BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10799
         (750 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB007646_1510170 Arabidopsis thaliana genomic DNA, chromosome...   181   2e-44   
pir|T51611|T51611 phosphoprotein phosphatase (EC 3.1.3.16) PP7 [...   181   2e-44   Arabidopsis thaliana [mouse-ear cress]
gb:AP004765_1844673 Oryza sativa (japonica cultivar-group) genom...   176   1e-43   
pir|D96521|D96521 protein F21D18.16 [imported] - Arabidopsis tha...   103   4e-21   Arabidopsis thaliana [mouse-ear cress]
pir|T50799|T50799 serine/threonine protein phosphatase-like prot...    98   2e-19   Arabidopsis thaliana [mouse-ear cress]
gb:AY182777_1587883 Lycopersicon esculentum type 5 protein serin...    55   1e-06   
gb:AY150041_1584918 Lycopersicon esculentum type 5 serine/threon...    55   1e-06   
gb:AC135918_1742825 Oryza sativa (japonica cultivar-group) chrom...    55   2e-06   
gb:AY182779_1587886 Arabidopsis thaliana type 5 protein serine/t...    54   4e-06   
gb:AY080674_1568404 Arabidopsis thaliana putative phosphoprotein...    54   4e-06   
gb:AC006931_1534828 Arabidopsis thaliana chromosome 2 clone F7D1...    54   4e-06   
pir|E84858|E84858 phosphoprotein phosphatase (EC 3.1.3.16) At2g4...    54   4e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AF032879_1762665 Arabidopsis thaliana protein phosphatase U (...    51   2e-05   
gb:BC073033_2556946 Xenopus laevis protein phosphatase 5, mRNA (...    48   5e-05   
gb:AF018263_2468871 Xenopus laevis protein phosphatase 5 (PP5) m...    48   5e-05   
gb:BC054321_2550967 Xenopus laevis cDNA clone IMAGE:6873203, par...    48   6e-05   
gb:BC080162_2561592 Xenopus tropicalis ppp5c-prov protein, mRNA ...    48   2e-04   
gb:AF305085_1260700 Trypanosoma brucei serine/threonine protein ...    48   2e-04   
gb:PPP5C_2039892 Human serine-threonine phosphatase (PP5) mRNA, ...    46   6e-04   
gb:HSRNAPPP5_2020084 H.sapiens mRNA for protein phosphatase 5.         46   6e-04   
gb:CR859667_1183773 Pongo pygmaeus mRNA; cDNA DKFZp459E169 (from...    46   6e-04   
pir|S52570|S52570 phosphoprotein phosphatase (EC 3.1.3.16) 5 [va...    46   6e-04   Homo sapiens [man]
sp|P53041|PPP5_HUMAN|PPP5_HUMAN Serine/threonine protein phosphatase 5 (EC ...    46   6e-04   Homo sapiens [man]
gb:BC078786_2106945 Rattus norvegicus protein phosphatase 5, cat...    44   0.001   
pir|A55346|A55346 phosphoprotein phosphatase (EC 3.1.3.16) PPT [...    44   0.001   Rattus norvegicus [brown rat]
sp|P53042|PPP5_RAT|PPP5_RAT Serine/threonine protein phosphatase 5 (EC 3....    44   0.001   Rattus norvegicus [brown rat]
sp|Q60676|PPP5_MOUSE|PPP5_MOUSE Serine/threonine protein phosphatase 5 (EC ...    44   0.001   Mus musculus [mouse]
gb:RNU12203_2136861 Rattus norvegicus phosphoprotein phosphatase...    44   0.001   
gb:AE014297_1138737 Drosophila melanogaster chromosome 3R, compl...    43   0.003   
gb:CR382128_1660617 Yarrowia lipolytica chromosome B of strain C...    41   0.007   
gb:BC000750_1967000 Homo sapiens protein phosphatase 5, catalyti...    43   0.007   
pir|T46576|T46576 phosphoprotein phosphatase (EC 3.1.3.16) ppt-1...    42   0.012   Neurospora crassa
gb:AY054983_1291088 Plasmodium falciparum Dd2 serine/threonine p...    42   0.016   
gb:AF404815_1268581 Plasmodium falciparum serine/threonine prote...    42   0.016   
gb:PFMAL13_1191603 Plasmodium falciparum 3D7 chromosome 13, *** ...    42   0.016   
gb:CNS07EGC_1373288 chromosome V of strain GB-M1 of Encephalitoz...    41   0.027   
gb:CEY39B6A_1369835 Caenorhabditis elegans YAC Y39B6A, complete ...    41   0.027   
pir|T45058|T45058 phosphoprotein phosphatase (EC 3.1.3.16) Y39B6...    41   0.027   Caenorhabditis elegans [roundworm]
pir|T40391|T40391 phosphoprotein phosphatase (EC 3.1.3.16) SPBC3...    40   0.059   Schizosaccharomyces pombe
gb:YSCCALA1_1728343 S.cerevisiae calcineurin A1 (CNA1) gene, com...    38   0.23    
sp|P23287|P2B1_YEAST|P2B1_YEAST Serine/threonine protein phosphatase 2B cat...    38   0.23    Saccharomyces cerevisiae [brewer's yeast]
gb:AJ849851_1284838 Drosophila subobscura partial canA1 gene for...    37   0.29    
gb:AJ849827_1284814 Drosophila subobscura partial canA1 gene for...    37   0.29    
gb:AE014297_1142276 Drosophila melanogaster chromosome 3R, compl...    37   0.29    
sp|P48456|P2B1_DROME|P2B1_DROME Serine/threonine protein phosphatase 2B cat...    37   0.29    Drosophila melanogaster
gb:SCCMP2_1707356 Yeast CMP2 gene for calmodulin-binding protein 2.    36   0.86    
gb:OCPP2BWS_1692030 Saccharomyces cerevisiae partial mRNA for pr...    36   0.86    
gb:AF014922_1231917 Paramecium tetraurelia protein phosphatase 2...    36   0.86    
sp|P14747|P2B2_YEAST|P2B2_YEAST Serine/threonine protein phosphatase 2B cat...    36   0.86    Saccharomyces cerevisiae [brewer's yeast]
gb:CR382122_1655276 Kluyveromyces lactis strain NRRL Y-1140 chro...    33   1.1     
gb:AY062270_1565013 Exophiala dermatitidis strain 8656 calcineur...    35   1.5     
gb:AF287250_1259078 Bombyx mori calcineurin A (cna) mRNA, comple...    35   1.5     
gb:HSPPEF_2019670 H.sapiens mRNA for serine/threonine protein ph...    35   1.9     
gb:AE008692_241704 Zymomonas mobilis subsp. mobilis ZM4, complet...    35   1.9     
pir|JC7241|JC7241 phosphoprotein phosphatase (EC 3.1.3.16), calc...    35   1.9     Mizuhopecten yessoensis [ezo giant scallop]
sp|O14829|PPE1_HUMAN|PPE1_HUMAN Serine/threonine protein phosphatase with E...    35   1.9     Homo sapiens [man]
gb:AE016814_1745912 Ashbya gossypii (= Eremothecium gossypii) AT...    34   2.5     
gb:CR380958_1653551 Candida glabrata strain CBS138 chromosome L ...    34   2.5     
gb:AE014298_1126007 Drosophila melanogaster chromosome X, comple...    34   2.5     
gb:AE014298_1126006 Drosophila melanogaster chromosome X, comple...    34   2.5     
pir|S70554|S70554 phosphoprotein phosphatase (EC 3.1.3.16), calc...    34   2.5     Drosophila melanogaster
pir|S70551|S70551 phosphoprotein phosphatase (EC 3.1.3.16), calc...    34   2.5     Drosophila melanogaster
gb:AE014187_938690 Plasmodium falciparum 3D7 chromosome 14 compl...    32   3.0     
sp|P40421|RDGC_DROME|RDGC_DROME Serine/threonine protein phosphatase rdgC (...    32   3.1     Drosophila melanogaster
gb:BT015959_1358404 Drosophila melanogaster RH46370 full insert ...    32   3.1     
gb:AE014296_1137139 Drosophila melanogaster chromosome 3L, compl...    32   3.1     
gb:BC087175_2565032 Xenopus laevis hypothetical LOC495851, mRNA ...    34   3.3     
gb:AY324833_2527711 Gallus gallus calcineurin A beta mRNA, parti...    34   3.3     
gb:AJ720756_2502943 Gallus gallus mRNA for hypothetical protein,...    34   3.3     
gb:BC066000_2105647 Mus musculus protein phosphatase 3, catalyti...    34   3.3     
gb:HSA488506_2007504 Homo sapiens mRNA for protein phosphatase 3...    34   3.3     
gb:BC028049_1979082 Homo sapiens protein phosphatase 3 (formerly...    34   3.3     
gb:BC004864_1969398 Homo sapiens protein phosphatase 3 (formerly...    34   3.3     
gb:AY007249_1934081 Homo sapiens calcineurin A catalytic subunit...    34   3.3     
gb:AL353731_1923018 Human DNA sequence from clone RP11-345K20 on...    34   3.3     
gb:AJ584614_1422525 Sus scrofa partial mRNA for Calcineurin A pr...    34   3.3     
gb:AF541961_1422365 Oryctolagus cuniculus calcineurin A beta mRN...    34   3.3     
gb:CEC02F4_1359942 Caenorhabditis elegans cosmid C02F4, complete...    34   3.3     
gb:AB041523_1195574 Mizuhopecten yessoensis mRNA for calcineurin...    34   3.3     
pir|JT0976|JT0976 phosphoprotein phosphatase (EC 3.1.3.16) 3-alp...    34   3.3     Mus musculus [mouse]
pir|T18864|T18864 phosphoprotein phosphatase (EC 3.1.3.16), calc...    34   3.3     Caenorhabditis elegans [roundworm]
pir|A36222|A36222 phosphoprotein phosphatase (EC 3.1.3.16) 3-bet...    34   3.3     Homo sapiens [man]
sp|P48454|P2BC_HUMAN|P2BC_HUMAN Serine/threonine protein phosphatase 2B cat...    34   3.3     Homo sapiens [man]
sp|P20651|P2BB_RAT|P2BB_RAT Serine/threonine protein phosphatase 2B catal...    34   3.3     Rattus norvegicus [brown rat]
sp|P48453|P2BB_MOUSE|P2BB_MOUSE Serine/threonine protein phosphatase 2B cat...    34   3.3     Mus musculus [mouse]
sp|P16299|P2BB_HUMAN|P2BB_HUMAN Serine/threonine protein phosphatase 2B cat...    34   3.3     Homo sapiens [man]
sp|Q27889|P2B2_DROME|P2B2_DROME Serine/threonine protein phosphatase 2B cat...    34   3.3     Drosophila melanogaster
gb:AF195248_1249803 Plasmodium falciparum PP1-like protein serin...    32   3.3     
gb:BC071006_2555880 Xenopus laevis hypothetical protein MGC81043...    33   4.3     
gb:RNCALCA_2134561 Rat mRNA for calcineurin A.                         33   5.6     
gb:MUSCNRA_2125496 Mouse brain calmodulin-dependent phosphatase ...    33   5.6     
gb:NC99H12_1688830 Neurospora crassa DNA linkage group V Cosmid ...    33   5.6     
gb:AX343907_1465941 Sequence 3 from Patent WO0200872.                  33   5.6     
gb:PTE567906_1395951 Paramecium tetraurelia macronuclear caN-A2 ...    33   5.6     
gb:AC115584_1205693 Dictyostelium discoideum chromosome 2 map co...    33   5.6     
gb:PA12396_156533 P.abyssi gene encoding protein serine/threonin...    33   5.6     
pir|S78706|S78706 protein YBR058c-a - yeast (Saccharomyces cerev...    33   5.6     Saccharomyces cerevisiae [brewer's yeast]
pir|S68963|S68963 phosphoprotein phosphatase (EC 3.1.3.16) 3 cat...    33   5.6     Dictyostelium discoideum
sp|Q05681|P2B_NEUCR|P2B_NEUCR Serine/threonine protein phosphatase 2B cata...    33   5.6     Neurospora crassa
sp|P20652|P2BA_MOUSE|P2BA_MOUSE Serine/threonine protein phosphatase 2B cat...    33   5.6     Mus musculus [mouse]
gb:AY324834_2527712 Gallus gallus calcineurin A alpha mRNA, part...    33   7.3     
gb:AY340621_1600673 Aspergillus parasiticus calcineurin A (cnaA)...    33   7.3     
gb:AB063317_1522213 Aspergillus oryzae cnaA gene for calcineurin...    33   7.3     
gb:AY266682_1428143 Canis familiaris heart calcineurin catalytic...    33   7.3     
gb:AF541960_1422364 Oryctolagus cuniculus calcineurin A alpha mR...    33   7.3     
gb:AF193515_1415886 Sus scrofa calcineurin catalytic subunit del...    33   7.3     
gb:SMA276884_1397767 Schistosoma mansoni mRNA for calcineurin A.       33   7.3     
gb:CR859582_1183691 Pongo pygmaeus mRNA; cDNA DKFZp459C244 (from...    33   7.3     
sp|Q08209|P2BA_HUMAN|P2BA_HUMAN Serine/threonine protein phosphatase 2B cat...    33   7.3     Homo sapiens [man]
sp|P48452|P2BA_BOVIN|P2BA_BOVIN Serine/threonine protein phosphatase 2B cat...    33   7.3     Bos taurus [bovine]
sp|P53043|PPT1_YEAST|PPT1_YEAST Serine/threonine protein phosphatase T (EC ...    30   8.6     Saccharomyces cerevisiae [brewer's yeast]
gb:BC079683_2561222 Xenopus laevis MGC79144 protein, mRNA (cDNA ...    32   9.5     
gb:BC049001_2550075 Xenopus laevis protein phosphatase 3 (former...    32   9.5     
gb:AB037146_2461688 Xenopus laevis mRNA for calcineurin catalyti...    32   9.5     
gb:BC079027_2107166 Rattus norvegicus cDNA clone MGC:93954 IMAGE...    32   9.5     
gb:BC046617_2099317 Mus musculus protein phosphatase 3, catalyti...    32   9.5     
gb:CR382136_1669024 Debaryomyces hansenii chromosome D of strain...    32   9.5     
sp|P48457|P2B_EMENI|P2B_EMENI Serine/threonine protein phosphatase 2B cata...    32   9.5     Aspergillus nidulans
sp|P48455|P2BC_MOUSE|P2BC_MOUSE Serine/threonine protein phosphatase 2B cat...    32   9.5     Mus musculus [mouse]


>gb:AB007646_1510170 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MGI19.
          Length = 413

 Score =  181 bits (458), Expect = 2e-44
 Identities = 84/105 (80%), Positives = 95/105 (90%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQAT 549
           +FL+K  LKLIIRSHEGPDAREKR GLGGMD GYTIDH VESGKLIT+FSAPDYPQFQAT
Sbjct: 289 DFLKKYELKLIIRSHEGPDAREKRTGLGGMDNGYTIDHNVESGKLITIFSAPDYPQFQAT 348

Query: 548 EDRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANPFYDFEDVI 414
           E+RY+NKGAYI+L+ PDF  P FHSF+AV PRPKA+P+YDFE+VI
Sbjct: 349 EERYKNKGAYIILQAPDFSDPQFHSFEAVKPRPKAHPYYDFENVI 393



>pir|T51611|T51611 phosphoprotein phosphatase (EC 3.1.3.16) PP7
           [imported] - Arabidopsis thaliana>gb:ATAJ0057_1543861
           Arabidopsis thaliana mRNA for a serine/threonine protein
           phosphatase.
          Length = 413

 Score =  181 bits (458), Expect = 2e-44
 Identities = 84/105 (80%), Positives = 95/105 (90%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQAT 549
           +FL+K  LKLIIRSHEGPDAREKR GLGGMD GYTIDH VESGKLIT+FSAPDYPQFQAT
Sbjct: 289 DFLKKYELKLIIRSHEGPDAREKRTGLGGMDNGYTIDHNVESGKLITIFSAPDYPQFQAT 348

Query: 548 EDRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANPFYDFEDVI 414
           E+RY+NKGAYI+L+ PDF  P FHSF+AV PRPKA+P+YDFE+VI
Sbjct: 349 EERYKNKGAYIILQAPDFSDPQFHSFEAVKPRPKAHPYYDFENVI 393



>gb:AP004765_1844673 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0711H09.
          Length = 428

 Score =  176 bits (447), Expect(2) = 1e-43
 Identities = 85/104 (81%), Positives = 90/104 (86%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL   NLKLIIRSHEGPDAR+KR  L GMD GYTIDH VE GKLITLFSAPDYPQFQA+E
Sbjct: 307 FLYTNNLKLIIRSHEGPDARDKRHDLLGMDNGYTIDHHVECGKLITLFSAPDYPQFQASE 366

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANPFYDFEDVI 414
           DRY N GAYIVL PPDF TP+FHSF+AV PRPKANP+YDFEDVI
Sbjct: 367 DRYNNCGAYIVLNPPDFSTPVFHSFEAVKPRPKANPYYDFEDVI 410



 Score = 23.1 bits (48), Expect(2) = 1e-43
 Identities = 7/10 (70%), Positives = 9/10 (90%)
 Frame = -1

Query: 750 WGPDMTDEFL 721
           WGPD+T +FL
Sbjct: 299 WGPDITQQFL 308



>pir|D96521|D96521 protein F21D18.16 [imported] - Arabidopsis
            thaliana>gb:AE005173_892772 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:AC023673_1539214 Genomic sequence for
            Arabidopsis thaliana BAC F21D18 from chromosome I,
            complete sequence.
          Length = 1340

 Score =  103 bits (256), Expect = 4e-21
 Identities = 56/112 (50%), Positives = 70/112 (62%)
 Frame = -2

Query: 725  FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
            FL+  NLK IIR    PD R KR  L  M+ GY  DH      LITLFSAPD+PQFQ TE
Sbjct: 877  FLQDNNLKWIIRGKGAPDERAKRDDLAPMNGGYAEDHE----GLITLFSAPDHPQFQDTE 932

Query: 545  DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANPFYDFEDVILMKSWIWH 390
            +R+ NK AYI+L+ P+ +   F   +AV+PRPKA  +YDF  +I   S + H
Sbjct: 933  ERHNNKAAYIILQIPECEELKFQPLEAVSPRPKAEAYYDFRRLIHPPSNLVH 984



>pir|T50799|T50799 serine/threonine protein phosphatase-like protein
           - Arabidopsis thaliana>gb:ATT30N20_1555808 Arabidopsis
           thaliana DNA chromosome 5, BAC clone T30N20 (ESSA
           project).
          Length = 600

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 49/85 (57%), Positives = 60/85 (70%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL++ NLK+IIRSHEGPDAR  R  +G M +GY+IDH VESGKL T+FSA     F    
Sbjct: 419 FLQQSNLKMIIRSHEGPDARADREDMGNMLSGYSIDHEVESGKLCTVFSA---SMFSQGS 475

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSF 471
             Y N+GAY VLEPP+F  P+F S+
Sbjct: 476 RNYENEGAYAVLEPPNFTEPVFVSY 500



>gb:AY182777_1587883 Lycopersicon esculentum type 5 protein
           serine/threonine phosphatase 62 kDa isoform (PP5) mRNA,
           complete cds, alternatively spliced.>gb:AY182778_1587884
           Lycopersicon esculentum type 5 protein serine/threonine
           phosphatase (PP5) gene, complete cds, alternatively
           spliced.
          Length = 556

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 40/96 (41%), Positives = 50/96 (52%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL++ NL L++RSHE  D             GY I+H    GKLIT+FSAP+Y       
Sbjct: 472 FLQENNLDLVVRSHEVKDE------------GYEIEH---DGKLITVFSAPNYC------ 510

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANP 438
           D+  NKGA+I  E PD   P   +F AV P P   P
Sbjct: 511 DQMGNKGAFIRFEAPDM-KPNIVTFSAV-PHPDVKP 544



>gb:AY150041_1584918 Lycopersicon esculentum type 5 serine/threonine
           phosphatase 55 kDa isoform mRNA, complete cds;
           alternatively spliced.>gb:AY182778_1587885 Lycopersicon
           esculentum type 5 protein serine/threonine phosphatase
           (PP5) gene, complete cds, alternatively spliced.
          Length = 485

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 40/96 (41%), Positives = 50/96 (52%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL++ NL L++RSHE  D             GY I+H    GKLIT+FSAP+Y       
Sbjct: 401 FLQENNLDLVVRSHEVKDE------------GYEIEH---DGKLITVFSAPNYC------ 439

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANP 438
           D+  NKGA+I  E PD   P   +F AV P P   P
Sbjct: 440 DQMGNKGAFIRFEAPDM-KPNIVTFSAV-PHPDVKP 473



>gb:AC135918_1742825 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0115F21, complete sequence.
          Length = 483

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 40/96 (41%), Positives = 49/96 (51%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL++ NL L++RSHE  D             GY I+H    GKLIT+FSAP+Y       
Sbjct: 399 FLQENNLDLVVRSHEVKDE------------GYEIEH---DGKLITVFSAPNYC------ 437

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANP 438
           D+  NKGAYI    P+   P   SF AV P P   P
Sbjct: 438 DQMGNKGAYIRFTAPEL-KPNISSFSAV-PHPDVKP 471



>gb:AY182779_1587886 Arabidopsis thaliana type 5 protein
           serine/threonine phosphatase 60 kDa isoform mRNA,
           complete cds, alternatively spliced.
          Length = 538

 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 39/96 (40%), Positives = 49/96 (51%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL L++RSHE  D             GY ++H    GKLIT+FSAP+Y       
Sbjct: 454 FLQDNNLDLLVRSHEVKDE------------GYEVEH---DGKLITVFSAPNYC------ 492

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANP 438
           D+  NKGA+I  E PD   P   +F AV P P   P
Sbjct: 493 DQMGNKGAFIRFEAPDM-KPNIVTFSAV-PHPDVKP 526



>gb:AY080674_1568404 Arabidopsis thaliana putative phosphoprotein
           phosphatase (At2g42810) mRNA, partial cds.
          Length = 325

 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 39/96 (40%), Positives = 49/96 (51%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL L++RSHE  D             GY ++H    GKLIT+FSAP+Y       
Sbjct: 241 FLQDNNLDLLVRSHEVKDE------------GYEVEH---DGKLITVFSAPNYC------ 279

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANP 438
           D+  NKGA+I  E PD   P   +F AV P P   P
Sbjct: 280 DQMGNKGAFIRFEAPDM-KPNIVTFSAV-PHPDVKP 313



>gb:AC006931_1534828 Arabidopsis thaliana chromosome 2 clone F7D19
           map m551, complete sequence.>gb:BT010180_1640246
           Arabidopsis thaliana At2g42810/F7D19.19 mRNA, complete
           cds.>gb:AF419574_1798436 Arabidopsis thaliana
           At2g42810/F7D19.19 mRNA, complete cds.
          Length = 484

 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 39/96 (40%), Positives = 49/96 (51%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL L++RSHE  D             GY ++H    GKLIT+FSAP+Y       
Sbjct: 400 FLQDNNLDLLVRSHEVKDE------------GYEVEH---DGKLITVFSAPNYC------ 438

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANP 438
           D+  NKGA+I  E PD   P   +F AV P P   P
Sbjct: 439 DQMGNKGAFIRFEAPDM-KPNIVTFSAV-PHPDVKP 472



>pir|E84858|E84858 phosphoprotein phosphatase (EC 3.1.3.16)
           At2g42810 [similarity] - Arabidopsis thaliana
          Length = 533

 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 39/96 (40%), Positives = 49/96 (51%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL L++RSHE  D             GY ++H    GKLIT+FSAP+Y       
Sbjct: 449 FLQDNNLDLLVRSHEVKDE------------GYEVEH---DGKLITVFSAPNYC------ 487

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANP 438
           D+  NKGA+I  E PD   P   +F AV P P   P
Sbjct: 488 DQMGNKGAFIRFEAPDM-KPNIVTFSAV-PHPDVKP 521



>gb:AF032879_1762665 Arabidopsis thaliana protein phosphatase U
           (PPU) mRNA, partial cds.
          Length = 195

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 38/96 (39%), Positives = 48/96 (50%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL L++RSHE  D             GY ++H    GKLIT+F AP+Y       
Sbjct: 111 FLQDNNLDLLVRSHEVKDE------------GYEVEH---DGKLITVFFAPNYC------ 149

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANP 438
           D+  NKGA+I  E PD   P   +F AV P P   P
Sbjct: 150 DQMGNKGAFIRFEAPDM-KPNIVTFSAV-PHPDVKP 183



>gb:BC073033_2556946 Xenopus laevis protein phosphatase 5, mRNA
           (cDNA clone MGC:82642 IMAGE:5049131), complete cds.
          Length = 493

 Score = 48.1 bits (113), Expect(2) = 5e-05
 Identities = 38/96 (39%), Positives = 47/96 (48%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL +  L  IIRSHE       +P       GY + H   +G  +T+FSAP+Y       
Sbjct: 408 FLEENGLDYIIRSHE------VKP------EGYEVSH---NGLCVTVFSAPNYC------ 446

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANP 438
           D+  NKGAYI L   D   P FH F+AV P P   P
Sbjct: 447 DQMGNKGAYIHLSGSDL-KPKFHQFEAV-PHPNVKP 480



 Score = 21.2 bits (43), Expect(2) = 5e-05
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = -1

Query: 750 WGPDMTDEFLKE 715
           +GPD+T +FL+E
Sbjct: 400 FGPDVTHQFLEE 411



>gb:AF018263_2468871 Xenopus laevis protein phosphatase 5 (PP5)
           mRNA, partial cds.
          Length = 492

 Score = 48.1 bits (113), Expect(2) = 5e-05
 Identities = 38/96 (39%), Positives = 47/96 (48%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL +  L  IIRSHE       +P       GY + H   +G  +T+FSAP+Y       
Sbjct: 407 FLEENGLDYIIRSHE------VKP------EGYEVSH---NGLCVTVFSAPNYC------ 445

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANP 438
           D+  NKGAYI L   D   P FH F+AV P P   P
Sbjct: 446 DQMGNKGAYIHLSGSDL-KPKFHQFEAV-PHPNVKP 479



 Score = 21.2 bits (43), Expect(2) = 5e-05
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = -1

Query: 750 WGPDMTDEFLKE 715
           +GPD+T +FL+E
Sbjct: 399 FGPDVTHQFLEE 410



>gb:BC054321_2550967 Xenopus laevis cDNA clone IMAGE:6873203,
           partial cds.
          Length = 168

 Score = 48.1 bits (113), Expect(2) = 6e-05
 Identities = 38/96 (39%), Positives = 47/96 (48%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL +  L  IIRSHE       +P       GY + H   +G  +T+FSAP+Y       
Sbjct: 83  FLEENGLDYIIRSHE------VKP------EGYEVSH---NGLCVTVFSAPNYC------ 121

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANP 438
           D+  NKGAYI L   D   P FH F+AV P P   P
Sbjct: 122 DQMGNKGAYIHLSGSDL-KPKFHQFEAV-PHPNVKP 155



 Score = 21.2 bits (43), Expect(2) = 6e-05
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = -1

Query: 750 WGPDMTDEFLKE 715
           +GPD+T +FL+E
Sbjct: 75  FGPDVTHQFLEE 86



>gb:BC080162_2561592 Xenopus tropicalis ppp5c-prov protein, mRNA
           (cDNA clone MGC:89961 IMAGE:7025761), complete cds.
          Length = 493

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 38/96 (39%), Positives = 47/96 (48%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL +  L  IIRSHE       +P       GY + H   +G  +T+FSAP+Y       
Sbjct: 408 FLEENGLDYIIRSHE------VKP------EGYEVSH---NGLCVTVFSAPNYC------ 446

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANP 438
           D+  NKGAYI L   D   P FH F+AV P P   P
Sbjct: 447 DQMGNKGAYIHLNGSDL-KPKFHQFEAV-PHPNVKP 480



>gb:AF305085_1260700 Trypanosoma brucei serine/threonine protein
           phosphatase type 5 mRNA, complete cds.
          Length = 472

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 38/98 (38%), Positives = 47/98 (47%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL   NLKL++RSHE              D GY I+H    GK IT+FSAP+Y       
Sbjct: 390 FLNNNNLKLLVRSHE------------VKDEGYEIEH---GGKCITVFSAPNYC------ 428

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANPFY 432
           D+  NKGA+I     D   P F +F  V P P   P +
Sbjct: 429 DQMGNKGAFIRFTGGDM-KPRFTTFTHV-PHPGKRPMH 464



>gb:PPP5C_2039892 Human serine-threonine phosphatase (PP5) mRNA,
           partial cds.
          Length = 491

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 36/96 (37%), Positives = 45/96 (46%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL + NL  IIRSHE                GY + H    G+ +T+FSAP+Y       
Sbjct: 406 FLEENNLDYIIRSHEVKAE------------GYEVAH---GGRCVTVFSAPNYC------ 444

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANP 438
           D+  NK +YI L+  D   P FH F AV P P   P
Sbjct: 445 DQMGNKASYIHLQGSDL-RPQFHQFTAV-PHPNVKP 478



>gb:HSRNAPPP5_2020084 H.sapiens mRNA for protein phosphatase 5.
          Length = 493

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 36/96 (37%), Positives = 45/96 (46%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL + NL  IIRSHE                GY + H    G+ +T+FSAP+Y       
Sbjct: 408 FLEENNLDYIIRSHEVKAE------------GYEVAH---GGRCVTVFSAPNYC------ 446

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANP 438
           D+  NK +YI L+  D   P FH F AV P P   P
Sbjct: 447 DQMGNKASYIHLQGSDL-RPQFHQFTAV-PHPNVKP 480



>gb:CR859667_1183773 Pongo pygmaeus mRNA; cDNA DKFZp459E169 (from
           clone DKFZp459E169).
          Length = 499

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 36/96 (37%), Positives = 45/96 (46%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL + NL  IIRSHE                GY + H    G+ +T+FSAP+Y       
Sbjct: 414 FLEENNLDYIIRSHEVKAE------------GYEVAH---GGRCVTVFSAPNYC------ 452

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANP 438
           D+  NK +YI L+  D   P FH F AV P P   P
Sbjct: 453 DQMGNKASYIHLQGSDL-RPQFHQFTAV-PHPNVKP 486



>pir|S52570|S52570 phosphoprotein phosphatase (EC 3.1.3.16) 5
           [validated] - human
          Length = 498

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 36/96 (37%), Positives = 45/96 (46%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL + NL  IIRSHE                GY + H    G+ +T+FSAP+Y       
Sbjct: 413 FLEENNLDYIIRSHEVKAE------------GYEVAH---GGRCVTVFSAPNYC------ 451

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANP 438
           D+  NK +YI L+  D   P FH F AV P P   P
Sbjct: 452 DQMGNKASYIHLQGSDL-RPQFHQFTAV-PHPNVKP 485



>sp|P53041|PPP5_HUMAN Serine/threonine protein phosphatase 5 (EC
           3.1.3.16) (PP5) (Protein phosphatase T) (PP-T)
           (PPT).>gb:AC007193_1875224 Homo sapiens chromosome 19,
           BAC 82621 (CIT-B-139a18), complete
           sequence.>gb:BC001970_1968010 Homo sapiens protein
           phosphatase 5, catalytic subunit, mRNA (cDNA clone
           MGC:5260 IMAGE:3459309), complete
           cds.>gb:BT007275_1990713 Homo sapiens protein
           phosphatase 5, catalytic subunit mRNA, complete cds.
          Length = 499

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 36/96 (37%), Positives = 45/96 (46%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL + NL  IIRSHE                GY + H    G+ +T+FSAP+Y       
Sbjct: 414 FLEENNLDYIIRSHEVKAE------------GYEVAH---GGRCVTVFSAPNYC------ 452

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANP 438
           D+  NK +YI L+  D   P FH F AV P P   P
Sbjct: 453 DQMGNKASYIHLQGSDL-RPQFHQFTAV-PHPNVKP 486



>gb:BC078786_2106945 Rattus norvegicus protein phosphatase 5,
           catalytic subunit, mRNA (cDNA clone MGC:93338
           IMAGE:7126555), complete cds.
          Length = 499

 Score = 43.9 bits (102), Expect(2) = 0.001
 Identities = 35/96 (36%), Positives = 44/96 (45%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL +  L  IIRSHE                GY + H    G+ +T+FSAP+Y       
Sbjct: 414 FLEENQLDYIIRSHEVKAE------------GYEVAH---GGRCVTVFSAPNYC------ 452

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANP 438
           D+  NK +YI L+  D   P FH F AV P P   P
Sbjct: 453 DQMGNKASYIHLQGSDL-RPQFHQFTAV-PHPNVKP 486



 Score = 20.8 bits (42), Expect(2) = 0.001
 Identities = 8/14 (57%), Positives = 11/14 (78%)
 Frame = -1

Query: 750 WGPDMTDEFLKEVQ 709
           +GPD+T  FL+E Q
Sbjct: 406 FGPDVTKAFLEENQ 419



>pir|A55346|A55346 phosphoprotein phosphatase (EC 3.1.3.16) PPT
           [validated] - rat
          Length = 499

 Score = 43.9 bits (102), Expect(2) = 0.001
 Identities = 35/96 (36%), Positives = 44/96 (45%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL +  L  IIRSHE                GY + H    G+ +T+FSAP+Y       
Sbjct: 414 FLEENQLDYIIRSHEVKAE------------GYEVAH---GGRCVTVFSAPNYC------ 452

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANP 438
           D+  NK +YI L+  D   P FH F AV P P   P
Sbjct: 453 DQMGNKASYIHLQGSDL-RPQFHQFTAV-PHPNVKP 486



 Score = 20.8 bits (42), Expect(2) = 0.001
 Identities = 8/14 (57%), Positives = 11/14 (78%)
 Frame = -1

Query: 750 WGPDMTDEFLKEVQ 709
           +GPD+T  FL+E Q
Sbjct: 406 FGPDVTKAFLEENQ 419



>sp|P53042|PPP5_RAT Serine/threonine protein phosphatase 5 (EC
           3.1.3.16) (PP5) (Protein phosphatase T)
           (PPT).>gb:RNPPT_2136243 R.norvegicus mRNA for protein
           phosphatase T.
          Length = 499

 Score = 43.9 bits (102), Expect(2) = 0.001
 Identities = 35/96 (36%), Positives = 44/96 (45%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL +  L  IIRSHE                GY + H    G+ +T+FSAP+Y       
Sbjct: 414 FLEENQLDYIIRSHEVKAE------------GYEVAH---GGRCVTVFSAPNYC------ 452

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANP 438
           D+  NK +YI L+  D   P FH F AV P P   P
Sbjct: 453 DQMGNKASYIHLQGSDL-RPQFHQFTAV-PHPNVKP 486



 Score = 20.8 bits (42), Expect(2) = 0.001
 Identities = 8/14 (57%), Positives = 11/14 (78%)
 Frame = -1

Query: 750 WGPDMTDEFLKEVQ 709
           +GPD+T  FL+E Q
Sbjct: 406 FGPDVTKAFLEENQ 419



>sp|Q60676|PPP5_MOUSE Serine/threonine protein phosphatase 5 (EC
           3.1.3.16) (PP5) (Protein phosphatase T)
           (PPT).>gb:AF018262_2050988 Mus musculus protein
           phosphatase 5 (PP5) mRNA, complete
           cds.>gb:BC003744_2089304 Mus musculus protein
           phosphatase 5, catalytic subunit, mRNA (cDNA clone
           MGC:5847 IMAGE:3590322), complete cds.
          Length = 499

 Score = 43.9 bits (102), Expect(2) = 0.001
 Identities = 35/96 (36%), Positives = 44/96 (45%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL +  L  IIRSHE                GY + H    G+ +T+FSAP+Y       
Sbjct: 414 FLEENQLDYIIRSHEVKAE------------GYEVAH---GGRCVTVFSAPNYC------ 452

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANP 438
           D+  NK +YI L+  D   P FH F AV P P   P
Sbjct: 453 DQMGNKASYIHLQGSDL-RPQFHQFTAV-PHPNVKP 486



 Score = 20.8 bits (42), Expect(2) = 0.001
 Identities = 8/14 (57%), Positives = 11/14 (78%)
 Frame = -1

Query: 750 WGPDMTDEFLKEVQ 709
           +GPD+T  FL+E Q
Sbjct: 406 FGPDVTKAFLEENQ 419



>gb:RNU12203_2136861 Rattus norvegicus phosphoprotein phosphatase
           mRNA, partial cds.
          Length = 479

 Score = 43.9 bits (102), Expect(2) = 0.001
 Identities = 35/96 (36%), Positives = 44/96 (45%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL +  L  IIRSHE                GY + H    G+ +T+FSAP+Y       
Sbjct: 394 FLEENQLDYIIRSHEVKAE------------GYEVAH---GGRCVTVFSAPNYC------ 432

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANP 438
           D+  NK +YI L+  D   P FH F AV P P   P
Sbjct: 433 DQMGNKASYIHLQGSDL-RPQFHQFTAV-PHPNVKP 466



 Score = 20.8 bits (42), Expect(2) = 0.001
 Identities = 8/14 (57%), Positives = 11/14 (78%)
 Frame = -1

Query: 750 WGPDMTDEFLKEVQ 709
           +GPD+T  FL+E Q
Sbjct: 386 FGPDVTKAFLEENQ 399



>gb:AE014297_1138737 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE014297_1138738 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE003684_1220730
           Drosophila melanogaster chromosome 3R, section 22 of 118
           of the complete sequence.>gb:AE003684_1220731 Drosophila
           melanogaster chromosome 3R, section 22 of 118 of the
           complete sequence.>gb:AY058356_1291510 Drosophila
           melanogaster GH12714 full length
           cDNA.>gb:DME271781_1379103 Drosophila melanogaster mRNA
           for protein phosphatase 5 (PPP5 gene).
          Length = 520

 Score = 42.7 bits (99), Expect(2) = 0.003
 Identities = 35/96 (36%), Positives = 45/96 (46%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           F +  NL  IIRSHE  D             GY + H   +GK IT+FSAP+Y       
Sbjct: 436 FCKDNNLDYIIRSHEVKDM------------GYEVAH---NGKCITVFSAPNYC------ 474

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANP 438
           D   N GA+I +   +   P + SF+AV P P   P
Sbjct: 475 DTMGNMGAFITITGNNL-KPNYKSFEAV-PHPDVKP 508



 Score = 20.4 bits (41), Expect(2) = 0.003
 Identities = 6/12 (50%), Positives = 11/12 (91%)
 Frame = -1

Query: 750 WGPDMTDEFLKE 715
           +GPD+T++F K+
Sbjct: 428 FGPDVTEKFCKD 439



>gb:CR382128_1660617 Yarrowia lipolytica chromosome B of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 479

 Score = 41.2 bits (95), Expect(2) = 0.007
 Identities = 32/96 (33%), Positives = 47/96 (48%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           F ++  LK ++RSHE       R G      GY ++H   +GKL+T+FSAP+Y   Q  +
Sbjct: 399 FCKENGLKGVLRSHE------VRMG------GYEVEH---NGKLVTVFSAPNYCDSQGNK 443

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANP 438
             Y N G  + ++        F+ FDA  P P   P
Sbjct: 444 GAYINIGHDLEMQ--------FNVFDA-QPHPDVKP 470



 Score = 20.8 bits (42), Expect(2) = 0.007
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -1

Query: 750 WGPDMTDEFLKE 715
           +GPD+T+ F KE
Sbjct: 391 FGPDVTEAFCKE 402



>gb:BC000750_1967000 Homo sapiens protein phosphatase 5, catalytic
           subunit, mRNA (cDNA clone IMAGE:2961155), partial
           cds.>gb:BC001831_1967888 Homo sapiens protein
           phosphatase 5, catalytic subunit, mRNA (cDNA clone
           IMAGE:2961155), partial cds.
          Length = 484

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 33/88 (37%), Positives = 42/88 (47%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL + NL  IIRSHE                GY + H    G+ +T+FSAP+Y       
Sbjct: 412 FLEENNLDYIIRSHEVKAE------------GYEVAH---GGRCVTVFSAPNYC------ 450

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAV 462
           D+  NK +YI L+  D   P FH F AV
Sbjct: 451 DQMGNKASYIHLQGSDL-RPQFHQFTAV 477



>pir|T46576|T46576 phosphoprotein phosphatase (EC 3.1.3.16) ppt-1
           [similarity] - Neurospora crassa>gb:NCB20D17_1689634
           Neurospora crassa DNA linkage group V BAC clone
           B20D17.>gb:NCU89985_1690714 Neurospora crassa
           serine/threonine protein phosphatase PPT1 (ppt-1) mRNA,
           complete cds.
          Length = 479

 Score = 42.0 bits (97), Expect = 0.012
 Identities = 40/96 (41%), Positives = 45/96 (46%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           F  K  L+ IIRSHE             MD GY  +H    GK IT+FSAP Y       
Sbjct: 395 FCDKNGLEAIIRSHEVR-----------MD-GYEEEH---DGKCITVFSAPKYC------ 433

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANP 438
           D   NKGAYI +  PD+    F  FDAV P P   P
Sbjct: 434 DMTENKGAYINI-GPDYKLK-FSQFDAV-PHPNIKP 466



>gb:AY054983_1291088 Plasmodium falciparum Dd2 serine/threonine
           protein phosphatase PP5 mRNA, complete cds.
          Length = 594

 Score = 41.6 bits (96), Expect = 0.016
 Identities = 28/71 (39%), Positives = 40/71 (56%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQAT 549
           NFL+  NL LIIRSHE              D GY+++   ++G+L T+FSAP+Y      
Sbjct: 510 NFLKINNLSLIIRSHE------------VRDEGYSLE---QNGQLYTVFSAPNYC----- 549

Query: 548 EDRYRNKGAYI 516
            D  +NKGA++
Sbjct: 550 -DIMKNKGAFL 559



>gb:AF404815_1268581 Plasmodium falciparum serine/threonine protein
           phosphatase PfPP5 (pp5) gene, complete cds.
          Length = 594

 Score = 41.6 bits (96), Expect = 0.016
 Identities = 28/71 (39%), Positives = 40/71 (56%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQAT 549
           NFL+  NL LIIRSHE              D GY+++   ++G+L T+FSAP+Y      
Sbjct: 510 NFLKINNLSLIIRSHE------------VRDEGYSLE---QNGQLYTVFSAPNYC----- 549

Query: 548 EDRYRNKGAYI 516
            D  +NKGA++
Sbjct: 550 -DIMKNKGAFL 559



>gb:PFMAL13_1191603 Plasmodium falciparum 3D7 chromosome 13, ***
           SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 658

 Score = 41.6 bits (96), Expect = 0.016
 Identities = 28/71 (39%), Positives = 40/71 (56%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQAT 549
           NFL+  NL LIIRSHE              D GY+++   ++G+L T+FSAP+Y      
Sbjct: 574 NFLKINNLSLIIRSHE------------VRDEGYSLE---QNGQLYTVFSAPNYC----- 613

Query: 548 EDRYRNKGAYI 516
            D  +NKGA++
Sbjct: 614 -DIMKNKGAFL 623



>gb:CNS07EGC_1373288 chromosome V of strain GB-M1 of Encephalitozoon
           cuniculi (Microspora).
          Length = 457

 Score = 40.8 bits (94), Expect = 0.027
 Identities = 24/74 (32%), Positives = 38/74 (51%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL +  L L++RSH+             +D GY + H    GK++T+FSAP+Y       
Sbjct: 370 FLERNGLDLLVRSHQA------------VDDGYRVHH---GGKVVTIFSAPEY------- 407

Query: 545 DRYRNKGAYIVLEP 504
           +  +  G+Y+VL P
Sbjct: 408 EGSKGPGSYLVLNP 421



>gb:CEY39B6A_1369835 Caenorhabditis elegans YAC Y39B6A, complete
           sequence.
          Length = 496

 Score = 40.8 bits (94), Expect = 0.027
 Identities = 32/90 (35%), Positives = 46/90 (51%)
 Frame = -2

Query: 707 LKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATEDRYRNK 528
           ++ ++RSHE       +P       GY + H   +G+  T+FSAP+Y       D+  NK
Sbjct: 419 IEYVVRSHE------VKP------EGYEMHH---NGQCFTVFSAPNYC------DQMNNK 457

Query: 527 GAYIVLEPPDFDTPIFHSFDAVTPRPKANP 438
           GA+I +   +  TP F  FDAV P PK  P
Sbjct: 458 GAFITITGDNL-TPRFTPFDAV-PHPKLPP 485



>pir|T45058|T45058 phosphoprotein phosphatase (EC 3.1.3.16)
           Y39B6B.ff [similarity] - Caenorhabditis elegans
          Length = 526

 Score = 40.8 bits (94), Expect = 0.027
 Identities = 32/90 (35%), Positives = 46/90 (51%)
 Frame = -2

Query: 707 LKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATEDRYRNK 528
           ++ ++RSHE       +P       GY + H   +G+  T+FSAP+Y       D+  NK
Sbjct: 449 IEYVVRSHE------VKP------EGYEMHH---NGQCFTVFSAPNYC------DQMNNK 487

Query: 527 GAYIVLEPPDFDTPIFHSFDAVTPRPKANP 438
           GA+I +   +  TP F  FDAV P PK  P
Sbjct: 488 GAFITITGDNL-TPRFTPFDAV-PHPKLPP 515



>pir|T40391|T40391 phosphoprotein phosphatase (EC 3.1.3.16)
           SPBC3F6.01c [similarity] - fission yeast
           (Schizosaccharomyces pombe)>gb:SPBC3F6_1720089 S.pombe
           chromosome II cosmid c3F6.
          Length = 473

 Score = 39.7 bits (91), Expect = 0.059
 Identities = 36/97 (37%), Positives = 43/97 (44%), Gaps = 1/97 (1%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           F     LK +IRSHE              D GY ++H    G  IT+FSAP+Y       
Sbjct: 391 FCEANGLKAVIRSHEV------------RDQGYEVEH---DGYCITVFSAPNYC------ 429

Query: 545 DRYRNKGAYI-VLEPPDFDTPIFHSFDAVTPRPKANP 438
           D   N GA I V E  + D   FH F+AV P P   P
Sbjct: 430 DSTGNLGAVIKVKEDMELD---FHQFEAV-PHPNIRP 462



>gb:YSCCALA1_1728343 S.cerevisiae calcineurin A1 (CNA1) gene,
           complete cds.
          Length = 553

 Score = 37.7 bits (86), Expect = 0.23
 Identities = 35/103 (33%), Positives = 45/103 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+   L  IIR+HE  DA  +          Y  + V     LIT+FSAP+Y       
Sbjct: 304 FLKANGLLSIIRAHEAQDAGYRM---------YKNNKVTGFPSLITMFSAPNY------L 348

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANPFYDFEDV 417
           D Y NK A +  E    +   FH    ++P P   P  DF DV
Sbjct: 349 DTYHNKAAVLKYEENVMNIRQFH----MSPHPYWLP--DFMDV 385



>sp|P23287|P2B1_YEAST Serine/threonine protein phosphatase 2B
           catalytic subunit A1 (EC 3.1.3.16) (Calcineurin A1)
           (Calmodulin-binding protein 1).>pir|S16809|S16809
           phosphoprotein phosphatase (EC 3.1.3.16) 3 catalytic
           chain A1 - yeast (Saccharomyces
           cerevisiae)>gb:AY693079_1623126 Saccharomyces cerevisiae
           clone FLH113381.01X YLR433C gene, complete
           cds.>gb:SCCMBP1_1707347 S. cerevisiae
           CMP1.>gb:SCCMP1_1707355 Yeast CMP1 gene for
           calmodulin-binding protein 1.>gb:YSCL9753_1729776
           Saccharomyces cerevisiae chromosome XII cosmid 9753.
          Length = 553

 Score = 37.7 bits (86), Expect = 0.23
 Identities = 35/103 (33%), Positives = 45/103 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+   L  IIR+HE  DA  +          Y  + V     LIT+FSAP+Y       
Sbjct: 304 FLKANGLLSIIRAHEAQDAGYRM---------YKNNKVTGFPSLITMFSAPNY------L 348

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANPFYDFEDV 417
           D Y NK A +  E    +   FH    ++P P   P  DF DV
Sbjct: 349 DTYHNKAAVLKYEENVMNIRQFH----MSPHPYWLP--DFMDV 385



>gb:AJ849851_1284838 Drosophila subobscura partial canA1 gene for
           calcineurin-A1, exons 2-9, line P21-O3+4-31.
          Length = 376

 Score = 37.4 bits (85), Expect = 0.29
 Identities = 27/73 (36%), Positives = 35/73 (47%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+K NL  I+R+HE  DA  +          Y  + V     LIT+FSAP+Y       
Sbjct: 232 FLQKNNLLSIVRAHEAQDAGYRM---------YRKNQVTGFPSLITIFSAPNY------L 276

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 277 DVYNNKAAVLKYE 289



>gb:AJ849827_1284814 Drosophila subobscura partial canA1 gene for
           calcineurin-A1, exons 2-9, line
           P21-Ost-01.>gb:AJ849828_1284815 Drosophila subobscura
           partial canA1 gene for calcineurin-A1, exons 2-9, line
           P21-Ost-02.>gb:AJ849829_1284816 Drosophila subobscura
           partial canA1 gene for calcineurin-A1, exons 2-9, line
           P21-Ost-03.>gb:AJ849830_1284817 Drosophila subobscura
           partial canA1 gene for calcineurin-A1, exons 2-9, line
           P21-Ost-04.>gb:AJ849831_1284818 Drosophila subobscura
           partial canA1 gene for calcineurin-A1, exons 2-9, line
           P21-Ost-05.>gb:AJ849832_1284819 Drosophila subobscura
           partial canA1 gene for calcineurin-A1, exons 2-9, line
           P21-Ost-06.>gb:AJ849833_1284820 Drosophila subobscura
           partial canA1 gene for calcineurin-A1, exons 2-9, line
           P21-Ost-07.>gb:AJ849834_1284821 Drosophila subobscura
           partial canA1 gene for calcineurin-A1, exons 2-9, line
           P21-Ost-08.>gb:AJ849835_1284822 Drosophila subobscura
           partial canA1 gene for calcineurin-A1, exons 2-9, line
           P21-Ost-09.>gb:AJ849836_1284823 Drosophila subobscura
           partial canA1 gene for calcineurin-A1, exons 2-9, line
           P21-Ost-10.>gb:AJ849837_1284824 Drosophila subobscura
           partial canA1 gene for calcineurin-A1, exons 2-9, line
           P21-Ost-11.>gb:AJ849838_1284825 Drosophila subobscura
           partial canA1 gene for calcineurin-A1, exons 2-9, line
           P21-Ost-12.>gb:AJ849839_1284826 Drosophila subobscura
           partial canA1 gene for calcineurin-A1, exons 2-9, line
           P21-Ost-13.>gb:AJ849840_1284827 Drosophila subobscura
           partial canA1 gene for calcineurin-A1, exons 2-9, line
           P21-Ost-14.>gb:AJ849841_1284828 Drosophila subobscura
           partial canA1 gene for calcineurin-A1, exons 2-9, line
           P21-O3+4-21.>gb:AJ849842_1284829 Drosophila subobscura
           partial canA1 gene for calcineurin-A1, exons 2-9, line
           P21-O3+4-22.>gb:AJ849843_1284830 Drosophila subobscura
           partial canA1 gene for calcineurin-A1, exons 2-9, line
           P21-O3+4-23.>gb:AJ849844_1284831 Drosophila subobscura
           partial canA1 gene for calcineurin-A1, exons 2-9, line
           P21-O3+4-24.>gb:AJ849845_1284832 Drosophila subobscura
           partial canA1 gene for calcineurin-A1, exons 2-9, line
           P21-O3+4-25.>gb:AJ849846_1284833 Drosophila subobscura
           partial canA1 gene for calcineurin-A1, exons 2-9, line
           P21-O3+4-26.>gb:AJ849847_1284834 Drosophila subobscura
           partial canA1 gene for calcineurin-A1, exons 2-9, line
           P21-O3+4-27.>gb:AJ849848_1284835 Drosophila subobscura
           partial canA1 gene for calcineurin-A1, exons 2-9, line
           P21-O3+4-28.>gb:AJ849849_1284836 Drosophila subobscura
           partial canA1 gene for calcineurin-A1, exons 2-9, line
           P21-O3+4-29.>gb:AJ849850_1284837 Drosophila subobscura
           partial canA1 gene for calcineurin-A1, exons 2-9, line
           P21-O3+4-30.>gb:AJ849852_1284839 Drosophila subobscura
           partial canA1 gene for calcineurin-A1, exons 2-9, line
           P21-O3+4-32.>gb:AJ849853_1284840 Drosophila subobscura
           partial canA1 gene for calcineurin-A1, exons 2-9, line
           P21-O3+4-33.>gb:AJ849854_1284841 Drosophila subobscura
           partial canA1 gene for calcineurin-A1, exons 2-9, line
           P21-O3+4-36.>gb:AJ849855_1284842 Drosophila madeirensis
           partial canA1 gene for calcineurin-A1, exons 2-9, line
           P21-MAD.
          Length = 376

 Score = 37.4 bits (85), Expect = 0.29
 Identities = 27/73 (36%), Positives = 35/73 (47%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+K NL  I+R+HE  DA  +          Y  + V     LIT+FSAP+Y       
Sbjct: 232 FLQKNNLLSIVRAHEAQDAGYRM---------YRKNQVTGFPSLITIFSAPNY------L 276

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 277 DVYNNKAAVLKYE 289



>gb:AE014297_1142276 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003776_1224269 Drosophila melanogaster
           chromosome 3R, section 114 of 118 of the complete
           sequence.>gb:AY128480_1302115 Drosophila melanogaster
           RE54552 full insert cDNA.
          Length = 622

 Score = 37.4 bits (85), Expect = 0.29
 Identities = 27/73 (36%), Positives = 35/73 (47%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+K NL  I+R+HE  DA  +          Y  + V     LIT+FSAP+Y       
Sbjct: 308 FLQKNNLLSIVRAHEAQDAGYRM---------YRKNQVTGFPSLITIFSAPNY------L 352

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 353 DVYNNKAAVLKYE 365



>sp|P48456|P2B1_DROME Serine/threonine protein phosphatase 2B
           catalytic subunit 1 (EC 3.1.3.16) (Calmodulin-dependent
           calcineurin A1 subunit).>pir|B44307|B44307
           phosphoprotein phosphatase (EC 3.1.3.16) 3-alpha
           catalytic chain - fruit fly (Drosophila
           melanogaster)>gb:DROCALCA_1381799 Drosophila
           melanogaster calcinuerin A1 (CNA1) mRNA, complete cds.
          Length = 577

 Score = 37.4 bits (85), Expect = 0.29
 Identities = 27/73 (36%), Positives = 35/73 (47%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+K NL  I+R+HE  DA  +          Y  + V     LIT+FSAP+Y       
Sbjct: 263 FLQKNNLLSIVRAHEAQDAGYRM---------YRKNQVTGFPSLITIFSAPNY------L 307

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 308 DVYNNKAAVLKYE 320



>gb:SCCMP2_1707356 Yeast CMP2 gene for calmodulin-binding protein 2.
          Length = 604

 Score = 35.8 bits (81), Expect = 0.86
 Identities = 34/104 (32%), Positives = 46/104 (44%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQAT 549
           +FL++  L  IIR+HE  DA  +          Y     +    L+TLFSAP+Y      
Sbjct: 345 HFLQETGLLSIIRAHEAQDAGYRM---------YKNTKTLGFPSLLTLFSAPNY------ 389

Query: 548 EDRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANPFYDFEDV 417
            D Y NK A +  E    +   F+    +TP P   P  DF DV
Sbjct: 390 LDTYNNKAAILKYENNVMNIRQFN----MTPHPYWLP--DFMDV 427



>gb:OCPP2BWS_1692030 Saccharomyces cerevisiae partial mRNA for
           protein phosphatase 2Bw catalytic subunit.
          Length = 505

 Score = 35.8 bits (81), Expect = 0.86
 Identities = 34/104 (32%), Positives = 46/104 (44%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQAT 549
           +FL++  L  IIR+HE  DA  +          Y     +    L+TLFSAP+Y      
Sbjct: 246 HFLQETGLLSIIRAHEAQDAGYRM---------YKNTKTLGFPSLLTLFSAPNY------ 290

Query: 548 EDRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANPFYDFEDV 417
            D Y NK A +  E    +   F+    +TP P   P  DF DV
Sbjct: 291 LDTYNNKAAILKYENNVMNIRQFN----MTPHPYWLP--DFMDV 328



>gb:AF014922_1231917 Paramecium tetraurelia protein phosphatase 2B
           gene, complete cds.
          Length = 509

 Score = 35.8 bits (81), Expect = 0.86
 Identities = 36/106 (33%), Positives = 46/106 (43%), Gaps = 1/106 (0%)
 Frame = -2

Query: 731 TNFLRKCNLKLIIRSHEGP-DAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQ 555
           + FL+K NL  IIR+HE   D  +     GG D             +IT+FSAP+Y    
Sbjct: 264 SKFLQKNNLISIIRAHEAQLDGYKMHRWHGGKDFPV----------VITIFSAPNYC--- 310

Query: 554 ATEDRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANPFYDFEDV 417
              D Y NKGA I  E    +   F      TP P   P  +F D+
Sbjct: 311 ---DVYNNKGAVIKFENNTLNIQQFQ----YTPHPYLLP--NFMDI 347



>sp|P14747|P2B2_YEAST Serine/threonine protein phosphatase 2B
           catalytic subunit A2 (EC 3.1.3.16) (Calcineurin A2)
           (Calmodulin-binding protein 2).>pir|S49804|S49804
           phosphoprotein phosphatase (EC 3.1.3.16) 3 catalytic
           chain A2 - yeast (Saccharomyces
           cerevisiae)>gb:SC9958_1706354 S.cerevisiae chromosome
           XIII cosmid 9958.>gb:YSCCALA2_1728344 S.cerevisiae
           calcineurin A2 (CNA2) gene, complete cds.
          Length = 604

 Score = 35.8 bits (81), Expect = 0.86
 Identities = 34/104 (32%), Positives = 46/104 (44%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQAT 549
           +FL++  L  IIR+HE  DA  +          Y     +    L+TLFSAP+Y      
Sbjct: 345 HFLQETGLLSIIRAHEAQDAGYRM---------YKNTKTLGFPSLLTLFSAPNY------ 389

Query: 548 EDRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANPFYDFEDV 417
            D Y NK A +  E    +   F+    +TP P   P  DF DV
Sbjct: 390 LDTYNNKAAILKYENNVMNIRQFN----MTPHPYWLP--DFMDV 427



>gb:CR382122_1655276 Kluyveromyces lactis strain NRRL Y-1140
           chromosome B of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 512

 Score = 33.5 bits (75), Expect(2) = 1.1
 Identities = 32/103 (31%), Positives = 44/103 (42%), Gaps = 7/103 (6%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL++ NLK I RSH      E R G      GY  +H     +L+T+FSAP+Y       
Sbjct: 421 FLKQNNLKRIFRSH------EVRQG------GYEFEH---ENQLVTVFSAPNYC------ 459

Query: 545 DRYRNKGAYIVLEP-------PDFDTPIFHSFDAVTPRPKANP 438
           D   N GA I + P          D+ +     + +P P   P
Sbjct: 460 DAGGNLGAIIHVVPNTKSEKKSSIDSDLVIETFSASPHPDIKP 502



 Score = 20.8 bits (42), Expect(2) = 1.1
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = -1

Query: 750 WGPDMTDEFLKE 715
           +GPD+T +FLK+
Sbjct: 413 FGPDITRKFLKQ 424



>gb:AY062270_1565013 Exophiala dermatitidis strain 8656 calcineurin
           (CNA) gene, complete cds.
          Length = 537

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 26/74 (35%), Positives = 33/74 (44%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQAT 549
           NFL K NL  IIR+HE  DA  +          Y          ++T+FSAP+Y      
Sbjct: 289 NFLEKNNLLSIIRAHEAQDAGYRM---------YRKTRTTGFPSVMTIFSAPNY------ 333

Query: 548 EDRYRNKGAYIVLE 507
            D Y NK A +  E
Sbjct: 334 LDVYNNKAAVLKYE 347



>gb:AF287250_1259078 Bombyx mori calcineurin A (cna) mRNA, complete
           cds.
          Length = 495

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 26/74 (35%), Positives = 34/74 (45%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQAT 549
           +FL++ NL  IIR+HE  DA  +          Y          LIT+FSAP+Y      
Sbjct: 265 DFLQRNNLLSIIRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------ 309

Query: 548 EDRYRNKGAYIVLE 507
            D Y NK A +  E
Sbjct: 310 LDVYNNKAAVLKYE 323



>gb:HSPPEF_2019670 H.sapiens mRNA for serine/threonine protein
           phosphatase.
          Length = 653

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 26/74 (35%), Positives = 35/74 (47%)
 Frame = -2

Query: 731 TNFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQA 552
           +  L K  LK++IRSHE                GY I H    GK++T+FSA +Y     
Sbjct: 388 SKILNKYQLKMLIRSHECKPE------------GYEICH---DGKVVTIFSASNY----- 427

Query: 551 TEDRYRNKGAYIVL 510
             +   N+GAYI L
Sbjct: 428 -YEEGSNRGAYIKL 440



>gb:AE008692_241704 Zymomonas mobilis subsp. mobilis ZM4, complete
           genome.
          Length = 329

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 15/52 (28%), Positives = 29/52 (55%)
 Frame = -2

Query: 494 DTPIFHSFDAVTPRPKANPFYDFEDVILMKSWIWHLWSHHDDGVSRPLYKNR 339
           D  +FH  D +  + + NP ++FE V  ++SW+   W+    G+ R L +++
Sbjct: 138 DVAVFHFLDKILEKEQNNPVHNFEKVTDIESWLREQWA----GLFRDLLRSK 185



>pir|JC7241|JC7241 phosphoprotein phosphatase (EC 3.1.3.16),
           calcineurin catalytic chain [similarity] - scallop
           (Patinopecten yessoensis)
          Length = 486

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 27/74 (36%), Positives = 33/74 (44%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQAT 549
           +FL + NL  IIR+HE  DA  +          Y          LITLFSAP+Y      
Sbjct: 263 DFLSQNNLLSIIRAHEAQDAGYRM---------YRKSQTTGFPSLITLFSAPNY------ 307

Query: 548 EDRYRNKGAYIVLE 507
            D Y NK A +  E
Sbjct: 308 LDVYNNKAAILKYE 321



>sp|O14829|PPE1_HUMAN Serine/threonine protein phosphatase with
           EF-hands-1 (EC 3.1.3.16) (PPEF-1) (Protein phosphatase
           with EF calcium-binding domain) (PPEF) (Serine/threonine
           protein phosphatase 7) (PP7).>gb:AF023455_1877142 Homo
           sapiens protein phosphatase with EF-hands-1 (PPEF-1)
           mRNA, complete cds.>gb:AF027977_1877451 Homo sapiens
           serine/threonine protein phosphatase 7 catalytic subunit
           (PPP7C) mRNA, complete cds.>gb:BC036026_1981803 Homo
           sapiens protein phosphatase, EF hand calcium-binding
           domain 1, transcript variant 1, mRNA (cDNA clone
           MGC:33082 IMAGE:5273322), complete
           cds.>gb:HS436M11_1998642 Human DNA sequence from clone
           RP3-436M11 on chromosome Xp22.11-22.2, complete
           sequence.>gb:HSJ499B10_2016180 Human DNA sequence from
           clone RP3-499B10 on chromosome Xp22.31-22.13 Contains
           the 3' end of the PHKA2 gene for phosphorylase kinase,
           alpha 2 (liver), the 3' end of the PPEF1 gene for
           protein phosphatase, EF hand calcium-binding domain 1, a
           pallidin homolog (mouse) (PLDN) pseudogene, a novel
           pseudogene and a novel gene, complete sequence.
          Length = 653

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 26/74 (35%), Positives = 35/74 (47%)
 Frame = -2

Query: 731 TNFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQA 552
           +  L K  LK++IRSHE                GY I H    GK++T+FSA +Y     
Sbjct: 388 SKILNKYQLKMLIRSHECKPE------------GYEICH---DGKVVTIFSASNY----- 427

Query: 551 TEDRYRNKGAYIVL 510
             +   N+GAYI L
Sbjct: 428 -YEEGSNRGAYIKL 440



>gb:AE016814_1745912 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome I, complete sequence.
          Length = 538

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 24/53 (45%), Positives = 29/53 (54%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDY 567
           FL K  LK IIRSHE       R G      G   +H   +GKL+T+FSAP+Y
Sbjct: 446 FLEKNGLKKIIRSHE------VRMG------GVAFEH---AGKLVTVFSAPNY 483



>gb:CR380958_1653551 Candida glabrata strain CBS138 chromosome L
           complete sequence.
          Length = 575

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 33/103 (32%), Positives = 45/103 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL++  L  IIR+HE  DA  +          Y     +    L+TLFSAP+Y       
Sbjct: 310 FLQRSGLLSIIRAHEAQDAGYRM---------YKNTKTLGFPSLLTLFSAPNY------L 354

Query: 545 DRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANPFYDFEDV 417
           D Y NK A +  E    +   F+    ++P P   P  DF DV
Sbjct: 355 DTYNNKAAILKYENNVMNIRQFN----MSPHPYWLP--DFMDV 391



>gb:AE014298_1126007 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE014298_1126008 Drosophila melanogaster
           chromosome X, complete sequence.>gb:AE003502_1213016
           Drosophila melanogaster chromosome X, section 54 of 74
           of the complete sequence.>gb:AE003502_1213017 Drosophila
           melanogaster chromosome X, section 54 of 74 of the
           complete sequence.>gb:BT004864_1357202 Drosophila
           melanogaster RE14919 full insert cDNA.
          Length = 584

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 26/74 (35%), Positives = 33/74 (44%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQAT 549
           +FL+  NL  IIR+HE  DA  +          Y          LIT+FSAP+Y      
Sbjct: 341 DFLQNNNLLSIIRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------ 385

Query: 548 EDRYRNKGAYIVLE 507
            D Y NK A +  E
Sbjct: 386 LDVYNNKAAVLKYE 399



>gb:AE014298_1126006 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003502_1213015 Drosophila melanogaster
           chromosome X, section 54 of 74 of the complete
           sequence.>gb:BT010083_1357449 Drosophila melanogaster
           LD04578 full insert cDNA.
          Length = 570

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 26/74 (35%), Positives = 33/74 (44%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQAT 549
           +FL+  NL  IIR+HE  DA  +          Y          LIT+FSAP+Y      
Sbjct: 333 DFLQNNNLLSIIRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------ 377

Query: 548 EDRYRNKGAYIVLE 507
            D Y NK A +  E
Sbjct: 378 LDVYNNKAAVLKYE 391



>pir|S70554|S70554 phosphoprotein phosphatase (EC 3.1.3.16),
           calcineurin catalytic chain CnnA14D, splice form I
           [similarity] - fruit fly (Drosophila
           melanogaster)>gb:DMU30493_1380615 Drosophila
           melanogaster calcineurin homolog (CnnA14D) mRNA,
           complete cds.
          Length = 578

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 26/74 (35%), Positives = 33/74 (44%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQAT 549
           +FL+  NL  IIR+HE  DA  +          Y          LIT+FSAP+Y      
Sbjct: 341 DFLQNNNLLSIIRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------ 385

Query: 548 EDRYRNKGAYIVLE 507
            D Y NK A +  E
Sbjct: 386 LDVYNNKAAVLKYE 399



>pir|S70551|S70551 phosphoprotein phosphatase (EC 3.1.3.16),
           calcineurin catalytic chain CnnA14D, splice form II
           [similarity] - fruit fly (Drosophila melanogaster)
          Length = 569

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 26/74 (35%), Positives = 33/74 (44%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQAT 549
           +FL+  NL  IIR+HE  DA  +          Y          LIT+FSAP+Y      
Sbjct: 332 DFLQNNNLLSIIRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------ 376

Query: 548 EDRYRNKGAYIVLE 507
            D Y NK A +  E
Sbjct: 377 LDVYNNKAAVLKYE 390



>gb:AE014187_938690 Plasmodium falciparum 3D7 chromosome 14 complete
           sequence.>gb:AE014819_1227766 Plasmodium falciparum 3D7
           chromosome 14 section 4 of 13 of the complete sequence.
          Length = 959

 Score = 32.3 bits (72), Expect(2) = 3.0
 Identities = 24/71 (33%), Positives = 37/71 (52%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL ++IRSH+ P        L G+++ +        GK ITLFSA +Y       
Sbjct: 425 FLKNNNLDILIRSHQVPKT------LKGIESHH-------EGKCITLFSASNYC------ 465

Query: 545 DRYRNKGAYIV 513
           ++ +N GA I+
Sbjct: 466 NKIKNLGAAII 476



 Score = 20.4 bits (41), Expect(2) = 3.0
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = -1

Query: 750 WGPDMTDEFLK 718
           +GPD+T+ FLK
Sbjct: 417 FGPDVTEMFLK 427



>sp|P40421|RDGC_DROME Serine/threonine protein phosphatase rdgC (EC
           3.1.3.16) (Retinal degeneration C
           protein).>pir|A42287|A42287 phosphoprotein phosphatase
           (EC 3.1.3.16) rdgC - fruit fly  (Drosophila
           melanogaster)>gb:AE014296_1137136 Drosophila
           melanogaster chromosome 3L, complete
           sequence.>gb:AE014296_1137137 Drosophila melanogaster
           chromosome 3L, complete sequence.>gb:AE014296_1137138
           Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003514_1213574 Drosophila melanogaster
           chromosome 3L, section 71 of 83 of the complete
           sequence.>gb:AE003514_1213575 Drosophila melanogaster
           chromosome 3L, section 71 of 83 of the complete
           sequence.>gb:AE003514_1213576 Drosophila melanogaster
           chromosome 3L, section 71 of 83 of the complete
           sequence.>gb:DRORDGC_1382632 Drosophila melanogaster
           retinal degeneration C (rdgC) gene, complete cds.
          Length = 661

 Score = 31.6 bits (70), Expect(2) = 3.1
 Identities = 25/74 (33%), Positives = 34/74 (45%), Gaps = 1/74 (1%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHE-GPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQA 552
           NFL++  L  +IRSHE  P+  E                 +   K+IT+FSA +Y    +
Sbjct: 346 NFLQRHRLSYVIRSHECKPNGHE----------------FMHDNKIITIFSASNYYAIGS 389

Query: 551 TEDRYRNKGAYIVL 510
                 NKGAYI L
Sbjct: 390 ------NKGAYIRL 397



 Score = 21.2 bits (43), Expect(2) = 3.1
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = -1

Query: 750 WGPDMTDEFLK 718
           +GPD+TD FL+
Sbjct: 339 FGPDVTDNFLQ 349



>gb:BT015959_1358404 Drosophila melanogaster RH46370 full insert
           cDNA.
          Length = 603

 Score = 31.6 bits (70), Expect(2) = 3.1
 Identities = 25/74 (33%), Positives = 34/74 (45%), Gaps = 1/74 (1%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHE-GPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQA 552
           NFL++  L  +IRSHE  P+  E                 +   K+IT+FSA +Y    +
Sbjct: 288 NFLQRHRLSYVIRSHECKPNGHE----------------FMHDNKIITIFSASNYYAIGS 331

Query: 551 TEDRYRNKGAYIVL 510
                 NKGAYI L
Sbjct: 332 ------NKGAYIRL 339



 Score = 21.2 bits (43), Expect(2) = 3.1
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = -1

Query: 750 WGPDMTDEFLK 718
           +GPD+TD FL+
Sbjct: 281 FGPDVTDNFLQ 291



>gb:AE014296_1137139 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003514_1213577 Drosophila melanogaster
           chromosome 3L, section 71 of 83 of the complete
           sequence.
          Length = 603

 Score = 31.6 bits (70), Expect(2) = 3.1
 Identities = 25/74 (33%), Positives = 34/74 (45%), Gaps = 1/74 (1%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHE-GPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQA 552
           NFL++  L  +IRSHE  P+  E                 +   K+IT+FSA +Y    +
Sbjct: 288 NFLQRHRLSYVIRSHECKPNGHE----------------FMHDNKIITIFSASNYYAIGS 331

Query: 551 TEDRYRNKGAYIVL 510
                 NKGAYI L
Sbjct: 332 ------NKGAYIRL 339



 Score = 21.2 bits (43), Expect(2) = 3.1
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = -1

Query: 750 WGPDMTDEFLK 718
           +GPD+TD FL+
Sbjct: 281 FGPDVTDNFLQ 291



>gb:BC087175_2565032 Xenopus laevis hypothetical LOC495851, mRNA
           (cDNA clone MGC:97950 IMAGE:7197701), complete cds.
          Length = 524

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 26/73 (35%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  IIR+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 277 FLQNNNLLSIIRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------L 321

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 322 DVYNNKAAVLKYE 334



>gb:AY324833_2527711 Gallus gallus calcineurin A beta mRNA, partial
           cds.
          Length = 266

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 26/73 (35%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  IIR+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 166 FLQNNNLLSIIRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------L 210

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 211 DVYNNKAAVLKYE 223



>gb:AJ720756_2502943 Gallus gallus mRNA for hypothetical protein,
           clone 24n15.
          Length = 510

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 26/73 (35%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  IIR+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 272 FLQNNNLLSIIRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------L 316

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 317 DVYNNKAAVLKYE 329



>gb:BC066000_2105647 Mus musculus protein phosphatase 3, catalytic
           subunit, beta isoform, mRNA (cDNA clone MGC:91348
           IMAGE:5699179), complete cds.
          Length = 525

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 26/73 (35%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  IIR+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 277 FLQNNNLLSIIRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------L 321

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 322 DVYNNKAAVLKYE 334



>gb:HSA488506_2007504 Homo sapiens mRNA for protein phosphatase 3
           catalytic subunit beta3 (PPP3CB gene).
          Length = 515

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 26/73 (35%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  IIR+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 277 FLQNNNLLSIIRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------L 321

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 322 DVYNNKAAVLKYE 334



>gb:BC028049_1979082 Homo sapiens protein phosphatase 3 (formerly
           2B), catalytic subunit, beta isoform (calcineurin A
           beta), mRNA (cDNA clone MGC:39903 IMAGE:4538822),
           complete cds.
          Length = 525

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 26/73 (35%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  IIR+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 277 FLQNNNLLSIIRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------L 321

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 322 DVYNNKAAVLKYE 334



>gb:BC004864_1969398 Homo sapiens protein phosphatase 3 (formerly
           2B), catalytic subunit, gamma isoform (calcineurin A
           gamma), mRNA (cDNA clone MGC:10576 IMAGE:3677098),
           complete cds.
          Length = 512

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 26/73 (35%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  IIR+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 264 FLQNNNLLSIIRAHEAQDAGYRM---------YRKSQATGFPSLITIFSAPNY------L 308

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 309 DVYNNKAAVLKYE 321



>gb:AY007249_1934081 Homo sapiens calcineurin A catalytic subunit
           gamma isoform mRNA, complete cds.
          Length = 502

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 26/73 (35%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  IIR+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 264 FLQNNNLLSIIRAHEAQDAGYRM---------YRKSQATGFPSLITIFSAPNY------L 308

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 309 DVYNNKAAVLKYE 321



>gb:AL353731_1923018 Human DNA sequence from clone RP11-345K20 on
           chromosome 10 Contains the 5' end of the ANXA7 gene for
           annexin A7, a ribosomal protein L26 (RPL26) pseudogene,
           a novel gene (FLJ39565), the 3' end of the PPP3CB gene
           for protein phosphatase 3 (formerly 2B) catalytic
           subunit beta isoform (calcineurin A beta) and a CpG
           island, complete sequence.>gb:AL359074_1925333 Human DNA
           sequence from clone RP11-137L10 on chromosome 10
           Contains the 5' end of the PPP3CB gene for protein
           phosphatase 3 (formerly 2B) catalytic subunit beta
           isoform (calcineurin A beta), two novel genes
           (FLJ37318), the 3' end of a novel gene, a ribosomal
           protein S26 (RPS26) pseudogene and a CpG island,
           complete sequence.
          Length = 496

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 26/73 (35%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  IIR+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 277 FLQNNNLLSIIRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------L 321

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 322 DVYNNKAAVLKYE 334



>gb:AJ584614_1422525 Sus scrofa partial mRNA for Calcineurin A
           protein.
          Length = 254

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 26/73 (35%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  IIR+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 119 FLQNNNLLSIIRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------L 163

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 164 DVYNNKAAVLKYE 176



>gb:AF541961_1422365 Oryctolagus cuniculus calcineurin A beta mRNA,
           complete cds.
          Length = 524

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 26/73 (35%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  IIR+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 277 FLQNNNLLSIIRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------L 321

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 322 DVYNNKAAVLKYE 334



>gb:CEC02F4_1359942 Caenorhabditis elegans cosmid C02F4, complete
           sequence.
          Length = 558

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 26/74 (35%), Positives = 33/74 (44%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQAT 549
           +FL+  NL  IIR+HE  DA  +          Y          LIT+FSAP+Y      
Sbjct: 292 DFLQHNNLLSIIRAHEAQDAGYRM---------YRKSQATGFPSLITIFSAPNY------ 336

Query: 548 EDRYRNKGAYIVLE 507
            D Y NK A +  E
Sbjct: 337 LDVYNNKAAILKYE 350



>gb:AB041523_1195574 Mizuhopecten yessoensis mRNA for calcineurin A,
           complete cds.
          Length = 486

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 26/74 (35%), Positives = 33/74 (44%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQAT 549
           +FL + NL  IIR+HE  DA  +          Y          LIT+FSAP+Y      
Sbjct: 263 DFLSQNNLLSIIRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------ 307

Query: 548 EDRYRNKGAYIVLE 507
            D Y NK A +  E
Sbjct: 308 LDVYNNKAAILKYE 321



>pir|JT0976|JT0976 phosphoprotein phosphatase (EC 3.1.3.16) 3-alpha
           catalytic chain - mouse (fragment)
          Length = 515

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 26/73 (35%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  IIR+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 267 FLQNNNLLSIIRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------L 311

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 312 DVYNNKAAVLKYE 324



>pir|T18864|T18864 phosphoprotein phosphatase (EC 3.1.3.16),
           calcineurin catalytic chain C02F4.2 [similarity] -
           Caenorhabditis elegans>gb:CEC02F4_1359941 Caenorhabditis
           elegans cosmid C02F4, complete sequence.
          Length = 535

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 26/74 (35%), Positives = 33/74 (44%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQAT 549
           +FL+  NL  IIR+HE  DA  +          Y          LIT+FSAP+Y      
Sbjct: 292 DFLQHNNLLSIIRAHEAQDAGYRM---------YRKSQATGFPSLITIFSAPNY------ 336

Query: 548 EDRYRNKGAYIVLE 507
            D Y NK A +  E
Sbjct: 337 LDVYNNKAAILKYE 350



>pir|A36222|A36222 phosphoprotein phosphatase (EC 3.1.3.16) 3-beta
           catalytic chain, splice form 1 -
           human>gb:HUMCNRA1_2030173 Human calcineurin A1 mRNA,
           complete cds.
          Length = 514

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 26/73 (35%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  IIR+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 295 FLQNNNLLSIIRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------L 339

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 340 DVYNNKAAVLKYE 352



>sp|P48454|P2BC_HUMAN Serine/threonine protein phosphatase 2B
           catalytic subunit, gamma isoform (EC 3.1.3.16)
           (Calmodulin-dependent calcineurin A subunit, gamma
           isoform) (Calcineurin, testis-specific catalytic
           subunit) (CAM- PRP catalytic subunit).>pir|JC1283|JC1283
           phosphoprotein phosphatase (EC 3.1.3.16) 3-gamma
           catalytic chain - human>gb:S46622_2040297 calcineurin A
           catalytic subunit [human, testis, mRNA, 2134 nt].
          Length = 502

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 26/73 (35%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  IIR+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 264 FLQNNNLLSIIRAHEAQDAGYRM---------YRKSQATGFPSLITIFSAPNY------L 308

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 309 DVYNNKAAVLKYE 321



>sp|P20651|P2BB_RAT Serine/threonine protein phosphatase 2B
           catalytic subunit, beta isoform (EC 3.1.3.16)
           (Calmodulin-dependent calcineurin A subunit, beta
           isoform) (CAM-PRP catalytic subunit).>pir|A33794|A33794
           phosphoprotein phosphatase (EC 3.1.3.16) 3-beta
           catalytic chain - rat>gb:RATCALAB_2131670 Rat
           calcineurin A-beta mRNA, complete
           cds.>gb:RATCNRAB_2131845 Rattus norvegicus mRNA for
           calcineurin A beta, complete cds.
          Length = 525

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 26/73 (35%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  IIR+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 277 FLQNNNLLSIIRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------L 321

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 322 DVYNNKAAVLKYE 334



>sp|P48453|P2BB_MOUSE Serine/threonine protein phosphatase 2B
           catalytic subunit, beta isoform (EC 3.1.3.16)
           (Calmodulin-dependent calcineurin A subunit, beta
           isoform) (CAM-PRP catalytic subunit)
           (Fragment).>gb:MUSCDP_2125457 Mus musculus calmodulin
           dependent phosphatase catalytic subunit (Cam-Prp) mRNA,
           3' end.
          Length = 515

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 26/73 (35%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  IIR+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 267 FLQNNNLLSIIRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------L 311

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 312 DVYNNKAAVLKYE 324



>sp|P16299|P2BB_HUMAN Serine/threonine protein phosphatase 2B
           catalytic subunit, beta isoform (EC 3.1.3.16)
           (Calmodulin-dependent calcineurin A subunit, beta
           isoform) (CAM-PRP catalytic subunit).>pir|B36222|B36222
           phosphoprotein phosphatase (EC 3.1.3.16) 3-beta
           catalytic chain, splice form 2 -
           human>gb:AL353731_1923016 Human DNA sequence from clone
           RP11-345K20 on chromosome 10 Contains the 5' end of the
           ANXA7 gene for annexin A7, a ribosomal protein L26
           (RPL26) pseudogene, a novel gene (FLJ39565), the 3' end
           of the PPP3CB gene for protein phosphatase 3 (formerly
           2B) catalytic subunit beta isoform (calcineurin A beta)
           and a CpG island, complete sequence.>gb:AL359074_1925332
           Human DNA sequence from clone RP11-137L10 on chromosome
           10 Contains the 5' end of the PPP3CB gene for protein
           phosphatase 3 (formerly 2B) catalytic subunit beta
           isoform (calcineurin A beta), two novel genes
           (FLJ37318), the 3' end of a novel gene, a ribosomal
           protein S26 (RPS26) pseudogene and a CpG island,
           complete sequence.>gb:HUMCNRAB_2030174 Human calcineurin
           A2 mRNA, complete cds.
          Length = 524

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 26/73 (35%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  IIR+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 277 FLQNNNLLSIIRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------L 321

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 322 DVYNNKAAVLKYE 334



>sp|Q27889|P2B2_DROME Serine/threonine protein phosphatase 2B
           catalytic subunit 2, (EC 3.1.3.16) (Calmodulin-dependent
           calcineurin A2 subunit).>pir|S41743|S41743
           phosphoprotein phosphatase (EC 3.1.3.16) 3 catalytic
           chain - fruit fly (Drosophila
           melanogaster)>gb:DMPPP3C_1379988 D.melanogaster mRNA for
           serine/threonine specific protein
           phosphatase.>gb:S68806_1396778 calcium/calmodulin
           regulated protein phosphatase 2B [Drosophila
           melanogaster, Oregon R, eye disk, mRNA, 3247 nt].
          Length = 560

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 26/73 (35%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  IIR+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 325 FLQNNNLLSIIRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------L 369

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 370 DVYNNKAAVLKYE 382



>gb:AF195248_1249803 Plasmodium falciparum PP1-like protein
           serine/threonine phosphatase mRNA, complete cds.
          Length = 294

 Score = 32.3 bits (72), Expect(2) = 3.3
 Identities = 24/71 (33%), Positives = 37/71 (52%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL ++IRSH+ P        L G+++ +        GK ITLFSA +Y       
Sbjct: 194 FLKNNNLDILIRSHQVPKT------LKGIESHH-------EGKCITLFSASNYC------ 234

Query: 545 DRYRNKGAYIV 513
           ++ +N GA I+
Sbjct: 235 NKIKNLGAAII 245



 Score = 20.4 bits (41), Expect(2) = 3.3
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = -1

Query: 750 WGPDMTDEFLK 718
           +GPD+T+ FLK
Sbjct: 186 FGPDVTEMFLK 196



>gb:BC071006_2555880 Xenopus laevis hypothetical protein MGC81043,
           mRNA (cDNA clone MGC:81043 IMAGE:6316114), complete cds.
          Length = 507

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 25/73 (34%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  +IR+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 266 FLQSNNLLSVIRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------L 310

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 311 DVYNNKAAVLKYE 323



>gb:RNCALCA_2134561 Rat mRNA for calcineurin A.
          Length = 511

 Score = 33.1 bits (74), Expect = 5.6
 Identities = 25/74 (33%), Positives = 33/74 (44%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQAT 549
           +FL+  NL  I+R+HE  DA  +          Y          LIT+FSAP+Y      
Sbjct: 267 DFLQHNNLLSILRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------ 311

Query: 548 EDRYRNKGAYIVLE 507
            D Y NK A +  E
Sbjct: 312 LDVYNNKAAVLKYE 325



>gb:MUSCNRA_2125496 Mouse brain calmodulin-dependent phosphatase
           (calcineurin) catalytic subunit mRNA, 3' end.
          Length = 307

 Score = 33.1 bits (74), Expect = 5.6
 Identities = 25/74 (33%), Positives = 33/74 (44%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQAT 549
           +FL+  NL  I+R+HE  DA  +          Y          LIT+FSAP+Y      
Sbjct: 53  DFLQHNNLLSILRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------ 97

Query: 548 EDRYRNKGAYIVLE 507
            D Y NK A +  E
Sbjct: 98  LDVYNNKAAVLKYE 111



>gb:NC99H12_1688830 Neurospora crassa DNA linkage group V Cosmid
           contig 99H12.
          Length = 517

 Score = 33.1 bits (74), Expect = 5.6
 Identities = 25/74 (33%), Positives = 33/74 (44%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQAT 549
           +FL K NL  IIR+HE  DA  +          Y          ++T+FSAP+Y      
Sbjct: 265 HFLEKNNLLSIIRAHEAQDAGYRM---------YRKTRTTGFPSVMTIFSAPNY------ 309

Query: 548 EDRYRNKGAYIVLE 507
            D Y NK A +  E
Sbjct: 310 LDVYNNKAAVLKYE 323



>gb:AX343907_1465941 Sequence 3 from Patent WO0200872.
          Length = 456

 Score = 33.1 bits (74), Expect = 5.6
 Identities = 25/74 (33%), Positives = 33/74 (44%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQAT 549
           +FL+  NL  I+R+HE  DA  +          Y          LIT+FSAP+Y      
Sbjct: 267 DFLQHNNLLSILRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------ 311

Query: 548 EDRYRNKGAYIVLE 507
            D Y NK A +  E
Sbjct: 312 LDVYNNKAAVLKYE 325



>gb:PTE567906_1395951 Paramecium tetraurelia macronuclear caN-A2
           gene for calcineurin A2, exons 1-8.
          Length = 508

 Score = 33.1 bits (74), Expect = 5.6
 Identities = 37/112 (33%), Positives = 49/112 (43%), Gaps = 3/112 (2%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGK---LITLFSAPDYPQFQ 555
           FL++ NL  +IR+HE             +D GY +     S     +IT+FSAP+Y    
Sbjct: 264 FLQRNNLISVIRAHEAQ-----------LD-GYKMHRWKSSSDFPVVITIFSAPNYC--- 308

Query: 554 ATEDRYRNKGAYIVLEPPDFDTPIFHSFDAVTPRPKANPFYDFEDVILMKSW 399
              D Y+NKGA I  E    +   F      TP P   P  +F DV    SW
Sbjct: 309 ---DVYKNKGAVIKFENNTLNIQQFKD----TPHPYLLP--NFMDVF---SW 348



>gb:AC115584_1205693 Dictyostelium discoideum chromosome 2 map
           complement(3622543-3568102) strain AX4, complete
           sequence.>gb:DDU22397_1377305 Dictyostelium discoideum
           calcineurin mRNA, complete cds.
          Length = 623

 Score = 33.1 bits (74), Expect = 5.6
 Identities = 25/74 (33%), Positives = 35/74 (47%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQAT 549
           +FL+K  L  +IR+HE  +A  K          +  +       +ITLFSAP+Y      
Sbjct: 316 SFLQKNKLLSVIRAHEAQNAGYKM---------HLQNDATGFPSVITLFSAPNY------ 360

Query: 548 EDRYRNKGAYIVLE 507
            D Y NKGA +  E
Sbjct: 361 LDAYNNKGAVLRYE 374



>gb:PA12396_156533 P.abyssi gene encoding protein serine/threonine
           phosphatase.
          Length = 302

 Score = 33.1 bits (74), Expect = 5.6
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 4/54 (7%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLG----GMDAGYTIDHVVESGKLITLFSA 576
           FL    L+LI+R+HE  DA       G    G++ GYT+      G ++T+FS+
Sbjct: 220 FLEANGLELIVRAHEAVDAHHVWTSSGRPVHGLEHGYTMGLEELRGSVVTVFSS 273



>pir|S78706|S78706 protein YBR058c-a - yeast (Saccharomyces
           cerevisiae)
          Length = 80

 Score = 33.1 bits (74), Expect = 5.6
 Identities = 16/53 (30%), Positives = 25/53 (47%)
 Frame = -1

Query: 330 RHNNNSSSWLRMIGTWLTSIQWRFRLEMEFCIMTSIENMYFLVLFL*CFSLHF 172
           R N  S   L  I   +  + W + + + F +M S ++ +  V FL  FSL F
Sbjct: 19  RRNGKSEGILNTIEEVVEKLYWTYYIHLPFYLMASFDSFFLHVFFLTIFSLSF 71



>pir|S68963|S68963 phosphoprotein phosphatase (EC 3.1.3.16) 3
           catalytic chain homolog - slime mold (Dictyostelium
           discoideum)>gb:DDCALNRNA_1376865 D.discoideum mRNA for
           calcineurin A.
          Length = 623

 Score = 33.1 bits (74), Expect = 5.6
 Identities = 25/74 (33%), Positives = 35/74 (47%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQAT 549
           +FL+K  L  +IR+HE  +A  K          +  +       +ITLFSAP+Y      
Sbjct: 316 SFLQKNKLLSVIRAHEAQNAGYKM---------HLQNDATGFPSVITLFSAPNY------ 360

Query: 548 EDRYRNKGAYIVLE 507
            D Y NKGA +  E
Sbjct: 361 LDAYNNKGAVLRYE 374



>sp|Q05681|P2B_NEUCR Serine/threonine protein phosphatase 2B
           catalytic subunit (EC 3.1.3.16) (Calmodulin-dependent
           calcineurin A subunit).>pir|A40942|A40942 phosphoprotein
           phosphatase (EC 3.1.3.16) 3-alpha catalytic chain -
           Neurospora crassa>gb:NEUCAM_1690787 Neurospora crassa
           calmodulin-dependent protein phosphatase mRNA, complete
           cds.
          Length = 518

 Score = 33.1 bits (74), Expect = 5.6
 Identities = 25/74 (33%), Positives = 33/74 (44%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQAT 549
           +FL K NL  IIR+HE  DA  +          Y          ++T+FSAP+Y      
Sbjct: 265 HFLEKNNLLSIIRAHEAQDAGYRM---------YRKTRTTGFPSVMTIFSAPNY------ 309

Query: 548 EDRYRNKGAYIVLE 507
            D Y NK A +  E
Sbjct: 310 LDVYNNKAAVLKYE 323



>sp|P20652|P2BA_MOUSE Serine/threonine protein phosphatase 2B
           catalytic subunit, alpha isoform (EC 3.1.3.16)
           (Calmodulin-dependent calcineurin A subunit, alpha
           isoform) (CAM-PRP catalytic subunit).>pir|A42232|A31257
           phosphoprotein phosphatase (EC 3.1.3.16) 3-alpha
           catalytic chain - mouse>pir|A33264|A33264 phosphoprotein
           phosphatase (EC 3.1.3.16) 3-alpha catalytic chain -
           rat>gb:MUSCALCAT_2125367 Mouse calcineurin catalytic
           subunit mRNA, complete cds.>gb:RATCNRA_2131843 Rat
           calcineurin A mRNA, complete cds.>gb:RATCNRAA_2131844
           Rattus norvegicus mRNA for calcineurin A alpha, complete
           cds.
          Length = 521

 Score = 33.1 bits (74), Expect = 5.6
 Identities = 25/74 (33%), Positives = 33/74 (44%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQAT 549
           +FL+  NL  I+R+HE  DA  +          Y          LIT+FSAP+Y      
Sbjct: 267 DFLQHNNLLSILRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------ 311

Query: 548 EDRYRNKGAYIVLE 507
            D Y NK A +  E
Sbjct: 312 LDVYNNKAAVLKYE 325



>gb:AY324834_2527712 Gallus gallus calcineurin A alpha mRNA, partial
           cds.
          Length = 504

 Score = 32.7 bits (73), Expect = 7.3
 Identities = 25/73 (34%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  I+R+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 262 FLQHNNLLSILRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------L 306

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 307 DVYNNKAAVLKYE 319



>gb:AY340621_1600673 Aspergillus parasiticus calcineurin A (cnaA)
           gene, complete cds.
          Length = 515

 Score = 32.7 bits (73), Expect = 7.3
 Identities = 25/73 (34%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL K NL  IIR+HE  DA  +          Y          ++T+FSAP+Y       
Sbjct: 266 FLEKNNLLSIIRAHEAQDAGYRM---------YRKTRTTGFPSVMTIFSAPNY------L 310

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 311 DVYNNKAAVLKYE 323



>gb:AB063317_1522213 Aspergillus oryzae cnaA gene for calcineurin A,
           complete cds.
          Length = 514

 Score = 32.7 bits (73), Expect = 7.3
 Identities = 25/73 (34%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL K NL  IIR+HE  DA  +          Y          ++T+FSAP+Y       
Sbjct: 266 FLEKNNLLSIIRAHEAQDAGYRM---------YRKTRTTGFPSVMTIFSAPNY------L 310

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 311 DVYNNKAAVLKYE 323



>gb:AY266682_1428143 Canis familiaris heart calcineurin catalytic
           subunit mRNA, partial cds.
          Length = 399

 Score = 32.7 bits (73), Expect = 7.3
 Identities = 25/73 (34%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  I+R+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 268 FLQHNNLLSILRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------L 312

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 313 DVYNNKAAVLKYE 325



>gb:AF541960_1422364 Oryctolagus cuniculus calcineurin A alpha mRNA,
           complete cds.
          Length = 511

 Score = 32.7 bits (73), Expect = 7.3
 Identities = 25/73 (34%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  I+R+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 268 FLQHNNLLSILRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------L 312

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 313 DVYNNKAAVLKYE 325



>gb:AF193515_1415886 Sus scrofa calcineurin catalytic subunit delta
           isoform mRNA, complete cds.
          Length = 511

 Score = 32.7 bits (73), Expect = 7.3
 Identities = 25/73 (34%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  I+R+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 268 FLQHNNLLSILRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------L 312

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 313 DVYNNKAAVLKYE 325



>gb:SMA276884_1397767 Schistosoma mansoni mRNA for calcineurin A.
          Length = 644

 Score = 32.7 bits (73), Expect = 7.3
 Identities = 26/74 (35%), Positives = 33/74 (44%)
 Frame = -2

Query: 728 NFLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQAT 549
           +FL+  NL  IIR+HE  DA  +          Y          LIT+FSAP+Y      
Sbjct: 264 HFLQANNLLSIIRAHEAQDAGYRM---------YRKSRQTGFPALITIFSAPNY------ 308

Query: 548 EDRYRNKGAYIVLE 507
            D Y NK A +  E
Sbjct: 309 LDVYNNKAAILKYE 322



>gb:CR859582_1183691 Pongo pygmaeus mRNA; cDNA DKFZp459C244 (from
           clone DKFZp459C244).>gb:BC025714_1978552 Homo sapiens
           protein phosphatase 3 (formerly 2B), catalytic subunit,
           alpha isoform (calcineurin A alpha), mRNA (cDNA clone
           MGC:34395 IMAGE:5227691), complete cds.
          Length = 511

 Score = 32.7 bits (73), Expect = 7.3
 Identities = 25/73 (34%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  I+R+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 268 FLQHNNLLSILRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------L 312

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 313 DVYNNKAAVLKYE 325



>sp|Q08209|P2BA_HUMAN Serine/threonine protein phosphatase 2B
           catalytic subunit, alpha isoform (EC 3.1.3.16)
           (Calmodulin-dependent calcineurin A subunit, alpha
           isoform) (CAM-PRP catalytic subunit).>pir|S35067|S35067
           phosphoprotein phosphatase (EC 3.1.3.16) 3-alpha
           catalytic chain [similarity] -
           human>gb:HSM802637_1186762 Homo sapiens mRNA; cDNA
           DKFZp761L0516 (from clone
           DKFZp761L0516).>gb:HUMCALAA_2029795 Human
           calmodulin-dependent protein phosphatase catalytic
           subunit (PPP3CA) mRNA, complete cds and alternative
           exon.
          Length = 521

 Score = 32.7 bits (73), Expect = 7.3
 Identities = 25/73 (34%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  I+R+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 268 FLQHNNLLSILRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------L 312

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 313 DVYNNKAAVLKYE 325



>sp|P48452|P2BA_BOVIN Serine/threonine protein phosphatase 2B
           catalytic subunit, alpha isoform (EC 3.1.3.16)
           (Calmodulin-dependent calcineurin A subunit, alpha
           isoform) (CAM-PRP catalytic subunit).>pir|A56968|A56968
           phosphoprotein phosphatase (EC 3.1.3.16) 3-alpha
           catalytic chain [validated] - bovine>gb:BTU33868_1437576
           Bos taurus calcineurin A alpha mRNA, complete cds.
          Length = 521

 Score = 32.7 bits (73), Expect = 7.3
 Identities = 25/73 (34%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  I+R+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 268 FLQHNNLLSILRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------L 312

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 313 DVYNNKAAVLKYE 325



>sp|P53043|PPT1_YEAST Serine/threonine protein phosphatase T (EC
           3.1.3.16) (PPT).>pir|S52571|S52571 phosphoprotein
           phosphatase (EC 3.1.3.16) PPT1 - yeast  (Saccharomyces
           cerevisiae)>gb:AY558095_1614322 Saccharomyces cerevisiae
           clone FLH112420.01X YGR123C gene, complete
           cds.>gb:SCDNAORFS_1707785 S.cerevisiae DNA for ORFs from
           chromosome VII.>gb:SCYGR123C_1712351 S.cerevisiae
           chromosome VII reading frame ORF YGR123c.
          Length = 513

 Score = 29.6 bits (65), Expect(2) = 8.6
 Identities = 20/53 (37%), Positives = 27/53 (50%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDY 567
           FLR   L+ I RSHE          +GG+          + GKL+T+FSAP+Y
Sbjct: 421 FLRNNKLRKIFRSHE--------LRMGGVQ-------FEQKGKLMTVFSAPNY 458



 Score = 21.6 bits (44), Expect(2) = 8.6
 Identities = 7/11 (63%), Positives = 10/11 (90%)
 Frame = -1

Query: 750 WGPDMTDEFLK 718
           +GPD+TD FL+
Sbjct: 413 FGPDITDRFLR 423



>gb:BC079683_2561222 Xenopus laevis MGC79144 protein, mRNA (cDNA
           clone MGC:79144 IMAGE:5073171), complete cds.
          Length = 511

 Score = 32.3 bits (72), Expect = 9.5
 Identities = 24/73 (32%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  ++R+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 268 FLQHNNLLSVLRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------L 312

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 313 DVYNNKAAVLKYE 325



>gb:BC049001_2550075 Xenopus laevis protein phosphatase 3 (formerly
           2B), catalytic subunit, alpha isoform (calcineurin A
           alpha), mRNA (cDNA clone MGC:52521 IMAGE:5542383),
           complete cds.
          Length = 518

 Score = 32.3 bits (72), Expect = 9.5
 Identities = 24/73 (32%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  ++R+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 268 FLQHNNLLSVLRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------L 312

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 313 DVYNNKAAVLKYE 325



>gb:AB037146_2461688 Xenopus laevis mRNA for calcineurin catalytic
           subunit, complete cds.
          Length = 508

 Score = 32.3 bits (72), Expect = 9.5
 Identities = 24/73 (32%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  NL  ++R+HE  DA  +          Y          LIT+FSAP+Y       
Sbjct: 268 FLQHNNLLSVLRAHEAQDAGYRM---------YRKSQTTGFPSLITIFSAPNY------L 312

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 313 DVYNNKAAVLKYE 325



>gb:BC079027_2107166 Rattus norvegicus cDNA clone MGC:93954
           IMAGE:7114037, complete cds.
          Length = 506

 Score = 32.3 bits (72), Expect = 9.5
 Identities = 25/73 (34%), Positives = 33/73 (45%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  +L  IIR+HE  DA  +          Y  +       LIT+FSAP+Y       
Sbjct: 264 FLQNNSLLSIIRAHEAQDAGYRM---------YRKNQATGFPSLITIFSAPNY------L 308

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 309 DVYNNKAAVLKYE 321



>gb:BC046617_2099317 Mus musculus protein phosphatase 3, catalytic
           subunit, gamma isoform, mRNA (cDNA clone IMAGE:6494240),
           partial cds.
          Length = 538

 Score = 32.3 bits (72), Expect = 9.5
 Identities = 25/73 (34%), Positives = 33/73 (45%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  +L  IIR+HE  DA  +          Y  +       LIT+FSAP+Y       
Sbjct: 280 FLQNNSLLSIIRAHEAQDAGYRM---------YRKNQATGFPSLITIFSAPNY------L 324

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 325 DVYNNKAAVLKYE 337



>gb:CR382136_1669024 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 564

 Score = 32.3 bits (72), Expect = 9.5
 Identities = 24/73 (32%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL +  L  IIR+HE  DA  +          Y     +    L+T+FSAP+Y       
Sbjct: 301 FLERTGLLSIIRAHEAQDAGYRM---------YKRTKTMGFPSLLTMFSAPNY------L 345

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 346 DTYNNKAAVLKYE 358



>sp|P48457|P2B_EMENI Serine/threonine protein phosphatase 2B
           catalytic subunit (EC 3.1.3.16) (Calmodulin-dependent
           calcineurin A subunit).>pir|S46322|S46322 phosphoprotein
           phosphatase (EC 3.1.3.16) catalytic chain 2B -
           Emericella nidulans>gb:ENU13919_1676752 Emericella
           nidulans calmodulin-dependent protein phosphatase
           catalytic subunit (cnaA+) gene, complete cds.
          Length = 530

 Score = 32.3 bits (72), Expect = 9.5
 Identities = 24/73 (32%), Positives = 32/73 (43%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL K NL  +IR+HE  DA  +          Y          ++T+FSAP+Y       
Sbjct: 266 FLEKNNLLSVIRAHEAQDAGYRM---------YRKTRTTGFPSVMTIFSAPNY------L 310

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 311 DVYNNKAAVLKYE 323



>sp|P48455|P2BC_MOUSE Serine/threonine protein phosphatase 2B
           catalytic subunit, gamma isoform (EC 3.1.3.16)
           (Calmodulin-dependent calcineurin A subunit, gamma
           isoform) (Calcineurin, testis-specific catalytic
           subunit) (CAM- PRP catalytic subunit).>pir|A38193|A38193
           phosphoprotein phosphatase (EC 3.1.3.16) 3-gamma
           catalytic chain - mouse>gb:MUSPPPPA_2129707 Murine
           phosphoprotein phosphatase mRNA, complete cds.
          Length = 513

 Score = 32.3 bits (72), Expect = 9.5
 Identities = 25/73 (34%), Positives = 33/73 (45%)
 Frame = -2

Query: 725 FLRKCNLKLIIRSHEGPDAREKRPGLGGMDAGYTIDHVVESGKLITLFSAPDYPQFQATE 546
           FL+  +L  IIR+HE  DA  +          Y  +       LIT+FSAP+Y       
Sbjct: 264 FLQNNSLLSIIRAHEAQDAGYRM---------YRKNQATGFPSLITIFSAPNY------L 308

Query: 545 DRYRNKGAYIVLE 507
           D Y NK A +  E
Sbjct: 309 DVYNNKAAVLKYE 321


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 806,513,171
Number of Sequences: 1806583
Number of extensions: 17247800
Number of successful extensions: 37990
Number of sequences better than 10.0: 119
Number of HSP's better than 10.0 without gapping: 36846
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37871
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 46505143296
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)