BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10810
         (933 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AF082891_1766701 Solanum tuberosum cystathionine gamma-syntha...   438   e-122   
gb:AY508112_1610232 Lycopersicon esculentum cystathionine gamma ...   438   e-122   
gb:AF097180_1767865 Nicotiana tabacum cystathionine gamma-syntha...   436   e-121   
gb:AF082892_1766702 Solanum tuberosum cystathionine gamma-syntha...   427   e-118   
gb:ATCYS1_1548043 A.thaliana mRNA for cystathionine gamma-synthase.   416   e-115   
sp|P55217|METB_ARATH|METB_ARATH Cystathionine gamma-synthase, chloroplast p...   416   e-115   Arabidopsis thaliana [mouse-ear cress]
gb:AY091062_1574290 Arabidopsis thaliana putative cystathionine ...   414   e-114   
gb:AF039206_1763323 Arabidopsis thaliana cystathionine gamma-syn...   413   e-114   
gb:ATU43709_1557011 Arabidopsis thaliana cystathionine-gamma-syn...   413   e-114   
pir|S71228|S71228 O-succinylhomoserine (thiol)-lyase (EC 4.2.99....   412   e-114   Arabidopsis thaliana [mouse-ear cress]
pir|T12288|T12288 O-succinylhomoserine (thiol)-lyase (EC 4.2.99....   409   e-113   Mesembryanthemum crystallinum
gb:FVAJ1451_1679511 Fragaria vesca partial mRNA for putative cys...   400   e-110   
gb:AF144102_1771834 Solanum tuberosum cystathionine-gamma-syntha...   400   e-110   
gb:AF141602_1771586 Glycine max cystathionine-gamma-synthase pre...   400   e-110   
gb:ATCYSKIN_1548045 A.thaliana ATCYS1, ORF1, ATHYP1 and AKIN10 g...   399   e-110   
pir|S51579|S51579 cystathionine gamma-lyase (EC 4.4.1.1) 1 - Ara...   399   e-110   Arabidopsis thaliana [mouse-ear cress]
gb:AF076495_1766183 Oryza sativa cystathionine gamma-synthase (C...   365   e-100   
gb:AC084766_1733766 Oryza sativa chromosome 3 BAC OSJNBb0048D20 ...   365   e-100   
pir|T02940|T02940 O-succinylhomoserine (thiol)-lyase (EC 4.2.99....   364   2e-99   Zea mays [maize]
pir|T02942|T02942 O-succinylhomoserine (thiol)-lyase (EC 4.2.99....   360   2e-98   Zea mays [maize]
gb:AC027035_1539799 Arabidopsis thaliana chromosome 1 BAC T16O9 ...   359   5e-98   
pir|H86456|H86456 probable cystathionine gamma-synthase F10C21.1...   359   5e-98   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1022449 Oryza sativa (japonica cultivar-group) chrom...   309   4e-83   
gb:AE016959_1022448 Oryza sativa (japonica cultivar-group) chrom...   305   1e-81   
gb:AE016959_1022454 Oryza sativa (japonica cultivar-group) chrom...   304   1e-81   
gb:AP004862_1846153 Oryza sativa (japonica cultivar-group) genom...   245   1e-63   
gb:BX294144_768602 Pirellula sp. strain 1 complete genome; segme...   233   4e-60   
pir|H83866|H83866 cystathionine gamma-lyase BH1736 [imported] - ...   222   7e-57   Bacillus halodurans
pir|H90407|H90407 hypothetical protein metB [imported] - Sulfolo...   219   6e-56   Saccharolobus solfataricus
gb:AY616087_1178730 Prototheca wickerhamii plastid cystathionine...   216   5e-55   
gb:BA000023_691084 Sulfolobus tokodaii str. 7 DNA, complete genome.   214   1e-54   
gb:AE017340_455984 Idiomarina loihiensis L2TR, complete genome.       209   6e-53   
gb:AE016776_330098 Pseudomonas putida KT2440 section 3 of 21 of ...   207   2e-52   
gb:CR555306_108009 Azoarcus sp. EbN1 complete genome.                 205   9e-52   
gb:AB077041_10132 Fusobacterium nucleatum mg1 gene for L-methion...   204   2e-51   
gb:AE012841_286180 Chlorobium tepidum TLS section 62 of 194 of t...   204   3e-51   
gb:AP006627_566253 Bacillus clausii KSM-K16 DNA, complete genome.     203   3e-51   
gb:BA000028_697336 Oceanobacillus iheyensis HTE831 DNA, complete...   203   4e-51   
gb:AY662340_1620461 Medicago sativa cystathionine gamma synthase...   200   3e-50   
gb:BX572594_799987 Rhodopseudomonas palustris CGA009 complete ge...   200   3e-50   
pir|A72595|A72595 probable cystathionine gamma-lyase APE1226 - A...   200   4e-50   Aeropyrum pernix
gb:AY052787_586931 Marinomonas mediterranea putative cystathioni...   199   5e-50   
gb:AE016966_369202 Coxiella burnetii strain RSA 493, section 7 o...   199   8e-50   
gb:AP006627_562348 Bacillus clausii KSM-K16 DNA, complete genome.     198   1e-49   
gb:AE013113_289203 Thermoanaerobacter tengcongensis MB4, section...   197   2e-49   
sp|Q9RAS9|METC_LACLA|METC_LACLA Cystathionine beta-lyase (EC 4.4.1.8) (CBL)...   196   5e-49   Lactococcus lactis subsp. lactis
gb:AE010647_265313 Fusobacterium nucleatum subsp. nucleatum ATCC...   196   7e-49   
sp|P56069|METB_HELPY|METB_HELPY Cystathionine gamma-synthase (EC 2.5.1.48) ...   196   7e-49   Helicobacter pylori
gb:AE015944_321552 Clostridium tetani E88, section 9 of 10 of th...   195   1e-48   
gb:AP006840_568021 Symbiobacterium thermophilum DNA, complete ge...   194   2e-48   
gb:AE016947_364414 Enterococcus faecalis V583, section 1 of 11 o...   194   2e-48   
gb:AE013565_293415 Methanosarcina mazei strain Goe1, section 347...   194   2e-48   
gb:AY204910_597228 Citrobacter freundii methionine gamma-lyase (...   194   2e-48   
gb:AE012010_278516 Xanthomonas axonopodis pv. citri str. 306, se...   194   3e-48   
gb:AE010947_267851 Methanosarcina acetivorans str. C2A, section ...   194   3e-48   
pir|F83595|F83595 probable cystathionine gamma-lyase PA0400 [imp...   194   3e-48   Pseudomonas aeruginosa
gb:AF204145_488220 Xanthomonas campestris pv. campestris LPS bio...   193   4e-48   
gb:AF092918_478615 Pseudomonas alcaligenes outer membrane Xcp-se...   193   4e-48   
pir|H84272|H84272 cystathionine alpha synthase [imported] - Halo...   193   4e-48   Halobacterium salinarum
gb:AE016791_333981 Pseudomonas putida KT2440 section 18 of 21 of...   193   5e-48   
pir|G83749|G83749 methionine gamma lyase BH0799 [imported] - Bac...   191   1e-47   Bacillus halodurans
gb:AF131881_481932 Lactococcus lactis subsp. cremoris strain NIZ...   190   3e-47   
gb:AE012157_279870 Xanthomonas campestris pv. campestris str. AT...   190   3e-47   
gb:BX842656_826524 Bdellovibrio bacteriovorus complete genome, s...   190   4e-47   
gb:AE013598_294479 Xanthomonas oryzae pv. oryzae KACC10331, comp...   190   4e-47   
gb:BX572600_801970 Rhodopseudomonas palustris CGA009 complete ge...   189   7e-47   
pir|T45483|T45483 cystathionine gamma-lyase homolog [imported] -...   189   7e-47   Stenotrophomonas maltophilia
gb:AY596297_633691 Haloarcula marismortui ATCC 43049 chromosome ...   189   9e-47   
sp|P55218|METZ_PSEAE|METZ_PSEAE O-succinylhomoserine sulfhydrylase (EC 2.5....   189   9e-47   Pseudomonas aeruginosa
gb:BC061381_2553156 Xenopus tropicalis hypothetical protein MGC7...   188   1e-46   
gb:AE013114_289214 Thermoanaerobacter tengcongensis MB4, section...   188   1e-46   
gb:BC080251_2561629 Danio rerio cystathionase (cystathionine gam...   187   2e-46   
gb:BA000012_669431 Mesorhizobium loti MAFF303099 DNA, complete g...   187   3e-46   
gb:AE017038_384547 Bacillus anthracis str. Ames section 15 of 18...   187   3e-46   
gb:AE015625_316203 Shewanella oneidensis MR-1 section 174 of 457...   187   3e-46   
gb:BC067624_2554796 Danio rerio cystathionase (cystathionine gam...   187   3e-46   
gb:BC056538_2551812 Danio rerio cystathionase (cystathionine gam...   187   3e-46   
pir|F72511|F72511 probable cystathionine gamma-synthase APE2068 ...   187   3e-46   Aeropyrum pernix
sp|Q9ZMW7|METB_HELPJ|METB_HELPJ Cystathionine gamma-synthase (EC 2.5.1.48) ...   187   3e-46   Helicobacter pylori
sp|P13254|MEGL_PSEPU|MEGL_PSEPU Methionine gamma-lyase (EC 4.4.1.11) (L-met...   187   3e-46   Pseudomonas putida
gb:BC082653_2562799 Xenopus laevis hypothetical LOC494673, mRNA ...   186   4e-46   
pir|H84236|H84236 cystathionine gamma-synthase [imported] - Halo...   186   4e-46   Halobacterium salinarum
gb:AX062018_1458710 Sequence 7 from Patent WO0100853.                 186   6e-46   
gb:AE017333_448685 Bacillus licheniformis DSM 13, complete genom...   185   1e-45   
pir|A69974|A69974 cystathionine gamma-synthase homolog yrhB - Ba...   185   1e-45   Bacillus subtilis
gb:A69681_1450470 Sequence 11 from Patent WO9807872.                  185   1e-45   
gb:TVMGL2_1401235 Trichomonas vaginalis mgl2 gene.>gb:A69673_145...   185   1e-45   
gb:BX571860_785382 Photorhabdus luminescens subsp. laumondii TTO...   185   1e-45   
gb:BA000043_737444 Geobacillus kaustophilus HTA426 DNA, complete...   185   1e-45   
gb:AY879312_1966045 Macaca fascicularis cystathionine gamma-lyas...   184   2e-45   
gb:AB125160_1873837 Macaca fascicularis CTH mRNA for cystathiona...   184   2e-45   
gb:CP000001_854715 Bacillus cereus ZK, complete genome.               184   2e-45   
gb:BX294144_768603 Pirellula sp. strain 1 complete genome; segme...   184   2e-45   
gb:AE017355_465399 Bacillus thuringiensis serovar konkukian str....   184   2e-45   
gb:AE017012_379235 Bacillus cereus ATCC 14579 section 15 of 18 o...   184   2e-45   
gb:LRE293860_142092 Lactobacillus reuteri mapA operon, strain 104R.   184   2e-45   
pir|T21246|T21246 hypothetical protein F22B8.6 - Caenorhabditis ...   184   2e-45   Caenorhabditis elegans [roundworm]
gb:A69679_1450469 Sequence 9 from Patent WO9807872.                   184   3e-45   
gb:TVMGL1_1401234 Trichomonas vaginalis mgl1 gene.>gb:A69671_145...   184   3e-45   
gb:AE017278_425654 Bacillus cereus ATCC 10987, section 15 of 18 ...   183   4e-45   
gb:AE017253_417239 Treponema denticola ATCC 35405, section 8 of ...   183   5e-45   
gb:AE017333_447158 Bacillus licheniformis DSM 13, complete genom...   182   6e-45   
pir|G96947|G96947 cystathionine gamma-synthase [imported] - Clos...   182   6e-45   Clostridium acetobutylicum
gb:AY204396_597043 Leptospirillum ferrooxidans Lfe147p1 gene, pa...   182   8e-45   
gb:BX571874_789611 Photorhabdus luminescens subsp. laumondii TTO...   182   1e-44   
gb:AE016924_359010 Chromobacterium violaceum ATCC 12472 section ...   182   1e-44   
gb:AE016922_358355 Chromobacterium violaceum ATCC 12472 section ...   182   1e-44   
pir|F87641|F87641 methionine-gamma-lyase [imported] - Caulobacte...   182   1e-44   Caulobacter vibrioides
gb:BT007589_2150521 Synthetic construct Homo sapiens cystathiona...   181   1e-44   
gb:S52784_2040398 cystathionine gamma-lyase [human, liver, mRNA,...   181   1e-44   
gb:BA000043_739117 Geobacillus kaustophilus HTA426 DNA, complete...   181   1e-44   
sp|P32929|CGL_HUMAN|CGL_HUMAN Cystathionine gamma-lyase (EC 4.4.1.1) (Gamm...   181   1e-44   Homo sapiens [man]
pir|B69847|B69847 cystathionine beta-lyase homolog yjcJ - Bacill...   181   2e-44   Bacillus subtilis
pir|D83853|D83853 cystathionine beta-lyase metC [imported] - Bac...   181   2e-44   Bacillus halodurans
gb:AE015837_318369 Shewanella oneidensis MR-1 section 386 of 457...   180   3e-44   
gb:AE017173_396694 Porphyromonas gingivalis W83 section 2 of 8 o...   180   4e-44   
gb:AE016781_331429 Pseudomonas putida KT2440 section 8 of 21 of ...   180   4e-44   
gb:AF337647_502678 Xanthomonas oryzae pv. oryzae putative cystat...   179   5e-44   
gb:AE017180_399245 Geobacter sulfurreducens PCA, complete genome.     179   5e-44   
gb:CP000033_89349 Lactobacillus acidophilus NCFM, complete genome.    179   5e-44   
gb:CR857176_1181424 Pongo pygmaeus mRNA; cDNA DKFZp469D0332 (fro...   179   7e-44   
pir|G97014|G97014 cystathionine gamma-synthase [imported] - Clos...   179   9e-44   Clostridium acetobutylicum
gb:BX842627_1643860 Neurospora crassa DNA linkage group I BAC cl...   178   1e-43   
gb:PSEMEGL_160730 Pseudomonas putida methionine gamma-lyase (MEG...   178   1e-43   
gb:AE013599_1132670 Drosophila melanogaster chromosome 2R, compl...   177   2e-43   
gb:CP000032_88195 Silicibacter pomeroyi DSS-3 plasmid megaplasmi...   177   2e-43   
pir|AG1284|AG1284 cystathionine beta-lyase homolog lmo1679 [impo...   177   2e-43   Listeria monocytogenes
gb:AE016919_357686 Chromobacterium violaceum ATCC 12472 section ...   177   3e-43   
gb:AB052882_2046368 Rattus norvegicus CSE mRNA for cystathionine...   176   4e-43   
gb:AE017327_444127 Listeria monocytogenes str. 4b F2365, section...   176   4e-43   
gb:AE017261_419494 Picrophilus torridus DSM 9790, complete genome.    176   4e-43   
gb:AY064018_1565957 Arabidopsis thaliana putative cystathionine ...   176   6e-43   
gb:AE016778_330746 Pseudomonas putida KT2440 section 5 of 21 of ...   176   6e-43   
sp|P53780|METC_ARATH|METC_ARATH Cystathionine beta-lyase, chloroplast precu...   176   6e-43   Arabidopsis thaliana [mouse-ear cress]
sp|Q8VCN5|CGL_MOUSE|CGL_MOUSE Cystathionine gamma-lyase (EC 4.4.1.1) (Gamm...   176   6e-43   Mus musculus [mouse]
gb:BA000028_695496 Oceanobacillus iheyensis HTE831 DNA, complete...   176   8e-43   
pir|AB1656|AB1656 cystathionine beta-lyase homolog lin1787 [impo...   176   8e-43   Listeria innocua
sp|P18757|CGL_RAT|CGL_RAT Cystathionine gamma-lyase (EC 4.4.1.1) (Gamma-...   176   8e-43   Rattus norvegicus [brown rat]
gb:AF095822_1240526 Drosophila melanogaster ecdysteroid-inducibl...   175   1e-42   
gb:BX936398_834750 Yersinia pseudotuberculosis IP32953 genome, c...   175   1e-42   
gb:AE017127_385973 Yersinia pestis biovar Medievalis str. 91001 ...   175   1e-42   
gb:SME591782_184094 Sinorhizobium meliloti 1021 complete chromos...   175   1e-42   
sp|P46807|METB_MYCLE|METB_MYCLE Cystathionine gamma-synthase (EC 2.5.1.48) ...   175   1e-42   Mycobacterium leprae
gb:BA000033_710707 Staphylococcus aureus subsp. aureus MW2 DNA, ...   174   2e-42   
gb:AY622198_637391 Brevibacterium linens L-methionine-gamma-lyas...   174   2e-42   
gb:AE016822_339569 Leifsonia xyli subsp. xyli str. CTCB07, compl...   174   2e-42   
gb:ERWCRTS_135754 Pantoea agglomerans pyrophosphate synthase (cr...   174   2e-42   
gb:CP000046_90670 Staphylococcus aureus subsp. aureus COL, compl...   174   2e-42   
pir|S52983|S52983 probable cystathionine gamma-lyase (EC 4.4.1.1...   174   2e-42   Pantoea agglomerans
pir|D75458|D75458 trans-sulfuration enzyme - Deinococcus radiodu...   174   2e-42   Deinococcus radiodurans
pir|F89811|F89811 cystathionine gamma-synthase [imported] - Stap...   174   2e-42   Staphylococcus aureus subsp. aureus N315
gb:AE017261_420119 Picrophilus torridus DSM 9790, complete genome.    174   2e-42   
gb:AE016869_353191 Pseudomonas syringae pv. tomato str. DC3000 s...   174   2e-42   
gb:AE012398_282084 Xanthomonas campestris pv. campestris str. AT...   174   3e-42   
gb:AB075037_9999 Rhodococcus erythropolis pDR51-orf4, pDR51-orf1...   174   3e-42   
gb:AE017180_399244 Geobacter sulfurreducens PCA, complete genome.     173   5e-42   
gb:AE011946_277955 Xanthomonas axonopodis pv. citri str. 306, se...   173   5e-42   
gb:AE013598_295519 Xanthomonas oryzae pv. oryzae KACC10331, comp...   172   8e-42   
sp|P55216|CGL_CAEEL|CGL_CAEEL Putative cystathionine gamma-lyase (EC 4.4.1...   172   8e-42   Caenorhabditis elegans [roundworm]
gb:AE017230_411731 Mycobacterium avium subsp. paratuberculosis s...   171   1e-41   
gb:BX321858_773028 Nitrosomonas europaea ATCC 19718, complete ge...   171   2e-41   
gb:BA000030_701191 Streptomyces avermitilis MA-4680 genomic DNA,...   171   2e-41   
gb:BA000028_697433 Oceanobacillus iheyensis HTE831 DNA, complete...   171   2e-41   
gb:AP006840_568189 Symbiobacterium thermophilum DNA, complete ge...   171   2e-41   
gb:SCO939122_178630 Streptomyces coelicolor A3(2) complete genom...   171   2e-41   
gb:CR628337_114119 Legionella pneumophila str. Lens complete gen...   171   2e-41   
gb:BX571856_779925 Staphylococcus aureus subsp. aureus strain MR...   171   2e-41   
gb:AL935252_550258 Lactobacillus plantarum strain WCFS1 complete...   171   2e-41   
gb:AE017011_379125 Bacillus cereus ATCC 14579 section 14 of 18 o...   171   2e-41   
gb:AE016801_336067 Vibrio vulnificus CMCP6 chromosome I section ...   171   2e-41   
gb:TACID1_195858 Thermoplasma acidophilum complete genome; segme...   171   2e-41   
gb:CP000026_78591 Salmonella enterica subsp. enterica serovar Pa...   170   3e-41   
pir|AI0937|AI0937 cystathionine gamma-synthase [imported] - Salm...   170   3e-41   Salmonella enterica subsp. enterica serovar Typhi
gb:BX950851_842986 Erwinia carotovora subsp. atroseptica SCRI104...   170   4e-41   
gb:CR628336_111066 Legionella pneumophila str. Paris complete ge...   170   4e-41   
pir|B71104|B71104 probable cystathionine gamma-lyase - Pyrococcu...   169   5e-41   Pyrococcus horikoshii
gb:BA000011_664617 Thermoplasma volcanium GSS1 DNA, complete gen...   169   7e-41   
gb:AE017355_465293 Bacillus thuringiensis serovar konkukian str....   169   7e-41   
gb:AE017037_384434 Bacillus anthracis str. Ames section 14 of 18...   169   7e-41   
gb:AE008891_245713 Salmonella typhimurium LT2, section 195 of 22...   169   7e-41   
gb:CR555306_108112 Azoarcus sp. EbN1 complete genome.                 169   7e-41   
gb:AB094500_1198985 Entamoeba histolytica metg mRNA for methioni...   169   9e-41   
gb:CP000024_876685 Streptococcus thermophilus CNRZ1066, complete...   169   9e-41   
gb:CP000023_874769 Streptococcus thermophilus LMG 18311, complet...   169   9e-41   
gb:AE017282_429197 Methylococcus capsulatus str. Bath, complete ...   169   9e-41   
gb:AE017277_425537 Bacillus cereus ATCC 10987, section 14 of 18 ...   168   1e-40   
gb:CP000029_80720 Staphylococcus epidermidis RP62A, complete gen...   168   1e-40   
sp|O53427|METB_MYCTU|METB_MYCTU Cystathionine gamma-synthase (EC 2.5.1.48) ...   168   1e-40   Mycobacterium tuberculosis
gb:AE005674_73601 Shigella flexneri 2a str. 301, complete genome...   167   2e-40   
gb:BA000037_723834 Vibrio vulnificus YJ016 DNA, chromosome I, co...   167   3e-40   
gb:AE016770_328858 Escherichia coli CFT073 section 16 of 18 of t...   167   3e-40   
gb:CP000031_85391 Silicibacter pomeroyi DSS-3, complete genome.       167   3e-40   
pir|D91237|D91237 cystathionine gamma-synthase [imported] - Esch...   167   3e-40   Escherichia coli O157:H7
sp|P00935|METB_ECOLI|METB_ECOLI Cystathionine gamma-synthase (EC 2.5.1.48) ...   167   3e-40   Escherichia coli [E. coli]
gb:AL354872_1923487 Human DNA sequence from clone RP11-42O15 on ...   167   4e-40   
gb:AP002069_1821917 Oryza sativa (japonica cultivar-group) genom...   167   4e-40   
gb:AP002069_1821905 Oryza sativa (japonica cultivar-group) genom...   167   4e-40   
gb:AF286193_1783196 Acremonium chrysogenum cystathionine-gamma-l...   167   4e-40   
pir|JC1362|JC1362 cystathionine gamma-lyase (EC 4.4.1.1) - human...   167   4e-40   Homo sapiens [man]
pir|E82752|E82752 cystathionine gamma-synthase XF0864 [imported]...   167   4e-40   Xylella fastidiosa
gb:CEC12C8_1360367 Caenorhabditis elegans cosmid C12C8, complete...   166   5e-40   
gb:AE012560_285194 Xylella fastidiosa Temecula1, section 8 of 9 ...   166   5e-40   
gb:CR382126_1658702 Kluyveromyces lactis strain NRRL Y-1140 chro...   166   6e-40   
gb:AE017340_456489 Idiomarina loihiensis L2TR, complete genome.       166   6e-40   
gb:AE014295_311535 Bifidobacterium longum NCC2705, complete genome.   166   6e-40   
gb:CR380954_1651331 Candida glabrata strain CBS138 chromosome H ...   165   1e-39   
gb:AP006627_564264 Bacillus clausii KSM-K16 DNA, complete genome.     165   1e-39   
gb:CP000011_868890 Burkholderia mallei ATCC 23344 chromosome 2, ...   165   1e-39   
gb:BX571966_794952 Burkholderia pseudomallei strain K96243, chro...   165   1e-39   
gb:AF082890_1766700 Solanum tuberosum cystathionine beta-lyase (...   164   2e-39   
gb:CR382135_1668437 Debaryomyces hansenii chromosome C of strain...   164   2e-39   
gb:AB094499_1198984 Entamoeba histolytica metg mRNA for methioni...   163   4e-39   
gb:CP000003_860117 Streptococcus pyogenes MGAS10394, complete ge...   163   4e-39   
gb:BA000040_729365 Bradyrhizobium japonicum USDA 110 DNA, comple...   163   4e-39   
gb:BA000031_708225 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...   163   4e-39   
gb:AE014139_303610 Streptococcus pyogenes MGAS315, section 4 of ...   163   4e-39   
gb:AE009966_257858 Streptococcus pyogenes strain MGAS8232, secti...   163   4e-39   
gb:AE014295_310816 Bifidobacterium longum NCC2705, complete genome.   163   5e-39   
gb:AE006486_219397 Streptococcus pyogenes M1 GAS, section 15 of ...   163   5e-39   
pir|E87526|E87526 O-succinylhomoserine sulfhydrylase [imported] ...   163   5e-39   Caulobacter vibrioides
pir|A82045|A82045 cystathionine gamma-synthase VC2683 [imported]...   163   5e-39   Vibrio cholerae
gb:AY316747_608840 Rhizobium sp. NGR234 megaplasmid 2 contig 1, ...   162   9e-39   
gb:AY458646_619925 Uncultured bacterium 578 clone EBAC080-L31E09...   162   1e-38   
gb:AE010233_260833 Pyrococcus furiosus DSM 3638, section 108 of ...   162   1e-38   
pir|F70632|F70632 probable metZ protein - Mycobacterium tubercul...   162   1e-38   Mycobacterium tuberculosis
gb:AP006618_561228 Nocardia farcinica IFM 10152 DNA, complete ge...   161   1e-38   
gb:CP000020_872443 Vibrio fischeri ES114 chromosome I, complete ...   161   2e-38   
gb:AF497482_516560 Micromonospora echinospora calicheamicin bios...   161   2e-38   
gb:AE017279_425991 Bacillus cereus ATCC 10987, section 16 of 18 ...   160   3e-38   
gb:AE017013_379517 Bacillus cereus ATCC 14579 section 16 of 18 o...   160   3e-38   
gb:BA000016_673216 Clostridium perfringens str. 13 DNA, complete...   160   3e-38   
gb:AB028629_4614 Clostridium perfringens metB, cysK, ygaG, lipA ...   160   3e-38   
pir|T43791|T43791 cystathionine beta-synthase [imported] - Clost...   160   3e-38   Clostridium perfringens
pir|B81949|B81949 cystathionine beta-lyase (EC 4.4.1.8) NMA1012 ...   160   4e-38   Neisseria meningitidis serogroup A
pir|A81158|A81158 cystathionine beta-lyase (EC 4.4.1.8) NMB0802 ...   160   4e-38   Neisseria meningitidis serogroup B
gb:BA000035_717126 Corynebacterium efficiens YS-314 DNA, complet...   159   6e-38   
gb:AE009875_256806 Pyrobaculum aerophilum strain IM2 section 130...   159   6e-38   
gb:CR543861_104193 Acinetobacter sp. ADP1 complete genome.            159   6e-38   
pir|T47234|T47234 O-succinylhomoserine (thiol)-lyase (EC 4.2.99....   159   6e-38   Corynebacterium glutamicum
pir|H96947|H96947 cystathionine beta-lyase [imported] - Clostrid...   159   6e-38   Clostridium acetobutylicum
pir|T19213|T19213 hypothetical protein C12C8.2 - Caenorhabditis ...   159   7e-38   Caenorhabditis elegans [roundworm]
gb:RNCYGLY_2134727 Rat mRNA for cystathionine gamma-lyase (EC 4....   159   1e-37   
gb:CP000001_854996 Bacillus cereus ZK, complete genome.               158   1e-37   
gb:AE017355_465679 Bacillus thuringiensis serovar konkukian str....   158   2e-37   
gb:AE017241_414578 Mycobacterium avium subsp. paratuberculosis s...   158   2e-37   
gb:TACID2_196301 Thermoplasma acidophilum complete genome; segme...   158   2e-37   
gb:MLCB4_145115 Mycobacterium leprae cosmid B4.                       158   2e-37   
pir|C86943|C86943 probable o-succinylhomoserine sulfhydrylase [i...   158   2e-37   Mycobacterium leprae
gb:CR382132_1665184 Yarrowia lipolytica chromosome F of strain C...   157   4e-37   
gb:AP006840_569870 Symbiobacterium thermophilum DNA, complete ge...   157   4e-37   
gb:BX571856_779823 Staphylococcus aureus subsp. aureus strain MR...   156   5e-37   
gb:CR378663_93677 Photobacterium profundum SS9; segment 1/12.         156   5e-37   
gb:AB096931_12688 Streptococcus anginosus cgs gene for cystathio...   156   6e-37   
gb:CP000023_874320 Streptococcus thermophilus LMG 18311, complet...   155   8e-37   
gb:BX248586_764187 Blochmannia floridanus complete genome; segme...   155   8e-37   
gb:AE014291_307762 Brucella suis 1330 chromosome I, complete seq...   155   8e-37   
pir|AC3454|AC3454 o-succinylhomoserine sulfhydrylase (EC 4.2.99....   155   8e-37   Brucella melitensis
gb:SME591784_184540 Sinorhizobium meliloti 1021 complete chromos...   155   1e-36   
gb:BA000033_710627 Staphylococcus aureus subsp. aureus MW2 DNA, ...   155   1e-36   
gb:AP006618_561760 Nocardia farcinica IFM 10152 DNA, complete ge...   155   1e-36   
pir|H89801|H89801 hypothetical protein SA0347 [imported] - Staph...   155   1e-36   Staphylococcus aureus subsp. aureus Mu50
gb:AE016818_1747807 Ashbya gossypii (= Eremothecium gossypii) AT...   154   2e-36   
gb:BA000028_697435 Oceanobacillus iheyensis HTE831 DNA, complete...   154   2e-36   
gb:AE017039_384832 Bacillus anthracis str. Ames section 16 of 18...   154   2e-36   
pir|H75137|H75137 probable carbon-sulfur lyase (EC 4.4.1.-) PAB0...   154   2e-36   Pyrococcus abyssi
pir|S31228|S31228 cystathionine gamma-lyase (EC 4.4.1.1) - yeast...   154   2e-36   Saccharomyces cerevisiae [brewer's yeast]
sp|P31373|CYS3_YEAST|CYS3_YEAST Cystathionine gamma-lyase (EC 4.4.1.1) (Gam...   154   2e-36   Saccharomyces cerevisiae [brewer's yeast]
gb:AE017144_389815 Helicobacter hepaticus ATCC 51449 section 1 o...   154   2e-36   
gb:AE010479_263562 Fusobacterium nucleatum subsp. nucleatum ATCC...   154   3e-36   
gb:BA000012_666641 Mesorhizobium loti MAFF303099 DNA, complete g...   153   4e-36   
pir|G64047|G64047 cystathionine gamma-lyase homolog - Haemophilu...   153   4e-36   Haemophilus influenzae
sp|P44502|METB_HAEIN|METB_HAEIN Cystathionine gamma-synthase (EC 2.5.1.48) ...   153   4e-36   Haemophilus influenzae
gb:AE004969_60159 Neisseria gonorrhoeae FA 1090, complete genome.     153   5e-36   
pir|A69847|A69847 cystathionine gamma-synthase homolog yjcI - Ba...   152   7e-36   Bacillus subtilis
gb:BA000012_670347 Mesorhizobium loti MAFF303099 DNA, complete g...   152   9e-36   
gb:AE008692_240414 Zymomonas mobilis subsp. mobilis ZM4, complet...   152   1e-35   
gb:CP000031_84474 Silicibacter pomeroyi DSS-3, complete genome.       151   2e-35   
gb:SME591790_186296 Sinorhizobium meliloti 1021 complete chromos...   150   3e-35   
gb:AE017327_444128 Listeria monocytogenes str. 4b F2365, section...   150   3e-35   
gb:BA000043_736861 Geobacillus kaustophilus HTA426 DNA, complete...   150   4e-35   
pir|H98043|H98043 O-succinylhomoserine (thiol)-lyase (EC 4.2.99....   149   6e-35   
pir|AH1284|AH1284 cystathionine gamma-synthase homolog lmo1680 [...   149   8e-35   
gb:BX572601_802238 Rhodopseudomonas palustris CGA009 complete ge...   149   1e-34   
gb:AP006840_569971 Symbiobacterium thermophilum DNA, complete ge...   149   1e-34   
pir|F95177|F95177 transulfuration enzyme family protein [importe...   149   1e-34   
sp|Q59829|CYSA_STRCO|CYSA_STRCO Putative cystathionine gamma-lyase (EC 4.4....   149   1e-34   
gb:BA000043_737443 Geobacillus kaustophilus HTA426 DNA, complete...   148   1e-34   
gb:AE014997_313987 Streptococcus mutans UA159 section 145 of 185...   148   1e-34   
pir|AC1656|AC1656 cystathionine gamma-synthase homolog lin1788 [...   148   1e-34   
gb:CQ794506_1453088 Sequence 9 from Patent WO2004024933.              148   2e-34   
gb:CP000009_863656 Gluconobacter oxydans 621H, complete genome.       148   2e-34   
gb:BX572608_804378 Rhodopseudomonas palustris CGA009 complete ge...   147   2e-34   
gb:BA000011_665478 Thermoplasma volcanium GSS1 DNA, complete gen...   147   2e-34   
gb:SCU37580_181719 Streptomyces coelicolor phosphotyrosine prote...   147   2e-34   
gb:RET012295_162982 Rhizobium etli metZ and apaG genes.               147   3e-34   
gb:CR543861_105142 Acinetobacter sp. ADP1 complete genome.            147   3e-34   
gb:BA000030_702160 Streptomyces avermitilis MA-4680 genomic DNA,...   146   5e-34   
gb:BX569690_775577 Synechococcus sp. WH8102 complete genome; seg...   146   6e-34   
gb:CP000029_80665 Staphylococcus epidermidis RP62A, complete gen...   146   6e-34   
gb:CP000002_856976 Bacillus licheniformis ATCC 14580, complete g...   145   8e-34   
gb:BX572095_797568 Prochlorococcus marinus MIT9313 complete geno...   145   8e-34   
gb:AE017333_447157 Bacillus licheniformis DSM 13, complete genome.    145   8e-34   
gb:AE017238_413758 Mycobacterium avium subsp. paratuberculosis s...   145   8e-34   
pir|AB3265|AB3265 O-succinylhomoserine (thiol)-lyase (EC 4.2.99....   145   8e-34   
gb:AP006840_569552 Symbiobacterium thermophilum DNA, complete ge...   145   1e-33   
gb:AE016752_324029 Staphylococcus epidermidis ATCC 12228, sectio...   145   1e-33   
gb:AE013162_289739 Thermoanaerobacter tengcongensis MB4, section...   145   1e-33   
gb:AP006878_576601 Thermococcus kodakaraensis strain KOD1 DNA, c...   144   2e-33   
gb:AE017162_394863 Prochlorococcus marinus subsp. marinus str. C...   144   2e-33   
gb:SADNAABAB_169413 S.antibioticus abaB gene.                         144   2e-33   
gb:AE014291_309370 Brucella suis 1330 chromosome I, complete seq...   144   2e-33   
pir|C83853|C83853 cystathionine gamma-synthase (O-succinylhomose...   144   2e-33   
pir|AF2629|AF2629 O-succinylhomoserine sulfhydrylase [imported] ...   144   2e-33   
gb:CP000029_80664 Staphylococcus epidermidis RP62A, complete gen...   144   3e-33   
pir|S14030|S14030 probable O-succinylhomoserine (thiol)-lyase (E...   143   4e-33   
sp|P24601|METB_HERAU|METB_HERAU Probable cystathionine gamma-synthase (EC 2...   143   4e-33   
gb:AL935259_552240 Lactobacillus plantarum strain WCFS1 complete...   143   5e-33   
gb:BX571870_788373 Photorhabdus luminescens subsp. laumondii TTO...   142   9e-33   
gb:BA000040_734171 Bradyrhizobium japonicum USDA 110 DNA, comple...   142   9e-33   
gb:AE017011_379124 Bacillus cereus ATCC 14579 section 14 of 18 o...   142   9e-33   
gb:AE017355_465292 Bacillus thuringiensis serovar konkukian str....   142   1e-32   
gb:AE017037_384433 Bacillus anthracis str. Ames section 14 of 18...   142   1e-32   
gb:AE006138_215883 Pasteurella multocida subsp. multocida str. P...   142   1e-32   
gb:AE017277_425536 Bacillus cereus ATCC 10987, section 14 of 18 ...   141   2e-32   
gb:AE016827_343256 Mannheimia succiniciproducens MBEL55E, comple...   141   2e-32   
gb:AE010479_263561 Fusobacterium nucleatum subsp. nucleatum ATCC...   141   2e-32   
gb:CP000001_854607 Bacillus cereus ZK, complete genome.               141   2e-32   
pir|AB3025|AB3025 methionine gamma-lyase mdeA [imported] - Agrob...   141   2e-32   
gb:BX571856_779822 Staphylococcus aureus subsp. aureus strain MR...   140   4e-32   
gb:BA000030_704949 Streptomyces avermitilis MA-4680 genomic DNA,...   140   4e-32   
gb:AE016822_340850 Leifsonia xyli subsp. xyli str. CTCB07, compl...   140   4e-32   
gb:CP000046_90600 Staphylococcus aureus subsp. aureus COL, compl...   140   4e-32   
pir|G89801|G89801 hypothetical protein SA0346 [imported] - Staph...   140   4e-32   
gb:AY560002_1614875 Medicago sativa chloroplast cystathionine be...   139   6e-32   
gb:AF401237_1796133 Neurospora crassa cystathionine beta-lyase (...   139   8e-32   
gb:AF211176_1777383 Botryotinia fuckeliana cystathionine beta-ly...   139   8e-32   
pir|E81806|E81806 O-succinylhomoserine sulfhydrolase (EC 4.2.99....   139   8e-32   
pir|C83975|C83975 O-acetylhomoserine sulfhydrylase BH2603 [impor...   139   1e-31   
gb:BX572091_796035 Prochlorococcus marinus MED4 complete genome;...   138   1e-31   
gb:AE016935_361755 Bacteroides thetaiotaomicron VPI-5482, sectio...   138   1e-31   
gb:AX063911_1458869 Sequence 193 from Patent WO0100843.>gb:AX244...   138   2e-31   
gb:AE017340_456362 Idiomarina loihiensis L2TR, complete genome.       138   2e-31   
gb:SCO939108_174969 Streptomyces coelicolor A3(2) complete genom...   138   2e-31   
gb:NCB13I18_1689208 Neurospora crassa DNA linkage group II BAC c...   137   3e-31   
gb:AE017180_399481 Geobacter sulfurreducens PCA, complete genome.     137   4e-31   
pir|D97242|D97242 o-acetylhomoserine sulfhydrylase [imported] - ...   137   4e-31   
pir|E72274|E72274 cystathionine gamma-synthase - Thermotoga mari...   137   4e-31   
gb:AE016865_352047 Pseudomonas syringae pv. tomato str. DC3000 s...   136   5e-31   
gb:AE017351_1759437 Cryptococcus neoformans var. neoformans JEC2...   136   7e-31   
gb:AE017351_1759436 Cryptococcus neoformans var. neoformans JEC2...   136   7e-31   
gb:AP006841_571934 Bacteroides fragilis YCH46 DNA, complete genome.   136   7e-31   
gb:AE014291_308180 Brucella suis 1330 chromosome I, complete seq...   136   7e-31   
pir|F83717|F83717 cystathionine gamma-synthase BH0542 [imported]...   136   7e-31   
gb:BA000031_706089 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...   135   9e-31   
gb:AL646085_549953 Ralstonia solanacearum GMI1000 megaplasmid, c...   135   9e-31   
gb:AE017180_400718 Geobacter sulfurreducens PCA, complete genome.     135   9e-31   
gb:BA000012_667237 Mesorhizobium loti MAFF303099 DNA, complete g...   135   1e-30   
pir|G81062|G81062 trans-sulfuration enzyme family protein NMB160...   135   1e-30   
pir|AG3403|AG3403 cystathionine beta-lyase (EC 4.4.1.8) [importe...   135   1e-30   
gb:AY186595_595764 Pseudomonas fluorescens cystathionine gamma l...   135   1e-30   
gb:CQ794516_1453093 Sequence 19 from Patent WO2004024933.             134   2e-30   
gb:BX640441_814193 Bordetella bronchiseptica strain RB50, comple...   134   2e-30   
gb:BA000012_672379 Mesorhizobium loti MAFF303099 DNA, complete g...   134   2e-30   
gb:AP006627_564186 Bacillus clausii KSM-K16 DNA, complete genome.     134   2e-30   
gb:AE004969_60845 Neisseria gonorrhoeae FA 1090, complete genome.     134   3e-30   
pir|C70846|C70846 probable metC protein - Mycobacterium tubercul...   134   3e-30   
gb:RLE315451_164269 Rhizobium leguminosarum fhuA gene, fhuF gene...   134   3e-30   
pir|E86864|E86864 O-succinylhomoserine (thiol)-lyase (EC 4.2.99....   134   3e-30   
gb:BA000036_720513 Corynebacterium glutamicum ATCC 13032 DNA, co...   133   4e-30   
gb:CR378679_98257 Photobacterium profundum SS9 chromosome 2; seg...   133   4e-30   
gb:CR382130_1662325 Yarrowia lipolytica chromosome D of strain C...   133   6e-30   
gb:AP006627_563189 Bacillus clausii KSM-K16 DNA, complete genome.     133   6e-30   
gb:AP006627_562758 Bacillus clausii KSM-K16 DNA, complete genome.     132   7e-30   
pir|E83018|E83018 homocysteine synthase PA5025 [imported] - Pseu...   132   7e-30   
pir|AE2770|AE2770 cystathionine beta lyase [imported] - Agrobact...   132   7e-30   
pir|A75306|A75306 O-acetylhomoserine (thiol)-lyase/O-acetylserin...   132   7e-30   
pir|A25539|A25539 O-acetyl homoserine-O-acetyl serine thiol-lyas...   132   7e-30   
sp|P06106|MT17_YEAST|MT17_YEAST MET17 protein [Includes: O-acetylhomoserine...   132   7e-30   
sp|O13326|CYSD_SCHPO|CYSD_SCHPO O-acetylhomoserine (Thiol)-lyase (EC 2.5.1....   132   7e-30   
gb:AE014295_312220 Bifidobacterium longum NCC2705, complete genome.   132   1e-29   
gb:AE012421_282295 Xanthomonas campestris pv. campestris str. AT...   132   1e-29   
gb:SME591790_186528 Sinorhizobium meliloti 1021 complete chromos...   132   1e-29   
gb:AE016783_331951 Pseudomonas putida KT2440 section 10 of 21 of...   132   1e-29   
gb:AE010969_268030 Methanosarcina acetivorans str. C2A, section ...   132   1e-29   
gb:AE017239_414162 Mycobacterium avium subsp. paratuberculosis s...   131   2e-29   
gb:AY294226_606761 Uncultured bacterium cosmid gbiox603r, comple...   131   2e-29   
gb:AX063913_1458870 Sequence 195 from Patent WO0100843.>gb:AX244...   130   3e-29   
gb:CQ794530_1453100 Sequence 33 from Patent WO2004024933.             130   3e-29   
gb:BX640433_811652 Bordetella parapertussis strain 12822, comple...   130   3e-29   
gb:BX640413_805246 Bordetella pertussis strain Tohama I, complet...   130   3e-29   
gb:BX571659_778372 Wolinella succinogenes, complete genome; segm...   130   3e-29   
gb:AP006841_574065 Bacteroides fragilis YCH46 DNA, complete genome.   130   3e-29   
gb:CR382138_1670942 Debaryomyces hansenii chromosome F of strain...   130   4e-29   
gb:AF188273_1775215 Candida albicans strain CAI4 O-acetylhomoser...   130   5e-29   
gb:CQ794548_1453109 Sequence 51 from Patent WO2004024933.>gb:AF1...   130   5e-29   
gb:CQ794508_1453089 Sequence 11 from Patent WO2004024933.             130   5e-29   
gb:AE014291_308234 Brucella suis 1330 chromosome I, complete seq...   130   5e-29   
gb:AE012834_286088 Chlorobium tepidum TLS section 55 of 194 of t...   130   5e-29   
pir|AH3397|AH3397 cysteine synthase (EC 4.2.99.8) [imported] - B...   130   5e-29   
gb:AY723749_1624146 Neotyphodium uncinatum isolate e167 LOL-1 lo...   129   8e-29   
gb:CQ794546_1453108 Sequence 49 from Patent WO2004024933.>gb:CR3...   129   1e-28   
gb:CP000023_874895 Streptococcus thermophilus LMG 18311, complet...   129   1e-28   
gb:BX950851_839570 Erwinia carotovora subsp. atroseptica SCRI104...   129   1e-28   
sp|Q92441|MT17_KLULA|MT17_KLULA MET17 protein [Includes: O-acetylhomoserine...   129   1e-28   
gb:CR380950_1649920 Candida glabrata strain CBS138 chromosome D ...   128   1e-28   
gb:AY260760_603600 Streptomyces hygroscopicus subsp. yingchengen...   128   1e-28   
pir|T44655|T44655 O-acetylhomoserine (thiol)-lyase (EC 4.2.99.10...   128   1e-28   
gb:AL646065_546490 Ralstonia solanacearum GMI1000 chromosome, co...   127   3e-28   
gb:AE006111_215626 Pasteurella multocida subsp. multocida str. P...   127   3e-28   
gb:AX063909_1458868 Sequence 191 from Patent WO0100843.>gb:AX244...   127   4e-28   
gb:CP000025_879316 Campylobacter jejuni RM1221, complete genome.      127   4e-28   
gb:AE015554_315505 Shewanella oneidensis MR-1 section 103 of 457...   127   4e-28   
gb:BA000012_672631 Mesorhizobium loti MAFF303099 DNA, complete g...   126   5e-28   
gb:AE017321_442125 Wolbachia endosymbiont strain TRS of Brugia m...   126   5e-28   
gb:CR522870_101793 Desulfotalea psychrophila LSv54 chromosome.        126   5e-28   
gb:LMFP1295_1388709 Leishmania major Friedlin chromosome 14 PAC ...   126   7e-28   
gb:AE017340_457768 Idiomarina loihiensis L2TR, complete genome.       126   7e-28   
gb:AE014295_311320 Bifidobacterium longum NCC2705, complete genome.   125   9e-28   
gb:BX571966_794163 Burkholderia pseudomallei strain K96243, chro...   125   1e-27   
pir|C81284|C81284 cystathionine beta-lyase truncated homolog Cj1...   125   1e-27   
gb:AE016957_367212 Enterococcus faecalis V583, section 11 of 11 ...   125   2e-27   
gb:AE016934_361291 Bacteroides thetaiotaomicron VPI-5482, sectio...   125   2e-27   
gb:MAD7PMMO_142342 Methylocystis strain SC2 clone, complete sequ...   125   2e-27   
gb:BX294147_769589 Pirellula sp. strain 1 complete genome; segme...   124   3e-27   
gb:CR382133_1666566 Debaryomyces hansenii chromosome A of strain...   124   3e-27   
gb:AY723750_1624154 Neotyphodium uncinatum isolate e167 LOL-2 lo...   124   3e-27   
sp|P50125|CYSD_EMENI|CYSD_EMENI O-acetylhomoserine (Thiol)-lyase (EC 2.5.1....   124   3e-27   
gb:SME591787_185497 Sinorhizobium meliloti 1021 complete chromos...   123   4e-27   
pir|AD1149|AD1149 O-acetylhomoserine sulfhydrylase homolog lmo05...   123   4e-27   
gb:ENU28383_1676764 Emericella nidulans cystathionine beta-lyase...   123   6e-27   
gb:BX842649_824308 Bdellovibrio bacteriovorus complete genome, s...   123   6e-27   
gb:AE017324_443057 Listeria monocytogenes str. 4b F2365, section...   122   8e-27   
gb:AE016858_350155 Pseudomonas syringae pv. tomato str. DC3000 s...   122   8e-27   
gb:AE014954_313537 Streptococcus mutans UA159 section 102 of 185...   122   8e-27   
gb:SME591786_185266 Sinorhizobium meliloti 1021 complete chromos...   122   8e-27   
pir|D96912|D96912 o-acetylhomoserine sulfhydrylase [imported] - ...   122   8e-27   
pir|AD1508|AD1508 O-acetylhomoserine sulfhydrylase homolog lin06...   122   8e-27   
gb:AY596297_633947 Haloarcula marismortui ATCC 43049 chromosome ...   122   1e-26   
gb:AE017259_418650 Wolbachia endosymbiont of Drosophila melanoga...   122   1e-26   
gb:BX572600_801975 Rhodopseudomonas palustris CGA009 complete ge...   122   1e-26   
gb:BX572091_796268 Prochlorococcus marinus MED4 complete genome;...   122   1e-26   
gb:BX571662_779159 Wolinella succinogenes, complete genome; segm...   122   1e-26   
pir|AF2730|AF2730 O-acetylhomoserine sulfhydrylase [imported] - ...   122   1e-26   
gb:BX572601_802172 Rhodopseudomonas palustris CGA009 complete ge...   121   2e-26   
gb:BX572597_801182 Rhodopseudomonas palustris CGA009 complete ge...   121   2e-26   
gb:AY596297_634245 Haloarcula marismortui ATCC 43049 chromosome ...   121   2e-26   
gb:AE011378_272299 Leptospira interrogans serovar lai str. 56601...   121   2e-26   
gb:BX571966_793423 Burkholderia pseudomallei strain K96243, chro...   121   2e-26   
gb:AE015661_316572 Shewanella oneidensis MR-1 section 210 of 457...   121   2e-26   
gb:AE016816_1746633 Ashbya gossypii (= Eremothecium gossypii) AT...   120   3e-26   
gb:AY260760_603602 Streptomyces hygroscopicus subsp. yingchengen...   120   3e-26   
gb:BX572607_804203 Rhodopseudomonas palustris CGA009 complete ge...   120   4e-26   
gb:CR555306_109009 Azoarcus sp. EbN1 complete genome.                 120   5e-26   
gb:BX640443_814628 Bordetella bronchiseptica strain RB50, comple...   119   6e-26   
gb:BX640430_810778 Bordetella parapertussis strain 12822, comple...   119   6e-26   
gb:BX569691_775753 Synechococcus sp. WH8102 complete genome; seg...   119   8e-26   
gb:BA000040_732705 Bradyrhizobium japonicum USDA 110 DNA, comple...   119   8e-26   
gb:AP008231_580838 Synechococcus elongatus PCC 6301 DNA, complet...   119   8e-26   
gb:BX640421_807915 Bordetella pertussis strain Tohama I, complet...   118   1e-25   
gb:AE017302_436048 Thermus thermophilus HB27 section 2 of 7 of t...   118   1e-25   
gb:AE017294_434047 Leptospira interrogans serovar Copenhageni st...   118   1e-25   
gb:AB049221_7333 Thermus thermophilus oah1 gene for O-acetyl-L-h...   118   1e-25   
pir|AB0035|AB0035 cystathionine beta-lyase (EC 4.4.1.8) [importe...   118   2e-25   
gb:CP000020_871362 Vibrio fischeri ES114 chromosome I, complete ...   117   2e-25   
gb:CP000031_85470 Silicibacter pomeroyi DSS-3, complete genome.       117   2e-25   
pir|D72324|D72324 O-acetylhomoserine sulfhydrylase - Thermotoga ...   117   2e-25   
gb:CR382130_1663358 Yarrowia lipolytica chromosome D of strain C...   117   3e-25   
gb:BX640439_813332 Bordetella bronchiseptica strain RB50, comple...   117   3e-25   
gb:BX640425_808925 Bordetella parapertussis strain 12822, comple...   117   3e-25   
gb:CR522870_100545 Desulfotalea psychrophila LSv54 chromosome.        117   3e-25   
gb:BX572606_803864 Rhodopseudomonas palustris CGA009 complete ge...   117   4e-25   
pir|F98008|F98008 O-acetylhomoserine (thiol)-lyase (EC 4.2.99.10...   117   4e-25   
gb:BA000037_722225 Vibrio vulnificus YJ016 DNA, chromosome I, co...   116   7e-25   
gb:AE016806_337459 Vibrio vulnificus CMCP6 chromosome I section ...   116   7e-25   
pir|G75463|G75463 O-acetylhomoserine (thiol)-lyase - Deinococcus...   116   7e-25   
gb:BA000012_667197 Mesorhizobium loti MAFF303099 DNA, complete g...   115   9e-25   
gb:AE016916_356895 Chromobacterium violaceum ATCC 12472 section ...   115   9e-25   
gb:AE016871_353631 Pseudomonas syringae pv. tomato str. DC3000 s...   115   1e-24   
gb:BA000031_706642 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...   114   2e-24   
gb:AY744399_645064 Uncultured alpha proteobacterium EBAC2C11, co...   114   2e-24   
gb:SPCC11E10_1720777 S.pombe chromosome III cosmid c11E10.            114   3e-24   
gb:CQ794538_1453104 Sequence 41 from Patent WO2004024933.             114   3e-24   
gb:AE017303_436430 Thermus thermophilus HB27 section 3 of 7 of t...   114   3e-24   
pir|T40852|T40852 cystathionine beta-lyase (EC 4.4.1.8) SPCC11E1...   114   3e-24   
gb:AE015940_320289 Clostridium tetani E88, section 5 of 10 of th...   114   4e-24   
gb:CP000031_87338 Silicibacter pomeroyi DSS-3, complete genome.       114   4e-24   
pir|A98336|A98336 cystathionine gamma-synthase[imported] - Agrob...   114   4e-24   
gb:CQ794520_1453095 Sequence 23 from Patent WO2004024933.             113   5e-24   
gb:BX640440_813707 Bordetella bronchiseptica strain RB50, comple...   113   5e-24   
gb:BX572097_798217 Prochlorococcus marinus MIT9313 complete geno...   113   6e-24   
gb:AB094564_12492 Thermus thermophilus oah2 gene for O-acetyl-L-...   113   6e-24   
gb:CR380958_1653336 Candida glabrata strain CBS138 chromosome L ...   112   1e-23   
pir|A46084|A46084 cystathionine beta-lyase (EC 4.4.1.8) - Bordet...   112   1e-23   
sp|Q07703|METC_BORAV|METC_BORAV Cystathionine beta-lyase (EC 4.4.1.8) (CBL)...   112   1e-23   
gb:CR382133_1666310 Debaryomyces hansenii chromosome A of strain...   111   2e-23   
gb:BX571659_778369 Wolinella succinogenes, complete genome; segm...   111   2e-23   
gb:BA000013_672824 Mesorhizobium loti MAFF303099 pMLa DNA, cpmpl...   111   2e-23   
gb:CR380957_1652759 Candida glabrata strain CBS138 chromosome K ...   110   3e-23   
gb:BX572600_801963 Rhodopseudomonas palustris CGA009 complete ge...   110   3e-23   
gb:AE017163_395256 Prochlorococcus marinus subsp. marinus str. C...   110   4e-23   


>gb:AF082891_1766701 Solanum tuberosum cystathionine gamma-synthase
            isoform 1 (CgS) mRNA, complete cds; chloroplast gene for
            chloroplast product.
          Length = 539

 Score =  438 bits (1127), Expect = e-122
 Identities = 210/231 (90%), Positives = 227/231 (98%)
 Frame = -1

Query: 930  RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
            RCVDIELVS+LC EKGALVCIDGTFATPLNQKALALGADLV+HSATKF+GGHNDVLAGCI
Sbjct: 309  RCVDIELVSKLCREKGALVCIDGTFATPLNQKALALGADLVVHSATKFLGGHNDVLAGCI 368

Query: 750  SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
            SGPEKLVSV+RNLHHILGG LNPNAAYLIIRGMKTLHLRVQQQNSTALRMAE+LEAHPKV
Sbjct: 369  SGPEKLVSVIRNLHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAHPKV 428

Query: 570  RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
            + VYYPGLPSHPE+H+AKKQMTGFGGVVSFE+DGDL+TTAKFVDAL+IPYIAPSFGGCES
Sbjct: 429  KHVYYPGLPSHPEYHLAKKQMTGFGGVVSFEVDGDLLTTAKFVDALRIPYIAPSFGGCES 488

Query: 390  IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
            IVDQPAIMSYWDL+Q++RA YGI+DNLVRFSFGVEDFEDVKADVLQAL++I
Sbjct: 489  IVDQPAIMSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDVKADVLQALDSI 539



>gb:AY508112_1610232 Lycopersicon esculentum cystathionine gamma
            synthase mRNA, complete cds.
          Length = 540

 Score =  438 bits (1127), Expect = e-122
 Identities = 210/231 (90%), Positives = 227/231 (98%)
 Frame = -1

Query: 930  RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
            RCVDIELVS+LC EKGALVCIDGTFATPLNQKALALGADLV+HSATKF+GGHNDVLAGCI
Sbjct: 310  RCVDIELVSKLCREKGALVCIDGTFATPLNQKALALGADLVVHSATKFLGGHNDVLAGCI 369

Query: 750  SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
            SGPEKLVSV+RNLHHILGG LNPNAAYLIIRGMKTLHLRVQQQNSTALRMAE+LEAHPKV
Sbjct: 370  SGPEKLVSVIRNLHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAHPKV 429

Query: 570  RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
            + VYYPGLPSHPE+H+AKKQMTGFGGVVSFE+DGDL+TTAKFVDAL+IPYIAPSFGGCES
Sbjct: 430  KHVYYPGLPSHPEYHLAKKQMTGFGGVVSFEVDGDLLTTAKFVDALRIPYIAPSFGGCES 489

Query: 390  IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
            IVDQPAIMSYWDL+Q++RA YGI+DNLVRFSFGVEDFEDVKADVLQAL++I
Sbjct: 490  IVDQPAIMSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDVKADVLQALDSI 540



>gb:AF097180_1767865 Nicotiana tabacum cystathionine gamma-synthase
           precursor (metB) mRNA, complete cds.
          Length = 445

 Score =  436 bits (1122), Expect = e-121
 Identities = 210/231 (90%), Positives = 224/231 (96%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           RCVDIELVS+LCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKF+GGHNDVLAGCI
Sbjct: 215 RCVDIELVSKLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFLGGHNDVLAGCI 274

Query: 750 SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
           SGP KLVS +RNLHHILGG LNPNAAYLIIRGMKTLHLRVQQQNSTALRMAE+LEAHPKV
Sbjct: 275 SGPLKLVSEIRNLHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAHPKV 334

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
           R VYYPGL SHPEHHIAKKQMTGFGG VSFE+DGDL+TTAKFVDALKIPYIAPSFGGCES
Sbjct: 335 RHVYYPGLQSHPEHHIAKKQMTGFGGAVSFEVDGDLLTTAKFVDALKIPYIAPSFGGCES 394

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           IVDQPAIMSYWDL+Q++RA YGIMDNLVRFSFGVEDF+D+KAD+LQAL++I
Sbjct: 395 IVDQPAIMSYWDLSQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQALDSI 445



>gb:AF082892_1766702 Solanum tuberosum cystathionine gamma-synthase
            isoform 2 (CgS2) mRNA, complete cds; chloroplast gene for
            chloroplast product.
          Length = 540

 Score =  427 bits (1097), Expect = e-118
 Identities = 203/231 (87%), Positives = 222/231 (96%)
 Frame = -1

Query: 930  RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
            RCVDIELVS+LCHEKGALVCIDGTFATPLNQK LALGADLV+HSATK++GGHNDVL GCI
Sbjct: 310  RCVDIELVSKLCHEKGALVCIDGTFATPLNQKVLALGADLVVHSATKYLGGHNDVLGGCI 369

Query: 750  SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
            SGP+KLVS VR LHHILGG +NPNAAYLIIRGMKTLHLRVQQQNSTA R+AE+LEAHPKV
Sbjct: 370  SGPDKLVSAVRTLHHILGGAINPNAAYLIIRGMKTLHLRVQQQNSTAQRIAEILEAHPKV 429

Query: 570  RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
            R VYYPGLPSHPE+H+AK+QMTGFGGVVSFE+DGDL+TTAKFVDALKIPYIAPSFGGCES
Sbjct: 430  RCVYYPGLPSHPEYHLAKRQMTGFGGVVSFEVDGDLLTTAKFVDALKIPYIAPSFGGCES 489

Query: 390  IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
            IVDQPAIMSYWDL ++ERA YGIMDNLVRFSFGVEDFED+KAD+LQALE++
Sbjct: 490  IVDQPAIMSYWDLKESERAKYGIMDNLVRFSFGVEDFEDLKADILQALESM 540



>gb:ATCYS1_1548043 A.thaliana mRNA for cystathionine gamma-synthase.
          Length = 563

 Score =  416 bits (1068), Expect = e-115
 Identities = 200/231 (86%), Positives = 214/231 (92%)
 Frame = -1

Query: 930  RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
            RCVDIELVS++CH++G LVCIDGTFATPLNQKALALGADLV+HSATK+IGGHNDVLAGCI
Sbjct: 333  RCVDIELVSKICHKRGTLVCIDGTFATPLNQKALALGADLVVHSATKYIGGHNDVLAGCI 392

Query: 750  SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
             G  KLVS +RNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTA RMAE+LEAHPKV
Sbjct: 393  CGSLKLVSEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAHPKV 452

Query: 570  RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
              VYYPGLPSHPEH +AK+QMTGFGGVVSFEIDGD+ TT KFVD+LKIPYIAPSFGGCES
Sbjct: 453  SHVYYPGLPSHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGGCES 512

Query: 390  IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
            IVDQPAIMSYWDL Q ER  YGI DNLVRFSFGVEDFEDVKAD+LQALE I
Sbjct: 513  IVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI 563



>sp|P55217|METB_ARATH Cystathionine gamma-synthase, chloroplast
            precursor (EC 2.5.1.48) (CGS) (O-succinylhomoserine
            (Thiol)-lyase).>gb:AB010888_1511283 Arabidopsis thaliana
            gene for cystathionine gamma-synthase, complete
            cds.>gb:ATAC008261_1542805 Arabidopsis thaliana
            chromosome III BAC T4P13 genomic sequence, complete
            sequence.>gb:ATU83500_1557327 Arabidopsis thaliana
            cystathionine gamma-synthase (CGS) mRNA, complete
            cds.>gb:AY094438_1575737 Arabidopsis thaliana
            AT3g01120/T4P13_19 mRNA, complete
            cds.>gb:BT002753_1636356 Arabidopsis thaliana clone
            C104884 putative cystathionine gamma-synthase (At3g01120)
            mRNA, complete cds.
          Length = 563

 Score =  416 bits (1068), Expect = e-115
 Identities = 200/231 (86%), Positives = 214/231 (92%)
 Frame = -1

Query: 930  RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
            RCVDIELVS++CH++G LVCIDGTFATPLNQKALALGADLV+HSATK+IGGHNDVLAGCI
Sbjct: 333  RCVDIELVSKICHKRGTLVCIDGTFATPLNQKALALGADLVVHSATKYIGGHNDVLAGCI 392

Query: 750  SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
             G  KLVS +RNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTA RMAE+LEAHPKV
Sbjct: 393  CGSLKLVSEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAHPKV 452

Query: 570  RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
              VYYPGLPSHPEH +AK+QMTGFGGVVSFEIDGD+ TT KFVD+LKIPYIAPSFGGCES
Sbjct: 453  SHVYYPGLPSHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGGCES 512

Query: 390  IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
            IVDQPAIMSYWDL Q ER  YGI DNLVRFSFGVEDFEDVKAD+LQALE I
Sbjct: 513  IVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI 563



>gb:AY091062_1574290 Arabidopsis thaliana putative cystathionine
            gamma-synthase (At3g01120) mRNA, complete cds.
          Length = 563

 Score =  414 bits (1064), Expect = e-114
 Identities = 199/231 (86%), Positives = 214/231 (92%)
 Frame = -1

Query: 930  RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
            RCVDIELVS++CH++G LVCIDGTFATPLNQKALALGADLV+HSATK+IGGHNDVLAGCI
Sbjct: 333  RCVDIELVSKICHKRGTLVCIDGTFATPLNQKALALGADLVVHSATKYIGGHNDVLAGCI 392

Query: 750  SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
             G  KLVS +RNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTA RMAE+LEAHPKV
Sbjct: 393  CGSLKLVSEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAHPKV 452

Query: 570  RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
              VYYPGLPSHPEH +AK+QMTGFGGVVSFEIDGD+ TT KFVD+LKIPYIAPSFGGCES
Sbjct: 453  SHVYYPGLPSHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGGCES 512

Query: 390  IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
            IVDQPAIMSYWDL Q ER  YGI DNLVRFSFGV+DFEDVKAD+LQALE I
Sbjct: 513  IVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVKDFEDVKADILQALEAI 563



>gb:AF039206_1763323 Arabidopsis thaliana cystathionine gamma-synthase
            precursor (CGS1) gene, nuclear gene encoding chloroplast
            protein, complete cds.
          Length = 563

 Score =  413 bits (1062), Expect = e-114
 Identities = 199/231 (86%), Positives = 213/231 (92%)
 Frame = -1

Query: 930  RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
            RCVDIELVS++CH++G LVCIDGTFATPLNQKALALGADLV+HSATK+IGGHNDVLAGCI
Sbjct: 333  RCVDIELVSKICHKRGTLVCIDGTFATPLNQKALALGADLVVHSATKYIGGHNDVLAGCI 392

Query: 750  SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
             G  KLVS +RNLHH+LGG LNPNAAYLIIRGMKTLHLRVQQQNSTA RMAE+LEAHPKV
Sbjct: 393  CGSLKLVSEIRNLHHVLGGPLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAHPKV 452

Query: 570  RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
              VYYPGLPSHPEH +AK+QMTGFGGVVSFEIDGD+ TT KFVD+LKIPYIAPSFGGCES
Sbjct: 453  SHVYYPGLPSHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGGCES 512

Query: 390  IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
            IVDQPAIMSYWDL Q ER  YGI DNLVRFSFGVEDFEDVKAD+LQALE I
Sbjct: 513  IVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI 563



>gb:ATU43709_1557011 Arabidopsis thaliana cystathionine-gamma-synthase
            (CGS1) mRNA, complete cds.
          Length = 563

 Score =  413 bits (1062), Expect = e-114
 Identities = 199/231 (86%), Positives = 213/231 (92%)
 Frame = -1

Query: 930  RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
            RCVDIELVS++CH++G LVCIDGTFATPLNQKALALGADLV+HSATK+IGGHNDVLAGCI
Sbjct: 333  RCVDIELVSKICHKRGTLVCIDGTFATPLNQKALALGADLVVHSATKYIGGHNDVLAGCI 392

Query: 750  SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
             G  KLVS +RNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTA RMAE+LEAHPKV
Sbjct: 393  CGSLKLVSEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAHPKV 452

Query: 570  RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
              VYYP LPSHPEH +AK+QMTGFGGVVSFEIDGD+ TT KFVD+LKIPYIAPSFGGCES
Sbjct: 453  SHVYYPALPSHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGGCES 512

Query: 390  IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
            IVDQPAIMSYWDL Q ER  YGI DNLVRFSFGVEDFEDVKAD+LQALE I
Sbjct: 513  IVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI 563



>pir|S71228|S71228 O-succinylhomoserine (thiol)-lyase (EC 4.2.99.9)
           1 - Arabidopsis thaliana
          Length = 311

 Score =  412 bits (1060), Expect = e-114
 Identities = 199/231 (86%), Positives = 213/231 (92%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           RCVDIELVS++CH++G LVCIDGTFATPLNQKALALGADLV+HSATK+IGGHNDVLAGCI
Sbjct: 81  RCVDIELVSKICHKRGTLVCIDGTFATPLNQKALALGADLVVHSATKYIGGHNDVLAGCI 140

Query: 750 SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
            G  KLVS +RNLHH+LGGTLNPNAAYLIIRGMKT HLRVQQQNSTA RMAE+LEAHPKV
Sbjct: 141 CGSLKLVSEIRNLHHVLGGTLNPNAAYLIIRGMKTGHLRVQQQNSTAFRMAEILEAHPKV 200

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
             VYYPGLPSHPEH +AK+QMTGFGGVVSFEIDGD+ TT KFVD+LKIPYIAPSFGGCES
Sbjct: 201 SHVYYPGLPSHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGGCES 260

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           IVDQPAIMSYWDL Q ER  YGI DNLVRFSFGVEDFEDVKAD+LQALE I
Sbjct: 261 IVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI 311



>pir|T12288|T12288 O-succinylhomoserine (thiol)-lyase (EC 4.2.99.9) -
            common ice plant>gb:AF069317_1765690 Mesembryanthemum
            crystallinum cystathionine gamma-synthase mRNA, complete
            cds.
          Length = 548

 Score =  409 bits (1051), Expect = e-113
 Identities = 194/231 (83%), Positives = 214/231 (92%)
 Frame = -1

Query: 930  RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
            RCVDI+LVS LCH+KGALVCIDGTFATPLNQKALALGAD V+HS TKFIGGHNDVL GCI
Sbjct: 318  RCVDIKLVSELCHKKGALVCIDGTFATPLNQKALALGADFVVHSMTKFIGGHNDVLGGCI 377

Query: 750  SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
            SG + L+S +R  HH+LGGTLNPNAAYL+IRGMKTLHLRVQQQN+TALRMAE+LEAHPKV
Sbjct: 378  SGSKNLISTIRTFHHVLGGTLNPNAAYLMIRGMKTLHLRVQQQNTTALRMAEILEAHPKV 437

Query: 570  RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
            + VYYPGLPSHPEH +AK+QMTGFGGVVSFE+DGDL+TTAKFVD+LKI YIAPSFGGCES
Sbjct: 438  KHVYYPGLPSHPEHKLAKRQMTGFGGVVSFEVDGDLLTTAKFVDSLKIAYIAPSFGGCES 497

Query: 390  IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
            IVDQPAIMSYWDL+ ++R  YGI DNLVRFSFGVEDFED+KADVLQALE I
Sbjct: 498  IVDQPAIMSYWDLSPSDRLKYGIKDNLVRFSFGVEDFEDLKADVLQALEAI 548



>gb:FVAJ1451_1679511 Fragaria vesca partial mRNA for putative
            cystathionine gamma synthase.>gb:FVY17185_1679527
            Fragaria vesca cgs gene, exons 1 to 11.
          Length = 545

 Score =  400 bits (1029), Expect = e-110
 Identities = 191/231 (82%), Positives = 211/231 (91%)
 Frame = -1

Query: 930  RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
            RCVDI LVS LCH KGA+VCI+GTFATP+NQKALALGADLV+HSATK++ GHNDVLAGCI
Sbjct: 315  RCVDINLVSDLCHSKGAVVCINGTFATPINQKALALGADLVVHSATKYLAGHNDVLAGCI 374

Query: 750  SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
            SG  KLVS +R LHHILGG LNPNAAYLIIRGMKTLH+R+QQQNSTALRMA++LEAHPKV
Sbjct: 375  SGSMKLVSEIRILHHILGGALNPNAAYLIIRGMKTLHIRIQQQNSTALRMAKILEAHPKV 434

Query: 570  RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
              VYYPGLPSHPEH +AK+QMTGFGGVVSFEIDGDL  T KF+DALKIPYIAPSFGGCES
Sbjct: 435  AHVYYPGLPSHPEHELAKRQMTGFGGVVSFEIDGDLKRTIKFIDALKIPYIAPSFGGCES 494

Query: 390  IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
            IVDQPAIMSYWDL+Q++R  YGI DNLVRFSFG+EDF D+KAD+LQALE I
Sbjct: 495  IVDQPAIMSYWDLSQSDRLKYGIKDNLVRFSFGIEDFNDLKADILQALEKI 545



>gb:AF144102_1771834 Solanum tuberosum cystathionine-gamma-synthase
            (CGS1) mRNA, complete cds.
          Length = 583

 Score =  400 bits (1028), Expect = e-110
 Identities = 194/231 (83%), Positives = 213/231 (92%)
 Frame = -1

Query: 930  RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
            RCVDIELVS+LC EKGALVCIDGTFATPLNQKALALGADLV+HSATKF+GGHNDVLAGCI
Sbjct: 310  RCVDIELVSKLCREKGALVCIDGTFATPLNQKALALGADLVVHSATKFLGGHNDVLAGCI 369

Query: 750  SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
            SGPEKLVSV+RNLHHILGG LNPNAAYL IRG    HLR   +    LRMAE+LEAHPKV
Sbjct: 370  SGPEKLVSVIRNLHHILGGALNPNAAYLAIRGRGLNHLRDSTKIQLHLRMAEILEAHPKV 429

Query: 570  RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
            + VYYPGLPSHPE+H+AKKQMTGFGGVVSFE+DGDL+TTAKFVDAL+IP IAPSF GC+S
Sbjct: 430  KHVYYPGLPSHPEYHLAKKQMTGFGGVVSFEVDGDLLTTAKFVDALRIPKIAPSFEGCKS 489

Query: 390  IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
            IVDQPAIMSYWDL+Q++RA YGI+DNLVRFSFGVEDFEDVKADVLQAL++I
Sbjct: 490  IVDQPAIMSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDVKADVLQALDSI 540



>gb:AF141602_1771586 Glycine max cystathionine-gamma-synthase
           precursor (cys) mRNA, complete cds; nuclear gene for
           chloroplast product.
          Length = 536

 Score =  400 bits (1028), Expect = e-110
 Identities = 191/231 (82%), Positives = 212/231 (91%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           RCVDI+LVS LCH+KG L+CIDGTFATPLNQKALALGADL+LHS TK++GGH+DVL GCI
Sbjct: 306 RCVDIKLVSELCHKKGTLLCIDGTFATPLNQKALALGADLILHSLTKYMGGHHDVLGGCI 365

Query: 750 SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
           SG  K+VS +R LHH+LGGTLNPNAAYL IRGMKTLHLRVQQQNST +RMA++LEAHPKV
Sbjct: 366 SGSIKVVSQIRTLHHVLGGTLNPNAAYLFIRGMKTLHLRVQQQNSTGMRMAKLLEAHPKV 425

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
           +RVYYPGLPSHPEH +AK+QMTGFGGVVSFEIDGDL TT KF+D+LKIPYIA SFGGCES
Sbjct: 426 KRVYYPGLPSHPEHELAKRQMTGFGGVVSFEIDGDLHTTIKFIDSLKIPYIAASFGGCES 485

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           IVDQPAI+SYWDL Q+ERA Y I DNLVRFSFGVEDFED+KADVLQALE I
Sbjct: 486 IVDQPAILSYWDLPQSERAKYKIYDNLVRFSFGVEDFEDLKADVLQALEAI 536



>gb:ATCYSKIN_1548045 A.thaliana ATCYS1, ORF1, ATHYP1 and AKIN10
           genes.
          Length = 224

 Score =  399 bits (1025), Expect = e-110
 Identities = 192/224 (85%), Positives = 206/224 (91%)
 Frame = -1

Query: 909 VSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISGPEKLV 730
           VS++CH++G LVCIDGTFATPLNQKALALGADLV+HSATK+IGGHNDVLAGCI G  KLV
Sbjct: 1   VSKICHKRGTLVCIDGTFATPLNQKALALGADLVVHSATKYIGGHNDVLAGCICGSLKLV 60

Query: 729 SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG 550
           S +RNLHH+LGG LNPNAAYLIIRGMKTLHLRVQQQNSTA RMAE+LEAHPKV  VYYPG
Sbjct: 61  SEIRNLHHVLGGPLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAHPKVSHVYYPG 120

Query: 549 LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI 370
           LPSHPEH +AK+QMTGFGGVVSFEIDGD+ TT KFVD+LKIPYIAPSFGGCESIVDQPAI
Sbjct: 121 LPSHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGGCESIVDQPAI 180

Query: 369 MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           MSYWDL Q ER  YGI DNLVRFSFGVEDFEDVKAD+LQALE I
Sbjct: 181 MSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI 224



>pir|S51579|S51579 cystathionine gamma-lyase (EC 4.4.1.1) 1 -
           Arabidopsis thaliana (fragment)
          Length = 224

 Score =  399 bits (1025), Expect = e-110
 Identities = 192/224 (85%), Positives = 206/224 (91%)
 Frame = -1

Query: 909 VSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISGPEKLV 730
           VS++CH++G LVCIDGTFATPLNQKALALGADLV+HSATK+IGGHNDVLAGCI G  KLV
Sbjct: 1   VSKICHKRGTLVCIDGTFATPLNQKALALGADLVVHSATKYIGGHNDVLAGCICGSLKLV 60

Query: 729 SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPG 550
           S +RNLHH+LGG LNPNAAYLIIRGMKTLHLRVQQQNSTA RMAE+LEAHPKV  VYYPG
Sbjct: 61  SEIRNLHHVLGGPLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAHPKVSHVYYPG 120

Query: 549 LPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAI 370
           LPSHPEH +AK+QMTGFGGVVSFEIDGD+ TT KFVD+LKIPYIAPSFGGCESIVDQPAI
Sbjct: 121 LPSHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGGCESIVDQPAI 180

Query: 369 MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           MSYWDL Q ER  YGI DNLVRFSFGVEDFEDVKAD+LQALE I
Sbjct: 181 MSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI 224



>gb:AF076495_1766183 Oryza sativa cystathionine gamma-synthase
           (CGS1) mRNA, partial cds; nuclear gene for chloroplast
           product.
          Length = 360

 Score =  365 bits (937), Expect = e-100
 Identities = 169/231 (73%), Positives = 202/231 (87%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           RC+DI+LVS++CH KGAL+CID TFA+P+NQKAL LGADLV+HSATK+I GHNDV+ GCI
Sbjct: 131 RCIDIDLVSKMCHSKGALLCIDSTFASPINQKALTLGADLVIHSATKYIAGHNDVIGGCI 190

Query: 750 SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
           SG ++LVS VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TA+RMA+ LE HPK+
Sbjct: 191 SGRDELVSKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTAMRMAQFLEEHPKI 250

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
            RVYYPGLPSHPEHHIAK QMTGFGGV+SFE+ GD   T +F+D++KIPY APSFGGCES
Sbjct: 251 ARVYYPGLPSHPEHHIAKSQMTGFGGVISFEVAGDFDATRRFIDSVKIPYHAPSFGGCES 310

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           I+DQPAIMSYWD ++ +R  YGI DNL+RFS GVEDFED+K DV+QAL+ I
Sbjct: 311 IIDQPAIMSYWD-SKEQREIYGIKDNLIRFSIGVEDFEDLKNDVVQALDKI 360



>gb:AC084766_1733766 Oryza sativa chromosome 3 BAC OSJNBb0048D20
           genomic sequence, complete sequence.
          Length = 446

 Score =  365 bits (937), Expect = e-100
 Identities = 169/231 (73%), Positives = 202/231 (87%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           RC+DI+LVS++CH KGAL+CID TFA+P+NQKAL LGADLV+HSATK+I GHNDV+ GCI
Sbjct: 217 RCIDIDLVSKMCHSKGALLCIDSTFASPINQKALTLGADLVIHSATKYIAGHNDVIGGCI 276

Query: 750 SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
           SG ++LVS VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TA+RMA+ LE HPK+
Sbjct: 277 SGRDELVSKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTAMRMAQFLEEHPKI 336

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
            RVYYPGLPSHPEHHIAK QMTGFGGV+SFE+ GD   T +F+D++KIPY APSFGGCES
Sbjct: 337 ARVYYPGLPSHPEHHIAKSQMTGFGGVISFEVAGDFDATRRFIDSVKIPYHAPSFGGCES 396

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           I+DQPAIMSYWD ++ +R  YGI DNL+RFS GVEDFED+K DV+QAL+ I
Sbjct: 397 IIDQPAIMSYWD-SKEQREIYGIKDNLIRFSIGVEDFEDLKNDVVQALDKI 446



>pir|T02940|T02940 O-succinylhomoserine (thiol)-lyase (EC 4.2.99.9)
           1 - maize>gb:AF007785_1760931 Zea mays cystathionine
           gamma-synthase (CGS1) mRNA, complete cds.
          Length = 509

 Score =  364 bits (934), Expect = 2e-99
 Identities = 171/231 (74%), Positives = 199/231 (86%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           RC+DIE VS +CH KGAL+CID TFA+P+NQKAL LGADLV+HSATK+I GHNDV+ GC+
Sbjct: 280 RCIDIEHVSNMCHSKGALLCIDSTFASPINQKALTLGADLVIHSATKYIAGHNDVIGGCV 339

Query: 750 SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
           SG ++LVS VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN TALRMA+ LE HPK+
Sbjct: 340 SGRDELVSKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNDTALRMAQFLEEHPKI 399

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
            RVYYPGLPSHPEHHIAK QMTGFGGVVSFE+ GD   T KF+D++KIPY APSFGGCES
Sbjct: 400 ARVYYPGLPSHPEHHIAKSQMTGFGGVVSFEVAGDFDATRKFIDSVKIPYHAPSFGGCES 459

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           I+DQPAIMSYWD ++ +R  YGI DNL+RFS GVEDFED+K D++QALE I
Sbjct: 460 IIDQPAIMSYWD-SKEQRDIYGIKDNLIRFSIGVEDFEDLKNDLVQALEKI 509



>pir|T02942|T02942 O-succinylhomoserine (thiol)-lyase (EC 4.2.99.9)
           1 - maize>gb:AF007786_1760932 Zea mays cystathionine
           gamma-synthase (CGS1) gene, complete cds.
          Length = 509

 Score =  360 bits (925), Expect = 2e-98
 Identities = 170/231 (73%), Positives = 199/231 (86%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           RC+DIE VS +CH KGAL+CID TFA+P+NQKAL LGADLV+HSATK+I GHNDV+ GC+
Sbjct: 280 RCIDIEHVSNMCHSKGALLCIDSTFASPINQKALTLGADLVIHSATKYIAGHNDVIGGCV 339

Query: 750 SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
           SG ++LVS VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TALRMA+ LE H K+
Sbjct: 340 SGRDELVSKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTALRMAQFLEEHLKI 399

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
            RVYYPGLPSHPEHHIAK QMTGFGGVVSFE+ GD   T KF+D++KIPY APSFGGCES
Sbjct: 400 ARVYYPGLPSHPEHHIAKSQMTGFGGVVSFEVAGDFDATRKFIDSVKIPYHAPSFGGCES 459

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           I+DQPAIMSYWD ++ +R  YGI DNL+RFS GVEDFED+K D++QALE I
Sbjct: 460 IIDQPAIMSYWD-SKEQRDIYGIKDNLIRFSIGVEDFEDLKNDLVQALEKI 509



>gb:AC027035_1539799 Arabidopsis thaliana chromosome 1 BAC T16O9
           genomic sequence, complete sequence.
          Length = 412

 Score =  359 bits (921), Expect = 5e-98
 Identities = 174/231 (75%), Positives = 199/231 (86%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           RCVDI+LVS++CH +G LVCID T ATP+NQK LALGADLV HSATK+IGGHND LAG I
Sbjct: 183 RCVDIKLVSKICHRRGTLVCIDATIATPINQKTLALGADLVHHSATKYIGGHNDFLAGSI 242

Query: 750 SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
           SG  +LVS +RNLH +LGGTLNPNAAYL+IRGMKT+HLRV+QQNST ++MA+VLEAHPKV
Sbjct: 243 SGSMELVSKIRNLHKLLGGTLNPNAAYLLIRGMKTMHLRVRQQNSTGMKMAQVLEAHPKV 302

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
            RVYY GLPSHPEH IAK+QMTG GG++SFEIDGDL TT KF+DALKIPY+A SFGGCES
Sbjct: 303 SRVYYLGLPSHPEHLIAKRQMTGIGGLISFEIDGDLKTTIKFIDALKIPYLAASFGGCES 362

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           +VDQ A    WD+ + ER   G  DNLVRFSFG+EDFED+KADVLQALETI
Sbjct: 363 LVDQLA-TGIWDIPREERLKDGFQDNLVRFSFGIEDFEDIKADVLQALETI 412



>pir|H86456|H86456 probable cystathionine gamma-synthase F10C21.1 -
           Arabidopsis thaliana>gb:AE005172_892148 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC051630_1540086 Arabidopsis thaliana
           chromosome 1 BAC F10C21 genomic sequence, complete
           sequence.
          Length = 373

 Score =  359 bits (921), Expect = 5e-98
 Identities = 174/231 (75%), Positives = 199/231 (86%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           RCVDI+LVS++CH +G LVCID T ATP+NQK LALGADLV HSATK+IGGHND LAG I
Sbjct: 144 RCVDIKLVSKICHRRGTLVCIDATIATPINQKTLALGADLVHHSATKYIGGHNDFLAGSI 203

Query: 750 SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
           SG  +LVS +RNLH +LGGTLNPNAAYL+IRGMKT+HLRV+QQNST ++MA+VLEAHPKV
Sbjct: 204 SGSMELVSKIRNLHKLLGGTLNPNAAYLLIRGMKTMHLRVRQQNSTGMKMAQVLEAHPKV 263

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
            RVYY GLPSHPEH IAK+QMTG GG++SFEIDGDL TT KF+DALKIPY+A SFGGCES
Sbjct: 264 SRVYYLGLPSHPEHLIAKRQMTGIGGLISFEIDGDLKTTIKFIDALKIPYLAASFGGCES 323

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           +VDQ A    WD+ + ER   G  DNLVRFSFG+EDFED+KADVLQALETI
Sbjct: 324 LVDQLA-TGIWDIPREERLKDGFQDNLVRFSFGIEDFEDIKADVLQALETI 373



>gb:AE016959_1022449 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC021891_1538759
           Genomic Sequence For Oryza sativa, Nipponbare Strain,
           Chromosome X, Clone OSJNBa0050N08, complete
           sequence.>gb:AE017091_1752268 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 45 of 77 of the
           complete sequence.
          Length = 472

 Score =  309 bits (792), Expect = 4e-83
 Identities = 146/231 (63%), Positives = 182/231 (78%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           + VD+  V+ LCH +GALVCID T A+P+NQK LALGAD+VLHSATK+I GH+DV+AGC+
Sbjct: 242 KVVDVARVAELCHRRGALVCIDSTLASPINQKPLALGADVVLHSATKYIAGHHDVIAGCV 301

Query: 750 SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
           SG E L+S +R  HH LGG ++PNAAY+IIRG+KTL LRV+ QN TALRMA +LE HPK+
Sbjct: 302 SGSEALISRIRAWHHDLGGAISPNAAYMIIRGLKTLALRVEAQNRTALRMARLLEKHPKI 361

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
            RVYYPGL S P H +A +QM G GGVVSFE+  D+    +FVDAL++P IA S GGCES
Sbjct: 362 ERVYYPGLESSPWHGVATRQMAGAGGVVSFEVASDMRGVMRFVDALELPLIATSLGGCES 421

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           +V QPA+MSYW  ++ E+A  GI DN VRFSFG+E FED++ D+LQALE I
Sbjct: 422 LVQQPAVMSYWGKSEEEKAKNGIKDNFVRFSFGIEKFEDLRDDILQALEKI 472



>gb:AE016959_1022448 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC021891_1538758
           Genomic Sequence For Oryza sativa, Nipponbare Strain,
           Chromosome X, Clone OSJNBa0050N08, complete
           sequence.>gb:AE017091_1752267 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 45 of 77 of the
           complete sequence.
          Length = 508

 Score =  305 bits (780), Expect = 1e-81
 Identities = 146/231 (63%), Positives = 178/231 (77%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           + VD+  V+ LCH +GALVCID T A+P+NQK LALGAD+VLHSATK+I GH+DV+AGC+
Sbjct: 278 KVVDVTRVAELCHRRGALVCIDSTLASPINQKPLALGADVVLHSATKYIAGHHDVIAGCV 337

Query: 750 SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
           SG E LVS +R  HH LGG ++PNAAY+IIRG+KTL LRVQ QN TALRMA++LE HPK+
Sbjct: 338 SGSEALVSRIRTWHHDLGGAISPNAAYMIIRGLKTLALRVQAQNRTALRMAQLLEKHPKI 397

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
            RVYYPGL S P H +A +QM G GGVV  E+  D+    +FVDAL++P IA S GGCES
Sbjct: 398 ERVYYPGLESSPWHGVATRQMAGAGGVVGLEVASDMRGAMRFVDALELPLIATSLGGCES 457

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           +V QPAIMSYW     E+A  GI DN VRFSFG+E FED++ D+LQAL  I
Sbjct: 458 LVQQPAIMSYWGKCDEEKAKNGIKDNFVRFSFGIEKFEDLRDDILQALGKI 508



>gb:AE016959_1022454 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC021891_1538764
           Genomic Sequence For Oryza sativa, Nipponbare Strain,
           Chromosome X, Clone OSJNBa0050N08, complete
           sequence.>gb:AE017091_1752273 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 45 of 77 of the
           complete sequence.
          Length = 486

 Score =  304 bits (779), Expect = 1e-81
 Identities = 144/231 (62%), Positives = 181/231 (78%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           + VD+  V+ LCH +GALVCID T A+P+NQK LALGAD+VLHSATK+I GH+DV+AGC+
Sbjct: 256 KVVDVTRVAELCHRRGALVCIDSTLASPINQKPLALGADVVLHSATKYIAGHHDVIAGCV 315

Query: 750 SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
           SG E L+S +R  HH LGG ++PNAAY+IIRG+KT+ LRV+ QN TALRMA +LE HPK+
Sbjct: 316 SGSEALISRIRAWHHDLGGAISPNAAYMIIRGLKTIALRVEAQNRTALRMARLLEKHPKI 375

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
            RVYYPGL S   H +A +QM G GGVVSF++  DL    +FVDAL++P IA S GGCES
Sbjct: 376 ERVYYPGLESSLWHGVATRQMAGAGGVVSFDVASDLRGVMRFVDALELPLIATSLGGCES 435

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           +V QPA+MSYW  ++ E+A  GI DN VRFSFG+E FED++ D+LQALE I
Sbjct: 436 LVQQPAVMSYWGKSEEEKAKNGIKDNFVRFSFGIEKFEDLRDDILQALEKI 486



>gb:AP004862_1846153 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0001B11.
          Length = 425

 Score =  245 bits (625), Expect = 1e-63
 Identities = 131/240 (54%), Positives = 165/240 (68%), Gaps = 9/240 (3%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGH------ND 769
           +CVD+  V+ LCH++GALVCID T A+P+NQK L LGAD+VLHS  + IG         D
Sbjct: 186 KCVDVRRVAELCHQRGALVCIDSTLASPINQKPLTLGADVVLHSHHQVIGAGWETPWVTD 245

Query: 768 VLAGCISGPEKLVSV-VRNLHHILGGTLNPN--AAYLIIRGMKTLHLRVQQQNSTALRMA 598
              G   G      V + +    L   L+P    AY+IIRG+KT+ LRV+ QN TALR+A
Sbjct: 246 FTTGMGVGFLNWHPVDITSARGRLWTPLSPPDLEAYMIIRGLKTMALRVEAQNRTALRVA 305

Query: 597 EVLEAHPKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYI 418
            +LE HPKV RV YP L S P H +A+KQMTG GGV+SFE+  D+    +FVDAL++P+I
Sbjct: 306 RLLERHPKVERVNYPWLESSPWHGVARKQMTGAGGVISFEVASDMRGAMRFVDALELPFI 365

Query: 417 APSFGGCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           A S GGCES+V QPAIMSYW  ++AE+   GI DNLVRFSFG+E FED+K D+LQALE I
Sbjct: 366 ATSLGGCESLVQQPAIMSYWGKSEAEKTENGIKDNLVRFSFGIEKFEDLKDDILQALEKI 425



>gb:BX294144_768602 Pirellula sp. strain 1 complete genome; segment
           12/24.
          Length = 434

 Score =  233 bits (594), Expect = 4e-60
 Identities = 117/231 (50%), Positives = 156/231 (67%), Gaps = 1/231 (0%)
 Frame = -1

Query: 927 CVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCIS 748
           CVD+E    L         ID T ATP+N + L  G D V HSATK++GGHND+LAG IS
Sbjct: 204 CVDLEQFVALGKAHEIETLIDATLATPMNVRPLDHGVDYVWHSATKYLGGHNDLLAGVIS 263

Query: 747 GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVR 568
           G ++L+  +R L   LG   +P++ YL+ RG+KT  LR+Q+ N     +AE L  HPK+ 
Sbjct: 264 GRKELLDPIRALRGCLGSVTSPHSMYLLERGLKTFSLRMQRHNENGQAVAEFLHQHPKID 323

Query: 567 RVYYPGLPSHPEHHIAKKQMTGFGGVVSFEI-DGDLMTTAKFVDALKIPYIAPSFGGCES 391
           RVYYPGLPSHP H IAK+QM G+GG+++F + D D  TT++ VDA KI  IAPS GG ES
Sbjct: 324 RVYYPGLPSHPTHAIAKEQMLGYGGLITFTVKDADWKTTSRVVDAAKIARIAPSLGGTES 383

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           +++QP +MSY+  +  ERA +GI DN++RFS G+ED  D+ AD+ QAL  I
Sbjct: 384 LIEQPLVMSYFHYSPEERACFGIADNMIRFSCGIEDSADLIADLDQALAAI 434



>pir|H83866|H83866 cystathionine gamma-lyase BH1736 [imported] -
           Bacillus halodurans (strain C-125)>gb:BA000004_655682
           Bacillus halodurans C-125 DNA, complete genome.
          Length = 398

 Score =  222 bits (566), Expect = 7e-57
 Identities = 112/231 (48%), Positives = 152/231 (65%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           +  D+E ++   HE  ALV +D TFATP+NQ  L  GADLV+HSATKF+GGH D L G  
Sbjct: 167 KITDLERITSFAHEHNALVFVDNTFATPINQNPLLTGADLVVHSATKFLGGHADALGGVA 226

Query: 750 SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
            G ++LVS + +   I G TL+P AAYL++RGMKTL LRV++Q   A+++A  L  H KV
Sbjct: 227 CGNKELVSAIYHYREINGATLDPMAAYLLLRGMKTLKLRVEKQQENAMKVARFLTEHDKV 286

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
           R VYYPGL +HP H +AK+QM GFGG++SF + G++    KF+ AL     A + G  E+
Sbjct: 287 RAVYYPGLETHPHHEVAKRQMRGFGGMLSFALKGEMEAVRKFLPALTYANRAANLGAVET 346

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
            V      S+ + T  ERAA GI + LVR+S G+ED  D+  D+ QAL++I
Sbjct: 347 TVGPARTTSHVENTPEERAALGIPEGLVRYSAGIEDAVDLIEDLSQALDSI 397



>pir|H90407|H90407 hypothetical protein metB [imported] - Sulfolobus
           solfataricus>gb:AE006838_223133 Sulfolobus solfataricus
           P2 section 197 of 272 of the complete
           genome.>gb:AE006641_1108981 Sulfolobus solfataricus P2,
           complete genome.
          Length = 376

 Score =  219 bits (558), Expect = 6e-56
 Identities = 106/231 (45%), Positives = 161/231 (69%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R +D+  +S++  E+G+++ +D TF+TP+NQK L LGAD+V+HSA+KF+ GHNDV+AG  
Sbjct: 145 RVIDVAELSKVAKEQGSILIVDATFSTPINQKPLELGADIVVHSASKFLAGHNDVIAGLA 204

Query: 750 SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
           +G  K ++V+  +   LG +L+P+AAYL +RG+KTL +R+   N  A ++AE LE HPKV
Sbjct: 205 AGYSKYLNVIDQMRRTLGTSLDPHAAYLTLRGIKTLKIRMDVINRNAEQIAEFLEGHPKV 264

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
            +VYYPGL SH ++ IA+K + GFGGV+SFE++G   +  K + +LK+   A + GG  S
Sbjct: 265 VKVYYPGLKSHVDYDIARKVLKGFGGVLSFEVNGGQESALKVMKSLKLIIPAQTLGGVNS 324

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           ++  PA MS+  L+  ER   GI D+L+R S G+ED  D+  D+ +AL T+
Sbjct: 325 VISHPATMSHRTLSLEERKIVGITDSLLRLSVGIEDVNDLIEDLDRALSTL 375



>gb:AY616087_1178730 Prototheca wickerhamii plastid cystathionine
           gamma-synthase mRNA, partial cds; nuclear gene for
           plastid product.
          Length = 197

 Score =  216 bits (550), Expect = 5e-55
 Identities = 102/156 (65%), Positives = 127/156 (81%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           RCVDI  +  LC  +GA V ID TFATP+NQ+ALALGADLVLHSATK++ GHNDVLAG I
Sbjct: 41  RCVDIPRIKALCEPRGAAVVIDSTFATPINQRALALGADLVLHSATKYLSGHNDVLAGAI 100

Query: 750 SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
           +G   LV+ VR +H++LGG ++P+AAYL++RGMKTL LRV + N+TA  +AE L  HP+V
Sbjct: 101 AGRSDLVASVRAMHNVLGGVMDPHAAYLLLRGMKTLDLRVGRANATAQLLAERLSEHPRV 160

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDL 463
            RV+YPGLPSHP+HHIA +QM G+GGVVSFE+ GDL
Sbjct: 161 ARVHYPGLPSHPDHHIALRQMDGYGGVVSFEVAGDL 196



>gb:BA000023_691084 Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 377

 Score =  214 bits (546), Expect = 1e-54
 Identities = 104/231 (45%), Positives = 156/231 (67%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R +DI  +S++C E G+L+  D TF+TP+NQK L  GAD+VLHSA+KFI GHNDV+AG  
Sbjct: 146 RVIDIPALSKICKENGSLLITDATFSTPINQKPLVQGADIVLHSASKFIAGHNDVIAGLG 205

Query: 750 SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
           +G ++L++ V  +   LG +L+P+AAYL+IRG+KTL +R+   NS A ++AE L+ H K+
Sbjct: 206 AGSKELMTKVDLMRRTLGTSLDPHAAYLVIRGIKTLKIRMDVINSNAQKIAEYLQEHNKI 265

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
           + VYYPGL SHP++  A++ + G+GGVV+FEI G +      +   K+   A + GG  S
Sbjct: 266 KSVYYPGLKSHPDYETARRILKGYGGVVTFEIKGSMNDALNLITRFKVILPAQTLGGVNS 325

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
            +  PA M++  LT  ER   GI D+++R S G+ED  D+  D+ +AL ++
Sbjct: 326 TISHPATMTHRTLTPEERKIIGISDSMLRLSVGIEDVNDLIEDLDKALTSL 376



>gb:AE017340_455984 Idiomarina loihiensis L2TR, complete genome.
          Length = 390

 Score =  209 bits (532), Expect = 6e-53
 Identities = 103/232 (44%), Positives = 155/232 (66%), Gaps = 4/232 (1%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGA--LVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG 757
           + VDIE + +L  +K    +V +D TFATP NQ+ L +GAD+V+HSATK++ GH+D++ G
Sbjct: 156 KLVDIEAIVKLAKKKNPDIIVVVDNTFATPFNQRPLEMGADMVMHSATKYLNGHSDMVGG 215

Query: 756 C--ISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEA 583
              +   + LV  +  L +  G    P  +YL +RG+KTL LR++  N  A+ +A+ LE 
Sbjct: 216 IAVVGDNDDLVERMLFLQNSAGAIAGPFDSYLALRGVKTLALRMRHHNEAAMELAKWLEQ 275

Query: 582 HPKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFG 403
           HPKV +V YPGL SHP+H +AKKQM GFGG++S  + GDL    KF++++++  +A S G
Sbjct: 276 HPKVEKVIYPGLESHPQHELAKKQMQGFGGMISILLKGDLEAARKFLESVEVFALAESLG 335

Query: 402 GCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           G ES+++ PAIM++  + +  R   GI+DN VR S G+ED +D+KAD+  AL
Sbjct: 336 GVESLIEHPAIMTHASVPKENREKLGILDNFVRVSVGIEDLDDLKADLDNAL 387



>gb:AE016776_330098 Pseudomonas putida KT2440 section 3 of 21 of the
           complete genome.>gb:AE015451_945175 Pseudomonas putida
           KT2440 complete genome.
          Length = 423

 Score =  207 bits (527), Expect = 2e-52
 Identities = 108/231 (46%), Positives = 148/231 (64%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           + +DI  +S   H+ GALV  D TFATPLNQ  LALG D+V+HSATKF+ GH DVL G +
Sbjct: 170 KVLDIRRLSAAAHKVGALVVADNTFATPLNQNPLALGVDVVVHSATKFLSGHGDVLGGVV 229

Query: 750 SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
            G E L++ VR+   I G  L+P +AYLIIRG+KTL +R++QQ ++A+ +A  L   P V
Sbjct: 230 CGAEALMAQVRHYREINGAALDPFSAYLIIRGIKTLAVRLRQQQASAMALAHYLSTEPLV 289

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
             V YPGLP+H  H IAK QM GFG +VSF + G + T A+ +  LK  + A + G  E+
Sbjct: 290 EAVNYPGLPAHAGHAIAKAQMRGFGAIVSFVLKGGMPTVARLLPRLKYAHRAGNLGAVET 349

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           I       S+ + T  ER A GI + LVR S G+E+ +D+ AD+ QA  ++
Sbjct: 350 IYGPARTTSHVENTLEERLALGISEGLVRISVGIEETDDLLADLAQACASV 400



>gb:CR555306_108009 Azoarcus sp. EbN1 complete genome.
          Length = 402

 Score =  205 bits (522), Expect = 9e-52
 Identities = 104/224 (46%), Positives = 147/224 (65%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISGP 742
           D+E V+ L   +G L   D TFA+PLNQK  ALG D+V+HSATK++GGH+D++AG +   
Sbjct: 175 DLEAVAALGRSRGILTVADNTFASPLNQKPHALGIDIVVHSATKYLGGHHDLMAGAVCCS 234

Query: 741 EKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRV 562
           E L   +  +H  LG  L+P  A+L++RG++TL +R+++ N+TAL  A  LEA P+V +V
Sbjct: 235 EALAERIWRMHVTLGAVLSPMDAWLLLRGLRTLPVRIERINATALAFAGWLEAQPQVEQV 294

Query: 561 YYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVD 382
           +YPGL SHP+H +AKKQM G+G V++F + G    T +FV AL++     S GG ES+V 
Sbjct: 295 FYPGLESHPQHALAKKQMKGYGAVIAFAVKGGFDATRRFVAALELATHGVSLGGVESLVV 354

Query: 381 QPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQA 250
             A M    + +A+  A GI  N VR S G+E  ED+KAD  QA
Sbjct: 355 HTAAMWSGTMNEAQMKAAGIAPNFVRLSIGLEHLEDLKADFSQA 398



>gb:AB077041_10132 Fusobacterium nucleatum mg1 gene for
           L-methionine-alpha-deamino-gamma-mercaptomethane-lyase,
           complete cds.
          Length = 395

 Score =  204 bits (520), Expect = 2e-51
 Identities = 107/234 (45%), Positives = 146/234 (62%), Gaps = 3/234 (1%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEK-GALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC 754
           + VD+E +S+L H     LV +D TFATP  QK L LGAD+V+HS TK+I GH DV+AG 
Sbjct: 162 KIVDLEALSKLAHTNPNTLVIVDNTFATPYMQKPLKLGADIVVHSVTKYINGHGDVIAGL 221

Query: 753 ISGPEKLVSVVR--NLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH 580
           +   ++L   +R   L  + G  L P  AY IIRGMKT  +R+++    A ++ E L  H
Sbjct: 222 VITNKELADQIRFIGLKDMTGAVLGPQDAYYIIRGMKTFEIRMERHCKNAKKVVEFLNKH 281

Query: 579 PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG 400
           PK+ RVYYPGL +HP H IAKKQM  FG ++SFE+ G        ++ LK+  +A S G 
Sbjct: 282 PKIERVYYPGLETHPGHEIAKKQMKDFGAMISFELKGGFEAGKTLLNNLKLCSLAVSLGD 341

Query: 399 CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
            E+++  PA M++   T+ ER A GI D LVR S G+E+ ED+ AD+ Q LE I
Sbjct: 342 TETLIQHPASMTHSPYTKEEREAAGITDGLVRLSVGLENVEDIIADLEQGLEKI 395



>gb:AE012841_286180 Chlorobium tepidum TLS section 62 of 194 of the
           complete genome.>gb:AE006470_933348 Chlorobium tepidum
           TLS complete genome.
          Length = 380

 Score =  204 bits (518), Expect = 3e-51
 Identities = 102/229 (44%), Positives = 150/229 (65%), Gaps = 1/229 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI-SG 745
           DI  ++ + +E+G ++ +D TFA+P  Q+ L LGA +V+HS TK++GGH+DV+ G + + 
Sbjct: 152 DIRALAEIANERGIVLAVDNTFASPYFQRPLDLGAHIVVHSTTKYLGGHSDVIGGAVVAS 211

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
            + L   +RN     G    P   +LI RG+KTL +R+++    AL +A  LE HP V R
Sbjct: 212 DDNLNLTIRNYQGAAGAIPGPWDCWLISRGIKTLKIRMEEHQKNALHLARALEKHPAVSR 271

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           V YPGL SHP+H +AK+QM+GFGG+++  + G L    K +++LK+  IA S GG ES+V
Sbjct: 272 VIYPGLESHPQHELAKRQMSGFGGMLTIALKGGLPAVRKMIESLKLFVIADSLGGVESLV 331

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
             PA M+   L+QAER      D+LVR S G+E+ ED++AD+LQAL TI
Sbjct: 332 ASPARMTLGPLSQAERDRRACTDDLVRLSIGLENAEDLEADLLQALATI 380



>gb:AP006627_566253 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 402

 Score =  203 bits (517), Expect = 3e-51
 Identities = 102/230 (44%), Positives = 155/230 (67%), Gaps = 1/230 (0%)
 Frame = -1

Query: 924 VDIELVSRLCHEKG-ALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCIS 748
           VDI  V+ L HE+  A+  +D TFATP NQK L  GAD+V+HSATK++GGH+DV+AG  +
Sbjct: 173 VDISKVATLVHEQSDAVFVVDSTFATPYNQKPLKHGADIVVHSATKYLGGHSDVVAGVCA 232

Query: 747 GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVR 568
           G  +L+  VR+ +   G  L+P  A+L+ RG++TL LR+++ N  AL++A+ LE HPK+R
Sbjct: 233 GSTELIDKVRHKYSFHGPHLDPFGAWLLCRGIRTLGLRMEKHNENALKLAQFLETHPKIR 292

Query: 567 RVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESI 388
           +V+YP   SHP++ +A KQMTG GG++ FE+   +      +  +K+  +A S GG  S 
Sbjct: 293 QVFYPFSESHPQYKLATKQMTGGGGMICFELKDGMDGGLGLISNVKLNKMAVSLGGYAST 352

Query: 387 VDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           +  PA M++  L + ER   GI D ++RFS G+E++ED++ D+ QAL+ I
Sbjct: 353 ITHPASMTHNLLPREEREKGGITDGMIRFSVGIEEYEDIRDDLSQALDKI 402



>gb:BA000028_697336 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 401

 Score =  203 bits (516), Expect = 4e-51
 Identities = 101/231 (43%), Positives = 146/231 (63%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           +  D++ ++ +    GA+V +D TF TP+NQ  LALGADLV+HSATKF+GGH D L G +
Sbjct: 164 KITDLKKMAEVGKRAGAIVIVDNTFGTPINQNPLALGADLVIHSATKFLGGHADALGGVV 223

Query: 750 SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
            GPE  V  + +   I G T++P AAYL +RGMKTLHLRV++Q+  A+++A+ L+    V
Sbjct: 224 CGPEDYVEQIYHFREINGATMDPMAAYLTLRGMKTLHLRVREQSFNAMQLAKFLQQQDIV 283

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
             V+YPGL +HP H IAK+QM  FGG++SF + G + T  + +  L+  + A + G  E+
Sbjct: 284 EEVFYPGLTTHPNHDIAKEQMKDFGGMLSFSVKGGVDTVRELLPKLQYAHRAANLGAVET 343

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
            V      S+ + T  ERAA GI + L+R S G+E  +D+  D  QA   I
Sbjct: 344 TVGPARTTSHVECTPEERAAMGIPEGLIRVSCGIEYIDDILEDFAQAFAHI 394



>gb:AY662340_1620461 Medicago sativa cystathionine gamma synthase
           mRNA, partial cds.
          Length = 203

 Score =  200 bits (509), Expect = 3e-50
 Identities = 94/117 (80%), Positives = 107/117 (91%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           RCVDI+LVS LCH+KG L+CIDGTFATPLNQKALALGADL+LHS TK++GGH+DVL GCI
Sbjct: 87  RCVDIKLVSELCHKKGTLLCIDGTFATPLNQKALALGADLILHSLTKYMGGHHDVLGGCI 146

Query: 750 SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH 580
           SG  K+VS +R LHH+LGGTLNPNAAYL IRGMKTLHLRVQQQNST +RMA++LEAH
Sbjct: 147 SGSIKVVSQIRTLHHVLGGTLNPNAAYLFIRGMKTLHLRVQQQNSTGMRMAKLLEAH 203



>gb:BX572594_799987 Rhodopseudomonas palustris CGA009 complete
           genome; segment 2/16.
          Length = 394

 Score =  200 bits (509), Expect = 3e-50
 Identities = 99/230 (43%), Positives = 151/230 (65%), Gaps = 2/230 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R VDI   + +C    A + +D T+ TP  Q+ L LGADLV HSATK++GGH D+LAG +
Sbjct: 165 RLVDIAACAEICRRADARLVVDNTYCTPYLQRPLDLGADLVTHSATKYLGGHGDLLAGAV 224

Query: 750 SGPEKLVSVVR--NLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
            GP++++  VR   +  + G  ++   A+LI+RG+KTL+LR+ + ++TA+++A  LEAHP
Sbjct: 225 VGPKEIIDQVRFVGVKELNGACISAFDAFLILRGLKTLNLRMDRHSATAVKLAHDLEAHP 284

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
            V  VYYPGL SH + ++A++QM   GG+++ E+ G L     F+D +K+   A S G  
Sbjct: 285 AVAAVYYPGLDSHKQRNLAQRQMRQPGGMIALELRGGLAAGRSFMDKVKLATRAVSLGDA 344

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           E+++  PA M++     AERA +G  D L+R S G+ED+ED+K D+L AL
Sbjct: 345 ETLIQHPASMTHATYDPAERARHGFTDGLIRISVGLEDYEDLKQDLLGAL 394



>pir|A72595|A72595 probable cystathionine gamma-lyase APE1226 -
           Aeropyrum pernix (strain K1)>gb:BA000002_651959
           Aeropyrum pernix K1 DNA, complete genome.
          Length = 384

 Score =  200 bits (508), Expect = 4e-50
 Identities = 98/230 (42%), Positives = 152/230 (66%), Gaps = 1/230 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           +  DI   + +    GA + +D TFATP  Q+ L LGAD+V+HSATK++ GH+D+LAG +
Sbjct: 153 KLTDIRAAAEIASRAGAYLVVDNTFATPYFQRPLELGADIVVHSATKYLSGHSDLLAGAV 212

Query: 750 S-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
                ++   ++   + +G    P  +YL++R +KTL LR++     A+++AE LE+HPK
Sbjct: 213 MVNSSEVYEKLKYHQNAVGAVPPPLDSYLLMRSLKTLALRMEWHQHNAMKIAEHLESHPK 272

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V RV YPGL +HP+H +AK+QMTG+ G++SFE+ G      +FV++L+I  +A S GG E
Sbjct: 273 VDRVIYPGLSTHPQHSLAKRQMTGYSGMLSFELKGGAGAAVRFVESLRIIALAESLGGVE 332

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           S+V+ P++M++  + + ER   GI D LVR S G+ED ED+  D+ QAL+
Sbjct: 333 SLVEIPSLMTHASIPREERLKKGITDGLVRLSVGIEDLEDLIEDIEQALK 382



>gb:AY052787_586931 Marinomonas mediterranea putative cystathionine
           gamma-synthase gene, partial cds; putative LysR-type
           transcriptional regulator gene, complete cds; tyrosinase
           operon, complete sequence; and putative ammonium
           transporter gene, partial cds.
          Length = 215

 Score =  199 bits (507), Expect = 5e-50
 Identities = 104/215 (48%), Positives = 138/215 (64%)
 Frame = -1

Query: 882 ALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISGPEKLVSVVRNLHHI 703
           A+V  D TFATPLNQ  L LG D+VLHSATKF+ GH D + G   G E L+S VR+   I
Sbjct: 1   AIVVADNTFATPLNQSPLTLGVDVVLHSATKFLSGHADAMGGVACGAESLMSQVRHYREI 60

Query: 702 LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHI 523
            G +L+P +AYLIIRG+KTL LR++QQ ++A+ +AE L+  P V  V YPGLP+H  H I
Sbjct: 61  NGASLDPFSAYLIIRGIKTLALRMRQQQASAMALAEYLQTEPLVEAVNYPGLPTHTGHEI 120

Query: 522 AKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQA 343
           AK QM GFG +VSF + G + T  K +  L+  + A + G  E+I       S+ + T  
Sbjct: 121 AKAQMKGFGAIVSFVLKGGMETVTKLLPKLQFAHCAGNLGAVETIYGPARTTSHVENTLE 180

Query: 342 ERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           ER A GI + LVR S G+ED ED+ AD+ QA  ++
Sbjct: 181 ERLALGISEGLVRISVGIEDTEDLVADLKQAFASL 215



>gb:AE016966_369202 Coxiella burnetii strain RSA 493, section 7 of 7
           of the complete genome.>gb:AE016828_1009938 Coxiella
           burnetii strain RSA 493, complete genome.
          Length = 387

 Score =  199 bits (505), Expect = 8e-50
 Identities = 97/230 (42%), Positives = 151/230 (65%), Gaps = 2/230 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG-C 754
           + VD+  ++ +  EK  +   D TFATP+ Q+ L LG D+V HSATK++ GH+D++ G  
Sbjct: 158 KIVDLAKIAEIAKEKNIIAVADNTFATPIIQRPLELGFDIVTHSATKYLNGHSDIIGGVA 217

Query: 753 ISGPEK-LVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
           + G  K L   ++ L + +G    P  +++++RG+KTL +R+++    A+++A+ LE HP
Sbjct: 218 VVGDNKTLAEQLKYLQNAIGAIAAPFDSFMVLRGLKTLAIRMERHCENAMQLAQWLEKHP 277

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
           KV+RVYYPGLPSHP+H IAKKQM  FGG++S E+  DL  T K ++  ++  +A S GG 
Sbjct: 278 KVKRVYYPGLPSHPQHSIAKKQMRYFGGMISVELKCDLNETKKVLERCQLFTLAESLGGV 337

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           ES+++ PAIM++  + QAER   GI D  +R S G+E   D++ D+  AL
Sbjct: 338 ESLIEHPAIMTHASIPQAERQKLGITDGFIRLSVGIEAITDLRHDLEAAL 387



>gb:AP006627_562348 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 399

 Score =  198 bits (503), Expect = 1e-49
 Identities = 107/230 (46%), Positives = 141/230 (61%), Gaps = 1/230 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           +  DI   +    + GALV +D TFATP+NQ  L LGADLVLHSATKF+GGH D L G +
Sbjct: 164 KITDIRACAEAGKQVGALVVVDNTFATPVNQNPLTLGADLVLHSATKFLGGHADALGGVV 223

Query: 750 SG-PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
            G  E L+  + +   I G T++P AAYLI+RGMKTL LRV++Q   A ++A  L+   +
Sbjct: 224 VGLDESLIEAIYHYREINGATMDPWAAYLILRGMKTLELRVKRQAENAEKLATYLQTVEE 283

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V  V+YPGL  HP H IAK QM+GFGG++SF + G + T    +  L     A + G  E
Sbjct: 284 VETVFYPGLIDHPNHEIAKAQMSGFGGMLSFAVAGGVDTVRHLLPKLAFANRAANLGAVE 343

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           + V      S+ + T  ERAA GI + L+R S G+ED ED+ AD  QA E
Sbjct: 344 TTVGPARTTSHVECTPQERAAMGIPEGLIRVSCGIEDGEDIIADFKQAFE 393



>gb:AE013113_289203 Thermoanaerobacter tengcongensis MB4, section
           140 of 244 of the complete genome.>gb:AE008691_1111268
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 393

 Score =  197 bits (502), Expect = 2e-49
 Identities = 100/232 (43%), Positives = 150/232 (64%), Gaps = 1/232 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R  DIE V ++    G  + +D TF TP   + L +GA  V+HSATK+I GH+DV+ G I
Sbjct: 162 RVFDIEEVVKIAKRHGLKLIVDNTFTTPYLIRPLEVGAYAVIHSATKYINGHSDVIGGLI 221

Query: 750 SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
           +G ++ +   R + H  GG+++P  A+L +RG KTL LR+++    A+R+AE LE+HPKV
Sbjct: 222 AGNKEFIFRTRRIVHNFGGSMSPFDAWLTLRGAKTLFLRMREHCKNAMRLAEFLESHPKV 281

Query: 570 RRVYYPGLPSHPEHHIAKKQMTG-FGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           ++V+YPGLPSHP++ IAKK     FGG++SFEIDG   +  +F+  LK+   APS  G +
Sbjct: 282 KKVFYPGLPSHPDYSIAKKLFKDEFGGMLSFEIDGGEQSVNRFMQELKLIKFAPSLAGVQ 341

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           +++  P   S+  L++ E  A GI + L+R S G+E+ EDV  D  QAL+ +
Sbjct: 342 TMITHPKSTSHRALSKEELKALGISEGLIRVSVGIEEIEDVIRDFKQALDKV 393



>sp|Q9RAS9|METC_LACLA Cystathionine beta-lyase (EC 4.4.1.8) (CBL)
           (Beta-cystathionase) (Cysteine lyase).>pir|E86722|E86722
           O-succinylhomoserine (thiol)-lyase (EC 4.2.99.9)
           [imported] - Lactococcus lactis subsp. lactis (strain
           IL1403)>pir|T47232|T47232 cystathionine beta-lyase (EC
           4.4.1.8) metC [validated] - Lactococcus lactis subsp.
           cremoris>gb:AE006311_217683 Lactococcus lactis subsp.
           lactis IL1403 section 73 of 218 of the complete
           genome.>gb:AF131880_481930 Lactococcus lactis subsp.
           cremoris strain MG1363 cystathionine beta-lyase MetC
           (metC) and O-acetylserine sulfhydrylase CysK (cysK)
           genes, complete cds.>gb:AF170901_485323 Lactococcus
           lactis subsp. cremoris MG1363 cystathionine
           beta/gamma-lyase (metC) gene, complete
           cds.>gb:AE005176_1094756 Lactococcus lactis subsp.
           lactis IL1403, complete genome.
          Length = 380

 Score =  196 bits (498), Expect = 5e-49
 Identities = 103/230 (44%), Positives = 150/230 (65%), Gaps = 1/230 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           + +DI+ +S +     AL  +D TFATP  Q+ +ALGAD+VLHSATK++GGH+DV+AG +
Sbjct: 150 KVLDIKEISAIAKAHDALTLVDNTFATPYLQQPIALGADIVLHSATKYLGGHSDVVAGLV 209

Query: 750 SGPEK-LVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
           +   K L S +  L + +G  L P  ++L+ RG+KTL LR++  ++ A ++AE LE    
Sbjct: 210 TTNSKELASEIGFLQNSIGAVLGPQDSWLVQRGIKTLALRMEAHSANAQKIAEFLETSKA 269

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V +VYYPGL SHP H IAKKQM+ FGG++SFE+  D      FV+ L    +A S GG E
Sbjct: 270 VSKVYYPGLNSHPGHEIAKKQMSAFGGMISFELT-DENAVKDFVENLSYFTLAESLGGVE 328

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           S+++ PA+M++  + +  R   GI D L+R S GVE  ED+  D+ +ALE
Sbjct: 329 SLIEVPAVMTHASIPKELREEIGIKDGLIRLSVGVEAIEDLLTDIKEALE 378



>gb:AE010647_265313 Fusobacterium nucleatum subsp. nucleatum ATCC
           25586, section 189 of 197 of the complete
           genome.>gb:AE009951_912481 Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586, complete genome.
          Length = 395

 Score =  196 bits (497), Expect = 7e-49
 Identities = 101/234 (43%), Positives = 144/234 (61%), Gaps = 3/234 (1%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEK-GALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC 754
           + VD+E +S++ H     LV +D TFATP  QK L LG D+V+HSATK++ GH DV+AG 
Sbjct: 162 KIVDLEALSKIAHTNPNTLVIVDNTFATPYMQKPLKLGVDIVVHSATKYLNGHGDVIAGL 221

Query: 753 ISGPEKLVSVVR--NLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH 580
           +   ++L   +R   L  + G  L P  AY IIRG+KT  +R+++    A  + + L  H
Sbjct: 222 VVTRQELADQIRFVGLKDMTGAVLGPQEAYYIIRGLKTFEIRMERHCKNARTIVDFLNKH 281

Query: 579 PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG 400
           PKV +VYYPGL +HP + IAKKQM  FG ++SFE+ G        ++ LK+  +A S G 
Sbjct: 282 PKVEKVYYPGLETHPGYEIAKKQMKDFGAMISFELKGGFEAGKTLLNNLKLCSLAVSLGD 341

Query: 399 CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
            E+++  PA M++   T+ ER   GI D LVR S G+E+ ED+ AD+ Q LE I
Sbjct: 342 TETLIQHPASMTHSPYTKEEREVAGITDGLVRLSVGLENVEDIIADLEQGLEKI 395



>sp|P56069|METB_HELPY Cystathionine gamma-synthase (EC 2.5.1.48)
           (CGS) (O-succinylhomoserine
           (Thiol)-lyase).>pir|B64533|B64533 cystathionine
           gamma-synthase - Helicobacter pylori (strain
           26695)>gb:AE000532_24285 Helicobacter pylori 26695
           section 10 of 134 of the complete
           genome.>gb:AE000511_879724 Helicobacter pylori 26695
           complete genome.
          Length = 380

 Score =  196 bits (497), Expect = 7e-49
 Identities = 102/232 (43%), Positives = 145/232 (62%), Gaps = 1/232 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           +  D+   + +  + G L  +D TFATP  Q  L LGAD+V HS TK++GGH+DV+AG +
Sbjct: 149 KITDLAQCASVAKDHGLLTIVDNTFATPYYQNPLLLGADIVAHSGTKYLGGHSDVVAGLV 208

Query: 750 S-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
           +   E L   +    + +GG L P  ++L+ RG+KTL LR++     AL +AE LE HPK
Sbjct: 209 TTNNEALAQEIAFFQNAIGGVLGPQDSWLLQRGIKTLGLRMEAHQKNALCVAEFLEKHPK 268

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V RVYYPGLP+HP + +AKKQM GF G++SF +  D    A FV++LK+  +  S GG E
Sbjct: 269 VERVYYPGLPTHPNYELAKKQMRGFSGMLSFTLKNDSEAVA-FVESLKLFILGESLGGVE 327

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           S+V  PA M++  + + +R A GI D LVR S G+E  +D+  D+ QA   I
Sbjct: 328 SLVGIPAFMTHACIPKTQREAAGIRDGLVRLSVGIEHEQDLLEDLEQAFAKI 379



>gb:AE015944_321552 Clostridium tetani E88, section 9 of 10 of the
           complete genome.>gb:AE015927_964341 Clostridium tetani
           E88, complete genome.
          Length = 398

 Score =  195 bits (495), Expect = 1e-48
 Identities = 100/234 (42%), Positives = 154/234 (65%), Gaps = 3/234 (1%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEK-GALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC 754
           +  DI+ +S + H+K   +V +D TF TP  Q+ L LGAD+V+HSATK++ GH DVLAG 
Sbjct: 163 KVADIKAISEIAHKKEDCMVFVDNTFCTPCIQRPLELGADVVVHSATKYLNGHGDVLAGF 222

Query: 753 ISGPEKLVSVVRN--LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH 580
           + G ++ ++ VR   +  + G  L+P  A+L++RG+KTL +R+++  + A ++AE L+ H
Sbjct: 223 VVGKQEFINNVRGFGVKDMTGSVLSPFDAFLVLRGLKTLEIRMERHCANAQKVAEFLQGH 282

Query: 579 PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG 400
             V +VYYPGL     + IAKKQM   G ++SFE++G L    K +D++K+  +A S G 
Sbjct: 283 EAVSKVYYPGLNDSEYYDIAKKQMRMPGAMISFEVNGGLEEGKKIMDSVKLANLAVSLGD 342

Query: 399 CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
            E+++  PA M++   T+ ER A GI DNLVR S G+E+ ED+  D+ QAL+TI
Sbjct: 343 AETLIQHPASMTHSPYTKEEREAAGISDNLVRLSVGLENVEDIIEDLRQALDTI 396



>gb:AP006840_568021 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 401

 Score =  194 bits (494), Expect = 2e-48
 Identities = 101/232 (43%), Positives = 150/232 (64%), Gaps = 1/232 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R  DI  +S L H     V +D TF +P  Q+ L  GAD+V+HSATKFIGGH DV+AG  
Sbjct: 164 RLADIRALSDLAHRHQITVVVDNTFMSPYLQRPLEHGADMVVHSATKFIGGHGDVVAGLA 223

Query: 750 SGPEKLVSVVRNLH-HILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
            GP ++++ VR+      GG L+P  A+L++RG+KTL +R+++ +  AL++A  LE HP 
Sbjct: 224 VGPAEVMARVRSTTLKNFGGILSPFDAWLLLRGLKTLAIRMERHSENALKVARYLEQHPL 283

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V RVYYPGL S P H +A++QM GFGG++SFE+ G +      ++ +++  +A S G  +
Sbjct: 284 VMRVYYPGLESSPYHELARRQMDGFGGLLSFELMGGMEAGRTLLNHVRLCTVAVSLGDTD 343

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           +++  PA M++  +    RAA GI D LVR S G+ED +D+ AD+ QAL  +
Sbjct: 344 TLIQHPASMTHAVVPPEARAAAGISDGLVRLSVGLEDADDIIADLDQALAAV 395



>gb:AE016947_364414 Enterococcus faecalis V583, section 1 of 11 of
           the complete genome.>gb:AE016830_990902 Enterococcus
           faecalis V583, complete genome.
          Length = 378

 Score =  194 bits (494), Expect = 2e-48
 Identities = 102/231 (44%), Positives = 150/231 (64%), Gaps = 2/231 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           +  DIE  ++L  +   L  +D TFATP  Q+ LALGAD+V+HS TK++GGH+DV++G +
Sbjct: 149 KITDIEAAAKLAKKHQLLTIVDNTFATPYFQRPLALGADIVVHSGTKYLGGHSDVVSGLV 208

Query: 750 --SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
             + PE    +   L + +G  L P+ ++L+ R +KTL +R+      A ++AE LEAHP
Sbjct: 209 VTNHPESAEKIAF-LQNAIGAVLGPHDSWLVQRSLKTLGVRMAAHAQNAQKIAEFLEAHP 267

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
            V  VYYPGL SHP H IA+KQM+GF G++SFE+  D      FV+AL+I  +A S GG 
Sbjct: 268 AVATVYYPGLASHPGHEIAQKQMSGFSGMISFELAKD-EQVVPFVEALEIFTLAESLGGV 326

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           ES+++ PAIM++  + +  R A GI D L+R S G+E  ED+ AD+ + L+
Sbjct: 327 ESLIEVPAIMTHASIPKENREAVGIKDGLIRLSVGIEAVEDLLADLEKGLQ 377



>gb:AE013565_293415 Methanosarcina mazei strain Goe1, section 347 of
           379 of the complete genome.>gb:AE008384_967524
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 394

 Score =  194 bits (494), Expect = 2e-48
 Identities = 98/228 (42%), Positives = 148/228 (64%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISGP 742
           DI ++S L   +GA+  +D TF+TP  QK L LGAD+ L S TK+IGGH D+L G I   
Sbjct: 167 DIRMISGLAKAQGAICVVDNTFSTPYFQKPLLLGADISLSSCTKYIGGHADLLGGIIVCD 226

Query: 741 EKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRV 562
           +  +  +  +    GGT+  + A+L IRG+KTLH+R+++    AL++A  LE+HP V  V
Sbjct: 227 KAFLKNLAKVAGYTGGTMGLHEAWLCIRGLKTLHIRMERHAENALKVANFLESHPAVEWV 286

Query: 561 YYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVD 382
            YPGL SHP+H IAKKQM+G+GG++SF +   +   +K ++++++  +A S G  ++++ 
Sbjct: 287 RYPGLSSHPQHEIAKKQMSGYGGMLSFGVKDGIDAGSKLMNSVRLCSLAVSLGATDTLIQ 346

Query: 381 QPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
            PA M++  + +  R   GI D LVR S G+ED ED+ AD+ QALE I
Sbjct: 347 HPASMTHACVPKEVRGKVGITDGLVRLSIGIEDPEDIIADLKQALEKI 394



>gb:AY204910_597228 Citrobacter freundii methionine gamma-lyase
           (megL) and putative amino acid permease (aap) genes,
           complete cds.
          Length = 398

 Score =  194 bits (493), Expect = 2e-48
 Identities = 95/228 (41%), Positives = 149/228 (65%), Gaps = 2/228 (0%)
 Frame = -1

Query: 924 VDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISG 745
           VDIE V+ + H++GAL+ +D TF +P  Q+ L LGAD+V+HS TK+I GH DV+ G I G
Sbjct: 166 VDIETVAGIAHQQGALLVVDNTFMSPYCQQPLQLGADIVVHSVTKYINGHGDVIGGIIVG 225

Query: 744 PEKLVSVVR--NLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
            ++ +   R   L  I GG ++P  A+L +RG+KTL +R+++    AL++A  LE HP +
Sbjct: 226 KQEFIDQARFVGLKDITGGCMSPFNAWLTLRGVKTLGIRMERHCENALKIARFLEGHPSI 285

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
            RVYYPGL SHP++ + ++QM+  GG++SFEI G L    + ++++++  +A S G  E+
Sbjct: 286 TRVYYPGLSSHPQYELGQRQMSLPGGIISFEIAGGLEAGRRMINSVELCLLAVSLGDTET 345

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           ++  PA M++  +   ER   GI D L+R S G+ED ED+  D+  A+
Sbjct: 346 LIQHPASMTHSPVAPEERLKAGITDGLIRLSVGLEDPEDIINDLEHAI 393



>gb:AE012010_278516 Xanthomonas axonopodis pv. citri str. 306,
           section 388 of 469 of the complete
           genome.>gb:AE008923_920291 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 398

 Score =  194 bits (492), Expect = 3e-48
 Identities = 94/230 (40%), Positives = 148/230 (64%), Gaps = 2/230 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC- 754
           + VDI  ++ +  ++G L+ +D TFA+P+ Q+ L+LGAD+V+HSATK++ GH+D++ G  
Sbjct: 164 KLVDIAAIAEIARKRGLLIVVDNTFASPMLQRPLSLGADIVVHSATKYLNGHSDMVGGIA 223

Query: 753 -ISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
            +    +L   +  L + +GG   P  ++L +RG+KTL LR++     AL +A+ LE HP
Sbjct: 224 VVGDNAELAEQMAFLQNSIGGVQGPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHP 283

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
            + +V YPGL SHP+H +AK QM+GFGG+VS  + G      +F +  ++  +A S GG 
Sbjct: 284 AIEKVIYPGLASHPQHALAKSQMSGFGGIVSIVLKGGFDAAKRFCEKTELFTLAESLGGV 343

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           ES+V+ PA+M++  +  A R   GI D LVR S G+ED ED++ D+  AL
Sbjct: 344 ESLVNHPAVMTHASIPVARRDQLGISDALVRLSVGIEDVEDLRGDLQAAL 393



>gb:AE010947_267851 Methanosarcina acetivorans str. C2A, section 292
           of 534 of the complete genome.>gb:AE010299_908410
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 406

 Score =  194 bits (492), Expect = 3e-48
 Identities = 98/228 (42%), Positives = 145/228 (63%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISGP 742
           DI  +S+L   +GA+  +D TFATP  QK L LGAD+ L S TK+IGGH D+L G + G 
Sbjct: 167 DIREISKLAKAQGAICIVDNTFATPYFQKPLELGADISLSSCTKYIGGHADLLGGIVVGS 226

Query: 741 EKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRV 562
              +  +  +    GG +  + A+L IRG+KTLH+R+++    AL +A  LEAHP V  V
Sbjct: 227 RDFMKSLGKVVGYTGGIMGLHEAWLCIRGLKTLHIRMERHAENALTVANFLEAHPTVEWV 286

Query: 561 YYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVD 382
            YPGL +HP+H +AKKQM+G+GG++SFEI G +    + +D++++  +A S G  ++++ 
Sbjct: 287 RYPGLSNHPQHEVAKKQMSGYGGMLSFEIRGGVEAGRRLMDSVRLCSLAVSLGATDTLIQ 346

Query: 381 QPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
            PA M++  +    R   GI D LVR S G+ED ED+ AD+ QAL  +
Sbjct: 347 HPASMTHACIPGHIRNKVGIKDGLVRLSVGIEDPEDIIADLEQALSKV 394



>pir|F83595|F83595 probable cystathionine gamma-lyase PA0400
           [imported] - Pseudomonas aeruginosa (strain
           PAO1)>gb:AE004477_54635 Pseudomonas aeruginosa PAO1,
           section 38 of 529 of the complete
           genome.>gb:AE004091_968735 Pseudomonas aeruginosa PAO1,
           complete genome.
          Length = 394

 Score =  194 bits (492), Expect = 3e-48
 Identities = 99/233 (42%), Positives = 150/233 (64%), Gaps = 2/233 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC- 754
           R  D+  +++LC  +G +   D TFA+P  Q+ L LG D+V+HS TK++ GH+DV+ G  
Sbjct: 162 RLTDLRAIAQLCRARGIISVADNTFASPYIQRPLELGFDVVVHSTTKYLNGHSDVIGGIA 221

Query: 753 -ISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
            +     L   +  L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P
Sbjct: 222 IVGDNPDLRERLGFLQNSVGAISGPFDAFLTLRGVKTLALRMERHCSNALALAQWLERQP 281

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
           +V RVYYPGL SHP+H +AK+QM GFGG++S ++  DL    +F++ ++I  +A S GG 
Sbjct: 282 QVARVYYPGLASHPQHELAKRQMRGFGGMISLDLRCDLAGARRFLENVRIFSLAESLGGV 341

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           ES+++ PAIM++  +    RA  GI D+L+R S GVE  ED++AD+ QAL  I
Sbjct: 342 ESLIEHPAIMTHASIPAETRADLGIGDSLIRLSVGVEALEDLQADLAQALAKI 394



>gb:AF204145_488220 Xanthomonas campestris pv. campestris LPS
           biosynthetic cluster, partial sequence; and putative
           electron-transferring flavoprotein beta subunit (etfS)
           and putative electron-transferring flavoprotein alpha
           subunit (etfL) genes, complete cds.
          Length = 399

 Score =  193 bits (491), Expect = 4e-48
 Identities = 97/231 (41%), Positives = 148/231 (64%), Gaps = 2/231 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC- 754
           + VDI  ++ +  + G LV +D TFA+P+ Q+ L LGADLV+HSATK++ GH+D++ G  
Sbjct: 164 KLVDIAAIAAIARKYGLLVVVDNTFASPMLQRPLELGADLVVHSATKYLNGHSDMVGGIA 223

Query: 753 -ISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
            +    +L   +  L + +GG   P  ++L +RG+KTL LR++     AL +A+ LE HP
Sbjct: 224 VVGDNAELAEQMAFLQNSIGGVQGPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHP 283

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
            + +V YPGL SHP+H +AK+QM+GFGG+VS  + G      +F +  ++  +A S GG 
Sbjct: 284 AIEKVIYPGLTSHPQHALAKQQMSGFGGIVSIVLKGGFEAAKRFCEKTELFTLAESLGGV 343

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           ES+V+ PA+M++  +  A R   GI D LVR S GVED  D++ D+ +ALE
Sbjct: 344 ESLVNHPAVMTHASIPVARREKLGISDALVRLSVGVEDVGDLRGDLERALE 394



>gb:AF092918_478615 Pseudomonas alcaligenes outer membrane
           Xcp-secretion system gene cluster.
          Length = 391

 Score =  193 bits (491), Expect = 4e-48
 Identities = 96/229 (41%), Positives = 145/229 (63%)
 Frame = -1

Query: 924 VDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISG 745
           VDI  ++ + H +GAL+ +D  F TP  Q+ LALGAD+V+HSATKFI G    L G ++G
Sbjct: 163 VDIGALAEIAHARGALLAVDNCFCTPALQQPLALGADMVMHSATKFIDGQGRGLGGVVAG 222

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
               +  V       G TL+P  A++ ++G++TL +R+Q Q+++AL +A  LE  P + R
Sbjct: 223 RRAQMEQVVGFLRTAGPTLSPFNAWMFLKGLETLRIRMQAQSASALELARWLETQPGIDR 282

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           VYY GLPSHP+H +AK+Q + FG V+SFE+ G      +F+DA ++  I  + G  ++ +
Sbjct: 283 VYYAGLPSHPQHELAKRQQSAFGAVLSFEVKGGKEAAWRFIDATRVISITTNLGDTKTTI 342

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
             PA  S+  L+  ERA+ GI DNLVR + G+ED  D+KAD+ + L  +
Sbjct: 343 AHPATTSHGRLSPQERASAGIRDNLVRVAVGLEDVVDLKADLARGLAAL 391



>pir|H84272|H84272 cystathionine alpha synthase [imported] -
           Halobacterium sp. NRC-1>gb:AE005045_62708 Halobacterium
           sp. NRC-1 section 76 of 170 of the complete
           genome.>gb:AE004437_887627 Halobacterium sp. NRC-1
           complete genome.
          Length = 393

 Score =  193 bits (491), Expect = 4e-48
 Identities = 99/227 (43%), Positives = 146/227 (64%), Gaps = 1/227 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC-ISG 745
           DI  ++ + HE  AL  +D TFATP  Q+ L  GAD+V HS TK++GGH+D++AG  I+ 
Sbjct: 163 DIGALADIAHEHDALCAVDNTFATPYLQRPLEFGADIVSHSLTKYLGGHSDLVAGALITD 222

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
            + L        + +G T +P   +L++RG KTL +R+ +   TA+ +A  L  H  V +
Sbjct: 223 DDDLDEQFGFYQNSVGATPSPFDCFLVLRGTKTLGVRMDRHCETAMELAAWLADHEHVSQ 282

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           V+YPGL SHP+H +A  QM GFGG+VSFE+D  L   + FV+   +  +A S GG ES++
Sbjct: 283 VHYPGLESHPDHELAAAQMDGFGGMVSFELDATLEAASAFVEETDVFTLAESLGGVESLI 342

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           +QPA M++  + +AER A G+ D L+R S GVE  +D+KAD+ QA+E
Sbjct: 343 EQPAAMTHAAIPKAEREAAGLTDGLIRASIGVEHVDDLKADLQQAIE 389



>gb:AE016791_333981 Pseudomonas putida KT2440 section 18 of 21 of
           the complete genome.>gb:AE015451_949058 Pseudomonas
           putida KT2440 complete genome.
          Length = 393

 Score =  193 bits (490), Expect = 5e-48
 Identities = 95/230 (41%), Positives = 148/230 (64%), Gaps = 1/230 (0%)
 Frame = -1

Query: 924 VDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI-S 748
           VDI+ V  L   KG L CID TF +P NQ+ + LG DLV+HSA+K+IGGH+D+  G + +
Sbjct: 161 VDIKAVCDLAKAKGILTCIDNTFCSPWNQRPITLGVDLVMHSASKYIGGHSDLTGGVVVA 220

Query: 747 GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVR 568
             + L++ +R +   +G    P   YL +RG+KTL +R+++Q + AL++A  LE H +V 
Sbjct: 221 ANDALLARLRRISMAIGAVQGPFDCYLALRGLKTLDVRMERQCANALQVARFLEGHAQVE 280

Query: 567 RVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESI 388
           +VYYPGL SHP+H + K+QM   G VV+ ++ GD     + V+AL+I  +A S GG ES+
Sbjct: 281 QVYYPGLESHPQHELCKRQMRSGGAVVAMKVKGDRAALNRLVEALQIFVLADSLGGVESM 340

Query: 387 VDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           ++    MS+  L+  ++   GI +NL+R S G+ED+ D+  D+  AL+ +
Sbjct: 341 INHSWSMSHCSLSPEQKGVMGISENLLRLSVGIEDYRDLVEDLDGALKAL 390



>pir|G83749|G83749 methionine gamma lyase BH0799 [imported] -
           Bacillus halodurans (strain C-125)>gb:BA000004_654745
           Bacillus halodurans C-125 DNA, complete genome.
          Length = 393

 Score =  191 bits (486), Expect = 1e-47
 Identities = 101/230 (43%), Positives = 147/230 (63%), Gaps = 1/230 (0%)
 Frame = -1

Query: 924 VDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISG 745
           +D+ELV R+  EKG  V +D TFATP  Q+ +ALG D V+HSATK+IGGH DV+AG + G
Sbjct: 164 IDLELVVRVAKEKGIKVIVDNTFATPYLQQPIALGCDFVVHSATKYIGGHGDVVAGVLIG 223

Query: 744 PEKLVSVVRNL-HHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVR 568
            ++ + ++R      +GG ++P  A+L++RG+KTL +R+ +    A ++AE L+ HPKV 
Sbjct: 224 DKETIQLIRKTTQKDMGGVISPFDAWLLLRGLKTLAVRMDRHCENAEKLAEKLKEHPKVS 283

Query: 567 RVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESI 388
            V YPG   HP+H I  KQM   GG++SFEI G     AK V+ LK+  IA S G  E++
Sbjct: 284 TVLYPGDFEHPDHSIVAKQMKKGGGLLSFEIKGTEADIAKVVNQLKLIRIAVSLGDAETL 343

Query: 387 VDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           +  PA M++  + +  R   GI   L+R S G+E ++DV AD+ QAL  +
Sbjct: 344 IQHPATMTHAVVPEKRRTQMGISKKLLRMSAGLEAWQDVWADLEQALNQL 393



>gb:AF131881_481932 Lactococcus lactis subsp. cremoris strain NIZO
           B78 cystathionine beta-lyase MetC (metC) gene, complete
           cds.
          Length = 380

 Score =  190 bits (483), Expect = 3e-47
 Identities = 100/230 (43%), Positives = 149/230 (64%), Gaps = 1/230 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           + +DI+ +S +     AL  +D TFATP  Q+ +ALGAD+VLHSATK++GGH+DV+AG +
Sbjct: 150 KVLDIKEISSIAKAHNALTLVDNTFATPYLQQPIALGADIVLHSATKYLGGHSDVVAGLV 209

Query: 750 S-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
           +    +L   +  L + +G  L P  ++L+ RG+KTL  R++  ++ A ++AE LEA   
Sbjct: 210 TTNSNELAIEIGFLQNSIGAVLGPQDSWLVQRGIKTLAPRMEAHSANAQKIAEFLEASQA 269

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V +VYYPGL +H  H IAKKQMT FGG++SFE+  D      FV+ L+   +A S GG E
Sbjct: 270 VSKVYYPGLVNHEGHEIAKKQMTAFGGMISFELT-DENAVKNFVENLRYFTLAESLGGVE 328

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           S+++ PA+M++  + +  R   GI D L+R S GVE  ED+  D+ +ALE
Sbjct: 329 SLIEVPAVMTHASIPKELREEIGIKDGLIRLSVGVEALEDLLTDLKEALE 378



>gb:AE012157_279870 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 65 of 460 of the complete
           genome.>gb:AE008922_913152 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 399

 Score =  190 bits (483), Expect = 3e-47
 Identities = 96/231 (41%), Positives = 146/231 (63%), Gaps = 2/231 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC- 754
           + VDI  ++ +    G LV +D TFA+P+ Q+ L LGADLV+HSATK++ GH+D++ G  
Sbjct: 164 KLVDIAAIAAIARRHGLLVVVDNTFASPMLQRPLELGADLVVHSATKYLNGHSDMVGGIA 223

Query: 753 -ISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
            +    +L   +  L + +GG   P  ++L +RG+KTL LR++     AL +A+ LE H 
Sbjct: 224 VVGDNAELAEQMAFLQNSIGGVQGPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHQ 283

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
            + +V YPGL SHP+H +AK+QM+GFGG+VS  + G      +F +  ++  +A S GG 
Sbjct: 284 AIEKVIYPGLASHPQHALAKQQMSGFGGIVSIVLKGGFEAAKRFCEKTELFTLAESLGGV 343

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           ES+V+ PA+M++  +  A R   GI D LVR S GVED  D++ D+ +ALE
Sbjct: 344 ESLVNHPAVMTHASIPVARREQLGISDALVRLSVGVEDVGDLRGDLERALE 394



>gb:BX842656_826524 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 11/11.
          Length = 387

 Score =  190 bits (482), Expect = 4e-47
 Identities = 96/230 (41%), Positives = 147/230 (63%), Gaps = 1/230 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           + VDI+ ++ +   KG LV +D TF +P  Q+ L LGAD+V+HSATK+IGGH+D + G +
Sbjct: 156 KLVDIKKIAAIAKAKGILVAVDNTFMSPYFQRPLELGADIVVHSATKYIGGHSDTVGGMV 215

Query: 750 S-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
                 L   +  L + +G T     +++ +R +KTL LR++     A+ +A+ LE+HPK
Sbjct: 216 VVSRADLAERMAFLSNGIGATQGAFDSFMFLRSLKTLPLRMKAHQENAMAIAKFLESHPK 275

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V +V YPGL SHP+H +AK+QM GFGG+++F I G L +  KF++ + +  +A S GG E
Sbjct: 276 VDKVIYPGLESHPQHALAKEQMHGFGGMITFYIKGGLDSARKFLENVNVFSLAESLGGVE 335

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           S+++ PAIM++  +    R A GI D L+R S GVED  D+ AD+  A +
Sbjct: 336 SLIEHPAIMTHASVPPENRKALGIDDTLIRLSVGVEDLNDLIADLKTAFD 385



>gb:AE013598_294479 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 397

 Score =  190 bits (482), Expect = 4e-47
 Identities = 94/230 (40%), Positives = 147/230 (63%), Gaps = 2/230 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC- 754
           + VDI  ++ +  + G L  +D TFA+P+ Q+ L+LGADLV+HSATK++ GH+D++ G  
Sbjct: 164 KLVDIAAIAVIARKHGLLTVVDNTFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIA 223

Query: 753 -ISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
            +    +L   +  L + +GG   P  ++L +RG+KTL LR++     AL +A+ LE HP
Sbjct: 224 VVGDNAELAEQMAFLQNSIGGVQGPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHP 283

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
            + +V YPGL SHP+H +AK+QM+GFGG+VS  + G      +F +  ++  +A S GG 
Sbjct: 284 AIEKVIYPGLASHPQHVLAKRQMSGFGGIVSIVLKGGFDAAKRFCEKTELFTLAESLGGV 343

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           ES+V+ PA+M++  +  A R   GI D LVR S G+ED  D++ D+ +AL
Sbjct: 344 ESLVNHPAVMTHASIPVARREQLGISDALVRLSVGIEDLGDLRGDLERAL 393



>gb:BX572600_801970 Rhodopseudomonas palustris CGA009 complete
           genome; segment 8/16.
          Length = 390

 Score =  189 bits (480), Expect = 7e-47
 Identities = 98/232 (42%), Positives = 146/232 (62%), Gaps = 1/232 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R  D+E ++ +  E+G L  +D TFA+P  Q+ L  G D+V+HS TK+IGGH+D++ G I
Sbjct: 159 RLADLEAIAAIGRERGVLTVVDNTFASPAVQRPLEHGIDIVVHSVTKYIGGHSDIVGGAI 218

Query: 750 SGPEK-LVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
              +  L   ++ L +  GG L+P +++L +RG+KTL LRVQ+ +S AL +A  L+AHPK
Sbjct: 219 VVRDPDLAQKLQFLQNATGGILDPFSSFLALRGIKTLPLRVQRHSSNALAVARWLDAHPK 278

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           + RV YPGL SHP+H +A +QM G GG+V+  +  D       +   ++  +A S G  E
Sbjct: 279 IERVVYPGLNSHPQHALAVRQMDGGGGMVAAYLKADEQQVVDVLSRFRLFALAESLGAVE 338

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           S+V QP  MS+  L +A+R A  I  NL+R S G+ED ED+  D+ QAL  +
Sbjct: 339 SLVGQPWTMSHGSLPEADRLAREITPNLIRLSIGIEDVEDLTDDLEQALSIL 390



>pir|T45483|T45483 cystathionine gamma-lyase homolog [imported] -
           Stenotrophomonas maltophilia>gb:AF031709_471056
           Stenotrophomonas maltophilia cystathionine
           gamma-lyase-like protein (CYS1) gene, complete cds.
          Length = 391

 Score =  189 bits (480), Expect = 7e-47
 Identities = 96/230 (41%), Positives = 146/230 (63%), Gaps = 2/230 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           + VDI  V+ +    G +V +D TFA+P+ Q+ L LGADLVLHSATK++ GH+D++ G +
Sbjct: 160 KIVDIAAVTAIAKRHGLIVVVDSTFASPMLQRPLELGADLVLHSATKYLNGHSDMVGGMV 219

Query: 750 --SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
                 +L   +  L + +GG   P  ++L +RG+KTL LR++   + AL +A+ LE HP
Sbjct: 220 VVGDNAELAEQMAFLQNSVGGVQGPFDSFLALRGLKTLPLRMKAHCANALALAQWLEKHP 279

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
            V +V YPGL SHP+H +A KQM G+GG+VS  + G      +F +  ++  +A S GG 
Sbjct: 280 AVEKVIYPGLASHPQHELAGKQMAGYGGIVSIVLKGGFEAAKRFCEKTELFTLAESLGGV 339

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           ES+V+ PA+M++  ++ A R   GI D LVR S GVE+  D++ D+ +AL
Sbjct: 340 ESLVNHPAVMTHASISVARREQLGISDALVRLSVGVEELGDLQVDLERAL 389



>gb:AY596297_633691 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 411

 Score =  189 bits (479), Expect = 9e-47
 Identities = 96/223 (43%), Positives = 144/223 (64%), Gaps = 2/223 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI--S 748
           DI+ ++ +  +  A V +D TFA+P  Q+ L+LGADLV+HS TK++ GH+D + G +   
Sbjct: 180 DIDAIAAVAADYDATVGVDNTFASPYFQQPLSLGADLVVHSTTKYLNGHSDAVGGALITD 239

Query: 747 GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVR 568
            PE    V       LG  L P  +YLI RG+KTL +R+ +  + A+ +A+ L+ H  V 
Sbjct: 240 DPEVAERVEFRQQIALGNMLAPFDSYLISRGIKTLGVRMTRHENNAMALAQYLDDHEHVE 299

Query: 567 RVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESI 388
            V+YPGL SHP+H +A++QM GFGGV+SFE+ GD+    +F++AL+   +A S GG ES+
Sbjct: 300 TVHYPGLESHPQHDLAREQMQGFGGVLSFELAGDMADAKQFLEALETVTLAVSLGGVESL 359

Query: 387 VDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADV 259
            + PA M++  L+ A R   GI D L+R S G+ED ED++AD+
Sbjct: 360 AELPAAMTHEPLSPAARDELGISDTLIRLSVGIEDVEDLRADL 402



>sp|P55218|METZ_PSEAE O-succinylhomoserine sulfhydrylase (EC
           2.5.1.-) (OSH sulfhydrylase).>pir|F83256|F83256
           o-succinylhomoserine sulfhydrylase PA3107 [imported] -
           Pseudomonas aeruginosa (strain PAO1)>gb:AE004735_57343
           Pseudomonas aeruginosa PAO1, section 296 of 529 of the
           complete genome.>gb:PAU10904_156998 Pseudomonas
           aeruginosa PAO1 glutamine phosphoribosylpyrophosphate
           amidotransferase (purF) gene, partial cds and
           O-succinylhomoserine sulfhydrylase (metZ) gene, complete
           cds.>gb:AE004091_971443 Pseudomonas aeruginosa PAO1,
           complete genome.
          Length = 403

 Score =  189 bits (479), Expect = 9e-47
 Identities = 92/229 (40%), Positives = 146/229 (63%)
 Frame = -1

Query: 924 VDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISG 745
           VDI  ++ + H KGAL+ +D  F TP  Q+ L LGAD+V+HSATK+I G    + G ++G
Sbjct: 175 VDIAALAEIAHAKGALLAVDNCFCTPALQQPLKLGADVVIHSATKYIDGQGRGMGGVVAG 234

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
             + +  V       G TL+P  A+L ++G++TL +R+Q  +++AL +AE LE  P + R
Sbjct: 235 RGEQMKEVVGFLRTAGPTLSPFNAWLFLKGLETLRIRMQAHSASALALAEWLERQPGIER 294

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           VYY GLPSHP+H +A++Q +GFG VVSF++ G      +F+DA ++  I  + G  ++ +
Sbjct: 295 VYYAGLPSHPQHELARRQQSGFGAVVSFDVKGGRDAAWRFIDATRMVSITTNLGDTKTTI 354

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
             PA  S+  L+  +RA  GI D+L+R + G+ED +D+KAD+ + L  +
Sbjct: 355 AHPATTSHGRLSPEDRARAGIGDSLIRVAVGLEDLDDLKADMARGLAAL 403



>gb:BC061381_2553156 Xenopus tropicalis hypothetical protein
           MGC75946, mRNA (cDNA clone MGC:75946 IMAGE:5383955),
           complete cds.
          Length = 398

 Score =  188 bits (478), Expect = 1e-46
 Identities = 97/230 (42%), Positives = 151/230 (65%), Gaps = 2/230 (0%)
 Frame = -1

Query: 924 VDIELVSRLCHE-KGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCIS 748
           +DI+  + + H+ K  ++ +D TF +   Q+ LALGAD+ ++SATK++ GH+DV+ G +S
Sbjct: 160 IDIKGCADIIHKHKDIILAVDNTFLSAYFQRPLALGADICMYSATKYMNGHSDVVMGLVS 219

Query: 747 -GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
              +KL   ++ L + +G   +P   YL  RG+KTLHLR+QQ    AL +A+ LEA P+V
Sbjct: 220 VNCDKLYEKLKFLQNAIGAVPSPFDCYLCNRGLKTLHLRMQQHFQNALAVAKFLEADPRV 279

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
            +V YPGLPSHP++ + K+Q TG  G+++F I G+L     F+ +LK+  +A S GG ES
Sbjct: 280 DKVLYPGLPSHPQYELTKRQCTGVSGMITFYIKGNLEHATTFLKSLKVFALAESLGGYES 339

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALET 241
           + + PAIM++  + + +RAA  I D L+R S G+ED ED+  D+ QAL +
Sbjct: 340 LAEHPAIMTHAAVPEEDRAALNISDTLIRLSIGLEDVEDIIGDLDQALRS 389



>gb:AE013114_289214 Thermoanaerobacter tengcongensis MB4, section
           141 of 244 of the complete genome.>gb:AE008691_1111279
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 394

 Score =  188 bits (477), Expect = 1e-46
 Identities = 99/231 (42%), Positives = 147/231 (63%), Gaps = 2/231 (0%)
 Frame = -1

Query: 924 VDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG-CIS 748
           +DIE VS++ +++G  V +D TFATP  Q  L LGAD+V+HSATK+I GH D L G  IS
Sbjct: 164 IDIEEVSKIAYQRGIKVVVDNTFATPCFQNPLLLGADVVVHSATKYICGHGDALGGVAIS 223

Query: 747 GPEKLVSVVRNLHHI-LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
             E  +  ++  +    GG ++P  A+L++RG+KTL LR++Q    A+ +A+ L  HPKV
Sbjct: 224 KDEAYIHYLKFDYMCEFGGVMSPFNAWLMLRGIKTLGLRMRQHEKNAMEVAKFLSRHPKV 283

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
           + V YPGL S   H IAKKQM GFG ++SFEI+G      +F+  LK+  +A S G  E+
Sbjct: 284 KNVLYPGLESFKGHGIAKKQMRGFGAIISFEIEGGRKELEEFIKGLKLCQLAVSLGDAET 343

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           +V+ P+IM++    + +   +G  +N VR S G+ED+ D+  D+  AL+ I
Sbjct: 344 LVEVPSIMTHRGYPKEKLEDFGFKENTVRISVGLEDYNDIIEDLEDALKRI 394



>gb:BC080251_2561629 Danio rerio cystathionase (cystathionine
           gamma-lyase), like, mRNA (cDNA clone MGC:92377
           IMAGE:7036273), complete cds.
          Length = 400

 Score =  187 bits (476), Expect = 2e-46
 Identities = 103/231 (44%), Positives = 145/231 (62%), Gaps = 3/231 (1%)
 Frame = -1

Query: 930 RCVDIELVSRLCHE--KGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG 757
           + VDI+  + + H+  K  LV +D TF +P  Q+ LALGAD+ + S TK++ GH+DVL G
Sbjct: 163 KVVDIQACADIVHKHNKDTLVVVDNTFMSPYFQRPLALGADICMSSGTKYMNGHSDVLMG 222

Query: 756 CIS-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH 580
            IS   E L   ++ L + +G   +P   Y+  RG+KTLHLR++Q    AL +A+ LEA 
Sbjct: 223 LISVNREDLYKRLKVLQNAVGAVPSPFDCYMCNRGLKTLHLRMKQHFKNALAVAQFLEAD 282

Query: 579 PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG 400
           P+V  V +PGLPSHP+H +AK+Q  G  G+VSF I G L   + F+  LK+  +A S GG
Sbjct: 283 PRVDSVIFPGLPSHPQHELAKRQCRGCSGMVSFYIKGKLEHASTFLSNLKVVALAESLGG 342

Query: 399 CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
            ES+   PA M +  L++ ER   GI D L+R S G+ED ED+ AD+ QAL
Sbjct: 343 IESLAKLPATMPHVSLSKDEREKLGISDTLIRLSVGLEDEEDIIADLDQAL 393



>gb:BA000012_669431 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 394

 Score =  187 bits (475), Expect = 3e-46
 Identities = 94/230 (40%), Positives = 150/230 (65%), Gaps = 2/230 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC- 754
           R VD+E V+ L   KG L   D TF +P  Q+ L LG D+V+HS TK++ GH+D++ G  
Sbjct: 163 RIVDLEGVAALAKRKGVLTVADNTFCSPYIQRPLELGIDIVVHSTTKYLNGHSDMVGGVA 222

Query: 753 -ISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
            +   ++L + ++ L + +G    P  ++L +RG+KTL LR+++ +   L++A+ LEA  
Sbjct: 223 VVGDNKELATQLKFLQNAIGAISGPFDSFLALRGLKTLALRMERHSDNGLKIAQWLEARK 282

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
            VRRV YPGL SHP+H IA +QM  FGG+++  +D DL  T +F++  ++  +A S GG 
Sbjct: 283 DVRRVLYPGLASHPQHSIAVQQMHAFGGMITAVLDRDLAGTKRFLERTQLFTLAESLGGV 342

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           ES+++ PA+M++  +   +R+  GI D+LVR S G+ED +D+ AD+ QAL
Sbjct: 343 ESLIEHPALMTHGSIPAEKRSEIGISDSLVRLSAGIEDGDDLIADLEQAL 392



>gb:AE017038_384547 Bacillus anthracis str. Ames section 15 of 18 of
           the complete genome.>gb:AE017225_409643 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_454394 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE016879_1014252 Bacillus
           anthracis str. Ames complete genome.
          Length = 377

 Score =  187 bits (475), Expect = 3e-46
 Identities = 95/229 (41%), Positives = 144/229 (62%), Gaps = 1/229 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           +  DI+ +S L  EKG L  ID TF TP  Q  ++LGAD+VLHSATK++GGH+DV+AG +
Sbjct: 149 KITDIKKISTLAKEKGLLTIIDNTFMTPYWQSPISLGADIVLHSATKYLGGHSDVVAGLV 208

Query: 750 S-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
                +L   +  + +  GG L P  ++L++RG+KTL +R+++  + +  +AE L  HPK
Sbjct: 209 VVNSPQLAEDLHFVQNSTGGILGPQDSFLLLRGLKTLGIRMEEHETNSRAIAEFLNNHPK 268

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V +VYYPGL SH  H +A +Q  GFG ++SF++D +  T  K ++ L+   +A S G  E
Sbjct: 269 VNKVYYPGLASHQNHELATEQANGFGAIISFDVDSE-ETLNKVLERLQYFTLAESLGAVE 327

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           S++  P+ M++  +    R   GI D L+R S G+ED ED+  D+ QAL
Sbjct: 328 SLISIPSQMTHASIPADRRKELGITDTLIRISVGIEDGEDLIEDLAQAL 376



>gb:AE015625_316203 Shewanella oneidensis MR-1 section 174 of 457 of
           the complete genome.>gb:AE014299_951800 Shewanella
           oneidensis MR-1 complete genome.
          Length = 397

 Score =  187 bits (475), Expect = 3e-46
 Identities = 99/229 (43%), Positives = 142/229 (62%), Gaps = 1/229 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISGP 742
           D+  ++ +         +D TF TPL Q+ +ALG D+V+HSATK++ GH DV+AG + G 
Sbjct: 168 DLSAIAAIAKRHSLTSIVDNTFMTPLLQQPIALGIDVVVHSATKYLNGHGDVIAGIVCGS 227

Query: 741 E-KLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
           E +L  V   +   +G  ++P+ A+LI+RG+KTL +R+Q+   +A R+AE LE HP V R
Sbjct: 228 EAQLHRVKYEILKDIGAVMSPHDAWLILRGLKTLDVRLQRHCESAQRVAEFLEQHPAVTR 287

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           VYYPGL SH  H    +QM   GGV++FE+  D      FV  LK+  IA S G  ES++
Sbjct: 288 VYYPGLKSHSGHRFIGQQMRRAGGVIAFELAADFTQAMAFVGNLKLFSIAVSLGDAESLI 347

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
             PA M++   +   RAA GI DNL+R S G+ED +D+ AD+ QAL  +
Sbjct: 348 QHPASMTHSPYSPEARAAAGIGDNLLRISVGLEDCDDIIADLSQALAAL 396



>gb:BC067624_2554796 Danio rerio cystathionase (cystathionine
           gamma-lyase), mRNA (cDNA clone MGC:85785 IMAGE:6961011),
           complete cds.
          Length = 400

 Score =  187 bits (474), Expect = 3e-46
 Identities = 100/231 (43%), Positives = 148/231 (64%), Gaps = 3/231 (1%)
 Frame = -1

Query: 930 RCVDIELVSRLCHE--KGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG 757
           + VDI+  + + H+  K  +V +D TF +   Q+ LALGAD+ ++SATK++ GH+DV+ G
Sbjct: 163 KVVDIQACADIVHKHNKDTIVVVDNTFMSAYFQRPLALGADICMYSATKYMNGHSDVVMG 222

Query: 756 CIS-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH 580
            IS   + L   ++ L + LG   +P   Y+  RG+KTLHLR++Q    AL  A+ LEA 
Sbjct: 223 LISLSRDDLYERLKFLQNSLGAVPSPFDCYMCNRGLKTLHLRMKQHFKNALAAAQFLEAD 282

Query: 579 PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG 400
           P+V RV +PGLPSHP+H + K+Q TG  G+++F I G L   + F+  LK+  +A S GG
Sbjct: 283 PRVDRVIFPGLPSHPQHELTKRQCTGCPGMITFYIKGKLEHASTFLSNLKLFALAESLGG 342

Query: 399 CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
            ES+ + PAIM++  + + ER   GI D L+R S G+ED ED+ AD+ QAL
Sbjct: 343 YESLAEHPAIMTHASVCEEERKKLGISDTLIRLSVGLEDEEDIIADLDQAL 393



>gb:BC056538_2551812 Danio rerio cystathionase (cystathionine
           gamma-lyase), mRNA (cDNA clone MGC:66001 IMAGE:6792913),
           complete cds.
          Length = 400

 Score =  187 bits (474), Expect = 3e-46
 Identities = 100/231 (43%), Positives = 148/231 (64%), Gaps = 3/231 (1%)
 Frame = -1

Query: 930 RCVDIELVSRLCHE--KGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG 757
           + VDI+  + + H+  K  +V +D TF +   Q+ LALGAD+ ++SATK++ GH+DV+ G
Sbjct: 163 KVVDIQACADIVHKHNKDTIVVVDNTFMSAYFQRPLALGADICMYSATKYMNGHSDVVMG 222

Query: 756 CIS-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH 580
            IS   + L   ++ L + LG   +P   Y+  RG+KTLHLR++Q    AL  A+ LEA 
Sbjct: 223 LISLSRDDLYERLKFLQNSLGAVPSPFDCYMCNRGLKTLHLRMKQHFKNALAAAQFLEAD 282

Query: 579 PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG 400
           P+V RV +PGLPSHP+H + K+Q TG  G+++F I G L   + F+  LK+  +A S GG
Sbjct: 283 PRVDRVIFPGLPSHPQHELTKRQCTGCPGMITFYIKGKLEHASTFLSNLKLFALAESLGG 342

Query: 399 CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
            ES+ + PAIM++  + + ER   GI D L+R S G+ED ED+ AD+ QAL
Sbjct: 343 YESLAEHPAIMTHASVCEEERKKLGISDTLIRLSVGLEDEEDIIADLDQAL 393



>pir|F72511|F72511 probable cystathionine gamma-synthase APE2068 -
           Aeropyrum pernix (strain K1)>gb:BA000002_652822
           Aeropyrum pernix K1 DNA, complete genome.
          Length = 389

 Score =  187 bits (474), Expect = 3e-46
 Identities = 100/218 (45%), Positives = 139/218 (63%), Gaps = 2/218 (0%)
 Frame = -1

Query: 885 GALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISGP-EKLVSVVRNLH 709
           G  V +D TFATP+  + L  GA   L S TK+I GHNDV+ G +SG  E+ +  + N+ 
Sbjct: 172 GVRVVVDNTFATPIAYRPLERGAHYSLESLTKYIAGHNDVVGGSLSGRVEEDLEPLWNMR 231

Query: 708 HILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEH 529
            ILG  + P  AYL  RGMKTL  R + Q+  A+ +AE LE+H KV++VYYPGL SHP+H
Sbjct: 232 KILGTIMQPIDAYLAWRGMKTLKARFEAQSRAAVEVAEWLESHRKVKKVYYPGLSSHPDH 291

Query: 528 HIAKKQMTG-FGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDL 352
            +A++++ G +G VVSFEI+G      K +  LK+   +PSFGG E+I+  PAI S+ +L
Sbjct: 292 ELARRELNGLYGAVVSFEIEGGREEVFKLLSRLKLVTPSPSFGGVETIISYPAISSHSNL 351

Query: 351 TQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
              ER+  G+ D L+R S G+ED  D+  D+ QAL  I
Sbjct: 352 DPLERSELGVTDGLLRLSVGLEDVSDIIDDLSQALSAI 389



>sp|Q9ZMW7|METB_HELPJ Cystathionine gamma-synthase (EC 2.5.1.48)
           (CGS) (O-succinylhomoserine
           (Thiol)-lyase).>pir|D71973|D71973 probable cystathionine
           gamma-synthase - Helicobacter pylori  (strain
           J99)>gb:AE001449_35092 Helicobacter pylori, strain J99
           section 10 of 132 of the complete
           genome.>gb:AE001439_883862 Helicobacter pylori, strain
           J99 complete genome.
          Length = 380

 Score =  187 bits (474), Expect = 3e-46
 Identities = 100/232 (43%), Positives = 141/232 (60%), Gaps = 1/232 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           +  D+   + +  E   L  +D TFATP  Q  L LG D+V H+ TK++GGH+DV+AG +
Sbjct: 149 KITDLAQCASVAKEHNLLTIVDNTFATPYCQNPLLLGTDIVAHNGTKYLGGHSDVVAGLV 208

Query: 750 S-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
           +   E L        + +GG L    ++L+ RG+KTL LR++     AL +AE LE HPK
Sbjct: 209 TTNNEALAQEFDFFQNAIGGVLGLQDSWLLQRGIKTLGLRMEAHQKNALCVAEFLEKHPK 268

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V RVYYPGLP+HP H +AK QM GF G+ SF +  D    A FV++LK+  +  S GG E
Sbjct: 269 VERVYYPGLPTHPNHELAKAQMRGFSGMFSFTLKNDSEAVA-FVESLKLFILGESLGGVE 327

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           S+V  PA+M++  + +A+R A GI D LVR S G+E  +D+  D+ QA   I
Sbjct: 328 SLVGIPALMTHACIPKAQREAAGIRDGLVRLSVGIEHEQDLLEDLDQAFAKI 379



>sp|P13254|MEGL_PSEPU Methionine gamma-lyase (EC 4.4.1.11)
           (L-methioninase).>pir|JC4174|JC4174 methionine
           gamma-lyase (EC 4.4.1.11) - Pseudomonas
           putida>gb:D88554_121091 Pseudomonas putida gene for
           L-methionine gamma-lyase, complete cds.>gb:D89015_121188
           Pseudomonas putida genes for MdeR,MdeA and MdeB,complete
           cds.>gb:AX069347_1460537 Sequence 11 from Patent
           WO0102600.
          Length = 398

 Score =  187 bits (474), Expect = 3e-46
 Identities = 97/228 (42%), Positives = 149/228 (65%), Gaps = 2/228 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISGP 742
           DI  V+++  + GA V +D T+ TP  Q+ L LGADLV+HSATK++ GH D+ AG + G 
Sbjct: 168 DIAGVAKIARKHGATVVVDNTYCTPYLQRPLELGADLVVHSATKYLSGHGDITAGIVVGS 227

Query: 741 EKLVSVVR--NLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVR 568
           + LV  +R   L  + G  L+P+ A L++RG+KTL+LR+ +  + A  +AE L   P+V 
Sbjct: 228 QALVDRIRLQGLKDMTGAVLSPHDAALLMRGIKTLNLRMDRHCANAQVLAEFLARQPQVE 287

Query: 567 RVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESI 388
            ++YPGL S P++ +A++QM+  GG+++FE+ G +    +F++AL++   A S G  ES+
Sbjct: 288 LIHYPGLASFPQYTLARQQMSQPGGMIAFELKGGIGAGRRFMNALQLFSRAVSLGDAESL 347

Query: 387 VDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
              PA M++   T  ERA YGI + LVR S G+ED +D+ ADV QAL+
Sbjct: 348 AQHPASMTHSSYTPEERAHYGISEGLVRLSVGLEDIDDLLADVQQALK 395



>gb:BC082653_2562799 Xenopus laevis hypothetical LOC494673, mRNA
           (cDNA clone MGC:81937 IMAGE:7009628), complete cds.
          Length = 398

 Score =  186 bits (473), Expect = 4e-46
 Identities = 98/228 (42%), Positives = 149/228 (65%), Gaps = 2/228 (0%)
 Frame = -1

Query: 924 VDIELVSRLCHE-KGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCIS 748
           +DI+  + + H+ K  ++ +D TF +   Q+ LALGAD+ ++SATK++ GH+DV+ G +S
Sbjct: 160 IDIKGCADIVHKHKDIILAVDNTFLSAYFQRPLALGADICMYSATKYMNGHSDVVMGLVS 219

Query: 747 -GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
              +KL   ++ L + LG   +P   YL  RG+KTLHLR+QQ    AL +A+ LEA P+V
Sbjct: 220 VNCDKLYEKLKFLQNSLGAIPSPFDCYLCNRGLKTLHLRMQQHFQNALTVAKFLEADPRV 279

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
            +V YPGLPSHP++ + K+Q TG  G+++F I G L     F+ ++K+  +A S GG ES
Sbjct: 280 DKVLYPGLPSHPQYELTKRQCTGVSGMITFYIKGTLEHAKTFLKSIKVFALAESLGGYES 339

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           + + PAIM++  + + ERAA  I D L+R S G+ED ED+  D+ QAL
Sbjct: 340 LAEHPAIMTHASVPEEERAALNISDTLIRLSVGLEDVEDLIEDLDQAL 387



>pir|H84236|H84236 cystathionine gamma-synthase [imported] -
           Halobacterium sp. NRC-1>gb:AE005022_62420 Halobacterium
           sp. NRC-1 section 53 of 170 of the complete
           genome.>gb:AE004437_887339 Halobacterium sp. NRC-1
           complete genome.
          Length = 405

 Score =  186 bits (473), Expect = 4e-46
 Identities = 97/230 (42%), Positives = 146/230 (63%), Gaps = 2/230 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC-ISG 745
           DI  ++ +  + G L  +D TF +P  Q+ LALGAD+V HS TK++ GH+D + G  ++ 
Sbjct: 169 DIAAIADITDDAGVLFGVDNTFLSPYFQQPLALGADVVAHSTTKYLNGHSDAVGGALVTN 228

Query: 744 PEKLVSVVRNLHHI-LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVR 568
            + L   V  L  + LG  L P  AYL++RG+KTL  R++   + AL +AE L  H +V 
Sbjct: 229 NDALADSVEFLQQVGLGNMLAPFDAYLVLRGIKTLAPRMRDHEANALAIAEYLADHDRVT 288

Query: 567 RVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESI 388
            V+YPGL SHP+H +A  Q +G+GG++SFE+DGDL    +F+DAL    +A S GG ES+
Sbjct: 289 AVHYPGLDSHPQHDLADAQQSGYGGILSFELDGDLADAKRFLDALDEFNLAVSVGGVESL 348

Query: 387 VDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           V+ PA M++  + + +R A GI D+L+R S G+E  ED+ AD+ +  E +
Sbjct: 349 VELPAGMTHEPIPKPDREAMGITDSLIRVSVGIEAIEDLIADLDRGFEAV 398



>gb:AX062018_1458710 Sequence 7 from Patent WO0100853.
          Length = 403

 Score =  186 bits (472), Expect = 6e-46
 Identities = 92/234 (39%), Positives = 147/234 (62%), Gaps = 3/234 (1%)
 Frame = -1

Query: 930 RCVDIELVSRLCH-EKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC 754
           + +D+E V +  H ++G LV  D TF +P+    +  G D+V+HSATK+I GH DV+AG 
Sbjct: 169 KIIDMERVCKEAHSQEGVLVIADNTFCSPMITNPVDFGVDVVVHSATKYINGHTDVVAGL 228

Query: 753 ISGPEKLVSVVR--NLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH 580
           I G   L+  +R   +  I G  ++P+ A+LI RG+ TL++R++ ++  A+++AE L++H
Sbjct: 229 ICGKADLLQQIRMVGIKDITGSVISPHDAWLITRGLSTLNIRMKAESENAMKVAEYLKSH 288

Query: 579 PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG 400
           P V +VYYPG   H  H IAKKQM  +G +++F +        K +D LK+  +A S GG
Sbjct: 289 PAVEKVYYPGFEDHEGHDIAKKQMRMYGSMITFILKSGFEGAKKLLDNLKLITLAVSLGG 348

Query: 399 CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           CES++  PA M++  + + ER A GI D ++R S G+ED +++ AD  Q L+ +
Sbjct: 349 CESLIQHPASMTHAVVPKEEREAAGITDGMIRLSVGIEDADELIADFKQGLDAL 402



>gb:AE017333_448685 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_858484 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 380

 Score =  185 bits (470), Expect = 1e-45
 Identities = 97/229 (42%), Positives = 140/229 (61%), Gaps = 1/229 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           +  DI+  +    +   L+ +D TF TP  Q  ++LGAD+VLHSATK++GGH+DV+ G +
Sbjct: 149 KITDIKKTAETAKKHDLLLIVDNTFYTPYFQNPISLGADIVLHSATKYLGGHSDVVGGLV 208

Query: 750 SGPEK-LVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
               K L   +  + +  GG L P  ++L++RGMKTL LR++     A ++A  L+ HP 
Sbjct: 209 VAASKELAEEIHFIQNSTGGILGPQDSWLLMRGMKTLGLRMEAHEQNARKIAAFLDDHPA 268

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V++VYYPGLPSHP H +AK+Q TGFGG++SF+I G        +  LK   IA S G  E
Sbjct: 269 VKKVYYPGLPSHPGHELAKRQSTGFGGMISFDI-GKEENVDLVLGRLKWFTIAESLGAVE 327

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           S++  PA M++  +    R   GI D L+R S GVED +D+  D+ QAL
Sbjct: 328 SLISVPARMTHASIPPERRLELGITDGLIRISAGVEDIDDLLEDLQQAL 376



>pir|A69974|A69974 cystathionine gamma-synthase homolog yrhB -
           Bacillus subtilis>gb:BSU93874_751913 Bacillus subtilis
           cysteine synthase (yrhA), cystathionine gamma-lyase
           (yrhB), YrhC (yrhC), YrhD (yrhD), formate dehydrogenase
           chain A (yrhE), YrhF (yrhF), formate dehydrogenase
           (yrhG), YrhH (yrhH), regulatory protein (yrhI),
           cytochrome P450 102 (yrhJ), YrhK (yrhK), hypothetical
           protein YrhL (yrhL), putative anti-SigV factor (yrhM),
           RNA polymerase sigma factor SigV (sigV) and YrhO (yrhO)
           genes, complete cds, and YrhP (yrhP) gene, partial
           cds.>gb:BSUB0014_754690 Bacillus subtilis complete
           genome (section 14 of 21): from 2613658 to 2812830.
          Length = 379

 Score =  185 bits (470), Expect = 1e-45
 Identities = 96/232 (41%), Positives = 147/232 (63%), Gaps = 1/232 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           +  D+ L++ +  + G L+ +D TF TP  Q+ L LGAD+VLHSATK++GGH+DV+ G +
Sbjct: 149 KITDLTLMADIAKKAGVLLIVDNTFNTPYFQQPLTLGADIVLHSATKYLGGHSDVVGGLV 208

Query: 750 -SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
            +  ++L   +  + +  GG L P  ++L++RG+KTL LR++  +  A ++A  LE HP 
Sbjct: 209 VTASKELGEELHFVQNSTGGVLGPQDSWLLMRGIKTLGLRMEAIDQNARKIASFLENHPA 268

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V+ +YYPG  +HP H +AK Q  GFGG++SF+I  +    A F+  LK+  IA S G  E
Sbjct: 269 VQTLYYPGSSNHPGHELAKTQGAGFGGMISFDIGSEERVDA-FLGNLKLFTIAESLGAVE 327

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           S++  PA M++  + +  R   GI D L+R S G+ED ED+  D+ QALE I
Sbjct: 328 SLISVPARMTHASIPRERRLELGITDGLIRISVGIEDAEDLLEDIGQALENI 379



>gb:A69681_1450470 Sequence 11 from Patent WO9807872.
          Length = 398

 Score =  185 bits (469), Expect = 1e-45
 Identities = 97/234 (41%), Positives = 148/234 (63%), Gaps = 3/234 (1%)
 Frame = -1

Query: 930 RCVDIE-LVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC 754
           + +DIE  V +   +K  LV +D TFA+P+    L LG D+V+HSATK+I GH DV+AG 
Sbjct: 165 KVIDIEDAVKQARKQKDILVIVDNTFASPILTNPLDLGVDIVVHSATKYINGHTDVVAGL 224

Query: 753 ISGPEKLVSVVRN--LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH 580
           +     +++ V++  +  I G  ++P+ A+LI RG  TL +RV++    A ++AE L  H
Sbjct: 225 VCSRADIIAKVKSQGIKDITGAIISPHDAWLITRGTLTLDMRVKRAAENAQKVAEFLHEH 284

Query: 579 PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG 400
             V++VYYPGLP HP H IAKKQM  FG +++F++DG L    K +D   +  +A S GG
Sbjct: 285 KAVKKVYYPGLPDHPGHEIAKKQMKMFGSMIAFDVDG-LEKAKKVLDNCHVVSLAVSLGG 343

Query: 399 CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
            ES++  PA M++  + + ER A G+ DNL+R S G E+ +D+  D+ QAL+ +
Sbjct: 344 PESLIQHPASMTHAGVPKEEREAAGLTDNLIRLSVGCENVQDIIDDLKQALDLV 397



>gb:TVMGL2_1401235 Trichomonas vaginalis mgl2
           gene.>gb:A69673_1450468 Sequence 3 from Patent
           WO9807872.
          Length = 398

 Score =  185 bits (469), Expect = 1e-45
 Identities = 97/234 (41%), Positives = 148/234 (63%), Gaps = 3/234 (1%)
 Frame = -1

Query: 930 RCVDIE-LVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC 754
           + +DIE  V +   +K  LV +D TFA+P+    L LG D+V+HSATK+I GH DV+AG 
Sbjct: 165 KVIDIEDAVKQARKQKDILVIVDNTFASPILTNPLDLGVDIVVHSATKYINGHTDVVAGL 224

Query: 753 ISGPEKLVSVVRN--LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH 580
           +     +++ V++  +  I G  ++P+ A+LI RG  TL +RV++    A ++AE L  H
Sbjct: 225 VCSRADIIAKVKSQGIKDITGAIISPHDAWLITRGTLTLDMRVKRAAENAQKVAEFLHEH 284

Query: 579 PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG 400
             V++VYYPGLP HP H IAKKQM  FG +++F++DG L    K +D   +  +A S GG
Sbjct: 285 KAVKKVYYPGLPDHPGHEIAKKQMKMFGSMIAFDVDG-LEKAKKVLDNCHVVSLAVSLGG 343

Query: 399 CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
            ES++  PA M++  + + ER A G+ DNL+R S G E+ +D+  D+ QAL+ +
Sbjct: 344 PESLIQHPASMTHAGVPKEEREAAGLTDNLIRLSVGCENVQDIIDDLKQALDLV 397



>gb:BX571860_785382 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 2/17.
          Length = 384

 Score =  185 bits (469), Expect = 1e-45
 Identities = 92/231 (39%), Positives = 147/231 (63%), Gaps = 2/231 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC- 754
           +  D+  ++++      +   D TFA+P  Q+ + LG D+V+HSATK++ GH+DV+AG  
Sbjct: 150 KLADLTAIAQIAQRHSIISVADNTFASPYLQRPVDLGFDIVVHSATKYLNGHSDVIAGLA 209

Query: 753 -ISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
            +    +L   +  L + +GG L+P +++L++RGM+TL LR+Q+   +A ++A  LE  P
Sbjct: 210 VVGKNAELAEKLGFLQNSVGGVLDPFSSFLVLRGMRTLALRMQRHIDSASKIAHWLEQQP 269

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
           ++  V+YPGL SHP+H +AK+QM GFGG++S  + GD     + +  LK+  +A S GG 
Sbjct: 270 QIETVFYPGLASHPQHELAKRQMKGFGGMISVHLKGDDDYARRLIQELKLFTLAESLGGV 329

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           ES++ QP  M++  +   +R A GI   LVR S G+ED ED+ AD+ QALE
Sbjct: 330 ESLISQPFSMTHASIPLEKRLASGITPQLVRISVGIEDAEDLIADLAQALE 380



>gb:BA000043_737444 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 393

 Score =  185 bits (469), Expect = 1e-45
 Identities = 100/232 (43%), Positives = 140/232 (60%), Gaps = 1/232 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG-C 754
           +  DI+ V +L    G L  +D TF TP  Q+ L LG D+VLHSATKF+ GH+DV+AG  
Sbjct: 153 KVTDIQGVVKLAKAHGCLTFLDNTFMTPALQRPLDLGVDVVLHSATKFLAGHSDVVAGLA 212

Query: 753 ISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
           +   E+L   +  L +  G  L    A+L++RG+KTLH+R++Q + +A  +A+ L  HPK
Sbjct: 213 VVKDEELGKELYKLQNAFGAVLGVQDAWLVLRGLKTLHVRLKQSSESAAAIAKYLACHPK 272

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V +VYYPGL +HP H I + Q  GFG V+SF +  D      FV  +++P  A S G  E
Sbjct: 273 VEKVYYPGLENHPGHDIQRHQAAGFGAVLSFRL-ADEEAARTFVRNVRLPVFAVSLGAVE 331

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           SI+  PA MS+  + + ER   GI D L+R S G+ED  D+ AD  QAL  +
Sbjct: 332 SILSHPAKMSHAAMPKEERLRRGITDGLLRLSVGLEDVNDLIADFEQALSFV 383



>gb:AY879312_1966045 Macaca fascicularis cystathionine gamma-lyase
           mRNA, complete cds.
          Length = 405

 Score =  184 bits (468), Expect = 2e-45
 Identities = 96/231 (41%), Positives = 152/231 (65%), Gaps = 2/231 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCI-DGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC 754
           + +DIE  + + H++G ++ + D TF +P  Q+ LALGAD+ + SATK++ GH+DV+ G 
Sbjct: 165 KMIDIEACAHIVHKRGDIILVVDNTFMSPYFQRPLALGADICMCSATKYMNGHSDVVMGL 224

Query: 753 IS-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
           +S   E+L + +R L + LG   +P   YL  RG+KTLH+R+++     + +A+ LE++P
Sbjct: 225 VSVNCERLHNRLRFLQNSLGAVPSPLDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNP 284

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
            V +V YPGLPSHP+H +AK+Q TG  G+++F I G L     F+  LK+  +A S GG 
Sbjct: 285 GVEKVIYPGLPSHPQHELAKRQCTGCTGMITFYIKGTLQHAEIFLKNLKLFTLAESLGGF 344

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           ES+V+ PAIM++  + + +R   GI D L+R S G+ED +D+  D+ QAL+
Sbjct: 345 ESLVELPAIMTHASVPKNDRDVLGISDTLIRLSVGLEDEKDLLEDLDQALK 395



>gb:AB125160_1873837 Macaca fascicularis CTH mRNA for cystathionase,
           complete cds.
          Length = 405

 Score =  184 bits (468), Expect = 2e-45
 Identities = 96/231 (41%), Positives = 152/231 (65%), Gaps = 2/231 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCI-DGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC 754
           + +DIE  + + H++G ++ + D TF +P  Q+ LALGAD+ + SATK++ GH+DV+ G 
Sbjct: 165 KMIDIEACAHIVHKRGDIILVVDNTFMSPYFQRPLALGADICMCSATKYMNGHSDVVMGL 224

Query: 753 IS-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
           +S   E+L + +R L + LG   +P   YL  RG+KTLH+R+++     + +A+ LE++P
Sbjct: 225 VSVNCERLHNRLRFLQNSLGAVPSPLDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNP 284

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
            V +V YPGLPSHP+H +AK+Q TG  G+++F I G L     F+  LK+  +A S GG 
Sbjct: 285 GVEKVIYPGLPSHPQHELAKRQCTGCTGMITFYIKGTLQHAEIFLKNLKLFTLAESLGGF 344

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           ES+V+ PAIM++  + + +R   GI D L+R S G+ED +D+  D+ QAL+
Sbjct: 345 ESLVELPAIMTHASVPKNDRDVLGISDTLIRLSVGLEDEKDLLEDLDQALK 395



>gb:CP000001_854715 Bacillus cereus ZK, complete genome.
          Length = 377

 Score =  184 bits (468), Expect = 2e-45
 Identities = 94/229 (41%), Positives = 143/229 (62%), Gaps = 1/229 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           +  DI+ +S L  EK  L  ID TF TP  Q  ++LGAD+VLHSATK++GGH+DV+AG +
Sbjct: 149 KITDIKKISTLAKEKDLLTIIDNTFMTPYWQSPISLGADIVLHSATKYLGGHSDVVAGLV 208

Query: 750 S-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
                +L   +  + +  GG L P  ++L++RG+KTL +R+++  + +  +AE L  HPK
Sbjct: 209 VVNSPQLAEDLHFVQNSTGGILGPQDSFLLLRGLKTLGIRMEEHETNSRAIAEFLNNHPK 268

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V +VYYPGL SH  H +A +Q  GFG ++SF++D +  T  K ++ L+   +A S G  E
Sbjct: 269 VNKVYYPGLASHQNHELAAEQANGFGAIISFDVDSE-ETLNKVLERLQYFTLAESLGAVE 327

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           S++  P+ M++  +    R   GI D L+R S G+ED ED+  D+ QAL
Sbjct: 328 SLISIPSQMTHASIPADRRKELGITDTLIRISVGIEDGEDLIEDLAQAL 376



>gb:BX294144_768603 Pirellula sp. strain 1 complete genome; segment
           12/24.
          Length = 397

 Score =  184 bits (468), Expect = 2e-45
 Identities = 96/238 (40%), Positives = 150/238 (63%), Gaps = 10/238 (4%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCIS-G 745
           D+  ++RL   KG L  +D TF TP   + L  G D+V+HSATK++GGH+D L G ++  
Sbjct: 159 DLPAIARLAKSKGILSGVDNTFGTPALLRPLDFGIDIVMHSATKYLGGHSDCLGGTLAVA 218

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
             +L   +  + +  G  L+P +++LI RG+KTL LRV++Q+ TALR+A+ LEAHP VR 
Sbjct: 219 DSELYDQLYFVQNATGAVLDPMSSFLIARGLKTLDLRVREQSRTALRLAKWLEAHPMVRS 278

Query: 564 VYYPGLPSHPEHHIAKK---------QMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAP 412
           V YPGLPSH +H +A++         + T FG +++FE+D  L    +   + ++ ++A 
Sbjct: 279 VLYPGLPSHNQHELARQLFGQHQSDSEETHFGAMITFELDATLDQVREVCQSTELFHLAV 338

Query: 411 SFGGCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           S G  ES+++QPA MS+       RAA+GI D+L+R S G+E   D++AD+ +A+  I
Sbjct: 339 SLGAVESLIEQPATMSHASYAPEARAAHGITDSLIRLSVGLESPSDLEADLERAIAII 396



>gb:AE017355_465399 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.
          Length = 377

 Score =  184 bits (468), Expect = 2e-45
 Identities = 94/229 (41%), Positives = 143/229 (62%), Gaps = 1/229 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           +  DI+ +S L  EK  L  ID TF TP  Q  ++LGAD+VLHSATK++GGH+DV+AG +
Sbjct: 149 KITDIKKISTLAKEKDLLTIIDNTFMTPYWQSPISLGADIVLHSATKYLGGHSDVVAGLV 208

Query: 750 S-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
                +L   +  + +  GG L P  ++L++RG+KTL +R+++  + +  +AE L  HPK
Sbjct: 209 VVNSPQLAEDLHFVQNSTGGILGPQDSFLLLRGLKTLGIRMEEHETNSRAIAEFLNNHPK 268

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V +VYYPGL SH  H +A +Q  GFG ++SF++D +  T  K ++ L+   +A S G  E
Sbjct: 269 VNKVYYPGLASHQNHELATEQANGFGAIISFDVDSE-ETLNKVLERLQYFTLAESLGAVE 327

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           S++  P+ M++  +    R   GI D L+R S G+ED ED+  D+ QAL
Sbjct: 328 SLISIPSQMTHASIPADRRKELGITDTLIRISVGIEDGEDLIEDLAQAL 376



>gb:AE017012_379235 Bacillus cereus ATCC 14579 section 15 of 18 of
           the complete genome.>gb:AE016877_1019485 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 377

 Score =  184 bits (468), Expect = 2e-45
 Identities = 94/229 (41%), Positives = 143/229 (62%), Gaps = 1/229 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           +  DI+ +S L  EK  L  ID TF TP  Q  ++LGAD+VLHSATK++GGH+DV+AG +
Sbjct: 149 KITDIKKISTLAKEKDLLTIIDNTFMTPYWQSPISLGADIVLHSATKYLGGHSDVVAGLV 208

Query: 750 S-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
                +L   +  + +  GG L P  ++L++RG+KTL +R+++  + +  +AE L  HPK
Sbjct: 209 VVNSPQLAEDLHFVQNSTGGILGPQDSFLLLRGLKTLGIRMEEHETNSRAIAEFLNNHPK 268

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V +VYYPGL SH  H +A +Q  GFG ++SF++D +  T  K ++ L+   +A S G  E
Sbjct: 269 VNKVYYPGLESHQNHELATEQANGFGAIISFDVDSE-ETLNKVLEKLQYFTLAESLGAVE 327

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           S++  P+ M++  +    R   GI D L+R S G+ED ED+  D+ QAL
Sbjct: 328 SLISIPSQMTHASIPADRRKELGITDTLIRISVGIEDGEDLIEDLAQAL 376



>gb:LRE293860_142092 Lactobacillus reuteri mapA operon, strain 104R.
          Length = 380

 Score =  184 bits (467), Expect = 2e-45
 Identities = 91/229 (39%), Positives = 147/229 (64%), Gaps = 1/229 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG-CISG 745
           DI+ ++ +  + G    +D TFATP NQ+ L LGAD+V+HSATK++GGH+DV+AG  ++ 
Sbjct: 152 DIKAIADIAKKHGVKTIVDNTFATPYNQQPLTLGADIVVHSATKYLGGHSDVVAGLAVTN 211

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
            +++   +  L + +G TL P+ ++L+ RGMKTL  R++     A  +   L+    + +
Sbjct: 212 DDEIAEQLAFLQNSIGSTLGPDDSWLLQRGMKTLGARMRVHQENANEVINFLQNDDHIGK 271

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           +YYPGL   P H +A KQM  FG ++SFE+  D +   KFV++L++  +A S GG ES++
Sbjct: 272 IYYPGLKDFPGHEVAAKQMRNFGAMISFELK-DSLDAKKFVESLQLIDLAESLGGIESLI 330

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           + PA+M++  + +  R   GI D L+R S G+ED ED+ AD+ QAL+ +
Sbjct: 331 EVPAVMTHGSIPREIRLENGIKDELIRLSVGIEDPEDIIADLQQALKKL 379



>pir|T21246|T21246 hypothetical protein F22B8.6 - Caenorhabditis
           elegans>gb:CEF22B8_1362823 Caenorhabditis elegans cosmid
           F22B8, complete sequence.
          Length = 392

 Score =  184 bits (467), Expect = 2e-45
 Identities = 90/213 (42%), Positives = 138/213 (64%), Gaps = 1/213 (0%)
 Frame = -1

Query: 879 LVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC-ISGPEKLVSVVRNLHHI 703
           +V +D TF TP  Q+ L+LGAD+ +HS TK+I GH+D++ G  I+  ++    +  +   
Sbjct: 174 VVVVDNTFMTPYFQRPLSLGADIAVHSITKYINGHSDIIMGAAITNNDEFQQHLHFMQRA 233

Query: 702 LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHI 523
           +GG  +P   +L+ RG+KTLH+R++     AL +A+ LEAH  +  V YP LPSHP+H +
Sbjct: 234 IGGVPSPFDCFLVNRGLKTLHVRMKAHFENALAIAKFLEAHDCIESVLYPALPSHPQHTV 293

Query: 522 AKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQA 343
             KQ  G  G++SF + G+L  +  F+ ALK+  +A S GGCES+ + P+IM++  +  A
Sbjct: 294 HVKQTKGMSGMISFYLKGELCQSRAFLSALKVFTLAESLGGCESLAELPSIMTHASVPSA 353

Query: 342 ERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
            RA  GI DNL+R S G+ED +D+ AD+ QAL+
Sbjct: 354 TRAELGITDNLIRISVGIEDLDDLIADLDQALK 386



>gb:A69679_1450469 Sequence 9 from Patent WO9807872.
          Length = 396

 Score =  184 bits (466), Expect = 3e-45
 Identities = 92/234 (39%), Positives = 146/234 (62%), Gaps = 3/234 (1%)
 Frame = -1

Query: 930 RCVDIELVSRLCH-EKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC 754
           + +D+E V +  H ++G LV  D TF +P+    +  G D+V+HSATK+I GH DV+AG 
Sbjct: 162 KIIDMERVCKDAHSQEGVLVIADNTFCSPMITNPVDFGVDVVVHSATKYINGHTDVVAGL 221

Query: 753 ISGPEKLVSVVR--NLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH 580
           I G   L+  +R   +  I G  ++P+ A+LI RG+ TL++R++ ++  A+++AE L++H
Sbjct: 222 ICGKADLLQQIRMVGIKDITGSVISPHDAWLITRGLSTLNIRMKAESENAMKVAEYLKSH 281

Query: 579 PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG 400
           P V +VYYPG   H  H IAKKQM   G +++F +        K +D LK+  +A S GG
Sbjct: 282 PAVEKVYYPGFEDHEGHDIAKKQMRMSGSMITFILKSGFEGAKKLLDNLKLITLAVSLGG 341

Query: 399 CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           CES++  PA M++  + + ER A GI D ++R S G+ED +++ AD  Q L+ +
Sbjct: 342 CESLIQHPASMTHAVVPKEEREAAGITDGMIRLSVGIEDADELIADFKQGLDAL 395



>gb:TVMGL1_1401234 Trichomonas vaginalis mgl1
           gene.>gb:A69671_1450467 Sequence 1 from Patent
           WO9807872.>gb:AX062020_1458711 Sequence 9 from Patent
           WO0100853.
          Length = 396

 Score =  184 bits (466), Expect = 3e-45
 Identities = 92/234 (39%), Positives = 146/234 (62%), Gaps = 3/234 (1%)
 Frame = -1

Query: 930 RCVDIELVSRLCH-EKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC 754
           + +D+E V +  H ++G LV  D TF +P+    +  G D+V+HSATK+I GH DV+AG 
Sbjct: 162 KIIDMERVCKDAHSQEGVLVIADNTFCSPMITNPVDFGVDVVVHSATKYINGHTDVVAGL 221

Query: 753 ISGPEKLVSVVR--NLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH 580
           I G   L+  +R   +  I G  ++P+ A+LI RG+ TL++R++ ++  A+++AE L++H
Sbjct: 222 ICGKADLLQQIRMVGIKDITGSVISPHDAWLITRGLSTLNIRMKAESENAMKVAEYLKSH 281

Query: 579 PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG 400
           P V +VYYPG   H  H IAKKQM   G +++F +        K +D LK+  +A S GG
Sbjct: 282 PAVEKVYYPGFEDHEGHDIAKKQMRMSGSMITFILKSGFEGAKKLLDNLKLITLAVSLGG 341

Query: 399 CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           CES++  PA M++  + + ER A GI D ++R S G+ED +++ AD  Q L+ +
Sbjct: 342 CESLIQHPASMTHAVVPKEEREAAGITDGMIRLSVGIEDADELIADFKQGLDAL 395



>gb:AE017278_425654 Bacillus cereus ATCC 10987, section 15 of 18 of
           the complete genome.>gb:AE017194_1064073 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 377

 Score =  183 bits (465), Expect = 4e-45
 Identities = 94/229 (41%), Positives = 142/229 (62%), Gaps = 1/229 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           +  DI+ +S L  EK  L  ID TF TP  Q  ++LGAD+VLHSATK++GGH+DV+AG +
Sbjct: 149 KITDIKKISTLAKEKDLLTIIDNTFMTPYWQSPISLGADIVLHSATKYLGGHSDVVAGLV 208

Query: 750 S-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
                +L   +  + +  GG L P  ++L++RG+KTL +R+++  + +  +AE L  HPK
Sbjct: 209 VVNSPQLAEDLHFVQNSTGGILGPQDSFLLLRGLKTLGIRMEEHETNSRAIAEFLNNHPK 268

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V +VYYPGL SH  H +A +Q  GFG ++SF++D +  T  K +  L+   +A S G  E
Sbjct: 269 VNKVYYPGLESHQNHELATEQANGFGAIISFDVDSE-ETLNKVLKKLQYFTLAESLGAVE 327

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           S++  P+ M++  +    R   GI D L+R S G+ED ED+  D+ QAL
Sbjct: 328 SLISIPSQMTHASIPADRRKELGITDTLIRISVGIEDGEDLIEDLAQAL 376



>gb:AE017253_417239 Treponema denticola ATCC 35405, section 8 of 10
           of the complete genome.>gb:AE017226_1070835 Treponema
           denticola ATCC 35405, complete genome.
          Length = 401

 Score =  183 bits (464), Expect = 5e-45
 Identities = 98/232 (42%), Positives = 144/232 (62%), Gaps = 4/232 (1%)
 Frame = -1

Query: 921 DIELVSRLCHEKG--ALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCIS 748
           DI  VS++ H       V +D T+ TP  Q+ L LGAD+VLHSATK++ GH DV+AG + 
Sbjct: 168 DIAAVSKIAHAHNPECKVIVDNTYMTPYLQRPLDLGADVVLHSATKYLNGHGDVIAGFVV 227

Query: 747 GPEKLVSVVR--NLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
           G ++ +  VR   +  + G TL P  AYLI RGMKTL +R+++  + A ++AE LE HP 
Sbjct: 228 GKKEFIDQVRFVGVKDMTGSTLGPFEAYLIGRGMKTLDIRMEKHCANAQKVAEFLEKHPA 287

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V  + +PGL S P++ +AKKQM   G +++F + G L      ++++K   IA S G  E
Sbjct: 288 VESIAFPGLKSFPQYELAKKQMKLCGAMIAFTVKGGLEAGKTLINSVKFATIAVSLGDAE 347

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           +++  PA M++   T  ERAA  I + LVR S G+ED ED+ AD+ QAL+ +
Sbjct: 348 TLIQHPASMTHSPYTPEERAASDIAEGLVRLSVGLEDAEDIIADLKQALDKL 399



>gb:AE017333_447158 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_856977 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 391

 Score =  182 bits (463), Expect = 6e-45
 Identities = 100/231 (43%), Positives = 141/231 (61%), Gaps = 1/231 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG-CISG 745
           DI  V +L    G L  +D TF TP  Q+ L LG D+VLHSATKF+ GH+DVL+G  +  
Sbjct: 157 DIRGVVKLAKAHGCLTFLDNTFMTPALQRPLELGVDIVLHSATKFLSGHSDVLSGLAVVK 216

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
            +KL   +  L +  G  L     +L++RG+KTL +R+++ + TA ++AE  E HP V++
Sbjct: 217 DKKLGEELYKLQNSFGAVLGVQDCWLVLRGLKTLQVRLEKASRTAQQLAEFFEKHPAVKQ 276

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           VYYPGL SHP   I K Q  G G V+SFE++ D     + V+ + +P  A S G  ESI+
Sbjct: 277 VYYPGLSSHPGASIHKHQANGAGAVLSFELE-DAEAVKQVVENVSLPVFAVSLGAVESIL 335

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI*G 232
             PA MS+  + + ER   GI D L+R S GVE+ +D++AD  QALE + G
Sbjct: 336 SYPAKMSHAAMPKEERTKRGITDGLLRLSVGVENADDLQADFAQALEAVSG 386



>pir|G96947|G96947 cystathionine gamma-synthase [imported] -
           Clostridium acetobutylicum>gb:AE007554_227731
           Clostridium acetobutylicum ATCC 824 section 42 of 356 of
           the complete genome.>gb:AE001437_1090686 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 384

 Score =  182 bits (463), Expect = 6e-45
 Identities = 93/230 (40%), Positives = 143/230 (62%), Gaps = 1/230 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG-C 754
           +  DI  VS+L  E   L+ +D TF TP  QK L LGAD+VLHS TK++ GHND LAG  
Sbjct: 155 KITDIREVSKLAKEHNTLLIVDNTFMTPYYQKPLELGADIVLHSGTKYLCGHNDALAGFV 214

Query: 753 ISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
           I   E+L+  +R + + +G  L P  ++LI+RG+KTLH+R+ +Q   A+++A  L+ H K
Sbjct: 215 ILNDERLIEKLRFIQNSVGAVLAPFDSWLILRGIKTLHIRLDRQQENAIKIANFLKKHKK 274

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           + +V YPGL  H  H I K + +GFG ++SF +D    T  K ++++K+   A S GG E
Sbjct: 275 ITKVLYPGLEEHVGHDILKSEASGFGAMISFYVDSK-ETVEKVLESVKVIIFAESLGGVE 333

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           S++  P   ++ D+    R   G+ D L+RFS G+E+ +D+  D+ +AL+
Sbjct: 334 SLITYPYTQTHADIPDDIRKRLGVTDKLLRFSVGIENVDDLIKDLDKALQ 383



>gb:AY204396_597043 Leptospirillum ferrooxidans Lfe147p1 gene,
           partial cds.
          Length = 321

 Score =  182 bits (462), Expect = 8e-45
 Identities = 99/228 (43%), Positives = 141/228 (61%), Gaps = 1/228 (0%)
 Frame = -1

Query: 924 VDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISG 745
           +D+E +S    + GA + +D TFATP+ QK L LGAD+V+HSATK++GGH D+L G ++G
Sbjct: 94  IDLEKLSSAAKKVGAPLVVDNTFATPILQKPLVLGADIVVHSATKYLGGHGDLLGGTVTG 153

Query: 744 PEKLVSVVR-NLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVR 568
              L+  +       LG TL+P  A+L++RGMKTL LR+      A+ +AE L  HP V+
Sbjct: 154 KASLIDRLSFEEGSYLGATLSPFNAWLLLRGMKTLPLRMDAHCRGAMMVAEFLSGHPGVK 213

Query: 567 RVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESI 388
            V+YPGL   P H IA  QM GFGG++SF + GD     +    L++  IA S G  ES+
Sbjct: 214 SVHYPGLSKDPGHKIASSQMKGFGGMLSFSL-GDDQRARRVASGLELFKIAVSLGDPESL 272

Query: 387 VDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           ++ PA +S+  +T  ER   GI    +R S G+ED ED+  D+ +ALE
Sbjct: 273 IEHPASLSHRQMTAEERMTLGIDPGFLRVSVGLEDPEDLVMDLKRALE 320



>gb:BX571874_789611 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 16/17.
          Length = 390

 Score =  182 bits (461), Expect = 1e-44
 Identities = 96/232 (41%), Positives = 144/232 (62%), Gaps = 1/232 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R VDI  + +L HE GA V +D TF +P+ QK LALGADLV+HS TK++ GH+DV+AG I
Sbjct: 156 RIVDIAHICQLSHEVGATVIVDNTFLSPVLQKPLALGADLVVHSCTKYLNGHSDVIAGAI 215

Query: 750 -SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
            +  E++ + +    + +G T     +YL++RGM+TL  RV  Q   AL +   L+  P 
Sbjct: 216 IAKDEEVATELAWWANNIGVTGAAFDSYLLLRGMRTLSPRVLLQQKNALELVNYLQQQPL 275

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V++++YP L  HP H IA KQ  GFG ++SFE DG      +F+  LK+  +A S GG E
Sbjct: 276 VKKLFYPALKDHPGHEIACKQQFGFGAMISFEFDGGEQAIRRFLSELKLFTLAESLGGVE 335

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           +++   A M++  ++   RA  GI D+L+R S G+ED +D+ AD+  A + +
Sbjct: 336 TLISHTATMTHAGMSAQARAEAGITDSLLRVSVGIEDSQDLIADLENAFQAV 387



>gb:AE016924_359010 Chromobacterium violaceum ATCC 12472 section 15
           of 16 of the complete genome.>gb:AE016825_1044164
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 381

 Score =  182 bits (461), Expect = 1e-44
 Identities = 95/228 (41%), Positives = 141/228 (61%), Gaps = 2/228 (0%)
 Frame = -1

Query: 924 VDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCIS- 748
           VDI  +S + H     V +D TFATP  Q+ L LGAD+V+HSATK++GGH+DVL G ++ 
Sbjct: 152 VDIAALSAIAHRHNVKVAVDNTFATPYLQQPLLLGADIVVHSATKYLGGHSDVLLGLVAV 211

Query: 747 GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVR 568
             +KL   +R L +  G    P   +L +RG+KTL LR+++   +A ++A  L   P V 
Sbjct: 212 SDDKLHHDIRFLQNAAGAVPGPQDCFLTLRGIKTLALRMERHCDSAEKVAVWLAGQPAVA 271

Query: 567 RVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTA-KFVDALKIPYIAPSFGGCES 391
           +V+YPGLP HP H +AK+QM  FGG++S  +  D    A +    LK+  +A S GG ES
Sbjct: 272 KVFYPGLPEHPGHELAKRQMRRFGGIISIRLQDDSREAASRVAQRLKLFALAESLGGVES 331

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           +V+    MS+  +   ++AA GI++  +R S G+ED +D+ AD+ QAL
Sbjct: 332 LVNHSYTMSHGGMPAEQKAALGIVEGGLRLSIGIEDLDDILADLEQAL 379



>gb:AE016922_358355 Chromobacterium violaceum ATCC 12472 section 13
           of 16 of the complete genome.>gb:AE016825_1043509
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 380

 Score =  182 bits (461), Expect = 1e-44
 Identities = 99/229 (43%), Positives = 145/229 (63%), Gaps = 4/229 (1%)
 Frame = -1

Query: 924 VDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI-- 751
           VD++ VS +      +  +D TFA+P+NQ+ L  G D+V+HSATK++ GH+DV+AG    
Sbjct: 152 VDLQQVSAIARRHKLIGVVDNTFASPVNQRPLDFGFDIVVHSATKYLNGHSDVVAGVAVV 211

Query: 750 --SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
               PE L   +  LH+ +G  L+   ++L++RG++TL LR++Q N   L +A  LEA P
Sbjct: 212 SRDQPE-LAEQLAFLHNAVGAILDAFPSFLVLRGLRTLALRIEQHNRNGLAIARWLEAQP 270

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
            V +V YPGL SHP+H +A++QM G+GG+VSF + GD+     F+  LK+  +A S GG 
Sbjct: 271 WVEKVLYPGLESHPQHALARRQMQGYGGIVSFYLKGDVKA---FLARLKLFALAESLGGV 327

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQA 250
           ES+V  PA M++  +    RAA GI DNL+R S GVE    + AD+ QA
Sbjct: 328 ESLVCLPAAMTHASIPAERRAALGIHDNLIRLSVGVEGEAALIADLEQA 376



>pir|F87641|F87641 methionine-gamma-lyase [imported] - Caulobacter
           crescentus>gb:AE005980_214293 Caulobacter crescentus
           CB15 section 306 of 359 of the complete
           genome.>gb:AE005673_924192 Caulobacter crescentus CB15
           complete genome.
          Length = 401

 Score =  182 bits (461), Expect = 1e-44
 Identities = 94/233 (40%), Positives = 146/233 (62%), Gaps = 2/233 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R VDI  ++R+ H  GA V +D T+ATP   + LALGAD+V+HSATK++GGH D++ G  
Sbjct: 163 RLVDIAAITRIAHAAGAKVVVDNTYATPCLTRPLALGADIVVHSATKYLGGHGDLVGGIA 222

Query: 750 SGPEKLVSVVR--NLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
           +G  + ++ VR   +  + G  ++P  A+L++RG+KTL LR+ + + +A  +A  LE HP
Sbjct: 223 AGGIEDMARVRLCGVKDMTGAVMSPFTAFLVLRGLKTLSLRMARHSQSAQAVARWLEDHP 282

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
            V +V+YPGL S P+  +A +QM   GG+++FE+ G        ++ L +   A S G  
Sbjct: 283 AVEQVFYPGLQSFPQRDLAARQMAAGGGMMAFELKGGHAAGVAMMNRLALIRRAVSLGDA 342

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           E+++  PA M++   T  ERAA GI + +VR S G+ED  D+ AD+  ALE +
Sbjct: 343 ETLIQHPASMTHSPYTPEERAAAGIGEGMVRLSVGLEDVADILADLAMALEPL 395



>gb:BT007589_2150521 Synthetic construct Homo sapiens cystathionase
           (cystathionine gamma-lyase) mRNA, partial cds.
          Length = 406

 Score =  181 bits (460), Expect = 1e-44
 Identities = 96/231 (41%), Positives = 149/231 (64%), Gaps = 2/231 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCI-DGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC 754
           + +DIE  + + H+ G ++ + D TF +P  Q+ LALGAD+ ++SATK++ GH+DV+ G 
Sbjct: 165 KVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGL 224

Query: 753 IS-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
           +S   E L + +R L + LG   +P   YL  RG+KTLH+R+++     + +A+ LE++P
Sbjct: 225 VSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNP 284

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
            V +V YPGLPSHP+H + K+Q TG  G+V+F I G L     F+  LK+  +A S GG 
Sbjct: 285 WVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGF 344

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           ES+ + PAIM++  + + +R   GI D L+R S G+ED ED+  D+ QAL+
Sbjct: 345 ESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALK 395



>gb:S52784_2040398 cystathionine gamma-lyase [human, liver, mRNA,
           1326 nt].
          Length = 405

 Score =  181 bits (460), Expect = 1e-44
 Identities = 96/231 (41%), Positives = 149/231 (64%), Gaps = 2/231 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCI-DGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC 754
           + +DIE  + + H+ G ++ + D TF +P  Q+ LALGAD+ ++SATK++ GH+DV+ G 
Sbjct: 165 KVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGL 224

Query: 753 IS-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
           +S   E L + +R L + LG   +P   YL  RG+KTLH+R+++     + +A+ LE++P
Sbjct: 225 VSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNP 284

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
            V +V YPGLPSHP+H + K+Q TG  G+V+F I G L     F+  LK+  +A S GG 
Sbjct: 285 WVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGF 344

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           ES+ + PAIM++  + + +R   GI D L+R S G+ED ED+  D+ QAL+
Sbjct: 345 ESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALK 395



>gb:BA000043_739117 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 377

 Score =  181 bits (460), Expect = 1e-44
 Identities = 93/233 (39%), Positives = 143/233 (61%), Gaps = 5/233 (2%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC- 754
           +  D++  + +    G L+ +D TF+TP  Q  L LGAD+V+HSATK++GGH+DV+AG  
Sbjct: 149 KITDLQAAAAIARAHGLLLIVDNTFSTPYFQTPLELGADIVIHSATKYLGGHSDVVAGLA 208

Query: 753 -ISGPEKLVSVVRNLHHI---LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLE 586
            +  PE    +   LH++    GG L P  ++L++RGMKTL +R+++    A ++A  L 
Sbjct: 209 VVRTPE----LAERLHYVQNSTGGVLGPQDSWLLMRGMKTLAVRMEEHEENARQIAVFLA 264

Query: 585 AHPKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSF 406
            H  V+RV+YPGLP HP H +AKKQM GFGG++SF++ G L    K +  ++   +A S 
Sbjct: 265 EHKAVKRVHYPGLPDHPNHELAKKQMRGFGGMISFDV-GSLERAEKVLSRVRYFTLAESL 323

Query: 405 GGCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           G  ES++  P  M++  + +  R   GI D L+R S G+ED  D+  D+ +AL
Sbjct: 324 GAVESLISLPGKMTHASIPKERREQLGITDGLIRLSVGLEDVNDLLDDLAKAL 376



>sp|P32929|CGL_HUMAN Cystathionine gamma-lyase (EC 4.4.1.1)
           (Gamma-cystathionase).>gb:AL354872_1923486 Human DNA
           sequence from clone RP11-42O15 on chromosome 1 Contains
           the CTH gene for cystathionase (cystathionine
           gamma-lyase) and a cysteine and histidine-rich domain
           (CHORD)-containing zinc binding protein 1 (CHORDC1)
           pseudogene, complete sequence.>gb:BC015807_1975320 Homo
           sapiens cystathionase (cystathionine gamma-lyase),
           transcript variant 1, mRNA (cDNA clone MGC:9471
           IMAGE:3915913), complete cds.>gb:BT006882_1990320 Homo
           sapiens cystathionase (cystathionine gamma-lyase) mRNA,
           complete cds.
          Length = 405

 Score =  181 bits (460), Expect = 1e-44
 Identities = 96/231 (41%), Positives = 149/231 (64%), Gaps = 2/231 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCI-DGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC 754
           + +DIE  + + H+ G ++ + D TF +P  Q+ LALGAD+ ++SATK++ GH+DV+ G 
Sbjct: 165 KVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGL 224

Query: 753 IS-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
           +S   E L + +R L + LG   +P   YL  RG+KTLH+R+++     + +A+ LE++P
Sbjct: 225 VSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNP 284

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
            V +V YPGLPSHP+H + K+Q TG  G+V+F I G L     F+  LK+  +A S GG 
Sbjct: 285 WVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGF 344

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           ES+ + PAIM++  + + +R   GI D L+R S G+ED ED+  D+ QAL+
Sbjct: 345 ESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALK 395



>pir|B69847|B69847 cystathionine beta-lyase homolog yjcJ - Bacillus
           subtilis>gb:BSUB0007_753153 Bacillus subtilis complete
           genome (section 7 of 21): from 1209742 to 1410982.
          Length = 390

 Score =  181 bits (459), Expect = 2e-44
 Identities = 99/229 (43%), Positives = 138/229 (60%), Gaps = 1/229 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCIS-G 745
           DI+ V +L  E G L  +D TF TP  Q+ L LG D+VLHSATKF+ GH+DVL+G  +  
Sbjct: 157 DIKAVVQLAKENGCLTFLDNTFMTPALQRPLDLGVDIVLHSATKFLSGHSDVLSGLAAVK 216

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
            E+L   +  L +  G  L     +L++RG+KTL +R+++ + TA R+AE  + HP V+R
Sbjct: 217 DEELGKQLYKLQNAFGAVLGVQDCWLVLRGLKTLQVRLEKASQTAQRLAEFFQKHPAVKR 276

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           VYYPGL  HP     K Q TG G V+SFE++       K V+ + +P  A S G  ESI+
Sbjct: 277 VYYPGLADHPGAETHKSQSTGAGAVLSFELESK-EAVKKLVENVSLPVFAVSLGAVESIL 335

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
             PA MS+  + + ER   GI D L+R S GVE  +D++ D  QAL+ I
Sbjct: 336 SYPATMSHAAMPKEEREKRGITDGLLRLSVGVEHADDLEHDFEQALKEI 384



>pir|D83853|D83853 cystathionine beta-lyase metC [imported] -
           Bacillus halodurans (strain C-125)>gb:BA000004_655574
           Bacillus halodurans C-125 DNA, complete genome.
          Length = 390

 Score =  181 bits (458), Expect = 2e-44
 Identities = 100/231 (43%), Positives = 141/231 (61%), Gaps = 1/231 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG-CISG 745
           DI  V  L  E   L  +D TF TP  Q+ L LG D+VLHSATKFIGGH+DV+AG  ++ 
Sbjct: 156 DIRGVVSLAKEHECLTFLDNTFLTPALQRPLELGVDVVLHSATKFIGGHSDVVAGLAVTK 215

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
            E+L   +  L +  G  L     +L++RG+KTLH+R++     A ++AE L+  P+V+R
Sbjct: 216 NEELGKKLAFLQNSFGAILGVQDVWLVLRGLKTLHVRMEHGEKGAQQIAEWLQGVPEVKR 275

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           VYYPGL  HP H + K+Q  GFG V+SFE++ +     +FV+ +K+P  A S G  ESI+
Sbjct: 276 VYYPGLKDHPGHELQKRQAEGFGAVLSFELENE-EAVRRFVEHVKLPVFAVSLGAVESIL 334

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI*G 232
             PA MS+  + + ER A GI D L+R S G+E  E++ AD   A   + G
Sbjct: 335 SYPAKMSHAAMPKEEREARGIRDGLLRLSVGLEKPEELMADFKAAFAHVRG 385



>gb:AE015837_318369 Shewanella oneidensis MR-1 section 386 of 457 of
           the complete genome.>gb:AE014299_953966 Shewanella
           oneidensis MR-1 complete genome.
          Length = 393

 Score =  180 bits (457), Expect = 3e-44
 Identities = 96/234 (41%), Positives = 140/234 (59%), Gaps = 3/234 (1%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R VDIE +++  H  GALV +D TF +P+ Q+ L LGAD+V+HS TK+I GH+DV+ G +
Sbjct: 158 RVVDIEAIAKASHGVGALVVVDNTFLSPILQQPLLLGADIVIHSTTKYINGHSDVVGGAV 217

Query: 750 SGPEKLVSVVRNLH---HILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH 580
              +  +     LH   + LG T +   +Y  +RG++TL +R+++    A R+ E+L   
Sbjct: 218 IAKDPQIG--ETLHWWSNTLGLTGSAFDSYQTLRGLRTLAVRIREHQRNAQRIVELLSNS 275

Query: 579 PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG 400
           P V +VYYPGL  HP H IA KQ  GFG ++SFE+ G       F+DAL +  +A S GG
Sbjct: 276 PVVSKVYYPGLADHPGHAIAAKQQKGFGAMLSFELKGGEAEVVAFLDALSLFSVAESLGG 335

Query: 399 CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
            ES+V  PA M++  +    R   GI D L+R S G+ED +D+ AD+   L  +
Sbjct: 336 VESLVAVPATMTHRAMEPQARFEAGIKDTLLRLSVGIEDADDLVADIQAGLAAV 389



>gb:AE017173_396694 Porphyromonas gingivalis W83 section 2 of 8 of
           the complete genome.>gb:AE015924_1032305 Porphyromonas
           gingivalis W83 complete genome.
          Length = 393

 Score =  180 bits (456), Expect = 4e-44
 Identities = 95/231 (41%), Positives = 143/231 (61%), Gaps = 3/231 (1%)
 Frame = -1

Query: 921 DIELVSRLCHE-KGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISG 745
           DI+ V  + H+ +G  V +D T+ TP   + L LGAD+V+HSATK++ GH DV+AG + G
Sbjct: 162 DIKAVCDIAHKHEGVRVMVDNTYCTPYICRPLELGADIVVHSATKYLNGHGDVIAGFVVG 221

Query: 744 PEKLVSVVR--NLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
            E  +  V+   +  + G  ++P  AYLI RGMKTL +R++Q    A  +AE LE HP V
Sbjct: 222 KEDYIKEVKLVGVKDLTGANMSPFDAYLISRGMKTLQIRMEQHCRNAQTVAEFLEKHPAV 281

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
             VY+PGLPS P++ +AKKQM   G +++FE+ G      K ++ L +  +A S G  E+
Sbjct: 282 EAVYFPGLPSFPQYELAKKQMALPGAMIAFEVKGGCEAGKKLMNNLHLCSLAVSLGDTET 341

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           ++  PA M++   T  ERAA  I + LVR S G+E+ ED+ AD+   L+++
Sbjct: 342 LIQHPASMTHSPYTPEERAASDISEGLVRLSVGLENVEDIIADLKHGLDSL 392



>gb:AE016781_331429 Pseudomonas putida KT2440 section 8 of 21 of the
           complete genome.>gb:AF363275_505089 Pseudomonas putida
           MetZ (metZ) gene, complete cds.>gb:AE015451_946506
           Pseudomonas putida KT2440 complete genome.
          Length = 403

 Score =  180 bits (456), Expect = 4e-44
 Identities = 91/229 (39%), Positives = 141/229 (61%)
 Frame = -1

Query: 924 VDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISG 745
           VDI  +S + H +GA++ +D  F+TP  Q+ L LGAD+V HSATKFI G    + G ++G
Sbjct: 175 VDITALSEIAHAQGAMLVVDNCFSTPALQQPLKLGADIVFHSATKFIDGQGRCMGGVVAG 234

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
             + +  V       G TL+P  A++  +G++TL LR++    +A  +AE LE    V +
Sbjct: 235 RTEQMKEVVGFLRTAGPTLSPFNAWIFTKGLETLRLRMRAHCESAQALAEWLEQQDGVEK 294

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           V+Y GLPSHP+H +AK+QM+GFG VVSFE+ G      +F+DA ++  I  + G  ++ +
Sbjct: 295 VHYAGLPSHPQHELAKRQMSGFGAVVSFEVKGGKEGAWRFIDATRVISITTNLGDSKTTI 354

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
             PA  S+  L+  ER A GI D+L+R + G+ED  D++AD+ + L  +
Sbjct: 355 AHPATTSHGRLSPQEREAAGIRDSLIRVAVGLEDVADLQADLARGLAAL 403



>gb:AF337647_502678 Xanthomonas oryzae pv. oryzae putative
           cystathionine gamma-lyase (metB) gene, partial cds;
           putative sugar nucleotide epimerase/dehydratase (wxoA),
           putative glycosyl transferase (wxoB), putative glycosyl
           transferase (wxoC), putative o-antigen acetylase (wxoD),
           putative ISXo8 transposase, putative IS1113 transposase
           (tnpX1), truncated putative transposase, putative ATP
           binding protein (wzt), and putative ABC transporter
           system integral membrane protein (wzm) genes, complete
           cds; and putative electron transferring flavoprotein
           alpha subunit (etfA) gene, partial cds.
          Length = 213

 Score =  179 bits (455), Expect = 5e-44
 Identities = 89/209 (42%), Positives = 136/209 (65%), Gaps = 2/209 (0%)
 Frame = -1

Query: 867 DGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC--ISGPEKLVSVVRNLHHILGG 694
           D TFA+P+ Q+ L+LGADLV+HSATK++ GH+D++ G   +    +L   +  L + +GG
Sbjct: 1   DNTFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVVGDNAELAEQMAFLQNSIGG 60

Query: 693 TLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHIAKK 514
              P  ++L +RG+KTL LR++     AL +A+ LE HP + +V YPGL SHP+H +AK+
Sbjct: 61  VQGPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLASHPQHVLAKR 120

Query: 513 QMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQAERA 334
           QM+GFGG+VS  + G      +F +  ++  +A S GG ES+V+ PA+M++  +  A R 
Sbjct: 121 QMSGFGGIVSIVLKGGFDAAKRFCEKTELFTLAESLGGVESLVNHPAVMTHASIPVARRE 180

Query: 333 AYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
             GI D LVR S G+ED  D++ D+ +AL
Sbjct: 181 QLGISDALVRLSVGIEDLGDLRGDLERAL 209



>gb:AE017180_399245 Geobacter sulfurreducens PCA, complete genome.
          Length = 378

 Score =  179 bits (455), Expect = 5e-44
 Identities = 94/226 (41%), Positives = 143/226 (63%), Gaps = 2/226 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG-- 757
           +  D+   +RL  E+GA+  +D TF TP  Q+ L LG D+VLHS TKF+ GH+DV+ G  
Sbjct: 149 KITDLAAAARLARERGAITLVDNTFMTPYLQRPLDLGCDVVLHSGTKFLNGHSDVVCGFA 208

Query: 756 CISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
            +  PE L   +R + +  G  L P  ++L++RG+KTL +R+++  + A+++A  L    
Sbjct: 209 VVRDPE-LGQRIRFIQNAFGAILGPQDSWLVLRGIKTLRVRMEESQAGAVKIANWLAGEK 267

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
           +V RV+YPGLP HP H I  +Q +G G V+SF +D  + TT + ++ +++   A S GG 
Sbjct: 268 RVSRVFYPGLPDHPGHDIHGRQSSGPGAVLSFTLD-TVETTRRLLEGMRLAAFAVSLGGV 326

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADV 259
           ESI+  PA MS+  +  AERAA GI D LVR S G+ED +D+ A++
Sbjct: 327 ESIISYPARMSHAAMPPAERAARGIGDTLVRLSVGLEDADDLLAEM 372



>gb:CP000033_89349 Lactobacillus acidophilus NCFM, complete genome.
          Length = 268

 Score =  179 bits (455), Expect = 5e-44
 Identities = 93/229 (40%), Positives = 144/229 (62%), Gaps = 1/229 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG-C 754
           R  DI  ++ +  +      ID TFATP NQ+ L LGAD+V+HSATK++GGH+DV+AG  
Sbjct: 36  RITDIHTIADIAKKHHLRTIIDNTFATPYNQQPLTLGADIVIHSATKYLGGHSDVVAGLA 95

Query: 753 ISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
           ++   KL   +  L + +G TL P+ ++L+ RG+KTL+ R++     A  + + L+ +P 
Sbjct: 96  VTNDPKLAEQLAFLQNSIGSTLGPDDSWLLQRGIKTLNARMRVHQENANAVIDFLQNNPY 155

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           + ++YYP L + P H IA KQM  FG ++SFE+   L    KFV+ L++  +A S GG E
Sbjct: 156 IAKIYYPDLKNFPGHEIAAKQMKNFGAMISFELQSGL-DVKKFVENLELIELAESLGGIE 214

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           S+++ PAIM++  + ++ R   GI D L+R S G+ED  D+  D+ QAL
Sbjct: 215 SLIEVPAIMTHGSIPRSIRLKNGIKDELIRLSVGIEDPVDIIDDLKQAL 263



>gb:CR857176_1181424 Pongo pygmaeus mRNA; cDNA DKFZp469D0332 (from
           clone DKFZp469D0332).
          Length = 405

 Score =  179 bits (454), Expect = 7e-44
 Identities = 95/231 (41%), Positives = 147/231 (63%), Gaps = 2/231 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCI-DGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC 754
           +  DIE  + + H+ G ++ + D TF +P  Q+ LALGAD+ + SATK++ GH+DV+ G 
Sbjct: 165 KMTDIEACAHIVHKHGDIILVVDNTFMSPYFQRPLALGADICMCSATKYMNGHSDVVMGL 224

Query: 753 IS-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
           +S   E L + +R L + LG   +P   YL  RG+KTL +R+++     + +A+ LE++P
Sbjct: 225 VSVNCESLYNRLRFLQNSLGAVPSPIDCYLCNRGLKTLQVRMEKHFKNGMAVAQFLESNP 284

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
            V +V YPGLPSHP+H + K+Q TG  G+V+F I G L     F+  LK+  +A S GG 
Sbjct: 285 WVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGF 344

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           ES+V+ PA+M++  + + +R   GI D L+R S G+ED ED+  D+ QAL+
Sbjct: 345 ESLVELPAVMTHASVLKKDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALK 395



>pir|G97014|G97014 cystathionine gamma-synthase [imported] -
           Clostridium acetobutylicum>gb:AE007608_228267
           Clostridium acetobutylicum ATCC 824 section 96 of 356 of
           the complete genome.>gb:AE001437_1091222 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 381

 Score =  179 bits (453), Expect = 9e-44
 Identities = 95/229 (41%), Positives = 142/229 (62%), Gaps = 3/229 (1%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISGP 742
           DI+LVS +  E   L  +D TF TP  QK L LGAD+VLHSATK++GGH+D++AG +   
Sbjct: 152 DIKLVSSIAKENNLLTIVDNTFMTPYLQKPLTLGADIVLHSATKYLGGHSDLVAGLVVVN 211

Query: 741 EKLVSVVRNLHHI---LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
            K   +   LH I    GG L P  ++L+IRG+KTL +R+ +    A ++A +L    ++
Sbjct: 212 NK--DLAEKLHFIQNSTGGVLGPFDSFLLIRGIKTLAVRMDRHTDNAKKIASLLNHRKEI 269

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
            +VYYPGL  H  H + KKQ +G+G ++SF I+ +     KF++ LK+     S GG ES
Sbjct: 270 EKVYYPGLEEHIGHEVQKKQASGYGAIISFVIN-EKYDYKKFIENLKLITFGESLGGVES 328

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           ++  PA M++  +    R   GI+DNL+R S G+E+ +D+  D+L+ALE
Sbjct: 329 LICHPASMTHAAIPYEIRQKVGIVDNLIRLSVGIENGDDLIEDLLKALE 377



>gb:BX842627_1643860 Neurospora crassa DNA linkage group I BAC clone
           B8J22.>gb:AF401238_1796134 Neurospora crassa
           cystathionine gamma-lyase (cys-16) gene, complete cds.
          Length = 417

 Score =  178 bits (452), Expect = 1e-43
 Identities = 104/232 (44%), Positives = 140/232 (60%), Gaps = 3/232 (1%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R VDI  V+   HE+G LV +D TF +P  Q  L  GAD+V+HS TK+I GH+DV+ G  
Sbjct: 168 RLVDIRAVATAAHERGILVVVDNTFLSPYVQNPLDHGADIVVHSVTKYINGHSDVVMGVA 227

Query: 750 S-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
           +   ++L + +  L + +G   +   ++L  RG KTLHLR ++  + A  +A  LEA P 
Sbjct: 228 AFNSDELYARLSFLQNAIGAVPSAFDSWLAHRGAKTLHLRAREATTNATAIAHALEASPL 287

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGF--GGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG 400
           V  V YPGL SHP   IA KQ      GG++SF I G      KF    KI  +A S GG
Sbjct: 288 VISVNYPGLESHPHRAIALKQHRNGMGGGMLSFRIHGGHAAAEKFCQYTKIFTLAESLGG 347

Query: 399 CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
            ES+ + P+ M++  + +A+R A GI D+LVR S GVED ED+KADVLQALE
Sbjct: 348 VESLCEIPSSMTHAGIPKAQREAVGIFDDLVRISCGVEDAEDLKADVLQALE 399



>gb:PSEMEGL_160730 Pseudomonas putida methionine gamma-lyase
           (MEGL-PSEPU) gene, methionine gamma-lyase gene, complete
           cds.>gb:AX069349_1460538 Sequence 13 from Patent
           WO0102600.
          Length = 398

 Score =  178 bits (452), Expect = 1e-43
 Identities = 96/229 (41%), Positives = 142/229 (62%), Gaps = 2/229 (0%)
 Frame = -1

Query: 924 VDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISG 745
           VDI  V         LV +D T+ TP  Q+ L LGADLV+HSATK++ GH D+ AG + G
Sbjct: 167 VDIAAVVEAVRGSDVLVVVDNTYCTPYLQRPLELGADLVVHSATKYLSGHGDITAGLVVG 226

Query: 744 PEKLVSVVR--NLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
            + LV  +R   L  + G  L+P+ A L++RG+KTL LR+ +  + AL +A+ L   P+V
Sbjct: 227 RKALVDRIRLEGLKDMTGAALSPHDAALLMRGIKTLALRMDRHCANALEVAQFLAGQPQV 286

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
             ++YPGLPS  ++ +A++QM   GG+++FE+ G +     F++AL++   A S G  ES
Sbjct: 287 ELIHYPGLPSFAQYELAQRQMRLPGGMIAFELKGGIEAGRGFMNALQLFARAVSLGDAES 346

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           +   PA M++   T  ERA +GI + LVR S G+ED ED+ AD+  ALE
Sbjct: 347 LAQHPASMTHSSYTPQERAHHGISEGLVRLSVGLEDVEDLLADIELALE 395



>gb:AE013599_1132670 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003799_1225095 Drosophila melanogaster
           chromosome 2R, section 51 of 74 of the complete
           sequence.>gb:AY089545_1297201 Drosophila melanogaster
           LD22255 full insert cDNA.
          Length = 393

 Score =  177 bits (450), Expect = 2e-43
 Identities = 97/232 (41%), Positives = 145/232 (62%), Gaps = 3/232 (1%)
 Frame = -1

Query: 930 RCVDIELVSRLCH--EKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG 757
           +  DIE +++L H   +  ++ +D TF T   Q+ L LGADLV +S TK++ GH DV+ G
Sbjct: 157 KVADIEAIAQLVHGVREDIVLAVDNTFLTSYFQRPLELGADLVCYSLTKYMNGHTDVVMG 216

Query: 756 CIS-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH 580
            I+   EKL   ++ L + +G   +P   Y + R +KTL LR++Q    AL++A+ LE +
Sbjct: 217 GITMNSEKLYKSLKFLQNAVGIVPSPFDCYQVNRSLKTLSLRMEQHQKNALKVAKYLETN 276

Query: 579 PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG 400
           P V +V +P LPSHP+H IA KQ  G+ GV SF I G+L  ++ F+ ALK+  +A S GG
Sbjct: 277 PFVEKVLHPSLPSHPQHKIALKQAYGYSGVFSFYIKGELKHSSAFLKALKVFTLAESLGG 336

Query: 399 CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
            ES+ + P+IM++  +   +R   GI D LVR S G+ED +D+  D+ QALE
Sbjct: 337 YESLAELPSIMTHASVPAEDRKTLGITDGLVRLSVGLEDADDLIKDLEQALE 388



>gb:CP000032_88195 Silicibacter pomeroyi DSS-3 plasmid megaplasmid,
           complete sequence.
          Length = 400

 Score =  177 bits (450), Expect = 2e-43
 Identities = 94/231 (40%), Positives = 143/231 (61%), Gaps = 2/231 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R VDI  VS + H   A V +D T+ATP   + + +GAD+VLHSATK++GGH DV+AG +
Sbjct: 162 RLVDIAAVSEIAHGASASVVVDNTYATPYLTRPIEMGADIVLHSATKYLGGHGDVVAGLV 221

Query: 750 SGPEKLVSVVR--NLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
            G  + +S +R   +  + G  + P  A LI+RG+KTL LR+ +  ++A  +AE L AHP
Sbjct: 222 VGGAEQISEIRLYGMKDMTGAVMAPFNAMLILRGLKTLALRMDRHCASAQVVAEWLAAHP 281

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
            V  V++PGL S  +H +A +QM   G +++FE+ G +      ++ L +   A S G  
Sbjct: 282 AVGEVHFPGLTSFSQHALANQQMAQPGAMIAFELKGGMDAGRAMMNRLNMIARAVSLGDA 341

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           E+++  PA M++   T  ERA +GI D LVR S G+E+ ED+ AD+ Q+L+
Sbjct: 342 ETLIQHPASMTHSTYTPEERAEHGISDGLVRLSVGLEEVEDILADLAQSLD 392



>pir|AG1284|AG1284 cystathionine beta-lyase homolog lmo1679
           [imported] - Listeria monocytogenes (strain
           EGD-e)>gb:AL591980_536170 Listeria monocytogenes strain
           EGD, complete genome, segment 8/12.
          Length = 390

 Score =  177 bits (450), Expect = 2e-43
 Identities = 102/229 (44%), Positives = 139/229 (60%), Gaps = 1/229 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI-SG 745
           DI  V++L    G    +D TF TPL QK L LGADLV+HSATKF+GGH+D+LAG I + 
Sbjct: 156 DIRTVAKLAKANGCYTFVDNTFLTPLIQKPLELGADLVIHSATKFLGGHSDILAGLIVTN 215

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
              L   V  L +  GG L    ++L++RG+KTL +R++    TA ++A  L A P V  
Sbjct: 216 NPNLAEAVYFLQNSTGGVLGVQDSWLLLRGLKTLSVRMKAGTETAEKIALFLNAEPDVVA 275

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           V+YPGLPSH  + I  +Q T  G V+SF++ G      + V  L++P  + S G  ESI+
Sbjct: 276 VHYPGLPSHAGYDIQVEQATSGGAVLSFDL-GSEEAVRELVTHLELPVFSVSLGAVESIL 334

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
             PA MS+  + + ER A GI   L+RFS G+ED ED+ AD+ QAL  I
Sbjct: 335 SYPAKMSHAAVPEEERLAQGITPGLLRFSAGLEDAEDLIADLKQALSFI 383



>gb:AE016919_357686 Chromobacterium violaceum ATCC 12472 section 10
           of 16 of the complete genome.>gb:AE016825_1042840
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 394

 Score =  177 bits (449), Expect = 3e-43
 Identities = 91/226 (40%), Positives = 139/226 (61%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISGP 742
           DI  ++ + H  GAL+ +D +F +P  Q+ L LGADLV+HSATKFI GH  V+ G + G 
Sbjct: 169 DIAAIADIAHAHGALLVVDNSFCSPALQQPLKLGADLVMHSATKFIDGHGRVMGGAVVGS 228

Query: 741 EKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRV 562
           +KLV  V       G +L P  A+ ++ G++TLHLR+++ ++ AL +A  LEA P V RV
Sbjct: 229 DKLVEQVYLHVRAAGPSLAPFNAWTLLSGLETLHLRMEKHSANALELARWLEAQPNVERV 288

Query: 561 YYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVD 382
           YYPGL SHP+H +A +Q    G VVSF + G      K VDA+++     + G  ++ + 
Sbjct: 289 YYPGLESHPQHELALRQQKSGGAVVSFVVKGGRKAAWKVVDAVRVISRTANLGDVKTTLT 348

Query: 381 QPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
            PA  ++  +TQ  R   GI++ L+R S G+E+  D++ D+L+ L+
Sbjct: 349 HPASTTHARVTQEARERAGIVEGLLRVSVGLENVRDLQQDLLRGLD 394



>gb:AB052882_2046368 Rattus norvegicus CSE mRNA for cystathionine
           gamma-lyase, complete cds.>gb:AY032875_2074127 Rattus
           norvegicus cystathionine gamma-lyase mRNA, complete
           cds.>gb:BC078869_2107022 Rattus norvegicus CTL target
           antigen, mRNA (cDNA clone MGC:93537 IMAGE:7109746),
           complete cds.
          Length = 398

 Score =  176 bits (447), Expect = 4e-43
 Identities = 93/231 (40%), Positives = 147/231 (63%), Gaps = 2/231 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHE-KGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC 754
           +  DI+  +++ H+ K  ++ +D TF +   Q+ LALGAD+ + SATK++ GH+DV+ G 
Sbjct: 164 KLADIKACAQIVHKHKDIILVVDNTFMSAYFQRPLALGADICMCSATKYMNGHSDVVMGL 223

Query: 753 IS-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
           +S   + L   +R L + LG   +P   YL  RG+KTL +R+++     + +A  LE++P
Sbjct: 224 VSVNSDDLNERLRFLQNSLGAVPSPFDCYLCCRGLKTLQIRMEKHFRNGMAVARFLESNP 283

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
           +V +V YPGLPSHP+H +AK+Q TG  G+VSF I G L     F+  +K+  +A S GG 
Sbjct: 284 RVEKVIYPGLPSHPQHELAKRQCTGCPGMVSFYIKGTLQHAQVFLKNIKLFALAESLGGY 343

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           ES+ + PAIM++  + + +RA  GI D L+R S G+ED +D+  D+ QAL+
Sbjct: 344 ESLAELPAIMTHASVPEKDRATLGISDTLIRLSVGLEDEKDLLEDLGQALK 394



>gb:AE017327_444127 Listeria monocytogenes str. 4b F2365, section 6
           of 10 of the complete genome.>gb:AE017262_1076483
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 390

 Score =  176 bits (447), Expect = 4e-43
 Identities = 101/229 (44%), Positives = 139/229 (60%), Gaps = 1/229 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI-SG 745
           DI  V++L    G    +D TF TPL QK L LGADLV+HSATKF+GGH+D+LAG I + 
Sbjct: 156 DIRTVAKLAKANGCYTFVDNTFLTPLIQKPLELGADLVIHSATKFLGGHSDILAGLIVTN 215

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
              L   V  L +  GG L    ++L++RG+KTL +R++    TA ++A  L A P V  
Sbjct: 216 NPNLAEAVYFLQNSTGGVLGVQDSWLLLRGLKTLSVRMKAGTETAEKIALFLNAEPDVVA 275

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           V+YPGLPSH  + I  +Q T  G V+SF++ G      + V  L++P  + S G  ESI+
Sbjct: 276 VHYPGLPSHAGYDIQVEQATSGGAVLSFDL-GSEEAVRELVTHLELPVFSVSLGAVESIL 334

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
             PA MS+  + + ER A GI   L+RFS G+ED +D+ AD+ QAL  I
Sbjct: 335 SYPAKMSHAAVPEEERLAQGITPGLLRFSAGLEDADDLIADLKQALSFI 383



>gb:AE017261_419494 Picrophilus torridus DSM 9790, complete genome.
          Length = 364

 Score =  176 bits (447), Expect = 4e-43
 Identities = 93/228 (40%), Positives = 138/228 (60%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R  DI+ +S+ C E GAL+  D TFATP N K L  GAD+V+HSA+KF+ GHNDV+AG  
Sbjct: 139 RVYDIDEISKACSENGALLICDSTFATPYNLKTLDHGADVVIHSASKFLSGHNDVIAGVA 198

Query: 750 SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
           +G   L+  + +    LG +++PN A+L+ RG+KTL LR+++ N  A+++A  L   P+V
Sbjct: 199 AGSYDLIKRIDDTRRSLGTSMDPNTAFLVERGIKTLDLRMERINENAMKIARFLNESPRV 258

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
             V YPGL SHP+H IA + + G+ GV+ F++  D      F+D L     A + GG  +
Sbjct: 259 SDVIYPGLESHPDHGIASRLLRGYSGVILFKLKKDF---NDFIDKLSNIKAANTLGGLNT 315

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           IV  P  MS+  L   E    GI  + VR S G+E+ E++  ++  A+
Sbjct: 316 IVSNPYTMSHRSLNNDELKILGIDKDYVRLSAGIENPENIIEELNTAI 363



>gb:AY064018_1565957 Arabidopsis thaliana putative cystathionine
           beta-lyase precursor CBL (At3g57050) mRNA, complete
           cds.>gb:AY114051_1578462 Arabidopsis thaliana putative
           cystathionine beta-lyase precursor CBL (At3g57050) mRNA,
           complete cds.
          Length = 449

 Score =  176 bits (446), Expect = 6e-43
 Identities = 94/228 (41%), Positives = 140/228 (61%), Gaps = 1/228 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISGP 742
           DI  +S + H +GALV +D +  +P+  + L LGAD+V+HSATKFI GH+DV+AG ++  
Sbjct: 220 DIRKISEMAHAQGALVLVDNSIMSPVLSRPLELGADIVMHSATKFIAGHSDVMAGVLAVK 279

Query: 741 -EKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
            EKL   V  L +  G  L P   +L +RG+KT+ LR+++Q   A ++A  L +HP+V++
Sbjct: 280 GEKLAKEVYFLQNSEGSGLAPFDCWLCLRGIKTMALRIEKQQENARKIAMYLSSHPRVKK 339

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           VYY GLP HP HH+   Q  G G V SF I G +  +   V+  K   IA SFG  +S++
Sbjct: 340 VYYAGLPDHPGHHLHFSQAKGAGSVFSF-ITGSVALSKHLVETTKYFSIAVSFGSVKSLI 398

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALET 241
             P  MS+  +    R A G+ ++LVR S G+ED +D+ +D+  A +T
Sbjct: 399 SMPCFMSHASIPAEVREARGLTEDLVRISAGIEDVDDLISDLDIAFKT 446



>gb:AE016778_330746 Pseudomonas putida KT2440 section 5 of 21 of the
           complete genome.>gb:AE015451_945823 Pseudomonas putida
           KT2440 complete genome.
          Length = 398

 Score =  176 bits (446), Expect = 6e-43
 Identities = 96/229 (41%), Positives = 143/229 (62%), Gaps = 2/229 (0%)
 Frame = -1

Query: 924 VDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISG 745
           VDI  V          V +D T+ TP  Q+ L LGADLV+HSATK++ GH D+ AG + G
Sbjct: 167 VDIAAVVEAVRGHDVHVVVDNTYCTPYLQRPLELGADLVVHSATKYLSGHGDITAGLVVG 226

Query: 744 PEKLVSVVR--NLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
            + LV  +R   L  + G  L+P+ A L++RG+KTL LR+ +  + A ++AE L   P+V
Sbjct: 227 RKVLVDRIRLEGLKDMTGAVLSPHDAALLMRGIKTLALRMDRHCANAQQVAEFLVRQPQV 286

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
             ++YPGLPS  ++ +A++QM   GG+++FE+ G +    +F++AL++   A S G  ES
Sbjct: 287 ELIHYPGLPSFAQYALAQRQMRLPGGMIAFELKGGIEAGRRFMNALQLFARAVSLGDAES 346

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           +   PA M++   T  ERA +GI + LVR S G+ED ED+ ADV QAL+
Sbjct: 347 LAQHPASMTHSSYTPQERAHHGISEGLVRLSVGLEDVEDLLADVEQALQ 395



>sp|P53780|METC_ARATH Cystathionine beta-lyase, chloroplast
           precursor (EC 4.4.1.8) (CBL) (Beta-cystathionase)
           (Cysteine lyase).>pir|S61429|S61429 cystathionine
           beta-lyase (EC 4.4.1.8) precursor - Arabidopsis
           thaliana>gb:AX067958_1460463 Sequence 3 from Patent
           WO0077185.>gb:ATF24I3_1549904 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F24I3.>gb:ATHCBL_1553093
           Arabidopsis thaliana cystathionine beta-lyase mRNA,
           complete cds.
          Length = 464

 Score =  176 bits (446), Expect = 6e-43
 Identities = 94/228 (41%), Positives = 140/228 (61%), Gaps = 1/228 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISGP 742
           DI  +S + H +GALV +D +  +P+  + L LGAD+V+HSATKFI GH+DV+AG ++  
Sbjct: 235 DIRKISEMAHAQGALVLVDNSIMSPVLSRPLELGADIVMHSATKFIAGHSDVMAGVLAVK 294

Query: 741 -EKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
            EKL   V  L +  G  L P   +L +RG+KT+ LR+++Q   A ++A  L +HP+V++
Sbjct: 295 GEKLAKEVYFLQNSEGSGLAPFDCWLCLRGIKTMALRIEKQQENARKIAMYLSSHPRVKK 354

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           VYY GLP HP HH+   Q  G G V SF I G +  +   V+  K   IA SFG  +S++
Sbjct: 355 VYYAGLPDHPGHHLHFSQAKGAGSVFSF-ITGSVALSKHLVETTKYFSIAVSFGSVKSLI 413

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALET 241
             P  MS+  +    R A G+ ++LVR S G+ED +D+ +D+  A +T
Sbjct: 414 SMPCFMSHASIPAEVREARGLTEDLVRISAGIEDVDDLISDLDIAFKT 461



>sp|Q8VCN5|CGL_MOUSE Cystathionine gamma-lyase (EC 4.4.1.1)
           (Gamma-cystathionase).>gb:AY083352_2075996 Mus musculus
           cystathionine gamma-lyase (Cse) mRNA, complete
           cds.>gb:AY262829_2081159 Mus musculus cystathionine
           gamma-lyase (Cys3) gene, complete
           cds.>gb:BC019483_2092953 Mus musculus cystathionase
           (cystathionine gamma-lyase), mRNA (cDNA clone MGC:28655
           IMAGE:4235178), complete cds.
          Length = 398

 Score =  176 bits (446), Expect = 6e-43
 Identities = 93/231 (40%), Positives = 147/231 (63%), Gaps = 2/231 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCI-DGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC 754
           +  DI   +++ H++G ++ + D TF +   Q+ LALGAD+ + SATK++ GH+DV+ G 
Sbjct: 164 KLADIGACAQIVHKRGDIILVVDNTFMSAYFQRPLALGADICMCSATKYMNGHSDVVMGL 223

Query: 753 IS-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
           +S   + L S +R L + LG   +P   YL  RG+KTL +R+++     + +A  LE +P
Sbjct: 224 VSVNSDDLNSRLRFLQNSLGAVPSPFDCYLCCRGLKTLQVRMEKHFKNGMAVARFLETNP 283

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
           +V +V YPGLPSHP+H +AK+Q +G  G+VSF I G L     F+  LK+  +A S GG 
Sbjct: 284 RVEKVVYPGLPSHPQHELAKRQCSGCPGMVSFYIKGALQHAKAFLKNLKLFTLAESLGGY 343

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           ES+ + PAIM++  + + +RA  GI D L+R S G+ED +D+  D+ +AL+
Sbjct: 344 ESLAELPAIMTHASVPEKDRATLGINDTLIRLSVGLEDEQDLLEDLDRALK 394



>gb:BA000028_695496 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 377

 Score =  176 bits (445), Expect = 8e-43
 Identities = 89/231 (38%), Positives = 145/231 (62%), Gaps = 2/231 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           +  DI+ +S +  +   L+ +D TFATP  QK L +GAD+VLHSATK+IGGH+DV+AG +
Sbjct: 149 KITDIKEISTIAQKHNLLLIVDNTFATPYWQKPLTMGADIVLHSATKYIGGHSDVVAGLV 208

Query: 750 S-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
           +    +L   +  + + +G  L P  ++L+ RG+KTL +R++       ++   LE +P+
Sbjct: 209 AVKSNELAERIHFIQNSVGAVLGPQDSWLLQRGIKTLAIRMEAIEQNTKKLIAYLEQNPR 268

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEI-DGDLMTTAKFVDALKIPYIAPSFGGC 397
           V ++YYPGL +HP HHIAK+Q +GFGG+VS ++  GDL    K +  ++   +A S G  
Sbjct: 269 VEKIYYPGLENHPGHHIAKQQASGFGGMVSIDVGSGDL--ADKILSKVEFFTLAESLGAI 326

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           ES++  PA M++  +    R   GI D L+R S G+ED +D+  D+ ++++
Sbjct: 327 ESLISIPAKMTHASIPADRRQELGITDGLIRLSVGIEDIDDLIDDLEKSMQ 377



>pir|AB1656|AB1656 cystathionine beta-lyase homolog lin1787
           [imported] - Listeria innocua (strain
           Clip11262)>gb:AL596169_539132 Listeria innocua Clip11262
           complete genome, segment 7/12.
          Length = 390

 Score =  176 bits (445), Expect = 8e-43
 Identities = 100/229 (43%), Positives = 139/229 (60%), Gaps = 1/229 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI-SG 745
           DI  VS+L    G    +D TF TPL QK L LGADLV+HSATKF+GGH+D+LAG I + 
Sbjct: 156 DIRTVSKLARANGCHTFVDNTFLTPLIQKPLELGADLVIHSATKFLGGHSDILAGLIVTN 215

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
              L   +  L +  GG L    ++L++RG+KTL +R++    TA ++A  L A P V  
Sbjct: 216 NPDLAEAIYFLQNSTGGVLGVQDSWLLLRGLKTLSVRMKAGTETAEKIALFLNAEPDVVA 275

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           V+YPGLPSH  + I  +Q T  G V+SF++ G      + V+ L++P  + S G  ESI+
Sbjct: 276 VHYPGLPSHAGYEIQVEQATSGGAVLSFDL-GSEEAVRELVNHLELPVFSVSLGAVESIL 334

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
             PA MS+  + + ER   GI   L+RFS G+ED +D+ AD+ QAL  I
Sbjct: 335 SYPAKMSHAAVPEEERLKQGITPGLLRFSAGLEDADDLIADLKQALSFI 383



>sp|P18757|CGL_RAT Cystathionine gamma-lyase (EC 4.4.1.1)
           (Gamma-cystathionase) (Probasin-related antigen)
           (PRB-RA).>pir|A49864|A49864 cystathionine gamma-lyase
           (EC 4.4.1.1) - rat>gb:RATCGL_2131790 Rattus norvegicus
           mRNA for cystathionine gamma-lyase, complete cds.
          Length = 398

 Score =  176 bits (445), Expect = 8e-43
 Identities = 93/231 (40%), Positives = 147/231 (63%), Gaps = 2/231 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHE-KGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC 754
           +  DI+  +++ H+ K  ++ +D TF +   Q+ LALGAD+ + SATK++ GH+DV+ G 
Sbjct: 164 KLADIKACAQIVHKHKDIILVVDNTFMSAYFQRPLALGADICMCSATKYMNGHSDVVMGL 223

Query: 753 IS-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
           +S   + L   +R L + LG   +P   YL  RG+KTL +R+++     + +A  LE++P
Sbjct: 224 VSVTSDDLNERLRFLQNSLGAVPSPFDCYLCCRGLKTLQIRMEKHFRNGMAVARFLESNP 283

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
           +V +V YPGLPSHP+H +AK+Q TG  G+VSF I G L     F+  +K+  +A S GG 
Sbjct: 284 RVEKVIYPGLPSHPQHELAKRQCTGCPGMVSFYIKGTLQHAQVFLKNIKLFALAESLGGY 343

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           ES+ + PAIM++  + + +RA  GI D L+R S G+ED +D+  D+ QAL+
Sbjct: 344 ESLAELPAIMTHASVPEKDRATLGISDTLIRLSVGLEDEKDLLEDLGQALK 394



>gb:AF095822_1240526 Drosophila melanogaster ecdysteroid-inducible
           polypeptide EIP40 (Eip40) gene, flanking region and
           complete cds.
          Length = 393

 Score =  175 bits (443), Expect = 1e-42
 Identities = 96/232 (41%), Positives = 144/232 (62%), Gaps = 3/232 (1%)
 Frame = -1

Query: 930 RCVDIELVSRLCH--EKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG 757
           +  DIE +++L H   +  ++ +D TF T   Q+ L LGADLV +S TK++ GH DV+ G
Sbjct: 157 KVADIEAIAQLVHGVREDIVLAVDNTFLTSYFQRPLELGADLVCYSLTKYMNGHTDVVMG 216

Query: 756 CIS-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH 580
            I+   EKL   ++ L + +    +P   Y + R +KTL LR++Q    AL++A+ LE +
Sbjct: 217 GITMNSEKLYKSLKFLQNAVDIVPSPFDCYQVNRSLKTLSLRMEQHQKNALKVAKYLETN 276

Query: 579 PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG 400
           P V +V +P LPSHP+H IA KQ  G+ GV SF I G+L  ++ F+ ALK+  +A S GG
Sbjct: 277 PFVEKVLHPSLPSHPQHKIALKQAYGYSGVFSFYIKGELKHSSAFLKALKVFTLAESLGG 336

Query: 399 CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
            ES+ + P+IM++  +   +R   GI D LVR S G+ED +D+  D+ QALE
Sbjct: 337 YESLAELPSIMTHASVPAEDRKTLGITDGLVRLSVGLEDADDLIKDLEQALE 388



>gb:BX936398_834750 Yersinia pseudotuberculosis IP32953 genome,
           complete sequence.
          Length = 386

 Score =  175 bits (443), Expect = 1e-42
 Identities = 94/231 (40%), Positives = 142/231 (61%), Gaps = 2/231 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R VDI  + +     GAL   D TF +P  Q+ L+LGADLV+HS TK++ GH+DV+AG +
Sbjct: 152 RVVDIAAICQAARAAGALTVCDNTFLSPALQQPLSLGADLVVHSCTKYLNGHSDVVAGAV 211

Query: 750 --SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
               PE +V +    ++I G T     +YL++RG++TL  R+ QQ   A  +   L+  P
Sbjct: 212 IAKDPELVVELAWWANNI-GVTGAAFDSYLLLRGLRTLSPRMAQQQRNADDIVRYLQQQP 270

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
            V+++Y+P LP HP H IA +Q +GFG ++SFE+DGD     +F+ AL++  +A S GG 
Sbjct: 271 LVKKLYHPSLPQHPGHEIACRQQSGFGAMLSFELDGDEQVMRRFLSALELFTLAESLGGV 330

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           ES++   A M++  +    R A GI D+L+R S G+ED ED+ AD+  A +
Sbjct: 331 ESLISHAATMTHAGMAAEARIAAGITDSLLRISVGIEDSEDLIADLDHAFQ 381



>gb:AE017127_385973 Yersinia pestis biovar Medievalis str. 91001
           section 1 of 16 of the complete
           genome.>gb:AE017042_1142539 Yersinia pestis biovar
           Medievalis str. 91001 complete genome.
          Length = 413

 Score =  175 bits (443), Expect = 1e-42
 Identities = 94/231 (40%), Positives = 142/231 (61%), Gaps = 2/231 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R VDI  + +     GAL   D TF +P  Q+ L+LGADLV+HS TK++ GH+DV+AG +
Sbjct: 179 RVVDIAAICQAARAAGALTVCDNTFLSPALQQPLSLGADLVVHSCTKYLNGHSDVVAGAV 238

Query: 750 --SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
               PE +V +    ++I G T     +YL++RG++TL  R+ QQ   A  +   L+  P
Sbjct: 239 IAKDPELVVELAWWANNI-GVTGAAFDSYLLLRGLRTLSPRMAQQQRNADDIVRYLQQQP 297

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
            V+++Y+P LP HP H IA +Q +GFG ++SFE+DGD     +F+ AL++  +A S GG 
Sbjct: 298 LVKKLYHPSLPQHPGHEIACRQQSGFGAMLSFELDGDEQVMRRFLSALELFTLAESLGGV 357

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           ES++   A M++  +    R A GI D+L+R S G+ED ED+ AD+  A +
Sbjct: 358 ESLISHAATMTHAGMAAEARIAAGITDSLLRISVGIEDSEDLIADLDHAFQ 408



>gb:SME591782_184094 Sinorhizobium meliloti 1021 complete
           chromosome; segment 1/12.
          Length = 408

 Score =  175 bits (443), Expect = 1e-42
 Identities = 87/221 (39%), Positives = 135/221 (61%), Gaps = 1/221 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R  DI  +S L    G+ V +D TF +P  Q+ L+LGAD  +HSATKF+ GH+DV+AG +
Sbjct: 177 RVTDIARLSTLAKAAGSAVAVDNTFLSPALQQPLSLGADYAIHSATKFLNGHSDVIAGAV 236

Query: 750 SGPE-KLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
              E +    ++   ++ G    P  A+L +RG++TL  R+  Q  +A+ +AE L+AHP 
Sbjct: 237 IAAEPQEAHDLKRWANVTGAVAAPFDAWLTLRGLRTLFARMSSQERSAMTIAEYLDAHPA 296

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           VR V+Y GLP H +H +A++Q  GFG ++SFE++G +    +F+  ++   +A S GG E
Sbjct: 297 VRHVHYAGLPDHADHEVARRQQRGFGAMMSFELEGGVPAVRRFLAHIRCFTLAESLGGVE 356

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDV 271
           S+V  PA M++ D+    R   GI D L+R S G+E  +D+
Sbjct: 357 SLVAHPATMTHLDMGPEARERAGIRDELLRLSIGLEHIDDL 397



>sp|P46807|METB_MYCLE Cystathionine gamma-synthase (EC 2.5.1.48)
           (CGS) (O-succinylhomoserine
           (Thiol)-lyase).>pir|F87208|F87208 cystathionine
           [gamma]-synthase [imported] - Mycobacterium
           leprae>gb:MLEPRTN9_148199 Mycobacterium leprae strain TN
           complete genome; segment 9/10.>gb:MLU15183_148926
           Mycobacterium leprae cosmid B1740.
          Length = 388

 Score =  175 bits (443), Expect = 1e-42
 Identities = 95/226 (42%), Positives = 135/226 (59%), Gaps = 1/226 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC-ISG 745
           DI  +  L  +    V +D TFA+P  Q+ L LGAD+VLHS TK+IGGH+DV+ G  ++ 
Sbjct: 165 DITSIGELGKKHSVKVLVDNTFASPALQQPLMLGADVVLHSTTKYIGGHSDVVGGALVTN 224

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
            E+L      L +  G   +P  AYL +RG+KTL LR+Q+ N  A+ +AE L  HP V  
Sbjct: 225 DEELDQAFGFLQNGAGAVPSPFDAYLTMRGLKTLVLRMQRHNENAITVAEFLAGHPSVSA 284

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           V YPGLPSHP H +A +QM GFGG+VS  +    +         K+  +A S GG ES++
Sbjct: 285 VLYPGLPSHPGHEVAARQMRGFGGMVSLRMRAGRLAAQDLCARTKVFTLAESLGGVESLI 344

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           +QP+ M++   T ++     + D+LVR S G+ED  D+  D+ QAL
Sbjct: 345 EQPSAMTHASTTGSQ---LEVPDDLVRLSVGIEDVGDLLCDLKQAL 387



>gb:BA000033_710707 Staphylococcus aureus subsp. aureus MW2 DNA,
           complete genome, strain:MW2.>gb:BX571857_782636
           Staphylococcus aureus strain MSSA476, complete genome.
          Length = 380

 Score =  174 bits (442), Expect = 2e-42
 Identities = 90/232 (38%), Positives = 143/232 (61%), Gaps = 1/232 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R  DI+  + +  E G +  +D TF TP  Q  L LG D+VLHSATK++GGH+DV+AG +
Sbjct: 150 RVTDIKKSAEIAKEHGLISVVDNTFMTPYYQNPLDLGIDIVLHSATKYLGGHSDVVAGLV 209

Query: 750 S-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
           +   +KL   +  + +  GG L P  +YL++RG+KTL LR++Q N + + + ++L+AHP 
Sbjct: 210 ATSDDKLAERLAFISNSTGGILGPQDSYLLVRGIKTLGLRMEQINRSVIEIIKMLQAHPA 269

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V++V++P + SH  H +   Q  G  GV++FE+  +  +  + + A     +A S G  E
Sbjct: 270 VQQVFHPSIESHLNHDVHMAQADGHTGVIAFEVK-NTESAKQLIKATSYYTLAESLGAVE 328

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           S++  PA+M++  +    RA  GI D LVR S G+ED ED+  D+ QAL+T+
Sbjct: 329 SLISVPALMTHASIPADIRAKEGITDGLVRISVGIEDTEDLVDDLKQALDTL 380



>gb:AY622198_637391 Brevibacterium linens L-methionine-gamma-lyase
           (mgl) gene, complete cds.
          Length = 425

 Score =  174 bits (442), Expect = 2e-42
 Identities = 95/234 (40%), Positives = 138/234 (58%), Gaps = 8/234 (3%)
 Frame = -1

Query: 924 VDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISG 745
           VDI   ++L H   A++ +D TFATP+ Q+ + LGAD+V+HS TKFI GH+DV+ G +  
Sbjct: 158 VDIAETAKLAHAANAILAVDSTFATPILQRPIELGADVVIHSTTKFINGHSDVIGGAVLA 217

Query: 744 PE-----KLVSVVRNLHHILGGT---LNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVL 589
            +     +   VV  L   L      + P  A+L  RG+KTL +R+ +    A  +A+ L
Sbjct: 218 GDGSTCPRAAKVVERLESYLASVGLGIAPFDAWLTRRGIKTLPVRMAKHCENAQAVAQWL 277

Query: 588 EAHPKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPS 409
           E+ P++  VYYPGLPSHP H +AKKQM+GFGGVVSF  D +    +  V + K+  +A S
Sbjct: 278 ESRPEIAEVYYPGLPSHPGHEVAKKQMSGFGGVVSFRTDTEARALS-LVKSTKLITLAES 336

Query: 408 FGGCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
            GG ES++D PA M++  +   E     +    +R S G+ED  D+ AD+  AL
Sbjct: 337 LGGVESLIDHPATMTHLAVADCE---LSVSPTFIRLSLGIEDIADILADLDAAL 387



>gb:AE016822_339569 Leifsonia xyli subsp. xyli str. CTCB07, complete
           genome.
          Length = 384

 Score =  174 bits (442), Expect = 2e-42
 Identities = 92/226 (40%), Positives = 139/226 (61%), Gaps = 1/226 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC-ISG 745
           D+  ++ L H  GALV +D TFA+P  Q+ L+ GAD+V+HS TK++GGH+DV+ G  + G
Sbjct: 157 DLAALTSLGHGAGALVVVDNTFASPALQQPLSFGADVVVHSTTKYLGGHSDVIGGALVFG 216

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
            E+L   VR +    G    P  A+L +RG+KTL +R+Q+    A  +A+ L   P V+ 
Sbjct: 217 GEELAEKVRFIQFAAGAVSVPMDAWLTVRGIKTLAVRMQRHTENAQAIADALLGRPGVQA 276

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           VYYPGLP+HP   +A +QM+GFGG++S  + G      +F ++ ++  +A S GG ES++
Sbjct: 277 VYYPGLPTHPGRALAVRQMSGFGGMLSVALAGGAAVARRFAESTEVFQLAESLGGVESLI 336

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
             PA M++  +   E    G   N++R S G+ED  D+ ADV QAL
Sbjct: 337 GYPAEMTHASVRGTELDVPG---NVIRLSVGIEDIADLLADVEQAL 379



>gb:ERWCRTS_135754 Pantoea agglomerans pyrophosphate synthase (crtE),
            zeaxanthin glucosyl transferase (crtX), and lycopene
            cyclase (crtY) genes, complete cds; phytoene
            dehydrogenase (crtI) gene, partial cds; phytoene synthase
            (crtB) and beta-carotene hydroxylase (crtZ) genes,
            complete cds; and unknown genes.
          Length = 611

 Score =  174 bits (442), Expect = 2e-42
 Identities = 89/230 (38%), Positives = 144/230 (62%), Gaps = 2/230 (0%)
 Frame = -1

Query: 930  RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC- 754
            +  D+  ++ +      +   D TFA+PL  + L LG D+V+HSATK++ GH+DV+AG  
Sbjct: 381  KLADLAAIAEIARRHNVISVADNTFASPLIHRPLTLGFDIVVHSATKYLNGHSDVVAGLA 440

Query: 753  -ISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
             +     L   +  L + +GG L+P +++L +RG++TL LR+++ +S AL +A  LE  P
Sbjct: 441  VVGDRPALAEKLGYLQNAVGGVLDPFSSFLTLRGIRTLALRIERHSSNALALARWLEQQP 500

Query: 576  KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
            +V +V++P L SHP++ +A++QM   GG++S  I GD    A+ +  LK+  +A S GG 
Sbjct: 501  QVEKVWFPWLTSHPQYALARQQMAQPGGMISIVIKGDDQRAAEVISKLKLFTLAESLGGV 560

Query: 396  ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
            ES+V QP  M++  +  A+R A GI   L+R S G+ED +D+ AD+ QAL
Sbjct: 561  ESLVSQPFSMTHASIPLAQRLANGITPQLIRLSVGIEDEKDLLADLQQAL 610



>gb:CP000046_90670 Staphylococcus aureus subsp. aureus COL, complete
           genome.
          Length = 380

 Score =  174 bits (442), Expect = 2e-42
 Identities = 90/232 (38%), Positives = 143/232 (61%), Gaps = 1/232 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R  DI+  + +  E G +  +D TF TP  Q  L LG D+VLHSATK++GGH+DV+AG +
Sbjct: 150 RVTDIKKSAEIAKEHGLISVVDNTFMTPYYQNPLDLGIDIVLHSATKYLGGHSDVVAGLV 209

Query: 750 S-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
           +   +KL   +  + +  GG L P  +YL++RG+KTL LR++Q N + + + ++L+AHP 
Sbjct: 210 ATSDDKLAERLAFISNSTGGILGPQDSYLLVRGIKTLGLRMEQINRSVIEIIKMLQAHPA 269

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V++V++P + SH  H +   Q  G  GV++FE+  +  +  + + A     +A S G  E
Sbjct: 270 VQQVFHPSIESHLNHDVHMAQADGHTGVIAFEVK-NTESAKQLIKATSYYTLAESLGAVE 328

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           S++  PA+M++  +    RA  GI D LVR S G+ED ED+  D+ QAL+T+
Sbjct: 329 SLISVPALMTHASIPADIRAKEGITDGLVRISVGIEDTEDLVDDLKQALDTL 380



>pir|S52983|S52983 probable cystathionine gamma-lyase (EC 4.4.1.1) -
            Erwinia herbicola (fragment)
          Length = 611

 Score =  174 bits (442), Expect = 2e-42
 Identities = 89/230 (38%), Positives = 144/230 (62%), Gaps = 2/230 (0%)
 Frame = -1

Query: 930  RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC- 754
            +  D+  ++ +      +   D TFA+PL  + L LG D+V+HSATK++ GH+DV+AG  
Sbjct: 381  KLADLAAIAEIARRHNVISVADNTFASPLIHRPLTLGFDIVVHSATKYLNGHSDVVAGLA 440

Query: 753  -ISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
             +     L   +  L + +GG L+P +++L +RG++TL LR+++ +S AL +A  LE  P
Sbjct: 441  VVGDRPALAEKLGYLQNAVGGVLDPFSSFLTLRGIRTLALRIERHSSNALALARWLEQQP 500

Query: 576  KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
            +V +V++P L SHP++ +A++QM   GG++S  I GD    A+ +  LK+  +A S GG 
Sbjct: 501  QVEKVWFPWLTSHPQYALARQQMAQPGGMISIVIKGDDQRAAEVISKLKLFTLAESLGGV 560

Query: 396  ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
            ES+V QP  M++  +  A+R A GI   L+R S G+ED +D+ AD+ QAL
Sbjct: 561  ESLVSQPFSMTHASIPLAQRLANGITPQLIRLSVGIEDEKDLLADLQQAL 610



>pir|D75458|D75458 trans-sulfuration enzyme - Deinococcus
           radiodurans (strain R1)>gb:AE001945_41195 Deinococcus
           radiodurans R1 section 82 of 229 of the complete
           chromosome 1.>gb:AE000513_882090 Deinococcus radiodurans
           R1 complete chromosome 1.
          Length = 392

 Score =  174 bits (442), Expect = 2e-42
 Identities = 101/231 (43%), Positives = 145/231 (62%), Gaps = 3/231 (1%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R  D+  V+ L H  GA + +D TF+TP   +    GADLV+HSATK++GGH DV+ G +
Sbjct: 160 RLTDLREVADLAHGAGARLVVDNTFSTPYLTRPAEFGADLVMHSATKYLGGHGDVIGGVV 219

Query: 750 SGPEKLVSVVR--NLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
           +G    +  +R   L H+ G +L P  AYL++RGMKTL LR++   + A  +AE L A  
Sbjct: 220 AGDAATLLDLRLHGLRHV-GASLGPFEAYLLLRGMKTLPLRMEAHCAGAHLIAERLAARG 278

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTG-FGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG 400
            ++ VYYPGLP HP H +A++QM+G FGG+VS ++ GD     +F+DAL++   A S G 
Sbjct: 279 DLK-VYYPGLPEHPGHDLARRQMSGRFGGIVSLDL-GDFAAAQQFLDALQLFTQAVSLGD 336

Query: 399 CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
            ES+   PA  ++  L +    A+GI+  LVR S G+ED ED+ AD+ QAL
Sbjct: 337 VESLSSHPASTTHQLLGEEVLNAHGIVPGLVRLSVGIEDPEDLWADIEQAL 387



>pir|F89811|F89811 cystathionine gamma-synthase [imported] -
           Staphylococcus aureus (strain N315)>gb:SAU564014_172390
           Staphylococcus aureus metB gene for cystathionine
           gamma-synthase, strain Mu50.>gb:SAU564015_172391
           Staphylococcus aureus metB gene for cystathionine
           gamma-synthase, strain Mu3.>gb:SAU564016_172392
           Staphylococcus aureus metB gene for cystathionine
           gamma-synthase, strain LLA.>gb:SAU564017_172393
           Staphylococcus aureus metB gene for cystathionine
           gamma-synthase, strain LLE.>gb:BA000017_676158
           Staphylococcus aureus subsp. aureus Mu50 DNA, complete
           genome.>gb:BA000018_678831 Staphylococcus aureus subsp.
           aureus N315 genomic DNA, complete genome.
          Length = 380

 Score =  174 bits (442), Expect = 2e-42
 Identities = 90/232 (38%), Positives = 143/232 (61%), Gaps = 1/232 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R  DI+  + +  E G +  +D TF TP  Q  L LG D+VLHSATK++GGH+DV+AG +
Sbjct: 150 RVTDIKKSAEIAKEHGLISVVDNTFMTPYYQNPLDLGIDIVLHSATKYLGGHSDVVAGLV 209

Query: 750 S-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
           +   +KL   +  + +  GG L P  +YL++RG+KTL LR++Q N + + + ++L+AHP 
Sbjct: 210 ATSDDKLAERLAFISNSTGGILGPQDSYLLVRGIKTLGLRMEQINRSVIEIIKMLQAHPA 269

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V++V++P + SH  H +   Q  G  GV++FE+  +  +  + + A     +A S G  E
Sbjct: 270 VQQVFHPSIESHLNHDVHMAQADGHTGVIAFEVK-NTESAKQLIKATSYYTLAESLGAVE 328

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           S++  PA+M++  +    RA  GI D LVR S G+ED ED+  D+ QAL+T+
Sbjct: 329 SLISVPALMTHASIPADIRAKEGITDGLVRISVGIEDTEDLVDDLKQALDTL 380



>gb:AE017261_420119 Picrophilus torridus DSM 9790, complete genome.
          Length = 385

 Score =  174 bits (441), Expect = 2e-42
 Identities = 94/231 (40%), Positives = 138/231 (59%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           + +DI+ V+  CHE   L   D TFA+P NQ  + LGAD+V+HSATK+I GH+DV+ G I
Sbjct: 157 KVIDIKNVASFCHENDVLFIDDATFASPYNQNPVELGADIVVHSATKYISGHSDVIIG-I 215

Query: 750 SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
           +G     + +  +   LG + +   AYL  RG+KTL LR+++ N  A+ +A  L    KV
Sbjct: 216 AGTNNYYNNLIEMRKTLGASPDAFQAYLSYRGLKTLGLRMERHNKNAMELARFLRDSKKV 275

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
             V YPGL  +  H IA K+M G+GG++SF ++  +    K +  L+IP  A S GG ES
Sbjct: 276 LNVNYPGLDDNKYHGIAGKEMRGYGGMLSFTLN-SMEDAHKLIKNLEIPAYAASLGGVES 334

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           ++  P   ++  L+  ER + GI D+LVRFS G+ED +D+  D   AL  +
Sbjct: 335 LITMPVETTHASLSPEERRSLGISDSLVRFSTGIEDIDDIIKDFENALSKL 385



>gb:AE016869_353191 Pseudomonas syringae pv. tomato str. DC3000
           section 14 of 21 of the complete
           genome.>gb:AE016853_1038366 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 403

 Score =  174 bits (441), Expect = 2e-42
 Identities = 87/229 (37%), Positives = 139/229 (60%)
 Frame = -1

Query: 924 VDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISG 745
           VDI  ++ + H KGA++ +D  F TP  Q+ L LGAD+V+HSATKFI G    + G ++G
Sbjct: 175 VDIAALAEIAHAKGAMLIVDNCFCTPALQQPLLLGADIVVHSATKFIDGQGRCMGGVVAG 234

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
             + +  V       G TL+P  A++ ++G++TL+LR++   + A  +AE LE    + +
Sbjct: 235 RSEQMKEVVGFLRTAGPTLSPFNAWIFLKGLETLNLRMRAHCANAQALAEWLEQQDGIEK 294

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           V+Y GL SHP+H +AK+Q  GFG VVSFE+ G      +F+DA ++  I  + G  ++ +
Sbjct: 295 VHYAGLESHPQHELAKRQQKGFGAVVSFEVKGGKDGAWRFIDATRLISITANLGDTKTTI 354

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
             P+  S+  L   ER A GI D+L+R + G+ED  D++AD+ + L  +
Sbjct: 355 THPSTTSHGRLAPQEREAAGIRDSLIRVAVGLEDVADLQADLARGLAAL 403



>gb:AE012398_282084 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 306 of 460 of the complete
           genome.>gb:AE008922_915366 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 405

 Score =  174 bits (440), Expect = 3e-42
 Identities = 97/231 (41%), Positives = 139/231 (60%), Gaps = 3/231 (1%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R  D+  V    H+ GAL  +D TF +P  QK L  GADLVLHS TK++ GH+DV+ G +
Sbjct: 160 RITDLRFVIEAAHKVGALTVVDNTFLSPALQKPLEFGADLVLHSTTKYVNGHSDVVGGAV 219

Query: 750 SGPE-KLVSVVRNLHHILGGTLNPNAAYLIIRGMKTL--HLRVQQQNSTALRMAEVLEAH 580
              + +L   +    + LG T +P  A+L +RG++TL   LRV Q+N+ A+  A +L+ H
Sbjct: 220 IARDAELHQQLVWWANALGLTGSPFDAFLTLRGLRTLDARLRVHQENADAI--AVLLDEH 277

Query: 579 PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG 400
             V +VY+PGL SHP H +A +Q  GFG ++SFE++G       FVD L+   +A S GG
Sbjct: 278 AAVNQVYFPGLASHPGHALAARQQKGFGAMISFELNGGEAAVRAFVDGLRYFTLAESLGG 337

Query: 399 CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
            ES++  PA M++  +T   RAA GI D L+R S G+E  ED+  D+   L
Sbjct: 338 VESLIAHPASMTHAAMTAEARAAAGISDGLLRLSVGIESAEDLLIDLRAGL 388



>gb:AB075037_9999 Rhodococcus erythropolis pDR51-orf4, pDR51-orf1,
           pDR51-orf2, pDR51-orf3 genes, partial and complete cds.
          Length = 390

 Score =  174 bits (440), Expect = 3e-42
 Identities = 92/226 (40%), Positives = 135/226 (59%), Gaps = 1/226 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC-ISG 745
           DIEL++ + HE  A + +D TFA+P  Q+ L LGAD+ LHS TK+IGGH+DV+ G  +  
Sbjct: 167 DIELLAEVAHEGNAKIVVDNTFASPYLQQPLQLGADIALHSTTKYIGGHSDVVGGALVCN 226

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
            E+L +    L +  GG   P  A+L +RG+KTL LR+++ +  A ++ E+L+ HP V  
Sbjct: 227 DEELDTAFAFLQNGSGGVPGPFDAFLTLRGIKTLALRMERHSDNAEKVVELLDGHPAVAS 286

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           V YPGL SHP H +A KQM  FGG++S  + G            +I  +A S GG ES++
Sbjct: 287 VIYPGLASHPSHKVAAKQMRRFGGMISVRLKGGKAAALDLCSRTEIFTLAESLGGVESLI 346

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           + P  M++        +A  + D+LVR S G+ED  D+  D+ QAL
Sbjct: 347 EFPGAMTH---ASTAGSALEVPDDLVRLSVGIEDASDLVGDIEQAL 389



>gb:AE017180_399244 Geobacter sulfurreducens PCA, complete genome.
          Length = 377

 Score =  173 bits (438), Expect = 5e-42
 Identities = 91/228 (39%), Positives = 136/228 (59%), Gaps = 1/228 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           +  DI  +S LC E+G L  +D TF TP   + L LGAD+ ++S TK++ GHND ++G +
Sbjct: 149 KVADIAALSTLCRERGLLCIVDNTFLTPYLLRPLDLGADITVYSGTKYLSGHNDTVSGLV 208

Query: 750 SGPEK-LVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
              E  L   V  L + +G  L P  A+L IRGMKTL +R+ +Q   A R+AE L  HP+
Sbjct: 209 VVKEPALAERVYFLQNSVGAVLGPQDAWLTIRGMKTLSVRLDRQQENAGRIAEWLARHPR 268

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V RV+YPGLP HP H +  +Q  GFG +++FE+D D     + +   ++   A S GG E
Sbjct: 269 VPRVFYPGLPGHPGHELLARQARGFGAMIAFEVD-DKALVERLLLKTELISFAESLGGVE 327

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQA 250
           +++  P + ++ D+    R   GI D L+R S G+ED +D+ AD+ +A
Sbjct: 328 TLITFPQVQTHADIPPEVRERLGINDVLLRLSVGIEDADDLIADLSRA 375



>gb:AE011946_277955 Xanthomonas axonopodis pv. citri str. 306,
           section 324 of 469 of the complete
           genome.>gb:AE008923_919730 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 405

 Score =  173 bits (438), Expect = 5e-42
 Identities = 98/231 (42%), Positives = 139/231 (60%), Gaps = 3/231 (1%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R  D+  V     + GAL  +D TF +P  QK L  GADLVLHS TK+I GH+DV+ G +
Sbjct: 160 RITDLRFVIEAAKKVGALTVVDNTFLSPALQKPLDFGADLVLHSTTKYINGHSDVVGGAV 219

Query: 750 SGPE-KLVSVVRNLHHILGGTLNPNAAYLIIRGMKTL--HLRVQQQNSTALRMAEVLEAH 580
              + +L   +    + LG T +P  A+L +RG++TL   LRV Q+N+ A+  A +L+ H
Sbjct: 220 VARDAQLHQQLVWWANALGLTGSPFDAFLTLRGLRTLDARLRVHQENADAI--AALLDGH 277

Query: 579 PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG 400
             V +VY+PGL SHP H +A +Q  GFG ++SFE++G       FVD L+   +A S GG
Sbjct: 278 AAVNQVYFPGLASHPGHALAARQQKGFGAMMSFELEGGEAAVRAFVDGLRYFTLAESLGG 337

Query: 399 CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
            ES++  PA M++  +T   RAA GI D L+R S G+E  ED+ AD+   L
Sbjct: 338 VESLIAHPASMTHAAMTAEARAAAGISDGLLRLSIGIESAEDLLADLRAGL 388



>gb:AE013598_295519 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 405

 Score =  172 bits (436), Expect = 8e-42
 Identities = 97/231 (41%), Positives = 139/231 (60%), Gaps = 3/231 (1%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R  D+  V     + GAL  +D TF +P  QK L  GADLVLHS TK+I GH+DV+ G +
Sbjct: 160 RITDLRFVIEAAKKVGALTVVDNTFLSPALQKPLDFGADLVLHSTTKYINGHSDVVGGAV 219

Query: 750 SGPE-KLVSVVRNLHHILGGTLNPNAAYLIIRGMKTL--HLRVQQQNSTALRMAEVLEAH 580
              + +L   +    + LG T +P  A+L +RG++TL   LRV Q+N+ A+  AE+L+ H
Sbjct: 220 VARDAELHQQLVWWANALGLTGSPFDAFLTLRGLRTLDARLRVHQENADAI--AELLDGH 277

Query: 579 PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG 400
             V +VY+PGL +HP H +A +Q  GFG ++SFE++G       FVD L+   +A S GG
Sbjct: 278 AMVNQVYFPGLATHPGHALAARQQKGFGAMMSFELEGGEAAVRAFVDGLRYFTLAESLGG 337

Query: 399 CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
            ES++  PA M++  +T   RAA GI D L+R S G+E  ED+  D+   L
Sbjct: 338 VESLIAHPASMTHAAMTAEARAAAGISDGLLRLSIGIESAEDLLIDLRAGL 388



>sp|P55216|CGL_CAEEL Putative cystathionine gamma-lyase (EC 4.4.1.1)
           (Gamma-cystathionase).>pir|C88197|C88197 protein
           ZK1127.10 [imported] - Caenorhabditis
           elegans>gb:U58758_1405407 Caenorhabditis elegans cosmid
           ZK1127, complete sequence.
          Length = 392

 Score =  172 bits (436), Expect = 8e-42
 Identities = 85/213 (39%), Positives = 137/213 (64%), Gaps = 1/213 (0%)
 Frame = -1

Query: 879 LVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC-ISGPEKLVSVVRNLHHI 703
           +V +D TF +P  Q+ ++LGAD+V+HS TK+I GH+DV+ G  I+  ++    +  +   
Sbjct: 174 VVVVDNTFMSPYFQRPISLGADVVVHSITKYINGHSDVVMGAVITDNDEFQQHLFFMQLA 233

Query: 702 LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHI 523
           +G   +P   +L+ RG+KTLH+R++     AL +A+ LEA+ ++  V YP LPSHP+H +
Sbjct: 234 VGAVPSPFDCFLVNRGLKTLHIRMRAHYENALAVAKYLEANDRIESVLYPALPSHPQHEV 293

Query: 522 AKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQA 343
            +KQ  G  G++SF + G+L  +  F+ ALK+  +A S GG ES+ + P+IM++  +   
Sbjct: 294 HEKQTKGMSGMISFYLKGELQESRAFLSALKVFTLAESLGGYESLAELPSIMTHASVPAE 353

Query: 342 ERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
            R   GI DNL+R S G+ED +D+ AD+ QAL+
Sbjct: 354 TRIVLGITDNLIRISVGIEDLDDLVADLDQALK 386



>gb:AE017230_411731 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 4 of 16 of the complete
           genome.>gb:AE016958_1055135 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 388

 Score =  171 bits (434), Expect = 1e-41
 Identities = 92/226 (40%), Positives = 135/226 (59%), Gaps = 1/226 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC-ISG 745
           DI  +++L H+  A V +D TFA+P  Q+ L LGAD+VLHS TK+IGGH+DV+ G  ++ 
Sbjct: 165 DIAALAQLGHQHSAKVLVDNTFASPALQQPLTLGADIVLHSTTKYIGGHSDVVGGALVTN 224

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
             +L      L +  G    P  AYL +RG+KTL LR+Q+    A  +A+ L  HP V  
Sbjct: 225 DAELDDAFGFLQNGAGAVPGPFDAYLTMRGLKTLVLRMQRHTENASAVAQFLAGHPAVSA 284

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           V YPGLP HP H +A +QM+GFGG+VS  + G      K     ++  +A S GG ES++
Sbjct: 285 VLYPGLPGHPGHDVAARQMSGFGGMVSVRMRGGRQAARKLCANTRVFILAESLGGVESLI 344

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           + P+ M++        +   + D+LVR S G+ED +D+ AD+ +AL
Sbjct: 345 EHPSAMTH---ASTAGSQLEVPDDLVRLSVGIEDVDDLLADLDRAL 387



>gb:BX321858_773028 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 3/10.
          Length = 391

 Score =  171 bits (433), Expect = 2e-41
 Identities = 90/228 (39%), Positives = 138/228 (60%), Gaps = 2/228 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISGP 742
           DI  ++ +    G  + +D  F TP+ Q+ L LGADLV+HSATK++ G   VL G I G 
Sbjct: 164 DIAALAEIAKRAGVWLAVDNCFCTPIIQQPLKLGADLVIHSATKYLDGQGRVLGGAILGK 223

Query: 741 EKLV--SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVR 568
             L+  S + +     G +L+   A++I++GM+TL LRV+  +  AL +A  LE HP+V 
Sbjct: 224 RDLLMDSGIFSFLRTAGPSLSAFNAWIILKGMETLSLRVKAHSDHALEVARWLETHPRVG 283

Query: 567 RVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESI 388
           RV+YPGLPSHP+H +A +Q    GG+VSFE+ G      + VDA ++  I  + G  +S 
Sbjct: 284 RVFYPGLPSHPQHELAMRQQKTGGGIVSFEVKGGREAAWRVVDAARLMSITANLGDTKST 343

Query: 387 VDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           +  PA  ++  ++Q  R A GI D L+R + G+E  +D+KAD+ + L+
Sbjct: 344 LTHPATTTHGRISQEAREAAGIRDGLLRIAVGLESPDDLKADLARGLQ 391



>gb:BA000030_701191 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 384

 Score =  171 bits (433), Expect = 2e-41
 Identities = 87/226 (38%), Positives = 139/226 (61%), Gaps = 1/226 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC-ISG 745
           DI  ++++  E GA + +D TFATP  Q+ LALGAD+V+HS TK++GGH+DV+ G  +  
Sbjct: 161 DIPAIAQIAREAGAKLVVDNTFATPYLQQPLALGADVVVHSLTKYMGGHSDVVGGALVVS 220

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
            ++L   +    + +G    P  ++L++RG KTL +R+ + +  A ++ E+L  H +V R
Sbjct: 221 DQELGEELAYHQNAMGAVAGPFDSWLVLRGTKTLSVRMDRHSENATKVTEMLTRHARVTR 280

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           V YPGLP HP H IA KQM  FGG+VSF+++G      +  +  K+  +  S GG ES++
Sbjct: 281 VLYPGLPEHPGHEIAAKQMRAFGGMVSFQVEGGEEAAVEVCNRAKVFTLGESLGGVESLI 340

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           + P  M++     A  +A  +  +LVR S G+E+ +D+  D+ QAL
Sbjct: 341 EHPGRMTH---ASAAGSALEVPADLVRLSVGIENVDDLLQDLQQAL 383



>gb:BA000028_697433 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 392

 Score =  171 bits (433), Expect = 2e-41
 Identities = 91/230 (39%), Positives = 140/230 (60%), Gaps = 1/230 (0%)
 Frame = -1

Query: 924 VDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISG 745
           +D+ELV ++  +   LV +D TF++P  Q+ L +G D V+HSATK+I GH DV+AG   G
Sbjct: 163 IDLELVVKVAKKHQLLVVVDNTFSSPYLQRPLEIGCDFVIHSATKYISGHGDVIAGLAVG 222

Query: 744 PEKLVSVVR-NLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVR 568
            + ++  +       +GG L+P  A+L+IRG+KTL LR+ + +S A ++ + L+ H  V+
Sbjct: 223 KKDIMDTIALTTQKDIGGVLSPFDAWLLIRGLKTLPLRMDRHSSNAEKIVQQLKLHKAVK 282

Query: 567 RVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESI 388
            VYYPG P      I  KQM   GGV++FEI+G      K ++ L    IA S G  ES+
Sbjct: 283 NVYYPGDPDFSNVAITNKQMKLAGGVLAFEINGGKKEAQKVLNQLHFIKIAVSLGDAESL 342

Query: 387 VDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           ++ PA M++  +   ER   GI ++L+R S G+E +ED+  D+ QAL+ I
Sbjct: 343 MEHPASMTHAVIPVEEREKMGITESLLRLSVGIEAWEDIWEDIQQALDNI 392



>gb:AP006840_568189 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 395

 Score =  171 bits (433), Expect = 2e-41
 Identities = 95/230 (41%), Positives = 143/230 (62%), Gaps = 2/230 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISGP 742
           D+  V+ L    G     D ++AT L Q+ L LG DLV++S +K+ GGH+DVLAG + GP
Sbjct: 170 DLAAVTALARRHGIATICDNSYATMLLQRPLELGVDLVVYSCSKYFGGHSDVLAGAVLGP 229

Query: 741 EKLVSVVRNLHH-ILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
            + +  + +    +LGG + P  A+LI RG++TL LR++Q   +A R+AE L  HP+V R
Sbjct: 230 AERIRRIGDAEQPLLGGVVGPFEAWLIGRGLRTLPLRLRQHQQSAGRVAEFLAGHPRVAR 289

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEID-GDLMTTAKFVDALKIPYIAPSFGGCESI 388
           V+YPG PSHP+H +A +QM G  G++SFE+D GDL   ++FVDAL++  +  S+GG ES+
Sbjct: 290 VHYPGHPSHPQHGLALRQMRGASGLLSFELDTGDLKQVSRFVDALRLFRLGVSWGGYESL 349

Query: 387 VDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           V  P I +     + +    G    LVR   G+ED +D+  D+ +AL  +
Sbjct: 350 VWLPVIGAMHRAPEEQWPNPG----LVRIHVGLEDVDDLLEDLDRALRAL 395



>gb:SCO939122_178630 Streptomyces coelicolor A3(2) complete genome;
           segment 19/29.
          Length = 386

 Score =  171 bits (433), Expect = 2e-41
 Identities = 88/226 (38%), Positives = 140/226 (61%), Gaps = 1/226 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC-ISG 745
           DI  V+++  + GA + +D TFATP  Q+ LALGAD+V+HS TK++GGH+DV+ G  I G
Sbjct: 163 DIAQVAQVARDAGARLVVDNTFATPYLQQPLALGADVVVHSLTKYMGGHSDVVGGALIVG 222

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
            ++L   +    + +G    P  ++L++RG KTL +R+ + +  A ++A++L  H +V  
Sbjct: 223 DQELGEELAFHQNAMGAVAGPFDSWLVLRGTKTLAVRMDRHSENATKVADMLSRHARVTS 282

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           V YPGLP HP H +A KQM  FGG+VSF ++G      +  +  K+  +  S GG ES++
Sbjct: 283 VLYPGLPEHPGHEVAAKQMKAFGGMVSFRVEGGEQAAVEVCNRAKVFTLGESLGGVESLI 342

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           + P  M++     A  +A  +  +LVR S G+E+ +D+ AD+ QAL
Sbjct: 343 EHPGRMTH---ASAAGSALEVPADLVRLSVGIENADDLLADLQQAL 385



>gb:CR628337_114119 Legionella pneumophila str. Lens complete
           genome.
          Length = 383

 Score =  171 bits (433), Expect = 2e-41
 Identities = 85/230 (36%), Positives = 141/230 (61%), Gaps = 2/230 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           +  ++  ++ +  +   +   D TFATP  Q+ L LG D+VLHSATK++ GH+DV++G +
Sbjct: 153 KLANLRKIAAIAKKHNLITVADNTFATPWIQRPLELGFDIVLHSATKYLNGHSDVISGVV 212

Query: 750 S-GPEKLVS-VVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
             G   ++S  +  L +  G    P  ++L++R +KTL LR+Q+    A  +A  L +HP
Sbjct: 213 VVGDNPMLSDKIAFLQNSCGAVAGPFDSFLVLRSLKTLSLRMQRHCENANHLANWLSSHP 272

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
           K+ +V YPGL SHP++ +AK+QM  FGG++S  + G L    +F+   ++  +A S GG 
Sbjct: 273 KIEKVIYPGLKSHPQYSLAKEQMNDFGGMISLVLKGGLEDAKRFLARCELFTLAESLGGV 332

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           ES+++ PAIM++  +   +R A GI D  +R S G+E  +D++AD+  AL
Sbjct: 333 ESLIEHPAIMTHASIPVEQRKALGIEDGFIRLSVGIEHIDDLRADLEHAL 382



>gb:BX571856_779925 Staphylococcus aureus subsp. aureus strain
           MRSA252, complete genome.
          Length = 380

 Score =  171 bits (432), Expect = 2e-41
 Identities = 89/232 (38%), Positives = 142/232 (61%), Gaps = 1/232 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R  DI+  + +  E G +  +D TF T   Q  L LG D+VLHSATK++GGH+DV+AG +
Sbjct: 150 RVTDIKKSAEIAKEHGLISVVDNTFMTLYYQNPLDLGIDIVLHSATKYLGGHSDVVAGLV 209

Query: 750 S-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
           +   +KL   +  + +  GG L P  +YL++RG+KTL LR++Q N + + + ++L+AHP 
Sbjct: 210 ATSDDKLAERLAFISNSTGGILGPQDSYLLVRGIKTLGLRMEQINRSVIEIIKMLQAHPA 269

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V++V++P + SH  H +   Q  G  GV++FE+  +  +  + + A     +A S G  E
Sbjct: 270 VQQVFHPSIESHLNHDVHMAQADGHTGVIAFEVK-NTESAKQLIKATSYYTLAESLGAVE 328

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           S++  PA+M++  +    RA  GI D LVR S G+ED ED+  D+ QAL+T+
Sbjct: 329 SLISVPALMTHASIPADIRAKEGITDGLVRISVGIEDTEDLVDDLKQALDTL 380



>gb:AL935252_550258 Lactobacillus plantarum strain WCFS1 complete
           genome; segment 1/11.
          Length = 381

 Score =  171 bits (432), Expect = 2e-41
 Identities = 91/229 (39%), Positives = 141/229 (61%), Gaps = 1/229 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI-SG 745
           DI  +++L      L  ID TFA+P  QK L LG D+VLHSA+K++GGH+DV+ G + + 
Sbjct: 151 DIAAIAKLAQAHDLLSIIDNTFASPYVQKPLDLGVDIVLHSASKYLGGHSDVIGGLVVTK 210

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
              L   +  L + +G  L P  ++L+ RGMKTL LR+Q   + A ++   L++HP V +
Sbjct: 211 TPALGEKIGYLQNAIGSILAPQESWLLQRGMKTLALRMQAHLNNAAKIFTYLKSHPAVTK 270

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           +YYPG P +P+  IAK+QM GFG ++SFE+    M    FV+ L++  +A S G  ES++
Sbjct: 271 IYYPGDPDNPDFSIAKQQMNGFGAMISFELQPG-MNPQTFVEHLQVITLAESLGALESLI 329

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           + PA+M++  + +  R   GI D L+R S GVE  +D+ AD+ +   +I
Sbjct: 330 EIPALMTHGAIPRTIRLQNGIKDELIRLSVGVEASDDLLADLERGFASI 378



>gb:AE017011_379125 Bacillus cereus ATCC 14579 section 14 of 18 of
           the complete genome.>gb:AE016877_1019375 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 387

 Score =  171 bits (432), Expect = 2e-41
 Identities = 97/232 (41%), Positives = 135/232 (58%), Gaps = 1/232 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG-C 754
           +  DI  VS+L    GAL  +D TF TPL QK L LGAD+VLHSATKFI GH+DV AG  
Sbjct: 151 KVTDIREVSKLAKSIGALTFVDNTFLTPLFQKPLELGADVVLHSATKFIAGHSDVTAGLA 210

Query: 753 ISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
           +    +L   +  L +  G  L P    L++RG+KTLH+R++     A ++A  L+ H K
Sbjct: 211 VVKDSELAQKLGFLQNAFGAILGPQDCSLVLRGLKTLHVRLEHSAKNANKIAHYLQEHSK 270

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V+ VYYPGL +H    I + Q T  G V+SF +  +     KF+  +K+P  A S G  E
Sbjct: 271 VKNVYYPGLQTHLGFDIQQSQATSAGAVLSFTLQSE-DALRKFLSKVKLPVFAVSLGAVE 329

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           SI+  PA MS+  L+Q  R   GI ++L+R S G+E+  D+ +D   AL  +
Sbjct: 330 SILSYPAKMSHAALSQEARDKRGISNSLLRLSVGLENVNDLISDFENALSYV 381



>gb:AE016801_336067 Vibrio vulnificus CMCP6 chromosome I section 5
           of 11 of the complete sequence.>gb:AE016795_1045791
           Vibrio vulnificus CMCP6 chromosome I complete sequence.
          Length = 388

 Score =  171 bits (432), Expect = 2e-41
 Identities = 93/230 (40%), Positives = 137/230 (59%), Gaps = 1/230 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC- 754
           R VDI  V    H+ GALV +D TF TP+ QK L LGAD V+HS TK+I GH+DV+ G  
Sbjct: 153 RVVDIAEVCEKAHKVGALVAVDNTFLTPVYQKPLELGADFVIHSTTKYINGHSDVIGGVV 212

Query: 753 ISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
           I+  E+  + +    + LG T  P  +Y+ +RG++TL  R++    ++ ++   L+    
Sbjct: 213 ITKTEEHATELSWWGNCLGATGTPFDSYMTLRGIRTLGARMRVHEESSQQILSYLQTQEL 272

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V  +Y+P LP+HP H IAKKQ +GFG ++SFE  G       FV AL +  +A S GG E
Sbjct: 273 VGTIYHPSLPAHPGHEIAKKQQSGFGSMLSFEFAGSFEQLKVFVKALDLFSLAESLGGVE 332

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           S+V  PA M++  + +   A  G+   L+R S G+ED +D+ AD+ QA +
Sbjct: 333 SLVCHPASMTHRAMGEEALAEAGVTQQLLRLSVGLEDAQDLIADLKQAFQ 382



>gb:TACID1_195858 Thermoplasma acidophilum complete genome; segment
           1/5.
          Length = 384

 Score =  171 bits (432), Expect = 2e-41
 Identities = 100/228 (43%), Positives = 139/228 (60%), Gaps = 3/228 (1%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISGP 742
           DI  VS   + K +LV +D TFA+P NQ  L LGAD+V+HSATK+IGGH+D++ G +   
Sbjct: 166 DIRSVSD--YAKKSLVIVDATFASPYNQHPLDLGADVVIHSATKYIGGHSDIVMGVVGTN 223

Query: 741 EKLVS---VVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
            K +    V+R   +  G   +P  AYL +RG+KTL LR+++ N   + +A  L  +  +
Sbjct: 224 SKEIFNSLVIRRKTY--GSNPDPIQAYLALRGLKTLGLRMEKHNRNGMEIATFLRKNDSI 281

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
            RVYYP      +  + KK ++GFGG+VSFEI  D      F+  L IP +A S GG ES
Sbjct: 282 SRVYYP------DTEMGKKVLSGFGGMVSFEIRRD-RDVHSFLRKLSIPMVAASLGGVES 334

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           ++  PA  S+  L++ ER   GI DNLVRFS G+ED ED+ AD+  AL
Sbjct: 335 LITLPAETSHSSLSREERERMGISDNLVRFSIGIEDAEDLIADIQNAL 382



>gb:CP000026_78591 Salmonella enterica subsp. enterica serovar
           Paratypi A str. ATCC 9150.
          Length = 386

 Score =  170 bits (431), Expect = 3e-41
 Identities = 92/228 (40%), Positives = 139/228 (60%), Gaps = 4/228 (1%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R VDI  + RL  E GA+  +D TF +P  Q  LALGADLVLHS TK++ GH+DV+AG +
Sbjct: 152 RVVDIAKICRLAREAGAVSVVDNTFLSPALQNPLALGADLVLHSCTKYLNGHSDVVAGVV 211

Query: 750 --SGPEKLVSVV--RNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEA 583
               PE +  +    N   + GG  +   +YL++RG++TL  R++     A  + + L+ 
Sbjct: 212 IAKDPEVVTELAWWANNIGVTGGAFD---SYLLLRGLRTLVPRMELAQRNAQAIVKYLQT 268

Query: 582 HPKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFG 403
            P V+++Y+P LP +  H IA +Q  GFG ++SFE+DGD  T  +F+  L +  +A S G
Sbjct: 269 QPLVKKLYHPSLPENQGHEIAARQQKGFGAMLSFELDGDEETLRRFLGGLSLFTLAESLG 328

Query: 402 GCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADV 259
           G ES++   A M++  ++   RAA GI + L+R S G+ED ED+ AD+
Sbjct: 329 GVESLISHAATMTHAGMSPQARAAAGISETLLRISTGIEDGEDLIADL 376



>pir|AI0937|AI0937 cystathionine gamma-synthase [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)>gb:AE016846_347482 Salmonella enterica
           subsp. enterica serovar Typhi Ty2, section 13 of 16 of
           the complete genome.>gb:AL627279_543817 Salmonella
           enterica serovar Typhi (Salmonella typhi) strain CT18,
           complete chromosome; segment 15/20.>gb:AE014613_984814
           Salmonella enterica subsp. enterica serovar Typhi Ty2,
           complete genome.
          Length = 386

 Score =  170 bits (431), Expect = 3e-41
 Identities = 92/228 (40%), Positives = 140/228 (61%), Gaps = 4/228 (1%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R VDI  + RL  E GA+  +D TF +P  Q  LALGADLVLHS TK++ GH+DV+AG +
Sbjct: 152 RVVDIAKICRLAREAGAVSVVDNTFLSPALQNPLALGADLVLHSCTKYLNGHSDVVAGVM 211

Query: 750 --SGPEKLVSVV--RNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEA 583
               PE +  +    N   + GG  +   +YL++RG++TL  R++     A  + + L+ 
Sbjct: 212 IAKDPEMVTELAWWANNIGVTGGAFD---SYLLLRGLRTLVPRMELAQRNAQAIVKYLQT 268

Query: 582 HPKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFG 403
            P V+++Y+P LP++  H IA +Q  GFG ++SFE+DGD  T  +F+  L +  +A S G
Sbjct: 269 QPLVKKLYHPSLPNNQGHEIAARQQKGFGAMLSFELDGDEETLRRFLGGLSLFTLAESLG 328

Query: 402 GCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADV 259
           G ES++   A M++  ++   RAA GI + L+R S G+ED ED+ AD+
Sbjct: 329 GVESLISHAATMTHAGMSPQARAAAGISETLLRISTGIEDGEDLIADL 376



>gb:BX950851_842986 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 386

 Score =  170 bits (430), Expect = 4e-41
 Identities = 90/232 (38%), Positives = 144/232 (62%), Gaps = 3/232 (1%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R VDI  + +   E GA+  +D TF +P  QK L LGADLV+HS TK++ GH+DV+AG +
Sbjct: 152 RVVDIAAICQAAREAGAVSVVDNTFLSPALQKPLELGADLVVHSCTKYLNGHSDVVAGAV 211

Query: 750 SGPEKLVSVVRNLH---HILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH 580
              +  V  +  L    + +G T     +YL++RG++TL  R+      A ++ E L+  
Sbjct: 212 IAKD--VDTITELAWWANNIGVTGAAFDSYLLLRGLRTLSPRMAAAQRNAQQVVEFLQTQ 269

Query: 579 PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG 400
           P V+ +Y+P LP++P H IA++Q +GFG ++SFE+DGD  T  +F+ +L++  +A S GG
Sbjct: 270 PLVKALYHPSLPNNPGHDIARRQQSGFGAMLSFELDGDEDTLRRFLASLELFTLAESLGG 329

Query: 399 CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
            ES++   A M++  +    RAA GI + L+R S G+ED +D+ AD+ +A +
Sbjct: 330 VESLISHAATMTHAGMAPEARAAAGISETLLRISTGIEDGDDLVADLDRAFQ 381



>gb:CR628336_111066 Legionella pneumophila str. Paris complete
           genome.>gb:AE017354_459263 Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1, complete genome.
          Length = 383

 Score =  170 bits (430), Expect = 4e-41
 Identities = 84/230 (36%), Positives = 141/230 (61%), Gaps = 2/230 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           +  ++  ++ +  +   +   D TFATP  Q+ L LG D+VLHSATK++ GH+DV++G +
Sbjct: 153 KLANLRKIAAIAKKYNLITVADNTFATPWIQRPLELGFDIVLHSATKYLNGHSDVVSGVV 212

Query: 750 S-GPEKLVS-VVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
             G   ++S  +  L +  G    P  ++L++R +KTL +R+Q+    A  +A  L +HP
Sbjct: 213 VVGDNSVLSDKIAFLQNSCGAVAGPFDSFLVLRSLKTLSVRMQRHCENANHLANWLSSHP 272

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
           K+ +V YPGL SHP++ +AK+QM  FGG++S  + G L    +F+   ++  +A S GG 
Sbjct: 273 KIEKVIYPGLKSHPQYSLAKEQMNNFGGMISLVLKGSLEDAKRFLARCELFTLAESLGGV 332

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           ES+++ PAIM++  +   +R A GI D  +R S G+E  +D++AD+  AL
Sbjct: 333 ESLIEHPAIMTHASIPVEQRKALGIEDGFIRLSVGIEHIDDLRADLEHAL 382



>pir|B71104|B71104 probable cystathionine gamma-lyase - Pyrococcus
           horikoshii>gb:BA000001_649754 Pyrococcus horikoshii OT3
           DNA, complete genome.
          Length = 371

 Score =  169 bits (429), Expect = 5e-41
 Identities = 92/233 (39%), Positives = 140/233 (60%), Gaps = 2/233 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           + +D+  V++ C E   ++ +D TF TPL  K L  GA+ V+HS TK+I GHNDVL G I
Sbjct: 139 KVIDVREVAKRCREVETILVVDNTFVTPLLYKPLKDGANFVVHSLTKYIAGHNDVLGGAI 198

Query: 750 SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
               + +  + N    LGG + P  A++I RGM+TL +R ++Q+  A  +AE L  HPKV
Sbjct: 199 LWNGEFIHDLWNWRRRLGGIIQPFDAWMIERGMRTLEVRFERQSKNAQAIAEFLSEHPKV 258

Query: 570 RRVYYPGLPSHPEHHIAKK--QMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
           + V+YPGL   P H IAKK  +   +GGVVSF++ G+      F+ ++K  + +PS GG 
Sbjct: 259 KEVHYPGLEDDPYHEIAKKLFERDLYGGVVSFDV-GNESNAIVFLRSIKKIFPSPSLGGV 317

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           ESIV  P   +   + + +R A GI + L+R S G+E  +++  D+ +ALE +
Sbjct: 318 ESIVTYPVKSAARYINEEQREALGITEGLIRLSVGLEPLDELLEDLDKALEVV 370



>gb:BA000011_664617 Thermoplasma volcanium GSS1 DNA, complete
           genome.
          Length = 394

 Score =  169 bits (428), Expect = 7e-41
 Identities = 97/229 (42%), Positives = 137/229 (59%), Gaps = 3/229 (1%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISGP 742
           DI+ VS      G  + +D TFA+P NQ  L LGAD+V+HSATK+I GH+DV+ G  S  
Sbjct: 172 DIKAVSE--RSTGKKIIVDATFASPYNQNPLDLGADVVIHSATKYISGHSDVVMGVFSTN 229

Query: 741 EKLVS---VVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
           +K +    VVR      G   +P  +YL +RG+KTL LR+++ N   + +A+ L   P++
Sbjct: 230 DKSIFDKVVVRR--KTFGSNPDPIQSYLALRGIKTLGLRMEKHNKNGMELAKYLRTEPRI 287

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
             VYYP      +  I KK + GFGG++SFE+  +L     F+  LKIP +A S GG ES
Sbjct: 288 SHVYYP------DTEIGKKVLRGFGGMISFELRPELDVHV-FMRNLKIPMVAASLGGVES 340

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           ++  P   S+  +T+ ER   GI DNLVRFS G+ED  D+  D+ QAL+
Sbjct: 341 LITLPVETSHSSMTKEERERIGITDNLVRFSIGIEDHVDLIDDIKQALD 389



>gb:AE017355_465293 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.
          Length = 387

 Score =  169 bits (428), Expect = 7e-41
 Identities = 95/232 (40%), Positives = 137/232 (59%), Gaps = 1/232 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG-C 754
           +  DI  VS L    GAL  +D TF TPL QK L LGAD+VLHSATKFI GH+DV AG  
Sbjct: 151 KVTDIRAVSTLAKSIGALTFVDNTFLTPLFQKPLDLGADVVLHSATKFIAGHSDVTAGLA 210

Query: 753 ISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
           +    +L   +  L +  G  L P    L++RG+KTLH+R++   + A ++A+ L+ H K
Sbjct: 211 VVKDAELAQKLGFLQNAFGAILGPQDCSLVLRGLKTLHVRLEHSAANANKIAQYLQEHSK 270

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           ++ VYYPGL +H    I + Q T  G V+SF +  +     +F+  +K+P  A S G  E
Sbjct: 271 IQNVYYPGLQTHLGFDIQQSQATSAGAVLSFTLQSE-DALRQFLSKVKLPVFAVSLGAVE 329

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           SI+  PA MS+  L+Q  R   GI ++L+R S G+E+ +D+ +D   AL  +
Sbjct: 330 SILSYPAKMSHAALSQEARDERGISNSLLRLSVGLENVDDLISDFENALSYV 381



>gb:AE017037_384434 Bacillus anthracis str. Ames section 14 of 18 of
           the complete genome.>gb:AE017225_409535 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_454281 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:CP000001_854608 Bacillus
           cereus ZK, complete genome.>gb:AE016879_1014139 Bacillus
           anthracis str. Ames complete genome.
          Length = 387

 Score =  169 bits (428), Expect = 7e-41
 Identities = 95/232 (40%), Positives = 137/232 (59%), Gaps = 1/232 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG-C 754
           +  DI  VS L    GAL  +D TF TPL QK L LGAD+VLHSATKFI GH+DV AG  
Sbjct: 151 KVTDIRAVSTLAKSIGALTFVDNTFLTPLFQKPLDLGADVVLHSATKFIAGHSDVTAGLA 210

Query: 753 ISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
           +    +L   +  L +  G  L P    L++RG+KTLH+R++   + A ++A+ L+ H K
Sbjct: 211 VVKDAELAQKLGFLQNAFGAILGPQDCSLVLRGLKTLHVRLEHSAANANKIAQYLQEHSK 270

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           ++ VYYPGL +H    I + Q T  G V+SF +  +     +F+  +K+P  A S G  E
Sbjct: 271 IQNVYYPGLQTHLGFDIQQSQATSAGAVLSFTLQSE-DALRQFLSKVKLPVFAVSLGAVE 329

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           SI+  PA MS+  L+Q  R   GI ++L+R S G+E+ +D+ +D   AL  +
Sbjct: 330 SILSYPAKMSHAALSQEARDERGISNSLLRLSVGLENVDDLISDFENALSYV 381



>gb:AE008891_245713 Salmonella typhimurium LT2, section 195 of 220
           of the complete genome.>gb:AE006468_1002795 Salmonella
           typhimurium LT2, complete genome.
          Length = 386

 Score =  169 bits (428), Expect = 7e-41
 Identities = 91/228 (39%), Positives = 139/228 (60%), Gaps = 4/228 (1%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R VDI  + RL  E GA+  +D TF +P  Q  LALGADLVLHS TK++ GH+DV+AG +
Sbjct: 152 RVVDIAKICRLAREAGAVSVVDNTFLSPALQNPLALGADLVLHSCTKYLNGHSDVVAGVV 211

Query: 750 --SGPEKLVSVV--RNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEA 583
               PE +  +    N   + GG  +   +YL++RG++TL  R++     A  + + L+ 
Sbjct: 212 IAKDPEVVTELAWWANNIGVTGGAFD---SYLLLRGLRTLVPRMELAQRNAQAIVKYLQT 268

Query: 582 HPKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFG 403
            P V+++Y+P LP +  H IA +Q  GFG ++SFE+DGD  T  +F+  L +  +A S G
Sbjct: 269 QPLVKKLYHPSLPENQGHEIAARQQKGFGAMLSFELDGDEETLRRFLGGLSLFTLAESLG 328

Query: 402 GCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADV 259
           G ES++   A M++  ++   RA+ GI + L+R S G+ED ED+ AD+
Sbjct: 329 GVESLISHAATMTHAGMSPQARASAGISETLLRISTGIEDGEDLIADL 376



>gb:CR555306_108112 Azoarcus sp. EbN1 complete genome.
          Length = 389

 Score =  169 bits (428), Expect = 7e-41
 Identities = 85/226 (37%), Positives = 138/226 (61%)
 Frame = -1

Query: 924 VDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISG 745
           +DI  V+ + H  GAL  +D  F TP  Q+ L LGAD+V+HSATK++ G   VL G ++G
Sbjct: 162 IDIAGVAEIAHAAGALFAVDNCFCTPALQRPLELGADVVVHSATKYLDGQGRVLGGAVAG 221

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
            + +V  V       G +++P  A++I++G++TL +R+  Q++T+L +A  LE  P V R
Sbjct: 222 AKVVVDEVLKFLRTAGPSISPFNAWVILKGLETLRIRMDAQSATSLDLARWLEQQPGVVR 281

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           V+YPGLPSHP+H +A +Q    G +VSFE+ G      + VD  ++  I  + G  ++ +
Sbjct: 282 VFYPGLPSHPQHALAMRQQKSGGAIVSFEVAGGRERAWQVVDGTRMISITANLGDTKTTI 341

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
             PA  ++  ++   RAA GI + L+R + G+E  ED++AD+ + L
Sbjct: 342 THPASTTHGRISAEARAAAGIGEGLLRVAVGLESIEDLRADLARGL 387



>gb:AB094500_1198985 Entamoeba histolytica metg mRNA for methionine
           gamma-lyase 2, complete cds.
          Length = 392

 Score =  169 bits (427), Expect = 9e-41
 Identities = 91/228 (39%), Positives = 143/228 (62%), Gaps = 2/228 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCIS-- 748
           DI+ ++++CHEKGA++ +D TF TP+   AL LGAD+VLHS TK+I GH DV+ G ++  
Sbjct: 165 DIKGIAKICHEKGAILVVDCTFTTPVFLPALELGADVVLHSITKYINGHGDVVGGVVTTK 224

Query: 747 GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVR 568
            PE L+  ++      G  + P  A+L IRG+KTL +R++      L++A+ LE HPK++
Sbjct: 225 NPE-LLQKIKAFRKDTGSLMAPMDAFLCIRGVKTLPMRMKVHMENGLKVAKFLEQHPKIK 283

Query: 567 RVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESI 388
           +V +PGL S P H IA +QM GFG   SFE+        K ++ +K+  +A S G  +++
Sbjct: 284 QVNHPGLESFPGHKIAMEQMKGFGSTFSFEMK-SFEAAKKLMEHVKLCGLAVSLGTLDTL 342

Query: 387 VDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           ++ PA M++  + +      G+   LVR S G+E+ +D+ AD+ QALE
Sbjct: 343 IEHPASMTHAAVPEHLLKQQGLTRELVRISVGLENPDDIIADLKQALE 390



>gb:CP000024_876685 Streptococcus thermophilus CNRZ1066, complete
           genome.
          Length = 394

 Score =  169 bits (427), Expect = 9e-41
 Identities = 88/225 (39%), Positives = 142/225 (63%), Gaps = 1/225 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R  DI  V+++      L  ID TF++P  Q+ L  G D+VLHSA+K++GGH+DV+AG +
Sbjct: 148 RVTDISAVAKIAKLHQILSIIDNTFSSPYVQRPLEQGVDIVLHSASKYLGGHSDVIAGLV 207

Query: 750 -SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
            +  ++L   +  L + +GG L P  ++L+ RG+KTL LR++   + A  +   L   P 
Sbjct: 208 VTKDDQLAEKIGYLQNAIGGILAPQESWLLQRGIKTLSLRMRAHLANAEAVFNYLSNQPL 267

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V ++YYPG P++P++ +AKKQM GFG ++SFE+  D +   +FV+ L +  +A S G  E
Sbjct: 268 VSKIYYPGDPNNPDYEVAKKQMHGFGAMISFELQ-DGLDPKQFVEQLHVITLAESLGALE 326

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADV 259
           S+++ PA+M++  + +  R   GI D L+R S GVED +D+ AD+
Sbjct: 327 SLIEIPALMTHGSIPRDIRLKNGIKDELIRLSVGVEDQKDLLADL 371



>gb:CP000023_874769 Streptococcus thermophilus LMG 18311, complete
           genome.
          Length = 394

 Score =  169 bits (427), Expect = 9e-41
 Identities = 88/225 (39%), Positives = 142/225 (63%), Gaps = 1/225 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R  DI  V+++      L  ID TF++P  Q+ L  G D+VLHSA+K++GGH+DV+AG +
Sbjct: 148 RVTDISAVAKIAKLHQILSIIDNTFSSPYVQRPLEQGVDIVLHSASKYLGGHSDVIAGLV 207

Query: 750 -SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
            +  ++L   +  L + +GG L P  ++L+ RG+KTL LR++   + A  +   L   P 
Sbjct: 208 VTKDDQLAEKIGYLQNAIGGILAPQESWLLQRGIKTLSLRMRAHLANAEAVFNYLSNQPL 267

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V ++YYPG P++P++ +AKKQM GFG ++SFE+  D +   +FV+ L +  +A S G  E
Sbjct: 268 VSKIYYPGDPNNPDYEVAKKQMHGFGAMISFELQ-DGLDPKQFVEQLHVITLAESLGALE 326

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADV 259
           S+++ PA+M++  + +  R   GI D L+R S GVED +D+ AD+
Sbjct: 327 SLIEIPALMTHGSIPRDIRLKNGIKDELIRLSVGVEDQKDLLADL 371



>gb:AE017282_429197 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 383

 Score =  169 bits (427), Expect = 9e-41
 Identities = 84/224 (37%), Positives = 139/224 (62%), Gaps = 3/224 (1%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISGP 742
           DI  ++ + H +G L+ +D  F TP  Q+ LALGAD+V+HSATK++ G    + G I G 
Sbjct: 158 DIPRLAEIAHSRGCLLVVDNCFCTPALQRPLALGADIVIHSATKYLDGQGRCVGGAIVGG 217

Query: 741 EKLVSVVRNLHHIL---GGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
            +L+     ++  L   G +++P  A++ ++G++TL+LR++     AL +A  LEA P V
Sbjct: 218 RELLDA--EIYPFLRTGGPSMSPFNAWVFLKGLETLNLRMKAHCENALGLARWLEAQPWV 275

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
            RV+YPGL SHP+H +A +Q +GFGG+VSFE+ G      + +D+ ++  I  + G  ++
Sbjct: 276 ERVHYPGLASHPQHELAARQQSGFGGIVSFEVKGGQEAAWRLIDSTRLLSITGNLGDAKT 335

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADV 259
            +  PA  ++  L+   RAA GI D L+R + G+E+  D++AD+
Sbjct: 336 TITHPATTTHGRLSPEARAAAGIADGLIRIAVGLENLADIQADL 379



>gb:AE017277_425537 Bacillus cereus ATCC 10987, section 14 of 18 of
           the complete genome.>gb:AE017194_1063956 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 387

 Score =  168 bits (426), Expect = 1e-40
 Identities = 95/232 (40%), Positives = 137/232 (59%), Gaps = 1/232 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG-C 754
           +  DI  VS+L    GAL  +D TF TPL QK + LGAD+VLHSATKFI GH+DV AG  
Sbjct: 151 KVTDIRAVSKLAKSIGALTFVDNTFLTPLFQKPIDLGADVVLHSATKFIAGHSDVTAGLA 210

Query: 753 ISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
           +     L   +  L +  G  L P    L++RG+KTLH+R++   + A ++A  L+ H K
Sbjct: 211 VVKDTDLAQKLGFLQNSFGAILGPQDCSLVLRGLKTLHVRLEYSAANANKIAHYLQEHAK 270

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V+ VYYPGL +H   +I + Q T  G V+SF +  +     +F+  +K+P  A S G  E
Sbjct: 271 VQNVYYPGLQTHLGFNIQQSQATSAGAVLSFTLQSE-DALRQFLSKVKLPVFAVSLGAVE 329

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           SI+  PA MS+  L+Q  R   GI ++L+R S G+E+ +D+ +D   AL  +
Sbjct: 330 SILSYPAKMSHAALSQEARDERGISNSLLRLSVGLENVDDLISDFENALSYV 381



>gb:CP000029_80720 Staphylococcus epidermidis RP62A, complete
           genome.>gb:AE016751_323973 Staphylococcus epidermidis
           ATCC 12228, section 8 of 9 of the complete
           genome.>gb:AE015929_1148642 Staphylococcus epidermidis
           ATCC 12228, complete genome.
          Length = 381

 Score =  168 bits (426), Expect = 1e-40
 Identities = 90/232 (38%), Positives = 138/232 (59%), Gaps = 1/232 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R  DI+  +++  +   +  +D TF TP  Q  L  G D+VLHSATK+IGGH+DV+AG +
Sbjct: 150 RVTDIKASAKIAKKYDLISVVDNTFMTPYYQNPLDFGIDIVLHSATKYIGGHSDVVAGLV 209

Query: 750 S-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
           +   + L   +  + +  GG L P  +YL+IRG+KTL LR++Q N     + ++L+ HPK
Sbjct: 210 ATADDDLAERLGFISNSTGGVLGPQDSYLLIRGIKTLGLRMEQINRNVEGIVQMLQKHPK 269

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V++V++P +  H  + I + Q TG  GVVSFE+  D     + + A     +A S G  E
Sbjct: 270 VQQVFHPSIKEHMNYTIHQNQATGHTGVVSFEVK-DTEAAKQVIHATNYFTLAESLGAVE 328

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           S++  PA+M++  +    RA  GI D L+R S G+ED ED+  D+ QAL T+
Sbjct: 329 SLISVPALMTHASIPSDVRAKEGITDGLIRLSIGIEDTEDLVNDLEQALNTL 380



>sp|O53427|METB_MYCTU Cystathionine gamma-synthase (EC 2.5.1.48)
           (CGS) (O-succinylhomoserine
           (Thiol)-lyase).>pir|E70894|E70894 probable metB protein
           - Mycobacterium tuberculosis (strain
           H37RV)>gb:AE000516_21139 Mycobacterium tuberculosis
           CDC1551, complete genome.>gb:BX248337_758463
           Mycobacterium bovis subsp. bovis AF2122/97 complete
           genome; segment 4/14.>gb:BX842575_819136 Mycobacterium
           tuberculosis H37Rv complete genome; segment 4/13.
          Length = 388

 Score =  168 bits (426), Expect = 1e-40
 Identities = 93/226 (41%), Positives = 132/226 (58%), Gaps = 1/226 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC-ISG 745
           DI  ++ L  ++ A V +D TFA+P  Q+ L LGAD+VLHS TK+IGGH+DV+ G  ++ 
Sbjct: 165 DITAIAELGTDRSAKVLVDNTFASPALQQPLRLGADVVLHSTTKYIGGHSDVVGGALVTN 224

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
            E+L      L +  G    P  AYL +RG+KTL LR+Q+ +  A  +AE L  HP V  
Sbjct: 225 DEELDEEFAFLQNGAGAVPGPFDAYLTMRGLKTLVLRMQRHSENACAVAEFLADHPSVSS 284

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           V YPGLPSHP H IA +QM GFGG+VS  +              ++  +A S GG ES++
Sbjct: 285 VLYPGLPSHPGHEIAARQMRGFGGMVSVRMRAGRRAAQDLCAKTRVFILAESLGGVESLI 344

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           + P+ M++        +   + D+LVR S G+ED  D+  D+ QAL
Sbjct: 345 EHPSAMTH---ASTAGSQLEVPDDLVRLSVGIEDIADLLGDLEQAL 387



>gb:AE005674_73601 Shigella flexneri 2a str. 301, complete
           genome.>gb:AE016990_373197 Shigella flexneri 2a str.
           2457T section 13 of 16 of the complete
           genome.>gb:AE014073_997947 Shigella flexneri 2a str.
           2457T complete genome.
          Length = 386

 Score =  167 bits (424), Expect = 2e-40
 Identities = 89/225 (39%), Positives = 137/225 (60%), Gaps = 1/225 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R VDI  +  L  E GA+  +D TF +P  Q  LALGADLVLHS TK++ GH+DV+AG +
Sbjct: 152 RVVDIAKICHLAREVGAVSVVDNTFLSPALQNPLALGADLVLHSCTKYLNGHSDVVAGVV 211

Query: 750 SGPEK-LVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
              +  +V+ +    + +G T     +YL++RG++TL  R++     A  + + L+  P 
Sbjct: 212 IAKDPDVVTELAWWANNIGVTGGAFDSYLLLRGLRTLVPRMELAQRNAQAIVKYLQTQPL 271

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V+++Y+P LP +  H IA +Q  GFG ++SFE+DGD  T  +F+  L +  +A S GG E
Sbjct: 272 VKKLYHPSLPENQGHEIAARQQKGFGAMLSFELDGDEQTLCRFLGGLSLFTLAESLGGVE 331

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADV 259
           S++   A M++  +    RAA GI + L+R S G+ED ED+ AD+
Sbjct: 332 SLISHAATMTHAGMAPEARAAAGISETLLRISTGIEDGEDLIADL 376



>gb:BA000037_723834 Vibrio vulnificus YJ016 DNA, chromosome I,
           complete sequence.
          Length = 388

 Score =  167 bits (423), Expect = 3e-40
 Identities = 92/230 (40%), Positives = 136/230 (59%), Gaps = 1/230 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC- 754
           R VDI  V    H+ GALV +D TF TP+ QK L LGAD V+HS TK+I GH+DV+ G  
Sbjct: 153 RVVDIAEVCEKAHKVGALVAVDNTFLTPVYQKPLELGADFVIHSTTKYINGHSDVIGGVV 212

Query: 753 ISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
           I+  E+  + +    + LG T  P  +Y+ +RG++TL  R++    ++ ++   L+    
Sbjct: 213 ITKTEEHATELAWWGNCLGATGTPFDSYMTLRGIRTLGARMRVHEESSQQILSYLQTQEL 272

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V  +Y+P LP+H  H IAKKQ +GFG ++SFE  G       FV AL +  +A S GG E
Sbjct: 273 VGAIYHPSLPAHSGHEIAKKQQSGFGSMLSFEFVGSFEQLKVFVKALDLFSLAESLGGVE 332

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           S+V  PA M++  + +   A  G+   L+R S G+ED +D+ AD+ QA +
Sbjct: 333 SLVCHPASMTHRAMGEEALAEAGVTQQLLRLSVGLEDAQDLIADLKQAFQ 382



>gb:AE016770_328858 Escherichia coli CFT073 section 16 of 18 of the
           complete genome.>gb:AE014075_959442 Escherichia coli
           CFT073 complete genome.
          Length = 424

 Score =  167 bits (423), Expect = 3e-40
 Identities = 89/225 (39%), Positives = 137/225 (60%), Gaps = 1/225 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R VDI  +  L  E GA+  +D TF +P  Q  LALGADLVLHS TK++ GH+DV+AG +
Sbjct: 190 RVVDIAKICHLAREVGAVSVVDNTFLSPALQNPLALGADLVLHSCTKYLNGHSDVVAGVV 249

Query: 750 SGPEK-LVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
              +  +V+ +    + +G T     +YL++RG++TL  R++     A  + + L+  P 
Sbjct: 250 IAKDPDVVTELAWWANNIGVTGGAFDSYLLLRGLRTLVPRMELAQRNAQAIVKYLQTQPL 309

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V+++Y+P LP +  H IA +Q  GFG ++SFE+DGD  T  +F+  L +  +A S GG E
Sbjct: 310 VKKLYHPSLPENQGHEIAARQQKGFGAMLSFELDGDEQTLRRFLGGLSLFTLAESLGGVE 369

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADV 259
           S++   A M++  +    RAA GI + L+R S G+ED ED+ AD+
Sbjct: 370 SLISHAATMTHAGMAPEARAAAGISETLLRISTGIEDGEDLIADL 414



>gb:CP000031_85391 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 396

 Score =  167 bits (423), Expect = 3e-40
 Identities = 91/231 (39%), Positives = 144/231 (62%), Gaps = 3/231 (1%)
 Frame = -1

Query: 924 VDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISG 745
           +DI  V+ + H  GA V +D  F+TP+  +A+  GAD+V++SATK I G    L G I G
Sbjct: 164 IDITAVAEIAHSVGAKVVVDNVFSTPVFSRAIQQGADVVVYSATKHIDGQGRALGGVIIG 223

Query: 744 PEKLV--SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
             + +  +V   L H  GG L+P +A+++++G++T+ LRV  Q  TA ++AE LE HP++
Sbjct: 224 SREFIRGTVEPYLKHT-GGALSPFSAWIMLKGLETMALRVNAQAETAQKLAEALEGHPEL 282

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGG-VVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
            R  YPGL SH ++ + + Q+ G GG V+S ++ G      +F++AL IP I+ + G  +
Sbjct: 283 VRTLYPGLKSHAQNALIQSQLGGKGGTVLSLDLRGGKPAAFRFLNALTIPVISNNLGDAK 342

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALET 241
           SI   PA  ++  L++A+RA  GI   L+RFS G+ED  D+ AD+  AL++
Sbjct: 343 SIATHPATTTHQRLSEAQRAELGITPGLIRFSVGLEDAGDLLADLRAALDS 393



>pir|D91237|D91237 cystathionine gamma-synthase [imported] -
           Escherichia coli  (strain O157:H7, substrain RIMD
           0509952)>pir|H86084|H86084 cystathionine gamma-synthase
           [imported] - Escherichia coli  (strain O157:H7,
           substrain EDL933)>gb:AE005174_69139 Escherichia coli
           O157:H7 EDL933, complete genome.>gb:BA000007_662880
           Escherichia coli O157:H7 DNA, complete genome.
          Length = 386

 Score =  167 bits (423), Expect = 3e-40
 Identities = 89/225 (39%), Positives = 137/225 (60%), Gaps = 1/225 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R VDI  +  L  E GA+  +D TF +P  Q  LALGADLVLHS TK++ GH+DV+AG +
Sbjct: 152 RVVDIAKICHLAREVGAVSVVDNTFLSPALQNPLALGADLVLHSCTKYLNGHSDVVAGVV 211

Query: 750 SGPEK-LVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
              +  +V+ +    + +G T     +YL++RG++TL  R++     A  + + L+  P 
Sbjct: 212 IAKDPDVVTELAWWANNIGVTGGAFDSYLLLRGLRTLVPRMELAQRNAKAIVKYLQTQPL 271

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V+++Y+P LP +  H IA +Q  GFG ++SFE+DGD  T  +F+  L +  +A S GG E
Sbjct: 272 VKKLYHPSLPENQGHEIAARQQKGFGAMLSFELDGDEQTLRRFLGGLSLFTLAESLGGVE 331

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADV 259
           S++   A M++  +    RAA GI + L+R S G+ED ED+ AD+
Sbjct: 332 SLISHAATMTHAGMAPEARAAAGISETLLRISTGIEDGEDLIADL 376



>sp|P00935|METB_ECOLI Cystathionine gamma-synthase (EC 2.5.1.48)
           (CGS) (O-succinylhomoserine
           (Thiol)-lyase).>pir|A01158|SYECCG O-succinylhomoserine
           (thiol)-lyase (EC 4.2.99.9) - Escherichia coli (strain
           K-12)>gb:ECOMETLB1_129429 E.coli metB and metL (5' end)
           genes coding for cystathione gamma-synthase and
           aspartokinase II-homoserine dehydrogenase
           II.>gb:ECOUW87_131481 E. coli chromosomal region from
           87.2 to 89.2 minutes.>gb:U00096_202915 Escherichia coli
           K-12 MG1655 complete genome.
          Length = 386

 Score =  167 bits (423), Expect = 3e-40
 Identities = 89/225 (39%), Positives = 137/225 (60%), Gaps = 1/225 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R VDI  +  L  E GA+  +D TF +P  Q  LALGADLVLHS TK++ GH+DV+AG +
Sbjct: 152 RVVDIAKICHLAREVGAVSVVDNTFLSPALQNPLALGADLVLHSCTKYLNGHSDVVAGVV 211

Query: 750 SGPEK-LVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
              +  +V+ +    + +G T     +YL++RG++TL  R++     A  + + L+  P 
Sbjct: 212 IAKDPDVVTELAWWANNIGVTGGAFDSYLLLRGLRTLVPRMELAQRNAQAIVKYLQTQPL 271

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V+++Y+P LP +  H IA +Q  GFG ++SFE+DGD  T  +F+  L +  +A S GG E
Sbjct: 272 VKKLYHPSLPENQGHEIAARQQKGFGAMLSFELDGDEQTLRRFLGGLSLFTLAESLGGVE 331

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADV 259
           S++   A M++  +    RAA GI + L+R S G+ED ED+ AD+
Sbjct: 332 SLISHAATMTHAGMAPEARAAAGISETLLRISTGIEDGEDLIADL 376



>gb:AL354872_1923487 Human DNA sequence from clone RP11-42O15 on
           chromosome 1 Contains the CTH gene for cystathionase
           (cystathionine gamma-lyase) and a cysteine and
           histidine-rich domain (CHORD)-containing zinc binding
           protein 1 (CHORDC1) pseudogene, complete sequence.
          Length = 361

 Score =  167 bits (422), Expect = 4e-40
 Identities = 88/204 (43%), Positives = 133/204 (65%), Gaps = 1/204 (0%)
 Frame = -1

Query: 852 TPLNQKALALGADLVLHSATKFIGGHNDVLAGCIS-GPEKLVSVVRNLHHILGGTLNPNA 676
           TP  ++ LALGAD+ ++SATK++ GH+DV+ G +S   E L + +R L + LG   +P  
Sbjct: 148 TPETKRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPID 207

Query: 675 AYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHIAKKQMTGFG 496
            YL  RG+KTLH+R+++     + +A+ LE++P V +V YPGLPSHP+H + K+Q TG  
Sbjct: 208 CYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCT 267

Query: 495 GVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQAERAAYGIMD 316
           G+V+F I G L     F+  LK+  +A S GG ES+ + PAIM++  + + +R   GI D
Sbjct: 268 GMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLGISD 327

Query: 315 NLVRFSFGVEDFEDVKADVLQALE 244
            L+R S G+ED ED+  D+ QAL+
Sbjct: 328 TLIRLSVGLEDEEDLLEDLDQALK 351



>gb:AP002069_1821917 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0015E04.
          Length = 383

 Score =  167 bits (422), Expect = 4e-40
 Identities = 89/228 (39%), Positives = 138/228 (60%), Gaps = 1/228 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISGP 742
           DI+ ++ + H  GALV +D +  +P+  + L LGAD+V+HSATKFI GH+D++AG ++  
Sbjct: 154 DIKKIAEIAHYHGALVLVDNSIMSPVLSRPLELGADIVMHSATKFIAGHSDLMAGILAVK 213

Query: 741 -EKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
            E L   +  L +  G  L P   +L +RG+KT+ LRV++Q + A ++AE L +HP+V++
Sbjct: 214 GESLAKEIAFLQNAEGSGLAPFDCWLCLRGIKTMALRVEKQQANAQKIAEFLASHPRVKK 273

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           V Y GLP HP   +   Q  G G V+SF + G L  +   V+  K   +  SFG  +S++
Sbjct: 274 VNYAGLPDHPGRSLHYSQAKGAGSVLSF-LTGSLALSKHVVETTKYFNVTVSFGSVKSLI 332

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALET 241
             P  MS+  +  A R   G+ D+LVR S G+ED +D+ AD+  AL +
Sbjct: 333 SLPCFMSHASIPSAVREERGLTDDLVRISVGIEDADDLIADLDHALRS 380



>gb:AP002069_1821905 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0015E04.
          Length = 475

 Score =  167 bits (422), Expect = 4e-40
 Identities = 89/228 (39%), Positives = 138/228 (60%), Gaps = 1/228 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISGP 742
           DI+ ++ + H  GALV +D +  +P+  + L LGAD+V+HSATKFI GH+D++AG ++  
Sbjct: 246 DIKKIAEIAHYHGALVLVDNSIMSPVLSRPLELGADIVMHSATKFIAGHSDLMAGILAVK 305

Query: 741 -EKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
            E L   +  L +  G  L P   +L +RG+KT+ LRV++Q + A ++AE L +HP+V++
Sbjct: 306 GESLAKEIAFLQNAEGSGLAPFDCWLCLRGIKTMALRVEKQQANAQKIAEFLASHPRVKK 365

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           V Y GLP HP   +   Q  G G V+SF + G L  +   V+  K   +  SFG  +S++
Sbjct: 366 VNYAGLPDHPGRSLHYSQAKGAGSVLSF-LTGSLALSKHVVETTKYFNVTVSFGSVKSLI 424

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALET 241
             P  MS+  +  A R   G+ D+LVR S G+ED +D+ AD+  AL +
Sbjct: 425 SLPCFMSHASIPSAVREERGLTDDLVRISVGIEDADDLIADLDHALRS 472



>gb:AF286193_1783196 Acremonium chrysogenum
           cystathionine-gamma-lyase (mecB) gene, complete cds; and
           unknown gene.
          Length = 423

 Score =  167 bits (422), Expect = 4e-40
 Identities = 98/228 (42%), Positives = 135/228 (59%), Gaps = 4/228 (1%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG-- 757
           R VDI  V  + H+ G LV +D TF +P  Q  L LGAD+V+HS TK+I GH+DV+ G  
Sbjct: 173 RLVDIRAVVSVAHKHGVLVVVDNTFLSPYVQNPLDLGADIVVHSVTKYINGHSDVVMGVA 232

Query: 756 CISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
             + PE L   +  L + +G   +   ++L  RG+KTLHLR ++ +  A  +A  LEA P
Sbjct: 233 AFNSPE-LKDRLGFLQNAIGAVPSAFDSWLAHRGLKTLHLRAREASRNAAAVAAALEASP 291

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGF--GGVVSFEIDGDLMTTAKFVDALKIPYIAPSFG 403
            V  V YPGL SHP  HIA KQ      GG++SF I G      +F    +I  +A S G
Sbjct: 292 NVISVNYPGLDSHPHRHIALKQHRDGMGGGMLSFRIRGGHDAAERFCQQTRIFTLAESLG 351

Query: 402 GCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADV 259
           G ES+V+ P+ M++  + + +R A G+ D+LVR S GVED ED+K DV
Sbjct: 352 GVESLVELPSSMTHAGIPRDQREAVGVFDDLVRVSCGVEDAEDLKNDV 399



>pir|JC1362|JC1362 cystathionine gamma-lyase (EC 4.4.1.1) -
           human>gb:S52028_2040366 cystathionine gamma-lyase {clone
           HCL-1} [human, liver, mRNA, 1194 nt].
          Length = 361

 Score =  167 bits (422), Expect = 4e-40
 Identities = 88/204 (43%), Positives = 133/204 (65%), Gaps = 1/204 (0%)
 Frame = -1

Query: 852 TPLNQKALALGADLVLHSATKFIGGHNDVLAGCIS-GPEKLVSVVRNLHHILGGTLNPNA 676
           TP  ++ LALGAD+ ++SATK++ GH+DV+ G +S   E L + +R L + LG   +P  
Sbjct: 148 TPETKRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPID 207

Query: 675 AYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHIAKKQMTGFG 496
            YL  RG+KTLH+R+++     + +A+ LE++P V +V YPGLPSHP+H + K+Q TG  
Sbjct: 208 CYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCT 267

Query: 495 GVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQAERAAYGIMD 316
           G+V+F I G L     F+  LK+  +A S GG ES+ + PAIM++  + + +R   GI D
Sbjct: 268 GMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLGISD 327

Query: 315 NLVRFSFGVEDFEDVKADVLQALE 244
            L+R S G+ED ED+  D+ QAL+
Sbjct: 328 TLIRLSVGLEDEEDLLEDLDQALK 351



>pir|E82752|E82752 cystathionine gamma-synthase XF0864 [imported] -
           Xylella fastidiosa (strain 9a5c)>gb:AE003926_48503
           Xylella fastidiosa 9a5c, section 72 of 229 of the
           complete genome.>gb:AE003849_1115713 Xylella fastidiosa
           9a5c, complete genome.
          Length = 405

 Score =  167 bits (422), Expect = 4e-40
 Identities = 94/237 (39%), Positives = 133/237 (56%), Gaps = 9/237 (3%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R  D+  V    H  GAL  +D TF +P+ Q+ L  GADLVLHS TK+I GH+DV+ G +
Sbjct: 160 RITDLGAVIEAAHRVGALTVVDNTFMSPVLQRPLEFGADLVLHSTTKYINGHSDVVGGVV 219

Query: 750 SGPEKLVSVVRNLHHI---------LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMA 598
                   V R++ H          LG T +P  A+L +RG++TL  R++     A  +A
Sbjct: 220 --------VARDVAHYQQLVWWANALGLTGSPFDAFLTLRGVRTLDARLRVHQENAQMIA 271

Query: 597 EVLEAHPKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYI 418
            +LE H  V+ V+YPGL SHP H +A +Q  GFG ++SFE+ G       FV  L+   +
Sbjct: 272 ALLEGHGVVKHVHYPGLASHPGHVLAGRQQKGFGAMLSFELQGGEAAVRAFVSGLRYFTL 331

Query: 417 APSFGGCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           A S GG ES++  PA M++  +T   RA  GI D L+R S G+E  ED+  D++  L
Sbjct: 332 AESLGGVESLIAHPASMTHAAMTPQARAKAGISDGLLRLSVGIEASEDLIVDLVAGL 388



>gb:CEC12C8_1360367 Caenorhabditis elegans cosmid C12C8, complete
           sequence.
          Length = 451

 Score =  166 bits (421), Expect = 5e-40
 Identities = 92/220 (41%), Positives = 133/220 (60%), Gaps = 6/220 (2%)
 Frame = -1

Query: 879 LVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISGPEKLVSVVRNLHHI- 703
           L C+D TF++P N + L LGAD+ LHS +K+IGGH DV+AG ++     VS   N   + 
Sbjct: 238 LTCLDATFSSPYNIQPLKLGADISLHSCSKYIGGHTDVIAGVVT-----VSSYDNWKKLK 292

Query: 702 -----LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSH 538
                 G +L+P  A L+ RG+KTL LRV + +  A + AE LE+HPKV RV+YPGLPSH
Sbjct: 293 LQQLTTGSSLSPYDAALLTRGLKTLGLRVDRISENAQKTAEFLESHPKVERVFYPGLPSH 352

Query: 537 PEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYW 358
           P+H  AK+ M  F G+++F++ G      K V++LK+   A S GG ES+++ P  MS+ 
Sbjct: 353 PQHQYAKQVMKQFAGMIAFDV-GTAENAIKLVESLKLIIHAVSLGGTESLIEHPLSMSHG 411

Query: 357 DLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
                      +   L+RFS G+E+ ED+  D+  ALE +
Sbjct: 412 KHLLRYLDGPTVAPGLLRFSVGIENVEDIIGDLNDALEKL 451



>gb:AE012560_285194 Xylella fastidiosa Temecula1, section 8 of 9 of
           the complete genome.>gb:AE009442_961770 Xylella
           fastidiosa Temecula1, complete genome.
          Length = 400

 Score =  166 bits (421), Expect = 5e-40
 Identities = 94/237 (39%), Positives = 133/237 (56%), Gaps = 9/237 (3%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R  D+  V    H  GAL  +D TF +P+ Q+ L  GADLVLHS TK+I GH+DV+ G +
Sbjct: 160 RITDLGAVIEAAHRVGALTVVDNTFMSPVLQRPLEFGADLVLHSTTKYINGHSDVVGGVV 219

Query: 750 SGPEKLVSVVRNLHHI---------LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMA 598
                   V R++ H          LG T +P  A+L +RG++TL  R++     A  +A
Sbjct: 220 --------VARDVAHYQQLVWWANALGLTGSPFDAFLTLRGVRTLDARLRVHQENAQMIA 271

Query: 597 EVLEAHPKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYI 418
            +LE H  V+ V+YPGL SHP H +A +Q  GFG ++SFE+ G       FV  L+   +
Sbjct: 272 ALLEGHGVVKHVHYPGLASHPGHVLAGRQQKGFGAMLSFELQGGEEAVRAFVSGLRYFTL 331

Query: 417 APSFGGCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           A S GG ES++  PA M++  +T   RA  GI D L+R S G+E  ED+  D++  L
Sbjct: 332 AESLGGVESLIAHPASMTHAAMTPEARAKAGISDGLLRLSVGIEASEDLIVDLVAGL 388



>gb:CR382126_1658702 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 391

 Score =  166 bits (420), Expect = 6e-40
 Identities = 89/233 (38%), Positives = 146/233 (62%), Gaps = 5/233 (2%)
 Frame = -1

Query: 930 RCVDIELVSRLCHE--KGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG 757
           +  DIELV++      K  L+ +D TF +P     L  GAD+V+HSATK+I GH+DV+ G
Sbjct: 154 KVTDIELVAKTAKSINKDILLVVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLG 213

Query: 756 CISGPEKLV-SVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH 580
            ++  +K++   ++ L + +G   +P  ++L+ RG+KTLHLRV+Q + +A ++AE L ++
Sbjct: 214 VLATNDKVIYEKLQFLQNAIGAIPSPFDSWLVHRGVKTLHLRVRQASLSAHKIAEFLSSN 273

Query: 579 PKVRRVYYPGLPSHPEHHIAKKQMTGF--GGVVSFEIDGDLMTTAKFVDALKIPYIAPSF 406
             V  V YPGLP+H  + + KKQ      GG++SF I G     + F  + ++  +A S 
Sbjct: 274 ENVIAVNYPGLPTHESYAVVKKQHRDALGGGMISFRIKGGAEAASTFSSSTRLFTLAESL 333

Query: 405 GGCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           GG ES+++ PA+M++  + + +R A G+ D+LVR S G+ED +D+  D+ QAL
Sbjct: 334 GGIESLLEVPAVMTHGGIPKEQREASGVYDDLVRLSIGIEDTDDLLEDIKQAL 386



>gb:AE017340_456489 Idiomarina loihiensis L2TR, complete genome.
          Length = 408

 Score =  166 bits (420), Expect = 6e-40
 Identities = 86/230 (37%), Positives = 140/230 (60%), Gaps = 1/230 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           + VDIE V  +  +    + +D TF TPL Q+    GAD+V+HSATKF+ GH DV+AG I
Sbjct: 169 KVVDIEKVHAVIADSDIRLVVDNTFMTPLMQQPKRHGADIVVHSATKFLNGHGDVVAGII 228

Query: 750 SGPEKLVSVVRNLH-HILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
            G +  ++ +++     +G T++P+ A+LI+RG+KTL +R+Q+    A  + + L A   
Sbjct: 229 CGSDDDINTIKSTTLKDMGATISPHDAWLILRGLKTLDVRMQRHCENADAVYDFLAARQD 288

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           ++++YYPG P H    +  KQM+  G V++FE++GD      F++ L++  +A S G  E
Sbjct: 289 IKKIYYPGAPDHEAQALMGKQMSRNGAVIAFELEGDEAKARYFLNQLRMIALAVSLGDAE 348

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           +++  PA M++   T   R   GI D L+R + G+E  +D+ AD+ QALE
Sbjct: 349 TLIQHPASMTHSPYTPEARLKAGISDTLIRIAVGLEAADDIIADLEQALE 398



>gb:AE014295_311535 Bifidobacterium longum NCC2705, complete genome.
          Length = 394

 Score =  166 bits (420), Expect = 6e-40
 Identities = 96/232 (41%), Positives = 141/232 (60%), Gaps = 4/232 (1%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC-ISG 745
           DI   + + H+ G  V +D TFA+P  Q  LA GAD+V++S TK+IGGH+DV+ G  +  
Sbjct: 166 DIAATTEVAHKYGTKVAVDNTFASPALQHPLADGADVVVYSTTKYIGGHSDVVGGAVVVN 225

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK--V 571
            E+    V  L +  G   +P  ++L IRG+KTL LRV++ ++ AL++AE LE+ P   +
Sbjct: 226 DEETREKVAFLQNAAGAVPSPFDSWLDIRGLKTLDLRVKRHSANALKVAEWLESQPSDVI 285

Query: 570 RRVYYPGLPSHPEHHIAKKQM-TGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
            RV+YPGL SHP H IA +QM  GFGG+VS ++         FVD  +I  +A S GG E
Sbjct: 286 ERVWYPGLESHPGHEIAARQMHGGFGGIVSVQLAAGAEAAKHFVDHTQIFTLAESLGGVE 345

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           S+++ PA M++            +  NLVR S G+E+ +D+ AD+ QAL+ I
Sbjct: 346 SLIEVPAAMTH---ASVAGTTLQVPANLVRISVGIENADDLIADLKQALDRI 394



>gb:CR380954_1651331 Candida glabrata strain CBS138 chromosome H
           complete sequence.
          Length = 391

 Score =  165 bits (418), Expect = 1e-39
 Identities = 93/234 (39%), Positives = 143/234 (61%), Gaps = 5/234 (2%)
 Frame = -1

Query: 930 RCVDIELVSRLCHE--KGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG 757
           +  DI+LV+    +  K  L+ +D TF +P     L  GAD+V+HSATK+I GH+DV+ G
Sbjct: 154 KVTDIQLVAENVKKINKDILLVVDNTFLSPYLSNPLKFGADIVVHSATKYINGHSDVVLG 213

Query: 756 CISGPEK-LVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH 580
            ++   K +   ++ L + +G   +P  A+L  RG+KTLHLRV+Q +  A ++A  LE++
Sbjct: 214 VLATNSKDIYERLQFLQNAIGCIPSPFDAWLTHRGLKTLHLRVRQASLNATKIATFLESN 273

Query: 579 PKVRRVYYPGLPSHPEHHIAKKQMTGF--GGVVSFEIDGDLMTTAKFVDALKIPYIAPSF 406
             V  V YPGL SHP + + KKQ      GG++SF I G     AKF  + ++  +A S 
Sbjct: 274 ENVVAVNYPGLQSHPNYDVVKKQHREALGGGMISFRIKGGAEAAAKFSSSTRLFTLAESL 333

Query: 405 GGCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           GG ES+++ PA+M++  + +  R A G+ D+LVR S G+ED ED+  D+ QAL+
Sbjct: 334 GGIESLLEVPAVMTHGGIPKEAREASGVFDDLVRLSVGIEDGEDLLEDIKQALQ 387



>gb:AP006627_564264 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 378

 Score =  165 bits (418), Expect = 1e-39
 Identities = 90/231 (38%), Positives = 133/231 (57%), Gaps = 7/231 (3%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           +  DI  ++     +  L+ +D TFATP  Q  L LGAD+V+HSATK++GGH+DV+AG +
Sbjct: 148 KVTDIRKLASYAQAEELLLIVDNTFATPYWQNPLVLGADIVVHSATKYLGGHSDVVAGAV 207

Query: 750 S-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
               EKL   +  + +  G  L P  ++L++RG+KTL +R+++  + A  + + L  HP 
Sbjct: 208 VVKDEKLAETLAFIQNATGAVLGPTDSWLLMRGIKTLGVRMEEIETNARMLVKFLLGHPN 267

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFE------IDGDLMTTAKFVDALKIPYIAP 412
           V R+YYPGL  HP H     Q  GFGG++SFE       D  L  T  F        +A 
Sbjct: 268 VSRIYYPGLVEHPGHATHALQARGFGGIISFEAASEEIADNVLNKTTYFT-------LAE 320

Query: 411 SFGGCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADV 259
           S G  ES++  PA M++  + +  R+A GI + LVR S G+EDFED+  D+
Sbjct: 321 SLGAVESLISLPAKMTHASIPEDRRSALGITNTLVRLSVGLEDFEDLAEDL 371



>gb:CP000011_868890 Burkholderia mallei ATCC 23344 chromosome 2,
           complete sequence.
          Length = 396

 Score =  165 bits (417), Expect = 1e-39
 Identities = 93/235 (39%), Positives = 136/235 (57%), Gaps = 10/235 (4%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISGP 742
           DIE V R+     AL  +D  F +P+ Q+ L LGAD+V+HSATKF+ G   VL G + G 
Sbjct: 164 DIEAVGRIAKAAHALFVVDNCFCSPVLQQPLKLGADVVMHSATKFLDGQGRVLGGALVGS 223

Query: 741 -----EKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
                EK+   VR      G TL+   A+++++GM+TL LRV +Q+  AL +A  LEAHP
Sbjct: 224 KAFIMEKVFPFVRTA----GPTLSAFNAWVLLKGMETLSLRVNRQSENALEIARWLEAHP 279

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDL-----MTTAKFVDALKIPYIAP 412
            V+RV+YPGL SHP+H +AK+Q    G VVSFE++GD          + +D  KI  I  
Sbjct: 280 AVKRVFYPGLESHPQHALAKRQQKSGGSVVSFELNGDTPERQRANAWRVIDGTKIVSITA 339

Query: 411 SFGGCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           + G   + +  PA  ++  +    R A GI + L+R + G+ED  D++ D+ + L
Sbjct: 340 NLGDTRTTITHPATTTHSRIAPEAREAAGITEGLIRLAVGLEDPADIRDDLARGL 394



>gb:BX571966_794952 Burkholderia pseudomallei strain K96243,
           chromosome 2, complete sequence.
          Length = 405

 Score =  165 bits (417), Expect = 1e-39
 Identities = 93/235 (39%), Positives = 136/235 (57%), Gaps = 10/235 (4%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISGP 742
           DIE V R+     AL  +D  F +P+ Q+ L LGAD+V+HSATKF+ G   VL G + G 
Sbjct: 173 DIEAVGRIAKAAHALFVVDNCFCSPVLQQPLKLGADVVMHSATKFLDGQGRVLGGALVGS 232

Query: 741 -----EKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHP 577
                EK+   VR      G TL+   A+++++GM+TL LRV +Q+  AL +A  LEAHP
Sbjct: 233 KAFIMEKVFPFVRTA----GPTLSAFNAWVLLKGMETLSLRVNRQSENALEIARWLEAHP 288

Query: 576 KVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDL-----MTTAKFVDALKIPYIAP 412
            V+RV+YPGL SHP+H +AK+Q    G VVSFE++GD          + +D  KI  I  
Sbjct: 289 AVKRVFYPGLESHPQHALAKRQQKSGGSVVSFELNGDTPERQRANAWRVIDGTKIVSITA 348

Query: 411 SFGGCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           + G   + +  PA  ++  +    R A GI + L+R + G+ED  D++ D+ + L
Sbjct: 349 NLGDTRTTITHPATTTHSRIAPEAREAAGITEGLIRLAVGLEDPADIRDDLARGL 403



>gb:AF082890_1766700 Solanum tuberosum cystathionine beta-lyase
           (CbL) mRNA, complete cds; chloroplast gene for
           chloroplast product.
          Length = 471

 Score =  164 bits (416), Expect = 2e-39
 Identities = 91/228 (39%), Positives = 136/228 (59%), Gaps = 1/228 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCIS-G 745
           DI  ++++ H  GALV +D +  +P+    L LGAD+V+HSATKFI GH+D++AG ++  
Sbjct: 242 DIRKIAKIAHAHGALVLVDNSIMSPVLSHPLELGADIVMHSATKFISGHSDLMAGVLAVR 301

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
            E L   V  L +  G  L P   +L +RG+KT+ LRV++Q   A ++AE L +HP+V++
Sbjct: 302 GESLAKEVYFLQNAEGAGLAPFDCWLCLRGIKTMALRVEKQQENAQKIAEFLSSHPRVKK 361

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           V YPGL  HP   +   Q TG G V+SF + G L  +    +A K   I  SFG  +S++
Sbjct: 362 VNYPGLLDHPGRSLHFSQATGAGSVLSF-LTGSLALSKHVAEATKYFSITVSFGSVKSLI 420

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALET 241
             P  MS+  +    R A G+ ++LVR S G+ED  D+  D+  AL+T
Sbjct: 421 SLPCFMSHASIPVEVREARGLTEDLVRISVGIEDVNDLIDDLDYALKT 468



>gb:CR382135_1668437 Debaryomyces hansenii chromosome C of strain
           CBS767 of Debaryomyces hansenii.
          Length = 400

 Score =  164 bits (415), Expect = 2e-39
 Identities = 90/215 (41%), Positives = 133/215 (61%), Gaps = 3/215 (1%)
 Frame = -1

Query: 879 LVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCIS-GPEKLVSVVRNLHHI 703
           L+ +D TF +P     L  GAD+V+HS TK+I GH+DV+ G ++   ++L    R L + 
Sbjct: 182 LLAVDNTFLSPYISNPLEHGADVVVHSVTKYINGHSDVVMGVLATNSDELHDRFRFLQNA 241

Query: 702 LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHI 523
           +G   +P  ++L  RG+KTLHLRV+Q  ++A ++A+ L  HP V +V YPGL S P H I
Sbjct: 242 IGSIPSPFDSWLAHRGLKTLHLRVRQAATSAQQIAQFLTQHPAVLKVNYPGLKSDPNHEI 301

Query: 522 AKKQMTGF--GGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLT 349
             KQ      GG++SF I+G     + F  + K   +A S GG ES+V+ PAIM++  + 
Sbjct: 302 VVKQHRDSLGGGMISFRINGGAKAASTFTSSTKFFTLAESLGGIESLVEVPAIMTHGGIP 361

Query: 348 QAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           + ER + G+ D+LVR S G+ED +D+  DV QALE
Sbjct: 362 KEERESNGVFDDLVRVSVGIEDTDDLIEDVRQALE 396



>gb:AB094499_1198984 Entamoeba histolytica metg mRNA for methionine
           gamma-lyase, complete cds.
          Length = 389

 Score =  163 bits (413), Expect = 4e-39
 Identities = 89/227 (39%), Positives = 136/227 (59%), Gaps = 1/227 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISGP 742
           DI+ ++ +CHE+GA + +D TF +P   K L LGAD+ LHS +K+I GH DV+ G  S  
Sbjct: 162 DIKGIAVVCHERGARLVVDATFTSPCFLKPLELGADIDLHSVSKYINGHGDVIGGVSSAK 221

Query: 741 E-KLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
             + ++ ++      G  + P  A+L  RGMKTL +R+Q      L++A+ LE H K+ +
Sbjct: 222 TAEDIATIKFYRKDAGSLMAPMDAFLCARGMKTLPIRMQIHMENGLKVAKFLEQHEKIVK 281

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           V +PGL S P H IAKKQMTG+G   SFE+        K ++ LK+  +A S G  ++++
Sbjct: 282 VNHPGLESFPGHDIAKKQMTGYGSTFSFEMK-SFEAAKKLMEHLKVCTLAVSLGCVDTLI 340

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           + PA M++  + +      GI   LVR S G+E+ +D+ AD+ QALE
Sbjct: 341 EHPASMTHAAVPENIMRKQGITPELVRISVGIENVDDIIADLKQALE 387



>gb:CP000003_860117 Streptococcus pyogenes MGAS10394, complete
           genome.
          Length = 463

 Score =  163 bits (413), Expect = 4e-39
 Identities = 94/228 (41%), Positives = 134/228 (58%), Gaps = 3/228 (1%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG-CISG 745
           DI  + +L    G L   D TF T L Q+ LA+G D+V+ S TKFI GH+DV+AG   + 
Sbjct: 237 DISELVQLAKAYGVLTVADNTFMTSLYQEPLAMGVDIVVESVTKFINGHSDVVAGLAATN 296

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
            E + + ++      G  +    A+LI+RGMKT+ +R++Q    A ++A  L  HPKV +
Sbjct: 297 NEAIYNQLKLFQKNFGAIVGVEDAWLILRGMKTMGIRMEQAVKNAQQLANYLAKHPKVLK 356

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDG--DLMTTAKFVDALKIPYIAPSFGGCES 391
           V+YPGL SHP H    +Q    G V+SFE+    +LMT   F   +++P +A S GG ES
Sbjct: 357 VHYPGLDSHPNHDTHLQQAKNGGAVLSFELASKEELMT---FTHRIQLPILAVSLGGVES 413

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           I+  PA MS+  L+   R   G++D L+R S GVE+ ED+ AD  QAL
Sbjct: 414 ILSHPATMSHACLSSQARLEQGVVDGLLRLSCGVENIEDLLADFEQAL 461



>gb:BA000040_729365 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 417

 Score =  163 bits (413), Expect = 4e-39
 Identities = 88/230 (38%), Positives = 139/230 (60%), Gaps = 3/230 (1%)
 Frame = -1

Query: 924 VDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISG 745
           +DI  ++ + H+ GA + +D  FATP+ Q  LALGAD+V++SATK I G    L G I  
Sbjct: 188 LDIPGIAEIAHKGGARLVVDNVFATPIWQSPLALGADVVVYSATKHIDGQGRCLGGIILS 247

Query: 744 PEKLVSVVRNLHHIL---GGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
            E  V+   +LH+ +   G +++P  A+++++G++TL +RV+ Q  TA  +AEVL  HPK
Sbjct: 248 SEAFVA--EHLHNFMRQTGPSISPFNAWVLLKGLETLAVRVRAQTDTAASVAEVLAGHPK 305

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           + R+ YPG   HP+  + KKQM G   +V FE+ G      + ++ LK+  I+ + G  +
Sbjct: 306 ISRLIYPGRADHPQAALVKKQMRGGSTLVGFEVKGGKAAAFRVLNELKLAKISNNLGDAK 365

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           S+V  PA  ++  L   +RAA GI +  +RFS G+E  +D+  D+  ALE
Sbjct: 366 SLVTHPATTTHQRLKPEDRAALGISEGFIRFSAGLEHADDLIEDLTAALE 415



>gb:BA000031_708225 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 1, complete sequence.
          Length = 386

 Score =  163 bits (413), Expect = 4e-39
 Identities = 89/228 (39%), Positives = 132/228 (57%), Gaps = 1/228 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC- 754
           R VDI  V     + GALV +D TF TP+ QK L LGAD V+HS TK+I GH+DV+ G  
Sbjct: 153 RVVDIAAVCEKAKQVGALVAVDNTFLTPVYQKPLELGADFVIHSTTKYINGHSDVIGGVV 212

Query: 753 ISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
           I+  E     +    + +G T  P  +Y+ +RG++TL  R++    ++  +   L+    
Sbjct: 213 ITKTEAHAEELAWWGNCIGATGTPFDSYMTLRGIRTLGARMRVHEESSQHVLNYLQQQAL 272

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V ++Y+P LP HP H IAKKQ +GFG ++SFE  G       FV  L++  +A S GG E
Sbjct: 273 VAKIYHPSLPDHPGHEIAKKQQSGFGSMLSFEFAGSFEQLKVFVKELELFSLAESLGGVE 332

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQA 250
           S++  PA M++  + +   A  G+   L+R S G+ED +D+ AD+ QA
Sbjct: 333 SLICHPASMTHRAMGEEALAEAGVSHQLLRLSVGLEDAQDLIADLDQA 380



>gb:AE014139_303610 Streptococcus pyogenes MGAS315, section 4 of 37
           of the complete genome.>gb:AE014074_926789 Streptococcus
           pyogenes MGAS315, complete genome.
          Length = 406

 Score =  163 bits (413), Expect = 4e-39
 Identities = 94/228 (41%), Positives = 134/228 (58%), Gaps = 3/228 (1%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG-CISG 745
           DI  + +L    G L   D TF T L Q+ LA+G D+V+ S TKFI GH+DV+AG   + 
Sbjct: 180 DISELVQLAKAYGVLTVADNTFMTSLYQEPLAMGVDIVVESVTKFINGHSDVVAGLAATN 239

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
            E + + ++      G  +    A+LI+RGMKT+ +R++Q    A ++A  L  HPKV +
Sbjct: 240 NEAIYNQLKLFQKNFGAIVGVEDAWLILRGMKTMGIRMEQAVKNAQQLANYLAKHPKVLK 299

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDG--DLMTTAKFVDALKIPYIAPSFGGCES 391
           V+YPGL SHP H    +Q    G V+SFE+    +LMT   F   +++P +A S GG ES
Sbjct: 300 VHYPGLDSHPNHDTHLQQAKNGGAVLSFELASKEELMT---FTHRIQLPILAVSLGGVES 356

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           I+  PA MS+  L+   R   G++D L+R S GVE+ ED+ AD  QAL
Sbjct: 357 ILSHPATMSHACLSSQARLEQGVVDGLLRLSCGVENIEDLLADFEQAL 404



>gb:AE009966_257858 Streptococcus pyogenes strain MGAS8232, section
           14 of 173 of the complete genome.>gb:BA000034_713060
           Streptococcus pyogenes SSI-1 DNA, complete
           genome.>gb:AE009949_904240 Streptococcus pyogenes strain
           MGAS8232, complete genome.
          Length = 379

 Score =  163 bits (413), Expect = 4e-39
 Identities = 94/228 (41%), Positives = 134/228 (58%), Gaps = 3/228 (1%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG-CISG 745
           DI  + +L    G L   D TF T L Q+ LA+G D+V+ S TKFI GH+DV+AG   + 
Sbjct: 153 DISELVQLAKAYGVLTVADNTFMTSLYQEPLAMGVDIVVESVTKFINGHSDVVAGLAATN 212

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
            E + + ++      G  +    A+LI+RGMKT+ +R++Q    A ++A  L  HPKV +
Sbjct: 213 NEAIYNQLKLFQKNFGAIVGVEDAWLILRGMKTMGIRMEQAVKNAQQLANYLAKHPKVLK 272

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDG--DLMTTAKFVDALKIPYIAPSFGGCES 391
           V+YPGL SHP H    +Q    G V+SFE+    +LMT   F   +++P +A S GG ES
Sbjct: 273 VHYPGLDSHPNHDTHLQQAKNGGAVLSFELASKEELMT---FTHRIQLPILAVSLGGVES 329

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           I+  PA MS+  L+   R   G++D L+R S GVE+ ED+ AD  QAL
Sbjct: 330 ILSHPATMSHACLSSQARLEQGVVDGLLRLSCGVENIEDLLADFEQAL 377



>gb:AE014295_310816 Bifidobacterium longum NCC2705, complete genome.
          Length = 412

 Score =  163 bits (412), Expect = 5e-39
 Identities = 95/228 (41%), Positives = 136/228 (59%), Gaps = 2/228 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG--CIS 748
           D+  +S + H  GAL  +D TF TP  QK LALGAD+V+HSATK++ GH+DV AG   +S
Sbjct: 160 DVRAISTVAHRFGALSIVDNTFVTPYLQKPLALGADVVIHSATKYLAGHSDVNAGLVVVS 219

Query: 747 GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVR 568
           G E L S V    + LGG L P     + RG++TL LR+ +Q   A  +A  L  HP V+
Sbjct: 220 G-EDLASRVYFAQNRLGGVLAPAECDAVRRGIQTLALRMDRQQENANAIARYLLVHPLVK 278

Query: 567 RVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESI 388
            V+YPGLP   +  +A K + G GGV+SFE+    +  A  ++ L +  +A S G  ES+
Sbjct: 279 AVHYPGLPGAGDQRLAAKGLKGAGGVLSFEVVPG-VDPADVLNNLHLFRLAVSLGAVESL 337

Query: 387 VDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
            + P  M++++L + ER   GI D LVR + G+ED  D+  D+ QA +
Sbjct: 338 AELPCRMTHFELPREERLKIGITDELVRLAVGIEDANDLIEDLGQAFD 385



>gb:AE006486_219397 Streptococcus pyogenes M1 GAS, section 15 of 167
           of the complete genome.>gb:AE004092_1105243
           Streptococcus pyogenes M1 GAS, complete genome.
          Length = 379

 Score =  163 bits (412), Expect = 5e-39
 Identities = 94/228 (41%), Positives = 134/228 (58%), Gaps = 3/228 (1%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG-CISG 745
           DI  + +L    G L   D TF T L Q+ LA+G D+V+ S TKFI GH+DV+AG   + 
Sbjct: 153 DISELVQLAKAYGVLTVADNTFMTSLYQEPLAMGVDIVVESVTKFINGHSDVVAGLAATN 212

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
            E + + ++      G  +    A+LI+RGMKT+ +R++Q    A ++A  L  HPKV +
Sbjct: 213 NEAIYNQLKLFQKNFGAIVGVEDAWLILRGMKTMGIRMEQAVKNAQQLANYLAKHPKVLK 272

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDG--DLMTTAKFVDALKIPYIAPSFGGCES 391
           V+YPGL SHP H    +Q    G V+SFE+    +LMT   F   +++P +A S GG ES
Sbjct: 273 VHYPGLDSHPNHDTHLQQAKNGGAVLSFELASKEELMT---FTHRIQLPILAVSLGGVES 329

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           I+  PA MS+  L+   R   G++D L+R S GVE+ ED+ AD  QAL
Sbjct: 330 ILSHPATMSHACLSPQARLEQGVVDGLLRLSCGVENIEDLLADFEQAL 377



>pir|E87526|E87526 O-succinylhomoserine sulfhydrylase [imported] -
           Caulobacter crescentus>gb:AE005894_213372 Caulobacter
           crescentus CB15 section 220 of 359 of the complete
           genome.>gb:AE005673_923271 Caulobacter crescentus CB15
           complete genome.
          Length = 404

 Score =  163 bits (412), Expect = 5e-39
 Identities = 91/227 (40%), Positives = 138/227 (60%), Gaps = 1/227 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISGP 742
           DI  VS L H  GA V +D  FATP+ QK L LGAD+V++SATK I G   VL G I   
Sbjct: 177 DIRAVSELAHAVGAKVIVDNVFATPIFQKPLELGADVVVYSATKHIDGQGRVLGGAILTS 236

Query: 741 EKL-VSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
           E +     R+     G +L+P  A+++++G++TL LRV++Q  +A  +A  +  H KV+ 
Sbjct: 237 EAINEEFYRDSLRHTGPSLSPFNAWVMLKGLETLDLRVRRQADSAFALANTIAEHKKVQT 296

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           V YP  P HP H++AK QMTG G V++ ++ G      KF++AL+I  I+ + G  +S+ 
Sbjct: 297 VLYPFRPDHPGHNVAKAQMTGGGTVIALDL-GSREAAFKFLNALEIVDISNNLGDAKSMA 355

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
             P   ++  + +AER + G+ +  VR S G+E  ED+K DV++AL+
Sbjct: 356 THPPTTTHRSVPEAERPSLGVTEGGVRLSVGLESVEDLKRDVIRALD 402



>pir|A82045|A82045 cystathionine gamma-synthase VC2683 [imported] -
           Vibrio cholerae (strain N16961 serogroup
           O1)>gb:AE004334_53054 Vibrio cholerae O1 biovar eltor
           str. N16961 chromosome I, section 242 of 251 of the
           complete chromosome.>gb:AE003852_1053828 Vibrio cholerae
           O1 biovar eltor str. N16961 chromosome I, complete
           chromosome.
          Length = 388

 Score =  163 bits (412), Expect = 5e-39
 Identities = 91/228 (39%), Positives = 131/228 (57%), Gaps = 1/228 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R VDI  + +L   +G LV +D TF TP+ QK L LGAD VLHS TK+I GH+DV+ G +
Sbjct: 153 RVVDIAHLCQLAKAQGTLVAVDNTFLTPVFQKPLTLGADFVLHSTTKYINGHSDVIGGVL 212

Query: 750 SGPEKL-VSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
               K     +    + LG T  P  +Y+ +RG++TL  R++    +A ++   L+    
Sbjct: 213 ICKHKQHAEELAWWGNCLGSTGTPFDSYMTLRGIRTLGARMRVHEESAQQILAYLQTQSL 272

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V ++Y+P LP HP H IAKKQ +GFG ++SFE  G       FV  L +  +A S GG E
Sbjct: 273 VSKIYHPSLPDHPGHEIAKKQQSGFGAMLSFEFAGSFEQLKFFVGKLALFSLAESLGGVE 332

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQA 250
           S++  PA M++  + +   A  GI   L+R S G+ED  D+ AD+ QA
Sbjct: 333 SLICHPASMTHRAMGEEALAEAGISQQLLRLSVGLEDASDLIADLDQA 380



>gb:AY316747_608840 Rhizobium sp. NGR234 megaplasmid 2 contig 1,
           complete sequence.
          Length = 425

 Score =  162 bits (410), Expect = 9e-39
 Identities = 91/241 (37%), Positives = 138/241 (57%), Gaps = 13/241 (5%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R  D+  V+ L H  GALV +D T ATP+  + LALG DLV+HS TKFI GH D L G +
Sbjct: 190 RLTDLSAVAALAHRHGALVSVDSTLATPVATRPLALGVDLVIHSLTKFINGHGDALGGIV 249

Query: 750 SGPEKLVSVVRNLHHI-LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
            G ++LV  +R+   + LG +L+   A+LI+RG+ TL  R++  + +A+R+A  L  HP 
Sbjct: 250 CGRKELVEKIRSRAGVYLGASLSAQNAWLIMRGIDTLFPRLKAMSDSAMRIAHFLRDHPG 309

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           VR V YPGL +HP+H +A++QM  FGG+V+F+ D       +  + L++ + A S G   
Sbjct: 310 VRSVTYPGLETHPQHALARRQMRIFGGIVTFQTDDPQKIALRLAERLRVVHYAFSLG--- 366

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIM------------DNLVRFSFGVEDFEDVKADVLQA 250
               Q +I+   D  +   + YG+             D + R S G+E  +D+ AD+ +A
Sbjct: 367 ---HQRSIVVLLDTKEMMNSTYGLEGPQLDDYRAFAGDGVFRLSVGLESVDDIIADLDRA 423

Query: 249 L 247
           L
Sbjct: 424 L 424



>gb:AY458646_619925 Uncultured bacterium 578 clone EBAC080-L31E09
           genomic sequence.
          Length = 385

 Score =  162 bits (409), Expect = 1e-38
 Identities = 85/222 (38%), Positives = 130/222 (58%)
 Frame = -1

Query: 924 VDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISG 745
           VD+  +S +  +   ++ ID    TP  QK LALGADLV+HSATK+I G    LAG I+G
Sbjct: 162 VDLRALSAISKKNNIILAIDNCIMTPALQKPLALGADLVIHSATKYIDGQGRCLAGAIAG 221

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
             KL+  + +     G TL+   A++I +G++TL LR+Q     A ++A  L     V++
Sbjct: 222 NNKLIDEISSFARSTGPTLSAFNAWIIFKGLETLSLRMQAHCENAKKLAVWLNEQEFVKK 281

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           V+Y GL SHP H IAK+Q + +GG+VSFE+ G      + ++  K+  I  + G  +S +
Sbjct: 282 VHYLGLDSHPHHSIAKEQQSDYGGIVSFEVIGGRKEAFRLINNTKMISITANLGDTKSTI 341

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADV 259
             PA  ++  L+  E+    I +NL+R S G+ED ED+ AD+
Sbjct: 342 THPATTTHVRLSDEEKQQSNISENLIRISVGLEDIEDIIADI 383



>gb:AE010233_260833 Pyrococcus furiosus DSM 3638, section 108 of 173
           of the complete genome.>gb:AE009950_901614 Pyrococcus
           furiosus DSM 3638, complete genome.
          Length = 366

 Score =  162 bits (409), Expect = 1e-38
 Identities = 86/231 (37%), Positives = 142/231 (61%), Gaps = 2/231 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           + +D+  V++ C E+   + +D TF TP+  + L  G + V+HS TK+I GHNDV  G I
Sbjct: 135 KVIDVREVAKKCREEEITLIVDNTFVTPILYRPLEDGVNFVVHSLTKYIAGHNDVTGGVI 194

Query: 750 SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
               K ++ + +    LG  + P  A+++ RGM+TL++R ++Q+  AL +AE L+ HPKV
Sbjct: 195 LWNGKFLNDLWDWRRRLGTIIQPFDAWMVERGMRTLNVRFEKQSKNALAIAEFLQDHPKV 254

Query: 570 RRVYYPGLPSHPEHHIAKK--QMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGC 397
           R+V+YPGLPS P H IA++  +   +GGVVSF++ G   +   F+ +LK  + +PS GG 
Sbjct: 255 RKVHYPGLPSDPYHGIARRLFRKDLYGGVVSFDL-GSEKSALAFLRSLKKIFPSPSLGGV 313

Query: 396 ESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           ES+   P   +  ++ +  R   GI D L+R S G+E+ +++  D+ +AL+
Sbjct: 314 ESLATYPVKSAVKNMEKETRDLLGITDGLIRLSVGIEEVDELIEDLDRALK 364



>pir|F70632|F70632 probable metZ protein - Mycobacterium
           tuberculosis (strain H37RV)>gb:AE000516_20394
           Mycobacterium tuberculosis CDC1551, complete
           genome.>gb:BX248335_757755 Mycobacterium bovis subsp.
           bovis AF2122/97 complete genome; segment
           2/14.>gb:BX842573_818433 Mycobacterium tuberculosis
           H37Rv complete genome; segment 2/13.
          Length = 406

 Score =  162 bits (409), Expect = 1e-38
 Identities = 93/231 (40%), Positives = 141/231 (61%), Gaps = 5/231 (2%)
 Frame = -1

Query: 924 VDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISG 745
           VDI  V+ L H  GA V +D  FATPL Q+   LG D+V++S TK I G   VL G I G
Sbjct: 175 VDIAAVTELAHAAGAKVVLDNVFATPLLQQGFPLGVDVVVYSGTKHIDGQGRVLGGAILG 234

Query: 744 PEKLVS-VVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVR 568
             + +   V+ L    G  ++   A+++++G++TL +RVQ  N++A R+AE L  HP VR
Sbjct: 235 DREYIDGPVQKLMRHTGPAMSAFNAWVLLKGLETLAIRVQHSNASAQRIAEFLNGHPSVR 294

Query: 567 RVYYPGLPSHPEHHIAKKQMTGFGGVVSFEID--GDLMTTAKF--VDALKIPYIAPSFGG 400
            V YP LPSHP++ +AK+QM+G G VV+F +D   D+     F  +D +++  I+ + G 
Sbjct: 295 WVRYPYLPSHPQYDLAKRQMSGGGTVVTFALDCPEDVAKQRAFEVLDKMRLIDISNNLGD 354

Query: 399 CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
            +S+V  PA  ++  +    RAA G+ D +VR S G+ED +D+ AD+ +AL
Sbjct: 355 AKSLVTHPATTTHRAMGPEGRAAIGLGDGVVRISVGLEDTDDLIADIDRAL 405



>gb:AP006618_561228 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 381

 Score =  161 bits (408), Expect = 1e-38
 Identities = 91/226 (40%), Positives = 128/226 (56%), Gaps = 1/226 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC-ISG 745
           DI  ++ + H  GA + +D TFATP  Q+ L LGAD+V+HS TK++GGH+DV+ G  I+ 
Sbjct: 157 DIPALAEIAHAAGAKLVVDNTFATPYLQQPLVLGADVVVHSTTKYLGGHSDVVGGALITN 216

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
             +L +    L +  G    P  AYL +RG KTL +R+++    A  +A  L  HP V  
Sbjct: 217 DPELDAAFGFLQNGAGAVPGPFDAYLTMRGTKTLAVRMERHCDNAEAIAGFLAKHPAVST 276

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           V YPGLP HP H +A KQM  FGG++S  + G       F    KI  +A S GG ES++
Sbjct: 277 VIYPGLPEHPGHAVADKQMRRFGGMISVRLHGGRDAALDFCSRTKIFTLAESLGGVESLI 336

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           + P  M++        +   +  +LVR S G+ED  D+ ADV QAL
Sbjct: 337 EHPGAMTH---ASTAGSQLEVPADLVRLSVGIEDAADLLADVEQAL 379



>gb:CP000020_872443 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 388

 Score =  161 bits (407), Expect = 2e-38
 Identities = 86/228 (37%), Positives = 132/228 (57%), Gaps = 1/228 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R VDI  + +   + GALV +D TF +P+ Q+ L+LGAD V+HS TK+I GH+DV+ G +
Sbjct: 153 RVVDIAEICQKAAQVGALVAVDNTFLSPVLQQPLSLGADFVIHSTTKYINGHSDVVGGVL 212

Query: 750 SGPEKL-VSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
               K     +    + +G T     +YL +RG++TL  R++     A+ + + L+  P 
Sbjct: 213 IAKTKAHADDLAWWGNCIGATGTAFDSYLTLRGIRTLGARMRVHEENAIEVLKCLQEQPL 272

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V  +Y+P LP HP H IAK+Q  GFG ++SFE++G L     FV  LK   +A S GG E
Sbjct: 273 VGTIYHPSLPEHPGHEIAKRQQVGFGAMLSFELNGSLEQLKVFVKELKYFSLAESLGGVE 332

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQA 250
           S++  P  M++  ++   +   G+   L+R S G+ED  D+ AD+ QA
Sbjct: 333 SLIAHPGTMTHRAMSDEAQEEAGLAPTLLRLSVGLEDSRDLIADLQQA 380



>gb:AF497482_516560 Micromonospora echinospora calicheamicin
           biosynthetic locus, complete sequence.
          Length = 381

 Score =  161 bits (407), Expect = 2e-38
 Identities = 94/227 (41%), Positives = 134/227 (59%), Gaps = 1/227 (0%)
 Frame = -1

Query: 924 VDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISG 745
           VD+  VSR  HE+GA V +D TFA+P+ Q+ LALGAD+ L+S TK I GH DVL G +  
Sbjct: 153 VDVAEVSRRAHERGARVVVDNTFASPVLQQPLALGADVSLYSTTKSIAGHADVLGGALVY 212

Query: 744 PEK-LVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVR 568
            +  L + VR      G        +L+ RG+ TL LRV +Q +TA  + E L A P V 
Sbjct: 213 RDADLHAAVRAYRTTAGNVPGALDCFLVRRGLHTLSLRVHRQVATARVLVERLRASPVVG 272

Query: 567 RVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESI 388
            V+YPGLP HP+H + K QM+  G +VSF+  G      + +D   +     S GG  S+
Sbjct: 273 AVHYPGLPEHPQHAVVKAQMSAPGAIVSFDYLGG--PAERLLDRFTLFTCGVSLGGVHSL 330

Query: 387 VDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
           V+ PA+M++  L+   RA  GI ++L+R S G+ED +D+  D+ +AL
Sbjct: 331 VECPALMTHRPLSAEARARRGIGESLIRLSVGIEDPQDLAEDLSRAL 377



>gb:AE017279_425991 Bacillus cereus ATCC 10987, section 16 of 18 of
           the complete genome.>gb:AE017194_1064410 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 392

 Score =  160 bits (406), Expect = 3e-38
 Identities = 90/232 (38%), Positives = 135/232 (58%), Gaps = 1/232 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC- 754
           + +D++ V R+    G LV +D TF +P  Q+ L LG D V+HSATK+IGGH DV+AG  
Sbjct: 161 KLIDLKQVIRVAKRNGLLVIVDNTFCSPYLQRPLELGCDAVVHSATKYIGGHGDVVAGVT 220

Query: 753 ISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
           I   + L   +R +   +GG + P  A+L++RG+KTL +R+ +    A ++   L+ H  
Sbjct: 221 ICKTKALAEKIRPMRKDIGGIMAPFDAWLLLRGLKTLAVRMDRHCDNAEKIVSFLKNHDA 280

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V  V+YP      E  +A +QM   GGV+SF I G    T  F++ L    IA S G  E
Sbjct: 281 VEGVWYP------EGELASRQMKRGGGVISFSIKGGKEETQAFINDLHFITIAVSLGDTE 334

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           +++  PA M++  +  A R   GI DNL+R S G+E +ED+ +D+ QAL+ I
Sbjct: 335 TLIQHPATMTHAAIPAALRQEMGIYDNLIRLSVGLESWEDIVSDLEQALKKI 386



>gb:AE017013_379517 Bacillus cereus ATCC 14579 section 16 of 18 of
           the complete genome.>gb:AE016877_1019767 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 391

 Score =  160 bits (406), Expect = 3e-38
 Identities = 89/232 (38%), Positives = 134/232 (57%), Gaps = 1/232 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC- 754
           + +D++ V R+   KG LV +D TF +P  Q+ L LG D V+HSATK+IGGH DV+AG  
Sbjct: 161 KLIDLKQVIRVAKRKGLLVIVDNTFCSPYLQRPLELGCDAVVHSATKYIGGHGDVVAGVT 220

Query: 753 ISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
           I   + L   +R +   +GG + P  A+L++RG+KTL +R+ +    A ++   L  H  
Sbjct: 221 ICKTKALAEKIRPMRKDIGGIMAPFDAWLLLRGLKTLAVRMDRHCDNAEKIVSFLRKHDA 280

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V  V+YP      E  +A +QM   GGV+SF + G    T  F++ L    IA S G  E
Sbjct: 281 VEGVWYP------EGELASRQMKRGGGVISFSVKGGKEETQAFINDLHFITIAVSLGDTE 334

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           +++  PA M++  +    R   GI DNL+R S G+E +ED+ +D+ QAL+ I
Sbjct: 335 TLIQHPATMTHAAIPAELRKEMGIFDNLIRLSVGLESWEDIVSDLEQALKKI 386



>gb:BA000016_673216 Clostridium perfringens str. 13 DNA, complete
           genome.
          Length = 384

 Score =  160 bits (405), Expect = 3e-38
 Identities = 89/227 (39%), Positives = 134/227 (59%), Gaps = 1/227 (0%)
 Frame = -1

Query: 924 VDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCIS- 748
           +DI++ S    +   L  +D TF TP  Q  L LGAD+V+HSATK++GGH+D++AG +  
Sbjct: 149 IDIKIASDKAKKYNLLTIVDNTFMTPYFQNPLNLGADIVIHSATKYLGGHSDLVAGLVVV 208

Query: 747 GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVR 568
             E+L   +  + +  GG L P  ++L+IRG+KTL +R+ +    A  +AE L     + 
Sbjct: 209 KDEELGEKIHFIQNSTGGILQPFDSFLLIRGIKTLSVRMDRHELNANFIAEKLGDLEGID 268

Query: 567 RVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESI 388
            VYYPGL +H  H I KKQ +GFGG++SF ++       KF ++L++     S GG ES+
Sbjct: 269 NVYYPGLKTHIGHDIQKKQASGFGGIISFTLN-KKYNYEKFFNSLELITFGESLGGVESL 327

Query: 387 VDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
              PA M++  +    R   GI D L+R S G+ED ED+  D+ +AL
Sbjct: 328 ACHPASMTHAAMPLELRERIGITDRLIRISVGIEDKEDILEDIQKAL 374



>gb:AB028629_4614 Clostridium perfringens metB, cysK, ygaG, lipA
           genes for cystathionine beta-synthase, cysteine
           synthase, hypothetical protein, lipase, partial and
           complete cds.
          Length = 351

 Score =  160 bits (405), Expect = 3e-38
 Identities = 89/227 (39%), Positives = 134/227 (59%), Gaps = 1/227 (0%)
 Frame = -1

Query: 924 VDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCIS- 748
           +DI++ S    +   L  +D TF TP  Q  L LGAD+V+HSATK++GGH+D++AG +  
Sbjct: 116 IDIKIASDKAKKYNLLTIVDNTFMTPYFQNPLNLGADIVIHSATKYLGGHSDLVAGLVVV 175

Query: 747 GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVR 568
             E+L   +  + +  GG L P  ++L+IRG+KTL +R+ +    A  +AE L     + 
Sbjct: 176 KDEELGEKIHFIQNSTGGILQPFDSFLLIRGIKTLSVRMDRHELNANFIAEKLGDLEGID 235

Query: 567 RVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESI 388
            VYYPGL +H  H I KKQ +GFGG++SF ++       KF ++L++     S GG ES+
Sbjct: 236 NVYYPGLKTHIGHDIQKKQASGFGGIISFTLN-KKYNYEKFFNSLELITFGESLGGVESL 294

Query: 387 VDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
              PA M++  +    R   GI D L+R S G+ED ED+  D+ +AL
Sbjct: 295 ACHPASMTHAAMPLELRERIGITDRLIRISVGIEDKEDILEDIQKAL 341



>pir|T43791|T43791 cystathionine beta-synthase [imported] -
           Clostridium perfringens (fragment)
          Length = 351

 Score =  160 bits (405), Expect = 3e-38
 Identities = 89/227 (39%), Positives = 134/227 (59%), Gaps = 1/227 (0%)
 Frame = -1

Query: 924 VDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCIS- 748
           +DI++ S    +   L  +D TF TP  Q  L LGAD+V+HSATK++GGH+D++AG +  
Sbjct: 116 IDIKIASDKAKKYNLLTIVDNTFMTPYFQNPLNLGADIVIHSATKYLGGHSDLVAGLVVV 175

Query: 747 GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVR 568
             E+L   +  + +  GG L P  ++L+IRG+KTL +R+ +    A  +AE L     + 
Sbjct: 176 KDEELGEKIHFIQNSTGGILQPFDSFLLIRGIKTLSVRMDRHELNANFIAEKLGDLEGID 235

Query: 567 RVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESI 388
            VYYPGL +H  H I KKQ +GFGG++SF ++       KF ++L++     S GG ES+
Sbjct: 236 NVYYPGLKTHIGHDIQKKQASGFGGIISFTLN-KKYNYEKFFNSLELITFGESLGGVESL 294

Query: 387 VDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
              PA M++  +    R   GI D L+R S G+ED ED+  D+ +AL
Sbjct: 295 ACHPASMTHAAMPLELRERIGITDRLIRISVGIEDKEDILEDIQKAL 341



>pir|B81949|B81949 cystathionine beta-lyase (EC 4.4.1.8) NMA1012
           [similarity] - Neisseria meningitidis (strain Z2491
           serogroup A)>gb:NMA3Z2491_153937 Neisseria meningitidis
           serogroup A strain Z2491 complete genome; segment 3/7.
          Length = 385

 Score =  160 bits (404), Expect = 4e-38
 Identities = 93/235 (39%), Positives = 135/235 (57%), Gaps = 5/235 (2%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R VDI+ ++      GALV ID TFATP  Q+ L +G D V HSATK++ GH+DVL G +
Sbjct: 151 RLVDIKALAAKAKAAGALVGIDNTFATPYLQQPLDMGCDFVFHSATKYLCGHSDVLMGIV 210

Query: 750 SGPEKLVSVVRNLHHIL---GGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH 580
               K   + + LH ++   G    P   +L++RG+KTL LR+      AL +A  LEAH
Sbjct: 211 VAKTK--ELAQPLHDMMVHTGAVAGPMDCWLVLRGIKTLALRMNAHYQNALEIARRLEAH 268

Query: 579 PKVRRVYYPGLPSHPEHHIAKKQM-TGFGGVVSFEIDGDLMTTA-KFVDALKIPYIAPSF 406
           P + +V++PGLPSH  + +AK QM  G GGVV+  +  D    A   +  +K+  +A S 
Sbjct: 269 PAIEKVFHPGLPSHEHYELAKTQMPKGIGGVVTVYLKNDTREAANSVIKNMKLVKMASSL 328

Query: 405 GGCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALET 241
           GG ES+V+     S+  +    +   GI   L+RFS G+ED +D+  D+  AL+T
Sbjct: 329 GGVESLVNHCYSQSHSGVPHNVKMEMGIRVGLLRFSVGIEDVDDIWNDISAALDT 383



>pir|A81158|A81158 cystathionine beta-lyase (EC 4.4.1.8) NMB0802
           [similarity] - Neisseria meningitidis (strain MC58
           serogroup B)>gb:AE002433_46254 Neisseria meningitidis
           serogroup B strain MC58 section 75 of 206 of the
           complete genome.>gb:AE002098_896367 Neisseria
           meningitidis serogroup B strain MC58 complete genome.
          Length = 385

 Score =  160 bits (404), Expect = 4e-38
 Identities = 93/235 (39%), Positives = 136/235 (57%), Gaps = 5/235 (2%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R VDI++++      GALV ID TFATP  Q+ L +G D V HSATK++ GH+DVL G +
Sbjct: 151 RLVDIKVLAAKAKAAGALVGIDNTFATPYLQQPLDMGCDFVFHSATKYLCGHSDVLMGIV 210

Query: 750 SGPEKLVSVVRNLHHIL---GGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH 580
               K   + + LH ++   G    P   +L++RG+KTL LR+      AL +A  LEAH
Sbjct: 211 VAKTK--ELAQPLHDMMVHTGAVAGPLDCWLVLRGIKTLALRMNAHCQNALEIARRLEAH 268

Query: 579 PKVRRVYYPGLPSHPEHHIAKKQM-TGFGGVVSFEIDGDLMTTA-KFVDALKIPYIAPSF 406
           P + +V++PGLPSH  + +AK QM  G GGVV+  +  D    A   +  +K+  +A S 
Sbjct: 269 PAIEKVFHPGLPSHEHYELAKTQMPKGIGGVVTVYLKNDTREAANSVIKNMKLVKMASSL 328

Query: 405 GGCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALET 241
           GG ES+V+     S+  +    +   GI   L+RFS G+ED +D+  D+  AL+T
Sbjct: 329 GGVESLVNHCYSQSHSGVPHDVKMEMGIKVGLLRFSIGIEDADDIWNDISAALDT 383



>gb:BA000035_717126 Corynebacterium efficiens YS-314 DNA, complete
           genome.
          Length = 409

 Score =  159 bits (403), Expect = 6e-38
 Identities = 91/229 (39%), Positives = 136/229 (59%), Gaps = 1/229 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI-SG 745
           DIE V++      A + +D TFA+P  Q+ L LGA  VLHS TK+IGGH+DV+ G + + 
Sbjct: 182 DIEAVAKAAEGTDAKLVVDNTFASPYLQQPLKLGAYAVLHSTTKYIGGHSDVVGGLVVTN 241

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
            ++L   +  +   +G   +   AYL  RG+KTL +R+ +    A ++AE L++ P+V  
Sbjct: 242 DQQLDEELLFMQGSIGPIPSVFDAYLTGRGVKTLAVRMDRHCDNAEKIAEFLDSRPEVST 301

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           V YPGL SHP H +AK+QM  FGG++S    G      KF  + K+  +A S GG ES++
Sbjct: 302 VLYPGLESHPGHEVAKRQMKRFGGMISVRFAGGEEAAKKFCTSTKLICLAESLGGVESLL 361

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           + PA M++     A  +   +  +LVR S G+ED ED+ ADV QAL+ +
Sbjct: 362 EHPATMTH---QSAAGSQLEVPRDLVRISIGIEDIEDLLADVEQALDQL 407



>gb:AE009875_256806 Pyrobaculum aerophilum strain IM2 section 130 of
           201 of the complete genome.>gb:AE009441_899432
           Pyrobaculum aerophilum strain IM2 complete genome.
          Length = 383

 Score =  159 bits (403), Expect = 6e-38
 Identities = 91/233 (39%), Positives = 136/233 (58%), Gaps = 3/233 (1%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG-C 754
           R +D   + +   + GA+V +D TFATP+    ++ GAD+V+HSATK++ GHNDV+ G  
Sbjct: 152 RVLDGPEIIKAAKDLGAVVVVDNTFATPVLTTPISYGADVVVHSATKYLAGHNDVVGGIA 211

Query: 753 ISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
           +     L+  +     +LG  + P  A+L +RG+KTL +R ++Q  TA+ +A+ LE H K
Sbjct: 212 VVARGDLLEELWIWRAMLGSIMQPFEAFLTLRGLKTLFVRFEKQCKTAMAVAQFLEGHGK 271

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTG--FGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG 400
           V  V YPGL SHP HH   K++ G  FG VVSF I G      +F  +L++    PS GG
Sbjct: 272 VAEVIYPGLSSHP-HHATAKRLFGDKFGAVVSFRIKGGRDAVVRFFKSLRLITPGPSLGG 330

Query: 399 CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALET 241
            ES    P   +   + + ER   GI ++LVR S G+E+ ED+  D+ +AL +
Sbjct: 331 VESNATYPVASAASPIPEDERKILGITEDLVRLSIGLEEAEDLIEDLDRALNS 383



>gb:CR543861_104193 Acinetobacter sp. ADP1 complete genome.
          Length = 396

 Score =  159 bits (403), Expect = 6e-38
 Identities = 83/228 (36%), Positives = 130/228 (57%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISGP 742
           DI  ++ + H   A++ +D +F TP  Q+ L LGADLV++SATK+I G    L G ++G 
Sbjct: 169 DIPALAEIAHAHNAMLVVDNSFCTPALQQPLKLGADLVMYSATKYIDGQGRALGGAVTGS 228

Query: 741 EKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRV 562
            KL+  V  +   LG +++P  A++ ++G++TL LR++     A ++AE L+ H  V +V
Sbjct: 229 HKLLEEVFGVVRTLGPSMSPFNAWVFLKGLETLRLRMKAHCENAQQLAEWLDQHKNVEKV 288

Query: 561 YYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVD 382
           YY GLP H  H  A KQ  GFGG+VSF + G      K +D  +   I  + G  +S + 
Sbjct: 289 YYAGLPQHIGHERATKQQQGFGGIVSFVVKGGREGAWKVIDNTQFISITGNLGDVKSTIT 348

Query: 381 QPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
            PA  ++  L+   + A GI + L+R S G+ED  D+  D+ + L  I
Sbjct: 349 HPATTTHGKLSPEAKQAAGIQEGLIRVSVGLEDISDIIRDLDRGLALI 396



>pir|T47234|T47234 O-succinylhomoserine (thiol)-lyase (EC 4.2.99.9)
           [validated] - Corynebacterium
           glutamicum>gb:AF126953_481391 Corynebacterium glutamicum
           cystathionine gamma-synthase (metB) gene, complete
           cds.>gb:BA000036_720173 Corynebacterium glutamicum ATCC
           13032 DNA, complete genome.>gb:BX927155_833981
           Corynebacterium glutamicum ATCC 13032, IS fingerprint
           type 4-5, complete genome; segment
           8/10.>gb:AX764323_1474564 Sequence 135 from Patent
           WO03040681.
          Length = 386

 Score =  159 bits (403), Expect = 6e-38
 Identities = 90/229 (39%), Positives = 135/229 (58%), Gaps = 1/229 (0%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI-SG 745
           DIE V++L     A + +D TFA+P  Q+ L LGA  VLHS TK+IGGH+DV+ G + + 
Sbjct: 161 DIEAVAKLTEGTNAKLVVDNTFASPYLQQPLKLGAHAVLHSTTKYIGGHSDVVGGLVVTN 220

Query: 744 PEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRR 565
            +++   +  +   +G   +   AYL  RG+KTL +R+ +    A ++AE L++ P+V  
Sbjct: 221 DQEMDEELLFMQGGIGPIPSVFDAYLTARGLKTLAVRMDRHCDNAEKIAEFLDSRPEVST 280

Query: 564 VYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIV 385
           V YPGL +HP H +A KQM  FGG++S    G      KF  + K+  +A S GG ES++
Sbjct: 281 VLYPGLKNHPGHEVAAKQMKRFGGMISVRFAGGEEAAKKFCTSTKLICLAESLGGVESLL 340

Query: 384 DQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           + PA M++     A  +   +  +LVR S G+ED ED+ ADV QAL  +
Sbjct: 341 EHPATMTH---QSAAGSQLEVPRDLVRISIGIEDIEDLLADVEQALNNL 386



>pir|H96947|H96947 cystathionine beta-lyase [imported] - Clostridium
           acetobutylicum>gb:AE007554_227732 Clostridium
           acetobutylicum ATCC 824 section 42 of 356 of the
           complete genome.>gb:AE001437_1090687 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 377

 Score =  159 bits (403), Expect = 6e-38
 Identities = 91/230 (39%), Positives = 131/230 (56%), Gaps = 1/230 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           +  DI  +  L  E   LV  D TF +P  Q+ L LGAD+V+HSATKF+ GH+D++AG +
Sbjct: 149 KITDIRAIVELAREYKLLVIADNTFMSPYLQRPLELGADIVVHSATKFLNGHSDIVAGLV 208

Query: 750 SGPEK-LVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
               K L   +  + +  G  L+P  ++L++RGMKTL +R+  Q + A  +A+ L  +  
Sbjct: 209 VAKNKELADKIYFVQNAFGAVLSPQDSWLLLRGMKTLKVRLNYQQNNATELAKWLLLNKF 268

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V RV+YPG+PSH    I   Q +G G V+SFE          F+  +K   +  S GG E
Sbjct: 269 VDRVHYPGMPSHEGREIHLSQASGAGAVLSFEA-CSTEKAKSFMKKVKCAAVGVSLGGVE 327

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           +IV  PA MS+ ++   ER   GI DNL+R S G+ED ED+  +   ALE
Sbjct: 328 TIVSYPAKMSHAEIPHNERIKLGIGDNLIRVSVGLEDIEDLIENFKIALE 377



>pir|T19213|T19213 hypothetical protein C12C8.2 - Caenorhabditis
           elegans
          Length = 444

 Score =  159 bits (402), Expect = 7e-38
 Identities = 90/220 (40%), Positives = 130/220 (59%), Gaps = 6/220 (2%)
 Frame = -1

Query: 879 LVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISGPEKLVSVVRNLHHI- 703
           L C+D TF++P N + L LGAD+ LHS +K+IGGH DV+AG ++     VS   N   + 
Sbjct: 238 LTCLDATFSSPYNIQPLKLGADISLHSCSKYIGGHTDVIAGVVT-----VSSYDNWKKLK 292

Query: 702 -----LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSH 538
                 G +L+P  A L+ RG+KTL LRV + +  A + AE LE+HPKV RV+YPGLPSH
Sbjct: 293 LQQLTTGSSLSPYDAALLTRGLKTLGLRVDRISENAQKTAEFLESHPKVERVFYPGLPSH 352

Query: 537 PEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYW 358
           P+H  AK+ M  F G+++F++ G      K V+A+       S GG ES+++ P  MS+ 
Sbjct: 353 PQHQYAKQVMKQFAGMIAFDV-GTAENAIKLVEAI-------SLGGTESLIEHPLSMSHG 404

Query: 357 DLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
                      +   L+RFS G+E+ ED+  D+  ALE +
Sbjct: 405 KHLLRYLDGPTVAPGLLRFSVGIENVEDIIGDLNDALEKL 444



>gb:RNCYGLY_2134727 Rat mRNA for cystathionine gamma-lyase (EC
           4.4.1.1).
          Length = 364

 Score =  159 bits (401), Expect = 1e-37
 Identities = 90/233 (38%), Positives = 142/233 (60%), Gaps = 4/233 (1%)
 Frame = -1

Query: 930 RCVDIELVSRLCHE-KGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC 754
           +  DI+  +++ H+ K  ++ +D TF +   Q+ LALGAD+ + SATK++ GH+DV+ G 
Sbjct: 130 KLADIKACAQIVHKHKDIILVVDNTFMSAYFQRPLALGADICMCSATKYMNGHSDVVMGL 189

Query: 753 IS-GPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNS--TALRMAEVLEA 583
           +S   + L   +R L + LG   +P   YL  RG+K  H R   +N+    + +A  LE+
Sbjct: 190 VSVNSDDLNERLRFLQNSLGAVPSPFDCYLCCRGLK--HCRSGWRNTFQDGMAVARFLES 247

Query: 582 HPKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFG 403
           +P+V +V YPGLPSHP+H +AK+      G+VSF I G L     F+  +K+  +A S G
Sbjct: 248 NPRVEKVIYPGLPSHPQHELAKRSARACPGMVSFYIKGTLQHAQVFLKNIKLFALAESLG 307

Query: 402 GCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           G ES+ + PAIM++  + + +RA  GI D L+R S G+ED +D+  D+ QAL+
Sbjct: 308 GYESLAELPAIMTHASVPEKDRATLGISDTLIRLSVGLEDEKDLLEDLGQALK 360



>gb:CP000001_854996 Bacillus cereus ZK, complete genome.
          Length = 392

 Score =  158 bits (400), Expect = 1e-37
 Identities = 89/232 (38%), Positives = 133/232 (57%), Gaps = 1/232 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC- 754
           + +D++ V R+    G LV +D TF +P  Q+ L LG D V+HSATK+IGGH DV+AG  
Sbjct: 161 KLIDLKQVIRVAKRNGLLVIVDNTFCSPYLQRPLELGCDAVVHSATKYIGGHGDVVAGVT 220

Query: 753 ISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
           I     L   +R +   +GG + P  A+L++RG+KTL +R+ +    A ++   L+ H  
Sbjct: 221 ICKTRALAEKIRPMRKDIGGIMAPFDAWLLLRGLKTLAVRMDRHCDNAEKIVSFLKNHDA 280

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V  V+YP      E  +A +QM   GGV+SF I G    T  F++ L    IA S G  E
Sbjct: 281 VEGVWYP------EGELASRQMKRGGGVISFSIKGGKEETQAFINDLHFITIAVSLGDTE 334

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           +++  PA M++  +    R   GI DNL+R S G+E +ED+ +D+ QAL+ I
Sbjct: 335 TLIQHPATMTHAAIPAELRQEMGIYDNLIRLSVGLESWEDIVSDLEQALKKI 386



>gb:AE017355_465679 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.
          Length = 392

 Score =  158 bits (399), Expect = 2e-37
 Identities = 89/232 (38%), Positives = 133/232 (57%), Gaps = 1/232 (0%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGC- 754
           + +D++ V R+    G LV +D TF +P  Q+ L LG D V+HSATK+IGGH DV+AG  
Sbjct: 161 KLIDLKQVIRVAKRNGLLVIVDNTFCSPYLQRPLELGCDAVVHSATKYIGGHGDVVAGVT 220

Query: 753 ISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK 574
           I     L   +R +   +GG + P  A+L++RG+KTL +R+ +    A ++   L+ H  
Sbjct: 221 ICKTRALAEKIRPMRKDIGGIMAPFDAWLLLRGLKTLAVRMDRHCDNAEKIVSFLKNHDA 280

Query: 573 VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE 394
           V  V+YP      E  +A +QM   GGV+SF I G    T  F++ L    IA S G  E
Sbjct: 281 VEGVWYP------EGELASRQMKRGGGVISFSIKGGKEETQAFINDLYFITIAVSLGDTE 334

Query: 393 SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI 238
           +++  PA M++  +    R   GI DNL+R S G+E +ED+ +D+ QAL+ I
Sbjct: 335 TLIQHPATMTHAAIPAELRQEMGIYDNLIRLSVGLESWEDIVSDLEQALKKI 386



>gb:AE017241_414578 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 15 of 16 of the complete
           genome.>gb:AE016958_1057982 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 408

 Score =  158 bits (399), Expect = 2e-37
 Identities = 92/231 (39%), Positives = 139/231 (60%), Gaps = 5/231 (2%)
 Frame = -1

Query: 924 VDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISG 745
           VDI  V+ L H  GA V +D  FATPL Q+ + LG D+V++S TK I G   VL G I G
Sbjct: 177 VDIAAVTELAHAAGAKVVLDNVFATPLLQQGIPLGVDVVVYSGTKHIDGQGRVLGGAILG 236

Query: 744 PEKLVS-VVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVR 568
               +   V+ L    G  ++   A+++++G++T+ +RV+  NS+A R+AE LE HP VR
Sbjct: 237 DRDYIDGPVQKLMRHTGPAMSAFNAWVLLKGLETMAIRVEHSNSSAHRIAEFLETHPAVR 296

Query: 567 RVYYPGLPSHPEHHIAKKQMTGFGGVVSFEID--GDLMTTAKF--VDALKIPYIAPSFGG 400
            V YP LPSHP++ +AK+QM+G G V++F +D   D      F  +D L +  I+ + G 
Sbjct: 297 WVRYPYLPSHPQYDLAKRQMSGGGTVITFALDCPDDKAKQRAFEVLDKLTLIDISNNLGD 356

Query: 399 CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
            +S+V  PA  ++  +    RAA G+ D +VR S G+E  +D+ AD+ +AL
Sbjct: 357 AKSLVTHPATTTHRAMGPEGRAAIGLGDGVVRISVGLEGTDDLIADIDRAL 407



>gb:TACID2_196301 Thermoplasma acidophilum complete genome; segment
           2/5.
          Length = 380

 Score =  158 bits (399), Expect = 2e-37
 Identities = 81/229 (35%), Positives = 139/229 (60%)
 Frame = -1

Query: 930 RCVDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCI 751
           R  DI+ +S    +  AL+ +D T  TP+ Q+A+  GAD+V++S +KFIGGHN  + G  
Sbjct: 148 RVYDIKRLSDSAKQNNALLVVDDTIITPVGQRAIDHGADIVVNSLSKFIGGHNAAIGGSS 207

Query: 750 SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV 571
           SG  + +  + +    LG +++P +A+L ++GMKTL +R+++ + +A  +AE L     V
Sbjct: 208 SGSSEFIKNIDSDRRSLGSSMDPFSAFLFLQGMKTLKIRIERSSRSAQIIAEHLSTLDHV 267

Query: 570 RRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCES 391
            RVYYPGL  +  H +A + +  +G VVSF +D D +  +KF+ +L+    A + G  E+
Sbjct: 268 ERVYYPGLTENDYHDLALRTLKNYGSVVSFVLD-DGVDASKFMSSLERIIPANTMGSVET 326

Query: 390 IVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE 244
           ++  P  MS+ +L+  ERA  G++  L+R S G+E+  D+  D+  A++
Sbjct: 327 LISNPYSMSHRNLSDKERARIGVVPGLMRLSVGIEEISDIMDDIENAIK 375



>gb:MLCB4_145115 Mycobacterium leprae cosmid B4.
          Length = 426

 Score =  158 bits (399), Expect = 2e-37
 Identities = 93/231 (40%), Positives = 136/231 (58%), Gaps = 5/231 (2%)
 Frame = -1

Query: 924 VDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISG 745
           VDI  V+ L H  GA V +D  FATPL Q  L LG D+V++S TK I G   VL G I G
Sbjct: 195 VDIAAVTELAHAAGAKVVLDNAFATPLLQHGLPLGVDVVIYSGTKHIDGQGRVLGGAILG 254

Query: 744 PEKLVS-VVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVR 568
               +   V+ L    G  ++   A+++++G++TL +RV   NS+A R+AE LE HP V 
Sbjct: 255 DRDYIDGPVQKLMRHTGPAMSAFNAWILLKGLETLAIRVDHCNSSAHRIAEFLEKHPAVS 314

Query: 567 RVYYPGLPSHPEHHIAKKQMTGFGGVVSFEI----DGDLMTTAKFVDALKIPYIAPSFGG 400
            V YP L SHP++ +AK+QM+G G VV+F +    D       + +D L++  I+ +FG 
Sbjct: 315 WVRYPFLVSHPQYDLAKRQMSGGGTVVTFALNSPEDAAKQRAFEVLDRLRLIDISNNFGD 374

Query: 399 CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
            +S++  PA  ++  +    RAA G+ D +VR S G+ED  D+ AD+ QAL
Sbjct: 375 VKSLITHPATTTHRAMGPEGRAAIGLGDGVVRISIGLEDAADLIADIDQAL 425



>pir|C86943|C86943 probable o-succinylhomoserine sulfhydrylase
           [imported] - Mycobacterium leprae>gb:MLEPRTN2_146075
           Mycobacterium leprae strain TN complete genome; segment
           2/10.
          Length = 406

 Score =  158 bits (399), Expect = 2e-37
 Identities = 93/231 (40%), Positives = 136/231 (58%), Gaps = 5/231 (2%)
 Frame = -1

Query: 924 VDIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCISG 745
           VDI  V+ L H  GA V +D  FATPL Q  L LG D+V++S TK I G   VL G I G
Sbjct: 175 VDIAAVTELAHAAGAKVVLDNAFATPLLQHGLPLGVDVVIYSGTKHIDGQGRVLGGAILG 234

Query: 744 PEKLVS-VVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVR 568
               +   V+ L    G  ++   A+++++G++TL +RV   NS+A R+AE LE HP V 
Sbjct: 235 DRDYIDGPVQKLMRHTGPAMSAFNAWILLKGLETLAIRVDHCNSSAHRIAEFLEKHPAVS 294

Query: 567 RVYYPGLPSHPEHHIAKKQMTGFGGVVSFEI----DGDLMTTAKFVDALKIPYIAPSFGG 400
            V YP L SHP++ +AK+QM+G G VV+F +    D       + +D L++  I+ +FG 
Sbjct: 295 WVRYPFLVSHPQYDLAKRQMSGGGTVVTFALNSPEDAAKQRAFEVLDRLRLIDISNNFGD 354

Query: 399 CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL 247
            +S++  PA  ++  +    RAA G+ D +VR S G+ED  D+ AD+ QAL
Sbjct: 355 VKSLITHPATTTHRAMGPEGRAAIGLGDGVVRISIGLEDAADLIADIDQAL 405



>gb:CR382132_1665184 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 394

 Score =  157 bits (396), Expect = 4e-37
 Identities = 88/220 (40%), Positives = 129/220 (58%), Gaps = 3/220 (1%)
 Frame = -1

Query: 891 EKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAG-CISGPEKLVSVVRN 715
           ++   + +D TF +P  Q  L LGAD+V+HS TK+I GH+DV+ G   +  + +   +R 
Sbjct: 171 DEQVFLVVDNTFMSPYVQNPLTLGADIVVHSVTKYINGHSDVVMGVAATNSDAIHEKLRF 230

Query: 714 LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP 535
           L + +G   +P  ++L  RG+KTLH+RV   ++ A  +AE LE  P V  V YPGL S+P
Sbjct: 231 LQNAIGAVPSPFDSWLAHRGVKTLHIRVGTASNNAQAIAEFLEKSPLVEAVNYPGLESNP 290

Query: 534 EHHIAKKQMTGF--GGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSY 361
              + K+Q      GG++SF I G   +  KF    KI  +A S GG ES+ + PA M++
Sbjct: 291 RREVVKRQHRNGLGGGMISFRIKGGAESANKFCQNTKIFTLAESLGGIESLCEVPAAMTH 350

Query: 360 WDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALET 241
             +    R A G+ DNLVR S G+ED ED+  DV QAL++
Sbjct: 351 AGIDVKAREASGVFDNLVRLSVGIEDKEDLLKDVEQALQS 390



>gb:AP006840_569870 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 435

 Score =  157 bits (396), Expect = 4e-37
 Identities = 95/259 (36%), Positives = 142/259 (54%), Gaps = 33/259 (12%)
 Frame = -1

Query: 921 DIELVSRLCHEKGALVCIDGTFATPLNQKALALGADLVLHSATKFIGGHNDVLAGCIS-- 748
           DI  V+ + HE G  + ID TFATP+  + +  GADLV+HSATK++GGH   + G +   
Sbjct: 172 DIAGVAAIAHEHGLPLVIDNTFATPMLCRPIEHGADLVIHSATKWLGGHGVAMGGVVVDS 231

Query: 747 -----------------------------GPEKLVSVVR-NLHHILGGTLNPNAAYLIIR 658
                                        G    ++ VR  +   LGG  +P  A+L++ 
Sbjct: 232 GNFDWNSPRFPGFTEPDPSYHGVRYAVDFGRAGFITKVRAQMLRDLGGCQSPFNAFLLLL 291

Query: 657 GMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHIAKKQMTG-FGGVVSF 481
           G+ TL LR++  +  AL +A  L  HP V  V YPGLPSHP+H +A++ +TG FGG++ F
Sbjct: 292 GLDTLALRMRAISENALEIARYLSEHPAVAWVRYPGLPSHPDHALAQRYLTGGFGGMLVF 351

Query: 480 EIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRF 301
            + G L   A+F+D++++     + G   S+V  PA  ++  LT A+R A G+ D+L+R 
Sbjct: 352 GLKGGLEAGARFIDSVRLFSHVANVGDARSLVIHPASTTHSQLTPAQREAAGVGDDLIRV 411

Query: 300 SFGVEDFEDVKADVLQALE 244
           S G ED  D+ AD+ QALE
Sbjct: 412 SVGFEDVADLIADLEQALE 430


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,018,745,165
Number of Sequences: 1806583
Number of extensions: 22267402
Number of successful extensions: 61121
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 58008
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 60347
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 66569713038
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)