FLJ16815 fis, clone
           THYMU3044175, highly similar to Adenosylhomocysteinase
           (EC 3.3.1.1).
          Length = 317

 Score = 59.3 bits (142), Expect = 7e-08
 Identities = 28/73 (38%), Positives = 48/73 (65%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRFVFPD 534
           T TGNK+++   H+ +MKN+ IVCN+GH + EID+  L + P +    ++ Q D  ++PD
Sbjct: 236 TCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRT-PELTWERVRSQVDHVIWPD 294

Query: 533 TKTGIIILAEGRL 495
            K  +++LAE ++
Sbjct: 295 GKR-VVLLAETQM 306



>gb:AF129871_1770694 Gossypium hirsutum S-adenosyl-L-homocysteine
           hydrolase mRNA, partial cds.
          Length = 102

 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 22/23 (95%), Positives = 23/23 (100%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIV 645
           TTTGNKDIIMVNHMRKMKNNA+V
Sbjct: 80  TTTGNKDIIMVNHMRKMKNNAVV 102



>gb:AX063939_1458883 Sequence 221 from Patent
           WO0100843.>gb:AX244107_1464644 Sequence 99 from Patent
           WO0166573.
          Length = 35

 Score = 48.9 bits (115), Expect = 9e-05
 Identities = 20/35 (57%), Positives = 26/35 (74%)
 Frame = -3

Query: 329 HLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY 225
           H+  LG +LT+LT EQ+ YI + V GP+KP HYRY
Sbjct: 1   HVEALGGQLTELTKEQAEYIGVDVAGPFKPEHYRY 35



>gb:AE014295_311497 Bifidobacterium longum NCC2705, complete genome.
          Length = 500

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 38/137 (27%), Positives = 62/137 (45%), Gaps = 1/137 (0%)
 Frame = -3

Query: 713 TTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESY-PGVKRITIKPQTDRFVFP 537
           + TG +  + + HMR M   A +  IG   NEI +  +  + P V R T++        P
Sbjct: 345 SATGVRHTVTLEHMRAMHEGAALAVIGGIANEIALDEVSDFTPQVNRDTVQLNV-----P 399

Query: 536 DTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYILPK 357
           D  T + ++A+G  +N     G+P  +M  SF  Q  A   L + +  G  +  +  L  
Sbjct: 400 DGPT-LTLIADGDGVNYTVGGGNPIEIMDLSFAVQASAVAYLLEHR--GTLDHTLIRLDA 456

Query: 356 HLDEKVAALHLGKLGAR 306
             D+++AA  L   G R
Sbjct: 457 ATDQRIAASALKARGYR 473



>gb:AE014296_1135677 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003549_1215010 Drosophila melanogaster
           chromosome 3L, section 36 of 83 of the complete
           sequence.
          Length = 277

 Score = 33.5 bits (75), Expect = 3.9
 Identities = 17/63 (26%), Positives = 31/63 (49%), Gaps = 12/63 (19%)
 Frame = -3

Query: 542 FPDTKTG-----IIILAEGRLMNLGCAT-------GHPSFVMSCSFTNQVIAQLELWKEK 399
           FP  K G       ++A     ++GCA        GHP F+++C++ +  +    ++KEK
Sbjct: 179 FPKGKLGDSIRNFAVMARDNNTHVGCAALRFEKPAGHPLFLLACNYASNYVPDWPIYKEK 238

Query: 398 SSG 390
           + G
Sbjct: 239 AIG 241


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 644,275,994
Number of Sequences: 1806583
Number of extensions: 12393810
Number of successful extensions: 29794
Number of sequences better than 10.0: 207
Number of HSP's better than 10.0 without gapping: 28671
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29407
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 42145286112
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)