BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10752
         (922 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|Q9SEL6|VT11_ARATH|VT11_ARATH Vesicle transport v-SNARE 11 (AtVTI11) (Ves...   289   6e-77   Arabidopsis thaliana [mouse-ear cress]
sp|Q9LVP9|VT13_ARATH|VT13_ARATH Vesicle transport v-SNARE 13 (AtVTI13) (Ves...   288   1e-76   Arabidopsis thaliana [mouse-ear cress]
gb:AF114750_1769215 Arabidopsis thaliana v-SNARE AtVTI1a (VTI1a)...   287   2e-76   
gb:AP003273_1826953 Oryza sativa (japonica cultivar-group) genom...   284   1e-75   
gb:AE005172_891541 Arabidopsis thaliana chromosome 1, top arm co...   265   9e-70   
gb:AF114751_1769216 Arabidopsis thaliana v-SNARE AtVTI1b (VTI1b)...   264   2e-69   
sp|Q9SEL5|VT12_ARATH|VT12_ARATH Vesicle transport v-SNARE 12 (AtVTI12) (Ves...   260   2e-68   Arabidopsis thaliana [mouse-ear cress]
gb:AP003924_1835338 Oryza sativa (japonica cultivar-group) genom...   249   5e-65   
gb:AK118255_1816242 Arabidopsis thaliana At3g29100 mRNA for puta...   204   1e-51   
gb:AB012243_1511741 Arabidopsis thaliana genomic DNA, chromosome...   156   6e-37   
sp|O89116|VT1A_MOUSE|VT1A_MOUSE Vesicle transport through interaction with ...   127   4e-28   Mus musculus [mouse]
gb:AF262221_2060849 Rattus norvegicus SNARE Vti1a protein mRNA, ...   125   2e-27   
gb:BC089321_2110773 Mus musculus vesicle transport through inter...   121   2e-26   
sp|Q96AJ9|VT1A_HUMAN|VT1A_HUMAN Vesicle transport through interaction with ...   120   5e-26   Homo sapiens [man]
sp|Q9JI51|VT1A_RAT|VT1A_RAT Vesicle transport through interaction with t-...   119   8e-26   Rattus norvegicus [brown rat]
gb:BC074431_2557935 Xenopus laevis similar to vesicle transport ...   114   2e-24   
gb:BT004676_1637710 Arabidopsis thaliana At1g26670 gene, complet...   104   3e-21   
gb:BC054311_2550957 Xenopus laevis similar to vesicle transport ...   102   1e-20   
gb:CR382128_1660433 Yarrowia lipolytica chromosome B of strain C...    92   1e-17   
pir|T27217|T27217 hypothetical protein Y57G11C.4 - Caenorhabditi...    90   5e-17   Caenorhabditis elegans [roundworm]
gb:AE014296_1134048 Drosophila melanogaster chromosome 3L, compl...    88   2e-16   
gb:CEY57G11C_1370708 Caenorhabditis elegans YAC Y57G11C, complet...    88   3e-16   
gb:CR382136_1669125 Debaryomyces hansenii chromosome D of strain...    86   1e-15   
sp|P78768|VTI1_SCHPO|VTI1_SCHPO Vesicle transport v-SNARE protein VTI1 homo...    79   1e-13   Schizosaccharomyces pombe
pir|T42225|T42225 hypothetical protein - fission yeast (Schizosa...    79   2e-13   Schizosaccharomyces pombe
gb:AY222929_1176395 Schistosoma japonicum clone ZZD1588 mRNA seq...    77   5e-13   
sp|Q04338|VTI1_YEAST|VTI1_YEAST Vesicle transport v-SNARE protein VTI1.>pir...    76   8e-13   Saccharomyces cerevisiae [brewer's yeast]
gb:BC055131_2551219 Danio rerio vesicle transport through intera...    76   1e-12   
gb:CR382122_1655249 Kluyveromyces lactis strain NRRL Y-1140 chro...    74   4e-12   
gb:AK035895_1164277 Mus musculus 16 days neonate cerebellum cDNA...    74   4e-12   
gb:AK014541_1158022 Mus musculus 0 day neonate skin cDNA, RIKEN ...    74   5e-12   
gb:BT019346_2151303 Synthetic construct Homo sapiens vesicle tra...    72   1e-11   
gb:AF060902_1879843 Homo sapiens vesicle soluble NSF attachment ...    72   1e-11   
sp|O88384|VT1B_MOUSE|VT1B_MOUSE Vesicle transport through interaction with ...    72   1e-11   Mus musculus [mouse]
sp|Q9UEU0|VT1B_HUMAN|VT1B_HUMAN Vesicle transport through interaction with ...    72   1e-11   Homo sapiens [man]
gb:BC009810_2090868 Mus musculus vesicle transport through inter...    72   2e-11   
gb:AY490205_1430522 Sus scrofa NFS (NFS) mRNA, complete cds.>gb:...    72   2e-11   
gb:BT019960_1991321 Homo sapiens vesicle transport through inter...    71   3e-11   
gb:BT019347_2151304 Synthetic construct Homo sapiens vesicle tra...    70   4e-11   
gb:AF035821_2051777 Mus musculus GES30 mRNA, complete cds.             68   3e-10   
gb:CR380958_1653528 Candida glabrata strain CBS138 chromosome L ...    67   5e-10   
gb:AE017347_1757910 Cryptococcus neoformans var. neoformans JEC2...    58   2e-07   
gb:AE016819_1748670 Ashbya gossypii (= Eremothecium gossypii) AT...    57   4e-07   
gb:AP003267_1826763 Oryza sativa (japonica cultivar-group) genom...    55   1e-06   
gb:AF282728_1258694 Culex pipiens Twin-Cp5 SINE retroposon, geno...    54   4e-06   
pir|T31036|T31036 hypothetical protein 630B - Sulfolobus sp. pla...    41   0.029   Sulfolobus sp. NOB8H2
gb:AF435011_1902074 Homo sapiens NUANCE (NUA) mRNA, complete cds.      39   0.14    
gb:AC082644_1733146 Oryza sativa chromosome 3 BAC OSJNBa0013M12 ...    39   0.19    
gb:AY740015_1626149 Oryza sativa (japonica cultivar-group) SNARE...    39   0.19    
gb:AF164622_1887183 Homo sapiens golgin-67 (GOLGA5) mRNA, comple...    38   0.24    
gb:AF204231_1889899 Homo sapiens 88-kDa Golgi protein (GM88) mRN...    38   0.32    
gb:AF163441_1887142 Homo sapiens golgin 67 mRNA, complete cds.         38   0.32    
gb:AB020662_1865260 Homo sapiens mRNA for KIAA0855 protein, part...    38   0.32    
gb:CR382130_1663372 Yarrowia lipolytica chromosome D of strain C...    38   0.32    
gb:HSM802091_1186602 Homo sapiens mRNA; cDNA DKFZp434J052 (from ...    38   0.32    
gb:AE017025_380744 Bacillus anthracis str. Ames section 2 of 18 ...    38   0.32    
sp|Q9NZW0|GO67_HUMAN|GO67_HUMAN Golgi autoantigen golgin-67 (88-kDa Golgi p...    38   0.32    Homo sapiens [man]
gb:AF380358_2490455 Gallus gallus AG9C5 mRNA, complete cds.>gb:A...    37   0.41    
pir|C96667|C96667 unknown protein, 71502-69704 [imported] - Arab...    37   0.41    Arabidopsis thaliana [mouse-ear cress]
gb:AE017206_405174 Lactobacillus johnsonii NCC 533, section 7 of...    37   0.54    
gb:AE017343_1755892 Cryptococcus neoformans var. neoformans JEC2...    37   0.70    
gb:A13463_1447488 P.falciparum gene for 41kd antigen, clone 41-8.      37   0.70    
gb:BX842653_825518 Bdellovibrio bacteriovorus complete genome, s...    36   0.92    
sp|Q10973|YT27_MYCTU|YT27_MYCTU Hypothetical protein Rv2927c/MT2997/Mb2952c...    36   0.92    Mycobacterium tuberculosis
gb:AB020719_1865317 Homo sapiens mRNA for KIAA0912 protein, part...    36   1.2     
gb:AP004856_1846062 Oryza sativa (japonica cultivar-group) genom...    36   1.2     
gb:CR380955_1651847 Candida glabrata strain CBS138 chromosome I ...    36   1.2     
gb:PFA929354_1393147 Plasmodium falciparum strain 3D7, chromosom...    36   1.2     
gb:AE000516_23093 Mycobacterium tuberculosis CDC1551, complete g...    36   1.2     
gb:AY062270_1565013 Exophiala dermatitidis strain 8656 calcineur...    35   1.6     
gb:AB019228_1514106 Arabidopsis thaliana genomic DNA, chromosome...    35   1.6     
gb:AE014134_1129660 Drosophila melanogaster chromosome 2L, compl...    35   1.6     
gb:AY039661_586219 Streptococcus pyogenes strain NS90 M protein ...    35   1.6     
pir|E81366|E81366 probable membrane protein Cj0926 [imported] - ...    35   1.6     Campylobacter jejuni RM1221
sp|Q91ZU8|BP1E_MOUSE|BP1E_MOUSE Bullous pemphigoid antigen 1, isoform 5 (BP...    35   1.6     Mus musculus [mouse]
gb:AE017342_1754872 Cryptococcus neoformans var. neoformans JEC2...    35   2.1     
gb:YSCINTANA_1729387 Saccharomyces cerevisiae integrin analogue ...    35   2.1     
gb:AB015484_1193578 Dugesia japonica mRNA for myosin heavy chain...    35   2.1     
gb:AJ748324_530339 Sulfolobus islandicus plasmid pHVE14.               35   2.1     
pir|A60776|A60776 230k bullous pemphigoid antigen BPM1 - mouse (...    35   2.1     Mus musculus [mouse]
gb:AY398408_2531938 Danio rerio clone RK112A2B01 ribosome bindin...    35   2.7     
gb:AY035224_2508896 Gallus gallus cardiac muscle factor 1 gene, ...    35   2.7     
gb:CNS07EGI_1374577 chromosome IX of strain GB-M1 of Encephalito...    35   2.7     
gb:AF151102_1245420 Polysphondylium pallidum cortexillin II gene...    35   2.7     
gb:AY137529_591602 Streptococcus equi strain CF32 immunoreactive...    35   2.7     
pir|T29095|T29095 cardiac muscle factor 1 - chicken>gb:GGU62026_...    35   2.7     Gallus gallus [bantam]
gb:SCYDL057W_1711619 S.cerevisiae chromosome IV reading frame OR...    34   3.5     
gb:BX649607_1643499 Aspergillus fumigatus BAC pilot project supe...    34   3.5     
gb:AE009900_257151 Pyrobaculum aerophilum strain IM2 section 155...    34   3.5     
pir|S67593|S67593 transport protein USO1 - yeast (Saccharomyces ...    34   3.5     Saccharomyces cerevisiae [brewer's yeast]
sp|P25386|USO1_YEAST|USO1_YEAST Intracellular protein transport protein USO...    34   3.5     Saccharomyces cerevisiae [brewer's yeast]
sp|Q8VZU2|S132_ARATH|S132_ARATH Syntaxin 132 (AtSYP132).>gb:AY063836_156578...    34   3.5     Arabidopsis thaliana [mouse-ear cress]
gb:BC070659_2555634 Xenopus laevis hypothetical protein LOC43181...    34   4.6     
gb:AF495911_1905254 Homo sapiens nesprin-2 mRNA, complete cds.         34   4.6     
gb:ANI291452_1819462 Aspergillus nidulans kinA gene for conventi...    34   4.6     
gb:CFC3VS_1438585 Canis familiaris mRNA for C3VS protein.              34   4.6     
gb:AB045982_1195788 Patinopecten yessoensis mRNA for myosin, par...    34   4.6     
sp|Q8WXH0|SNE2_HUMAN|SNE2_HUMAN Nesprin 2 (Nuclear envelope spectrin repeat...    34   4.6     Homo sapiens [man]
gb:AF115383_2055038 Mus musculus dystonin (Bpag1-n) mRNA, partia...    33   6.0     
gb:AK097432_1914862 Homo sapiens cDNA FLJ40113 fis, clone TESTI2...    33   6.0     
gb:NCB14D6_1689307 Neurospora crassa DNA linkage group II BAC co...    33   6.0     
gb:CR382123_1656012 Kluyveromyces lactis strain NRRL Y-1140 chro...    33   6.0     
gb:AB009054_1510728 Arabidopsis thaliana genomic DNA, chromosome...    33   6.0     
gb:AX763686_1474396 Sequence 3 from Patent EP1312615.>gb:BC02782...    33   6.0     
gb:U64862_1405900 Caenorhabditis elegans cosmid ZC8, complete se...    33   6.0     
gb:U64862_1405899 Caenorhabditis elegans cosmid ZC8, complete se...    33   6.0     
gb:U64862_1405898 Caenorhabditis elegans cosmid ZC8, complete se...    33   6.0     
gb:AK040912_1165785 Mus musculus adult male aorta and vein cDNA,...    33   6.0     
pir|T29999|T29999 hypothetical protein ZC8.4 - Caenorhabditis el...    33   6.0     Caenorhabditis elegans [roundworm]
pir|S41009|S41009 hypothetical protein T05G5.9 - Caenorhabditis ...    33   6.0     Caenorhabditis elegans [roundworm]
pir|T49451|T49451 kinesin-like protein Kif21a related protein [i...    33   6.0     Neurospora crassa
pir|E88564|E88564 protein T05G5.9 [imported] - Caenorhabditis el...    33   6.0     Caenorhabditis elegans [roundworm]
sp|P34562|YNP9_CAEEL|YNP9_CAEEL Hypothetical GRIP and coiled-coil domain-co...    33   6.0     Caenorhabditis elegans [roundworm]
sp|O26885|THSB_METTH|THSB_METTH Thermosome beta subunit (Thermosome subunit...    33   6.0     Methanothermobacter thermautotrophicus
sp|Q967Z0|MYSP_DERFA|MYSP_DERFA Paramyosin (Allergen Der f 11) (Antigen Df6...    33   6.0     Dermatophagoides farinae
sp|Q60824|BP1N_MOUSE|BP1N_MOUSE Bullous pemphigoid antigen 1, isoforms 6/7 ...    33   6.0     Mus musculus [mouse]
gb:BC064528_1986533 Homo sapiens hypothetical protein DKFZp434L0...    33   7.8     
gb:BC063848_1986391 Homo sapiens multimerin 1, mRNA (cDNA clone ...    33   7.8     
gb:AY125465_1936727 Homo sapiens mutant desmin mRNA, complete cds.     33   7.8     
gb:AL355877_1924121 Human DNA sequence from clone RP11-231P20 on...    33   7.8     
gb:CR380950_1649691 Candida glabrata strain CBS138 chromosome D ...    33   7.8     
gb:CR380947_1649096 Candida glabrata strain CBS138 chromosome A ...    33   7.8     
gb:AX883438_1479337 Sequence 18343 from Patent EP1074617.>gb:AK0...    33   7.8     
gb:BLA271077_1355337 Branchiostoma lanceolatum mRNA for nuclear ...    33   7.8     
gb:BLA132255_1355330 Branchiostoma lanceolatum mRNA for lamin, p...    33   7.8     
gb:AY189697_1308714 Dermatophagoides pteronyssinus HDM allergen ...    33   7.8     
gb:AB159602_1201650 Babesia equi Be158 mRNA, complete cds.             33   7.8     
gb:HSM801466_1186189 Homo sapiens mRNA; cDNA DKFZp434L0117 (from...    33   7.8     
gb:BA000033_710548 Staphylococcus aureus subsp. aureus MW2 DNA, ...    33   7.8     
gb:AY596297_633190 Haloarcula marismortui ATCC 43049 chromosome ...    33   7.8     
gb:AE017263_420571 Mesoplasma florum L1 complete genome.               33   7.8     
gb:CR767821_116834 Ehrlichia ruminantium strain Welgevonden, com...    33   7.8     
pir|T43448|T43448 hypothetical protein DKFZp434L0117.1 - human (...    33   7.8     Homo sapiens [man]
pir|A57384|A57384 multimerin, endothelial cell, precursor - human      33   7.8     Homo sapiens [man]
sp|Q13201|EMI4_HUMAN|EMI4_HUMAN Multimerin 1 precursor (Endothelial cell mu...    33   7.8     Homo sapiens [man]


>sp|Q9SEL6|VT11_ARATH Vesicle transport v-SNARE 11 (AtVTI11)
           (Vesicle transport v-SNARE protein VTI1a) (Vesicle
           soluble NSF attachment protein receptor VTI1a)
           (AtVTI1a).>gb:AB009054_1510727 Arabidopsis thaliana
           genomic DNA, chromosome 5, P1
           clone:MUL8.>gb:AY070486_1566868 Arabidopsis thaliana
           AT5g39510/MUL8_190 mRNA, complete
           cds.>gb:AY091707_1574718 Arabidopsis thaliana
           AT5g39510/MUL8_190 mRNA, complete cds.
          Length = 221

 Score =  289 bits (739), Expect = 6e-77
 Identities = 144/220 (65%), Positives = 174/220 (79%)
 Frame = -2

Query: 792 MSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEAR 613
           MS VF+GYERQYCELSA+L+KKC+SA  LDGEQKKQK+SE+K+G+E+AE LIRKMDLEAR
Sbjct: 1   MSDVFDGYERQYCELSASLSKKCSSAISLDGEQKKQKLSEIKSGLENAEVLIRKMDLEAR 60

Query: 612 SLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKMVSADQR 433
           +LPPN K+ LL KLRE+KSDLNN KTEVKRITS   N A+RDELLE+GMAD K  SADQR
Sbjct: 61  TLPPNLKSSLLVKLREFKSDLNNFKTEVKRITSGQLNAAARDELLEAGMADTKTASADQR 120

Query: 432 QRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDNIS 253
            RLMMSTERL +++DR+++ R+ M+ETEE+GVSI           L AH+TLHGVDDNI 
Sbjct: 121 ARLMMSTERLGRTTDRVKDSRRTMMETEEIGVSILQDLHGQRQSLLRAHETLHGVDDNIG 180

Query: 252 RSKKILTTMSRRMNRNKWIIGSXXXXXXXXXXXXVYFKLS 133
           +SKKILT M+RRMN+NKW IG+            +YFKL+
Sbjct: 181 KSKKILTDMTRRMNKNKWTIGAIIIALIAAIFIILYFKLT 220



>sp|Q9LVP9|VT13_ARATH Vesicle transport v-SNARE 13 (AtVTI13)
           (Vesicle transport v-SNARE protein VTI13) (Vesicle
           soluble NSF attachment protein receptor
           13).>gb:AB018121_1513910 Arabidopsis thaliana genomic
           DNA, chromosome 3, P1 clone: MXE2.
          Length = 221

 Score =  288 bits (736), Expect = 1e-76
 Identities = 144/220 (65%), Positives = 172/220 (78%)
 Frame = -2

Query: 792 MSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEAR 613
           MSQ FE YERQYCE+SANL+KKCTSA  LDGEQKKQ +SE+K+G+E+AEAL++KMDLEAR
Sbjct: 1   MSQGFERYERQYCEISANLSKKCTSAIALDGEQKKQNLSEIKSGVEEAEALVKKMDLEAR 60

Query: 612 SLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKMVSADQR 433
           +LPPN K+ LL KLREYKSDLNN KTEVKRITS N N  +RDELLE+GMAD    SADQR
Sbjct: 61  NLPPNVKSSLLVKLREYKSDLNNFKTEVKRITSGNLNATARDELLEAGMADTLTASADQR 120

Query: 432 QRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDNIS 253
            RLMMST+ L +++DRI++ R+ +LETEELGVSI           L AH+TLHGVDDN+ 
Sbjct: 121 SRLMMSTDHLGRTTDRIKDSRRTILETEELGVSILQDLHGQRQSLLRAHETLHGVDDNVG 180

Query: 252 RSKKILTTMSRRMNRNKWIIGSXXXXXXXXXXXXVYFKLS 133
           +SKKILTTM+RRMNRNKW IG+            +YFKL+
Sbjct: 181 KSKKILTTMTRRMNRNKWTIGAIITVLVLAIIFILYFKLT 220



>gb:AF114750_1769215 Arabidopsis thaliana v-SNARE AtVTI1a (VTI1a)
           mRNA, complete cds.
          Length = 221

 Score =  287 bits (735), Expect = 2e-76
 Identities = 143/220 (65%), Positives = 173/220 (78%)
 Frame = -2

Query: 792 MSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEAR 613
           MS  F+GYERQYCELSA+L+KKC+SA  LDGEQKKQK+SE+K+G+E+AE LIRKMDLEAR
Sbjct: 1   MSDAFDGYERQYCELSASLSKKCSSAISLDGEQKKQKLSEIKSGLENAEVLIRKMDLEAR 60

Query: 612 SLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKMVSADQR 433
           +LPPN K+ LL KLRE+KSDLNN KTEVKRITS   N A+RDELLE+GMAD K  SADQR
Sbjct: 61  TLPPNLKSSLLVKLREFKSDLNNFKTEVKRITSGQLNAAARDELLEAGMADTKTASADQR 120

Query: 432 QRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDNIS 253
            RLMMSTERL +++DR+++ R+ M+ETEE+GVSI           L AH+TLHGVDDNI 
Sbjct: 121 ARLMMSTERLGRTTDRVKDSRRTMMETEEIGVSILQDLHGQRQSLLRAHETLHGVDDNIG 180

Query: 252 RSKKILTTMSRRMNRNKWIIGSXXXXXXXXXXXXVYFKLS 133
           +SKKILT M+RRMN+NKW IG+            +YFKL+
Sbjct: 181 KSKKILTDMTRRMNKNKWTIGAIIIALIAAIFIILYFKLT 220



>gb:AP003273_1826953 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0510F09.>gb:AP003381_1828877 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0692C11.
          Length = 221

 Score =  284 bits (727), Expect = 1e-75
 Identities = 142/221 (64%), Positives = 178/221 (80%)
 Frame = -2

Query: 792 MSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEAR 613
           MS+VFEGYERQYCE+SA+L +KCT+A+ LDGE+KKQK+SE+++G+E+AE+LIRKMDLEAR
Sbjct: 1   MSEVFEGYERQYCEVSASLFRKCTTASALDGEKKKQKLSEIQSGVEEAESLIRKMDLEAR 60

Query: 612 SLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKMVSADQR 433
           SL P+ KA LLAKLREYKSDLNNLK+E+KRI++ NA QA+R+ELLESG+AD    S DQR
Sbjct: 61  SLQPSVKAGLLAKLREYKSDLNNLKSELKRISAPNARQATREELLESGLADTLAASTDQR 120

Query: 432 QRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDNIS 253
            RLMM+TERLN+S+D+I+E R+ +LETEELGVSI           LHAH TLHGVDDN+ 
Sbjct: 121 GRLMMTTERLNQSNDKIKESRRTILETEELGVSILQDLHQQRQSLLHAHTTLHGVDDNVG 180

Query: 252 RSKKILTTMSRRMNRNKWIIGSXXXXXXXXXXXXVYFKLSH 130
           +SKKIL  MS+RM+RNKWIIG             +YFKL++
Sbjct: 181 KSKKILAAMSKRMDRNKWIIGGIIAALVLAILLILYFKLAY 221



>gb:AE005172_891541 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC006535_1534407 Genomic sequence
           for Arabidopsis thaliana BAC T24P13 from chromosome I,
           complete sequence.
          Length = 222

 Score =  265 bits (677), Expect = 9e-70
 Identities = 138/222 (62%), Positives = 171/222 (77%), Gaps = 1/222 (0%)
 Frame = -2

Query: 792 MSQVFEGYERQYCELSANLTKKCTSATLL-DGEQKKQKISEVKNGMEDAEALIRKMDLEA 616
           MS VFEGYERQYCELS NL++KC SA++L +GE+KK KI+E+K+G+++A+ LIRKMDLEA
Sbjct: 1   MSDVFEGYERQYCELSTNLSRKCHSASVLSNGEEKKGKIAEIKSGIDEADVLIRKMDLEA 60

Query: 615 RSLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKMVSADQ 436
           RSL P+AKA+ L+KLREYKSDLN LK E KR++S +A  +SR+EL+ESGMAD   VSADQ
Sbjct: 61  RSLQPSAKAVCLSKLREYKSDLNQLKKEFKRVSSADAKPSSREELMESGMADLHAVSADQ 120

Query: 435 RQRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDNI 256
           R RL MS ERL++SSDRIRE R++MLETEE+G+SI           LHAH+ LHGVDD I
Sbjct: 121 RGRLAMSVERLDQSSDRIRESRRLMLETEEVGISIVQDLSQQRQTLLHAHNKLHGVDDAI 180

Query: 255 SRSKKILTTMSRRMNRNKWIIGSXXXXXXXXXXXXVYFKLSH 130
            +SKK+LT MSRRM RNKWII S            + +KLSH
Sbjct: 181 DKSKKVLTAMSRRMTRNKWIITSVIVALVLAIILIISYKLSH 222



>gb:AF114751_1769216 Arabidopsis thaliana v-SNARE AtVTI1b (VTI1b)
           mRNA, complete cds.
          Length = 222

 Score =  264 bits (674), Expect = 2e-69
 Identities = 137/222 (61%), Positives = 171/222 (77%), Gaps = 1/222 (0%)
 Frame = -2

Query: 792 MSQVFEGYERQYCELSANLTKKCTSATLL-DGEQKKQKISEVKNGMEDAEALIRKMDLEA 616
           MS VFEGYERQYCELS NL++KC SA++L +GE+KK KI+++K+G+++A+ LIRKMDLEA
Sbjct: 1   MSDVFEGYERQYCELSTNLSRKCHSASVLSNGEEKKGKIAQIKSGIDEADVLIRKMDLEA 60

Query: 615 RSLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKMVSADQ 436
           RSL P+AKA+ L+KLREYKSDLN LK E KR++S +A  +SR+EL+ESGMAD   VSADQ
Sbjct: 61  RSLQPSAKAVCLSKLREYKSDLNQLKKEFKRVSSADAKPSSREELMESGMADLHAVSADQ 120

Query: 435 RQRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDNI 256
           R RL MS ERL++SSDRIRE R++MLETEE+G+SI           LHAH+ LHGVDD I
Sbjct: 121 RGRLAMSVERLDQSSDRIRESRRLMLETEEVGISIVQDLSQQRQTLLHAHNKLHGVDDAI 180

Query: 255 SRSKKILTTMSRRMNRNKWIIGSXXXXXXXXXXXXVYFKLSH 130
            +SKK+LT MSRRM RNKWII S            + +KLSH
Sbjct: 181 DKSKKVLTAMSRRMTRNKWIITSVIVALVLAIILIISYKLSH 222



>sp|Q9SEL5|VT12_ARATH Vesicle transport v-SNARE 12 (AtVTI12)
           (Vesicle transport v-SNARE protein VTI1b) (Vesicle
           soluble NSF attachment protein receptor VTI1b)
           (AtVTI1b).
          Length = 223

 Score =  260 bits (665), Expect = 2e-68
 Identities = 138/223 (61%), Positives = 171/223 (76%), Gaps = 2/223 (0%)
 Frame = -2

Query: 792 MSQVFEGYERQYCELSANLTKKCTSATLL-DGEQKKQKISE-VKNGMEDAEALIRKMDLE 619
           MS VFEGYERQYCELS NL++KC SA++L +GE+KK KI+E +K+G+++A+ LIRKMDLE
Sbjct: 1   MSDVFEGYERQYCELSTNLSRKCHSASVLSNGEEKKGKIAEQIKSGIDEADVLIRKMDLE 60

Query: 618 ARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKMVSAD 439
           ARSL P+AKA+ L+KLREYKSDLN LK E KR++S +A  +SR+EL+ESGMAD   VSAD
Sbjct: 61  ARSLQPSAKAVCLSKLREYKSDLNQLKKEFKRVSSADAKPSSREELMESGMADLHAVSAD 120

Query: 438 QRQRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDN 259
           QR RL MS ERL++SSDRIRE R++MLETEE+G+SI           LHAH+ LHGVDD 
Sbjct: 121 QRGRLAMSVERLDQSSDRIRESRRLMLETEEVGISIVQDLSQQRQTLLHAHNKLHGVDDA 180

Query: 258 ISRSKKILTTMSRRMNRNKWIIGSXXXXXXXXXXXXVYFKLSH 130
           I +SKK+LT MSRRM RNKWII S            + +KLSH
Sbjct: 181 IDKSKKVLTAMSRRMTRNKWIITSVIVALVLAIILIISYKLSH 223



>gb:AP003924_1835338 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1064G04.
          Length = 221

 Score =  249 bits (636), Expect = 5e-65
 Identities = 126/221 (57%), Positives = 162/221 (73%)
 Frame = -2

Query: 792 MSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEAR 613
           M+ VFEGYERQYCE+SA+L +KCT+A+ L GE+ KQK SE+K+G++ AEALI+KMDLEAR
Sbjct: 1   MADVFEGYERQYCEISASLARKCTAASALQGEKLKQKASEIKSGIDGAEALIKKMDLEAR 60

Query: 612 SLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKMVSADQR 433
           +  P+ +A LLAKLREYKSDLNNLK  +KR+T+ NA Q SR+ELLESGMA+   VSADQ+
Sbjct: 61  NQQPSVRAGLLAKLREYKSDLNNLKGTLKRVTTGNAQQGSREELLESGMAETLGVSADQK 120

Query: 432 QRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDNIS 253
            RL+  TE+ NK++DRIR+  + MLETE+LGVS+           +HAH TL  VDDNI 
Sbjct: 121 SRLLRITEKQNKTTDRIRDSHRTMLETEDLGVSLLQDLHQQRERLIHAHGTLDNVDDNIG 180

Query: 252 RSKKILTTMSRRMNRNKWIIGSXXXXXXXXXXXXVYFKLSH 130
           +S++I+  M RRM+RNKWIIG             +YFK  H
Sbjct: 181 KSRRIMGAMVRRMDRNKWIIGFIIALLVLVILVILYFKFVH 221



>gb:AK118255_1816242 Arabidopsis thaliana At3g29100 mRNA for
           putative vesicle transport protein, complete cds, clone:
           RAFL19-55-L11.
          Length = 167

 Score =  204 bits (520), Expect = 1e-51
 Identities = 104/166 (62%), Positives = 123/166 (74%)
 Frame = -2

Query: 630 MDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKM 451
           MDLEAR+LPPN K+ LL KLREYKSDLNN KTEVKRITS N N  +RDELLE+GMAD   
Sbjct: 1   MDLEARNLPPNVKSSLLVKLREYKSDLNNFKTEVKRITSGNLNATARDELLEAGMADTLT 60

Query: 450 VSADQRQRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHG 271
            SADQR RLMMST+ L +++DRI++ R+ +LETEELGVSI           L AH+TLHG
Sbjct: 61  ASADQRSRLMMSTDHLGRTTDRIKDSRRTILETEELGVSILQDLHGQRQSLLRAHETLHG 120

Query: 270 VDDNISRSKKILTTMSRRMNRNKWIIGSXXXXXXXXXXXXVYFKLS 133
           VDDN+ +SKKILTTM+RRMNRNKW IG+            +YFKL+
Sbjct: 121 VDDNVGKSKKILTTMTRRMNRNKWTIGAIITVLVLAIIFILYFKLT 166



>gb:AB012243_1511741 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MIJ24.
          Length = 212

 Score =  156 bits (394), Expect = 6e-37
 Identities = 84/190 (44%), Positives = 123/190 (64%), Gaps = 1/190 (0%)
 Frame = -2

Query: 792 MSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEAR 613
           MS VF  Y++QY ELS NL+KKC+ A  L G +KK+K+SE+   +E+AE LI KMD  A 
Sbjct: 1   MSNVFHEYDQQYSELSINLSKKCSLAFSLKGGEKKEKLSEITYDLENAEKLISKMDHAAS 60

Query: 612 SLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLESGMADAK-MVSADQ 436
           +LPPN K++LL KL+E KS L  L+ E+KR TS+N    +R+E+LE+  A  K M  ADQ
Sbjct: 61  NLPPNIKSILLEKLKESKSSLKRLRNEIKRNTSENLKVTTREEVLEAEKAVCKDMDLADQ 120

Query: 435 RQRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDNI 256
           R RLM STE L ++ + I++ ++ +LETE +G+SI            ++   LH +DD +
Sbjct: 121 RSRLMKSTEGLVRTREMIKDSQRKLLETENIGISILENLQRQKESLQNSQAMLHEIDDTV 180

Query: 255 SRSKKILTTM 226
             S+ I+ ++
Sbjct: 181 KESRSIVRSI 190



>sp|O89116|VT1A_MOUSE Vesicle transport through interaction with
           t-SNAREs homolog 1A (Vesicle transport v-SNARE protein
           Vti1-like 2) (Vti1-rp2).>gb:AK004751_1152564 Mus
           musculus adult male lung cDNA, RIKEN full-length
           enriched library, clone:1200014A22 product:vesicle
           transport through interaction with t-SNAREs 1 homolog,
           full insert sequence.>gb:AK028646_1161089 Mus musculus
           10 days neonate skin cDNA, RIKEN full-length enriched
           library, clone:4732424P06 product:vesicle transport
           through interaction with t-SNAREs 1 homolog, full insert
           sequence.>gb:AF035209_2051754 Mus musculus putative
           v-SNARE Vti1a mRNA, complete cds.>gb:AF035823_2051779
           Mus musculus 29-kDa Golgi SNARE (Vti1-rp2) mRNA,
           complete cds.>gb:BC019386_2092878 Mus musculus vesicle
           transport through interaction with t-SNAREs homolog 1A
           (yeast), mRNA (cDNA clone MGC:30354 IMAGE:5012235),
           complete cds.
          Length = 217

 Score =  127 bits (318), Expect = 4e-28
 Identities = 68/200 (34%), Positives = 112/200 (56%)
 Frame = -2

Query: 792 MSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEAR 613
           MS  FEGYE+ +  L+A +T K      L  ++KKQ ++ V+  +E+A  L+ +MDLE R
Sbjct: 1   MSSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEARELLEQMDLEVR 60

Query: 612 SLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKMVSADQR 433
            +PP ++ M   ++R YK ++  L+T+ KR     +  A  DE+    + DA   S +QR
Sbjct: 61  EIPPQSRGMYSNRMRSYKQEMGKLETDFKR-----SRIAYSDEVRNELLGDAGNSSENQR 115

Query: 432 QRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDNIS 253
             L+ +TERL +SS R+  G ++ +ETE++G  +             A D L   D N+ 
Sbjct: 116 AHLLDNTERLERSSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARDRLRDADANLG 175

Query: 252 RSKKILTTMSRRMNRNKWII 193
           +S +ILT M RR+ +N+ ++
Sbjct: 176 KSSRILTGMLRRIIQNRILL 195



>gb:AF262221_2060849 Rattus norvegicus SNARE Vti1a protein mRNA,
           complete cds.
          Length = 217

 Score =  125 bits (313), Expect = 2e-27
 Identities = 67/200 (33%), Positives = 113/200 (56%)
 Frame = -2

Query: 792 MSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEAR 613
           MS  FEGYE+ +  L+A +T K +    L  ++KKQ ++ V+  +E+A  L+ +MDLE R
Sbjct: 1   MSADFEGYEQDFAVLTAEITSKISRVPRLPPDEKKQMVANVEKQLEEARELLEQMDLEVR 60

Query: 612 SLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKMVSADQR 433
            +PP ++ M   ++R YK ++  L+T+ KR     +  A  DE+    + DA   S +QR
Sbjct: 61  EIPPQSRGMYSNRMRSYKQEMGKLETDFKR-----SRIAYSDEVRNELLGDAGNSSENQR 115

Query: 432 QRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDNIS 253
             L+ +TERL +SS R+  G ++ +ETE++G  +             A + L   D N+ 
Sbjct: 116 AHLLDNTERLERSSRRLEAGYQIAVETEQIGQEMLENLSHDRERIQRARERLRETDANLG 175

Query: 252 RSKKILTTMSRRMNRNKWII 193
           +S +ILT M RR+ +N+ ++
Sbjct: 176 KSSRILTGMLRRIIQNRILL 195



>gb:BC089321_2110773 Mus musculus vesicle transport through
           interaction with t-SNAREs homolog 1A (yeast), mRNA (cDNA
           clone MGC:102006 IMAGE:6839437), complete cds.
          Length = 224

 Score =  121 bits (303), Expect = 2e-26
 Identities = 63/202 (31%), Positives = 113/202 (55%), Gaps = 2/202 (0%)
 Frame = -2

Query: 792 MSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEAR 613
           MS  FEGYE+ +  L+A +T K      L  ++KKQ ++ V+  +E+A  L+ +MDLE R
Sbjct: 1   MSSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEARELLEQMDLEVR 60

Query: 612 SLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKMV--SAD 439
            +PP ++ M   ++R YK ++  L+T+ KR     +++   + L ++G +    +    +
Sbjct: 61  EIPPQSRGMYSNRMRSYKQEMGKLETDFKRSRIAYSDEVRNELLGDAGNSSENQLIKLRE 120

Query: 438 QRQRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDN 259
           +R  L+ +TERL +SS R+  G ++ +ETE++G  +             A D L   D N
Sbjct: 121 ERAHLLDNTERLERSSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARDRLRDADAN 180

Query: 258 ISRSKKILTTMSRRMNRNKWII 193
           + +S +ILT M RR+ +N+ ++
Sbjct: 181 LGKSSRILTGMLRRIIQNRILL 202



>sp|Q96AJ9|VT1A_HUMAN Vesicle transport through interaction with
           t-SNAREs homolog 1A (Vesicle transport v-SNARE protein
           Vti1-like 2) (Vti1-rp2).>gb:AL139120_1920296 Human DNA
           sequence from clone RP11-25C19 on chromosome 10 Contains
           the 3' end of the VTI1A gene for vesicle transport
           through interaction with t-SNAREs homolog 1A (yeast), a
           novel gene and the 5' end of a novel gene, complete
           sequence.>gb:BC017052_1975870 Homo sapiens vesicle
           transport through interaction with t-SNAREs homolog 1A
           (yeast), mRNA (cDNA clone MGC:9292 IMAGE:3885564),
           complete cds.
          Length = 203

 Score =  120 bits (300), Expect = 5e-26
 Identities = 65/192 (33%), Positives = 106/192 (55%)
 Frame = -2

Query: 792 MSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEAR 613
           MS  FEGYE+ +  L+A +T K      L  ++KKQ ++ V+  +E+A+ L+ +MDLE R
Sbjct: 1   MSSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKELLEQMDLEVR 60

Query: 612 SLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKMVSADQR 433
            +PP ++ M   ++R YK ++  L+T+ KR     +  A  DE+    + D    S +QR
Sbjct: 61  EIPPQSRGMYSNRMRSYKQEMGKLETDFKR-----SRIAYSDEVRNELLGDDGNSSENQR 115

Query: 432 QRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDNIS 253
             L+ +TERL +SS R+  G ++ +ETE++G  +             A + L   D N+ 
Sbjct: 116 AHLLDNTERLERSSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARERLRETDANLG 175

Query: 252 RSKKILTTMSRR 217
           +S +ILT M RR
Sbjct: 176 KSSRILTGMLRR 187



>sp|Q9JI51|VT1A_RAT Vesicle transport through interaction with
           t-SNAREs homolog 1A (Vesicle transport v-SNARE protein
           Vti1-like 2) (Vti1-rp2).>gb:AF262222_2060850 Rattus
           norvegicus SNARE Vti1a-beta protein mRNA, complete cds.
          Length = 224

 Score =  119 bits (298), Expect = 8e-26
 Identities = 62/202 (30%), Positives = 114/202 (56%), Gaps = 2/202 (0%)
 Frame = -2

Query: 792 MSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEAR 613
           MS  FEGYE+ +  L+A +T K +    L  ++KKQ ++ V+  +E+A  L+ +MDLE R
Sbjct: 1   MSADFEGYEQDFAVLTAEITSKISRVPRLPPDEKKQMVANVEKQLEEARELLEQMDLEVR 60

Query: 612 SLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKMV--SAD 439
            +PP ++ M   ++R YK ++  L+T+ KR     +++   + L ++G +    +    +
Sbjct: 61  EIPPQSRGMYSNRMRSYKQEMGKLETDFKRSRIAYSDEVRNELLGDAGNSSENQLIKLRE 120

Query: 438 QRQRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDN 259
           +R  L+ +TERL +SS R+  G ++ +ETE++G  +             A + L   D N
Sbjct: 121 ERAHLLDNTERLERSSRRLEAGYQIAVETEQIGQEMLENLSHDRERIQRARERLRETDAN 180

Query: 258 ISRSKKILTTMSRRMNRNKWII 193
           + +S +ILT M RR+ +N+ ++
Sbjct: 181 LGKSSRILTGMLRRIIQNRILL 202



>gb:BC074431_2557935 Xenopus laevis similar to vesicle transport
           through interaction with t-SNAREs homolog 1A (yeast),
           mRNA (cDNA clone MGC:84675 IMAGE:6945432), complete cds.
          Length = 194

 Score =  114 bits (286), Expect = 2e-24
 Identities = 66/195 (33%), Positives = 111/195 (56%), Gaps = 3/195 (1%)
 Frame = -2

Query: 792 MSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEAR 613
           MS  FEGYE+ Y  L+A +T +      L G++KKQ I  V+  +E+A  L+ +MDLE R
Sbjct: 1   MSAEFEGYEQDYAVLTAEITGRVGKIPRLLGDEKKQMILNVEKQLEEARELLEQMDLEVR 60

Query: 612 SLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELL--ESGMADAKMVS-A 442
            +P  ++AM   ++R YK +L  L  + KR     +++  R+ELL  +   ++++++   
Sbjct: 61  EIPVQSRAMYSNRMRSYKQELGKLDADFKRSRIAYSDEV-RNELLGDDGNSSESQLIKLR 119

Query: 441 DQRQRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDD 262
           ++R  L+ +TERL +SS R+  G +V +ETE++G +I             A + L   D 
Sbjct: 120 EERAHLLDNTERLERSSRRLEAGYQVAVETEQIGQNILENLSQDREKIQRARERLRETDA 179

Query: 261 NISRSKKILTTMSRR 217
           N+ +S ++LT M RR
Sbjct: 180 NLGKSSRVLTGMLRR 194



>gb:BT004676_1637710 Arabidopsis thaliana At1g26670 gene, complete
           cds.>gb:AK118409_1816387 Arabidopsis thaliana At1g26670
           mRNA for putative v-SNARE AtVTI1b (VTI1b), complete cds,
           clone: RAFL19-66-F11.
          Length = 97

 Score =  104 bits (259), Expect = 3e-21
 Identities = 54/97 (55%), Positives = 65/97 (67%)
 Frame = -2

Query: 420 MSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDNISRSKK 241
           MS ERL++SSDRIRE R++MLETEE+G+SI           LHAH+ LHGVDD I +SKK
Sbjct: 1   MSVERLDQSSDRIRESRRLMLETEEVGISIVQDLSQQRQTLLHAHNKLHGVDDAIDKSKK 60

Query: 240 ILTTMSRRMNRNKWIIGSXXXXXXXXXXXXVYFKLSH 130
           +LT MSRRM RNKWII S            + +KLSH
Sbjct: 61  VLTAMSRRMTRNKWIITSVIVALVLAIILIISYKLSH 97



>gb:BC054311_2550957 Xenopus laevis similar to vesicle transport
           through interaction with t-SNAREs homolog 1A (yeast),
           mRNA (cDNA clone IMAGE:6880746), partial cds.
          Length = 233

 Score =  102 bits (253), Expect = 1e-20
 Identities = 63/211 (29%), Positives = 114/211 (54%), Gaps = 3/211 (1%)
 Frame = -2

Query: 816 ISVNLANRMSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALI 637
           +S  LA  + +V  G     C     +T +      L G++KKQ I  V+  +E+A  L+
Sbjct: 3   LSTVLAKHVCRV-RGLRAGLCGAHREITGRVGKIPRLLGDEKKQMILNVEKQLEEARELL 61

Query: 636 RKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELL--ESGMA 463
            +MDLE R +P  ++AM   ++R YK +L  L  + KR     +++  R+ELL  +   +
Sbjct: 62  EQMDLEVREIPVQSRAMYSNRMRSYKQELGKLDADFKRSRIAYSDEV-RNELLGDDGNSS 120

Query: 462 DAKMVS-ADQRQRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAH 286
           +++++   ++R  L+ +TERL +SS R+  G +V +ETE++G +I             A 
Sbjct: 121 ESQLIKLREERAHLLDNTERLERSSRRLEAGYQVAVETEQIGQNILENLSQDREKIQRAR 180

Query: 285 DTLHGVDDNISRSKKILTTMSRRMNRNKWII 193
           + L   D N+ +S ++LT M RR+ +N+ ++
Sbjct: 181 ERLRETDANLGKSSRVLTGMLRRIIQNRVLL 211



>gb:CR382128_1660433 Yarrowia lipolytica chromosome B of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 219

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 50/196 (25%), Positives = 104/196 (53%)
 Frame = -2

Query: 789 SQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEARS 610
           S++++ YE  +    + + +K  S + L+ + +   +  V+  + +A  ++ ++ +E ++
Sbjct: 4   SELYKSYETDFLLAQSEIEQKLESISTLERDARTSAVKAVERTIGEAYEILDQLSVEIQN 63

Query: 609 LPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKMVSADQRQ 430
           +P +A+A L A LR+Y+  + + K ++  +    A      +   +G  D   ++ DQRQ
Sbjct: 64  IPSSARAPLSANLRQYRQSIQSAKKQLANVEQAGARNELFGDRSAAGDGD---IALDQRQ 120

Query: 429 RLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDNISR 250
           +L+   E L++SS RIR+ ++V  ETE +G +I            ++ +TL   D  + +
Sbjct: 121 QLLSGQESLDRSSQRIRDSQRVANETESIGANILTDLRGQREQIQNSRNTLLEADGYVDK 180

Query: 249 SKKILTTMSRRMNRNK 202
           S + L +M+RRM  NK
Sbjct: 181 SIRTLRSMTRRMAMNK 196



>pir|T27217|T27217 hypothetical protein Y57G11C.4 - Caenorhabditis
           elegans
          Length = 458

 Score = 90.1 bits (222), Expect = 5e-17
 Identities = 55/214 (25%), Positives = 109/214 (50%), Gaps = 2/214 (0%)
 Frame = -2

Query: 828 HFKVISVNLANRMSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDA 649
           HFK +S N +  + Q+  G+E+QY   +A +T K      L    +   + E++  +E+ 
Sbjct: 231 HFKWMS-NQSATVEQL-SGFEKQYSLQTAEITSKIGRVHTLPSSDRAGAVQEIRKSLEEV 288

Query: 648 EALIRKMDLEARSLPPNA--KAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLE 475
             L+ +M+L  R L  N   +     ++R Y+SD   L TE+++       +A RDELL 
Sbjct: 289 NDLLDQMELVVRELESNTTERTKYELRVRSYQSDKKQLDTELEKAIKRVREEADRDELLA 348

Query: 474 SGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXL 295
               D ++    Q  +L+ +T+RL +S+ ++++  ++ +ETE++G  +            
Sbjct: 349 F---DDQLDEHRQEDQLIANTQRLERSTRKVQDAHRIAVETEQIGAEMLSNLASQRETIG 405

Query: 294 HAHDTLHGVDDNISRSKKILTTMSRRMNRNKWII 193
            + D L   + ++ R+ K L++M RR  +N+ ++
Sbjct: 406 RSRDRLRQSNADLGRANKTLSSMIRRAIQNRLLL 439



>gb:AE014296_1134048 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003469_1211347 Drosophila melanogaster
           chromosome 3L, section 3 of 83 of the complete
           sequence.>gb:AY058584_1291738 Drosophila melanogaster
           LD27967 full length cDNA.
          Length = 230

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 54/199 (27%), Positives = 100/199 (50%), Gaps = 2/199 (1%)
 Frame = -2

Query: 783 VFEGYERQYCELSANLTKKCTSATLLDGEQKKQKI-SEVKNGMEDAEALIRKMDLEARSL 607
           + E YE+QY  L A +T         +   ++  + S++ + + +A+ L+ +M LE R L
Sbjct: 3   LLEQYEQQYATLIAEITAHIGRLQQQNNNSERHDLCSKIDSSLPEAQELLEQMGLEVREL 62

Query: 606 PPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLESGMA-DAKMVSADQRQ 430
            P  ++    KL+  +++L  L+ E +       +QA+    L+ G + +   +S DQRQ
Sbjct: 63  NPGLRSSFNGKLQVAQAELKRLQAEYRLTKDKQRSQANTFTTLDLGDSYEDVSISTDQRQ 122

Query: 429 RLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDNISR 250
           RL+ ++ER+ ++ +R+ EG +V LETE+LG  +             A   L   +  + R
Sbjct: 123 RLLDNSERIERTGNRLTEGYRVALETEQLGAQVLNDLHHQRETLQGARARLRETNAELGR 182

Query: 249 SKKILTTMSRRMNRNKWII 193
           + + L TM  R  R K ++
Sbjct: 183 ASRTLNTMMLRALREKVVL 201



>gb:CEY57G11C_1370708 Caenorhabditis elegans YAC Y57G11C, complete
           sequence.
          Length = 224

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 49/196 (25%), Positives = 99/196 (50%), Gaps = 2/196 (1%)
 Frame = -2

Query: 774 GYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEARSLPPNA 595
           G+E+QY   +A +T K      L    +   + E++  +E+   L+ +M+L  R L  N 
Sbjct: 13  GFEKQYSLQTAEITSKIGRVHTLPSSDRAGAVQEIRKSLEEVNDLLDQMELVVRELESNT 72

Query: 594 --KAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKMVSADQRQRLM 421
             +     ++R Y+SD   L TE+++       +A RDELL     D ++    Q  +L+
Sbjct: 73  TERTKYELRVRSYQSDKKQLDTELEKAIKRVREEADRDELLAF---DDQLDEHRQEDQLI 129

Query: 420 MSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDNISRSKK 241
            +T+RL +S+ ++++  ++ +ETE++G  +             + D L   + ++ R+ K
Sbjct: 130 ANTQRLERSTRKVQDAHRIAVETEQIGAEMLSNLASQRETIGRSRDRLRQSNADLGRANK 189

Query: 240 ILTTMSRRMNRNKWII 193
            L++M RR  +N+ ++
Sbjct: 190 TLSSMIRRAIQNRLLL 205



>gb:CR382136_1669125 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 220

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 52/203 (25%), Positives = 102/203 (50%), Gaps = 4/203 (1%)
 Frame = -2

Query: 792 MSQVFEGYERQYCELSANLTKKCTSATLLDG-EQKKQKISEVKNGMEDAEALIRKMDLEA 616
           MS++F  YE            K    +  DG +++KQ +  ++   ++   ++ +M +E 
Sbjct: 1   MSELFATYESDLQLALQEAKSKLAQISSADGKDERKQFLRAIETATDECLEVLDQMSIEV 60

Query: 615 RSLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKM---VS 445
           ++LP N ++    K+R+YKS + + K  +K++  D      + EL  +   D      + 
Sbjct: 61  QNLPSNQRSTYNTKIRQYKSQVEDSKDRLKKLLDDQ----DKYELFGNRYTDDDSHDDIH 116

Query: 444 ADQRQRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVD 265
             QR++L+ +   L ++S+R+R+ +++ LETE +G +I             + +TL   D
Sbjct: 117 DSQRKQLLNNNSSLERTSERLRDSQRIALETENIGGNILNDLRSQREQITGSRNTLMTAD 176

Query: 264 DNISRSKKILTTMSRRMNRNKWI 196
             + +S K L +MSRR+  NK+I
Sbjct: 177 GYVDKSIKTLKSMSRRLTANKFI 199



>sp|P78768|VTI1_SCHPO Vesicle transport v-SNARE protein VTI1
           homolog.>pir|T40349|T40349 vesicle transport v-snare
           protein - fission yeast  (Schizosaccharomyces
           pombe)>gb:SPBC3B9_1720048 S.pombe chromosome II cosmid
           c3B9.
          Length = 214

 Score = 79.0 bits (193), Expect = 1e-13
 Identities = 53/196 (27%), Positives = 96/196 (48%), Gaps = 3/196 (1%)
 Frame = -2

Query: 777 EGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEARSLPPN 598
           E YE++Y  L A++ +K      L    +   I   +  + + + +I +M++E   +P +
Sbjct: 2   ETYEQEYRLLRADIEEKLND---LSKSGENSVIQSCQRLLNEIDEVIGQMEIEITGIPTS 58

Query: 597 AKAMLLAKLREYKSDLNNLKTEVKRITSDNANQA---SRDELLESGMADAKMVSADQRQR 427
            + ++  ++R Y+S L   +  +K     +  +A   +RDE   SG   A     DQR R
Sbjct: 59  ERGLVNGRIRSYRSTLEEWRRHLKEEIGKSDRKALFGNRDET--SGDYIASDQDYDQRTR 116

Query: 426 LMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDNISRS 247
           L+  T RL +SS R+ E +++  ETE +G SI            H+ + L     ++ RS
Sbjct: 117 LLQGTNRLEQSSQRLLESQRIANETEGIGASILRDLHGQRNQLEHSLEMLGDTSGHLDRS 176

Query: 246 KKILTTMSRRMNRNKW 199
            + L TM+RR+  N++
Sbjct: 177 LRTLKTMARRLAMNRF 192



>pir|T42225|T42225 hypothetical protein - fission yeast
           (Schizosaccharomyces pombe)>gb:D89116_1675234
           Schizosaccharomyces pombe mRNA, partial cds, clone: SY
           0416.
          Length = 214

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 53/196 (27%), Positives = 95/196 (48%), Gaps = 3/196 (1%)
 Frame = -2

Query: 777 EGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEARSLPPN 598
           E YE++Y  L A++ +K      L    +   I   +  + + + +I +M++E   +P +
Sbjct: 2   ETYEQEYRLLRADIEEKLND---LSKSGENSVIQSCQRLLNEIDEVIGQMEIEITGIPTS 58

Query: 597 AKAMLLAKLREYKSDLNNLKTEVKRITSDNANQA---SRDELLESGMADAKMVSADQRQR 427
            + ++  ++R Y+S L   +  +K     +  +A   +RDE   SG   A     DQR R
Sbjct: 59  ERGLVNGRIRSYRSTLEEWRRHLKEEIGKSDRKALFGNRDET--SGDYIASDQDYDQRTR 116

Query: 426 LMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDNISRS 247
           L+  T RL +SS R+ E  ++  ETE +G SI            H+ + L     ++ RS
Sbjct: 117 LLQGTNRLEQSSQRLLESHRIANETEGIGASILRDLHGQRNQLEHSLEMLGDTSGHLDRS 176

Query: 246 KKILTTMSRRMNRNKW 199
            + L TM+RR+  N++
Sbjct: 177 LRTLKTMARRLAMNRF 192



>gb:AY222929_1176395 Schistosoma japonicum clone ZZD1588 mRNA
           sequence.
          Length = 218

 Score = 77.0 bits (188), Expect = 5e-13
 Identities = 46/181 (25%), Positives = 93/181 (51%), Gaps = 5/181 (2%)
 Frame = -2

Query: 720 SATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNL 541
           S  ++ GE+ K+ + +V    ++   LI +M LE + +  + +     +L  Y+ +L  L
Sbjct: 3   SCIVISGERTKE-VRDVSALFDETRDLIDQMSLEVQEMRHDIRPKFQNRLECYRKELEKL 61

Query: 540 KTEVKRIT-----SDNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIRE 376
            TE KR        +N N    D+  E  + +  +   D R +L+ +TER+++++ ++ +
Sbjct: 62  TTEFKRPRYAARRPENRNLGISDD--EDTLHEEVLFDTDMRAQLLSNTERISRTTTKLED 119

Query: 375 GRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDNISRSKKILTTMSRRMNRNKWI 196
           G ++ LETEE+G  I             + D L   D ++ +S ++L+ M+RR+ +NK +
Sbjct: 120 GVRIALETEEVGGHILQDLSEQREKLQRSRDRLRQADSDLKKSSRVLSVMTRRILQNKLL 179

Query: 195 I 193
           +
Sbjct: 180 L 180



>sp|Q04338|VTI1_YEAST Vesicle transport v-SNARE protein
           VTI1.>pir|S50926|S50926 VTI1 protein - yeast
           (Saccharomyces cerevisiae)>gb:SC9646_1706079
           S.cerevisiae chromosome XIII cosmid
           9646.>gb:AF006074_1760850 Saccharomyces cerevisiae
           v-SNARE Vti1p (VTI1) mRNA, complete cds.
          Length = 217

 Score = 76.3 bits (186), Expect = 8e-13
 Identities = 55/201 (27%), Positives = 92/201 (45%), Gaps = 2/201 (0%)
 Frame = -2

Query: 792 MSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEAR 613
           MS +   YE  +             A      Q+   +  V+   ++   L+ +MD+E  
Sbjct: 1   MSSLLISYESDFKTTLEQAKASLAEAPSQPLSQRNTTLKHVEQQQDELFDLLDQMDVEVN 60

Query: 612 SLPPNA--KAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKMVSAD 439
           +   +A  +A   AKLRE+K     +++++KR      +   RD L   G  +A  +  D
Sbjct: 61  NSIGDASERATYKAKLREWKK---TIQSDIKRPLQSLVDSGDRDRLF--GDLNASNIDDD 115

Query: 438 QRQRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDN 259
           QRQ+L+ +   L KS DR+++  ++  ETE +G  I            +A  TL   D  
Sbjct: 116 QRQQLLSNHAILQKSGDRLKDASRIANETEGIGSQIMMDLRSQRETLENARQTLFQADSY 175

Query: 258 ISRSKKILTTMSRRMNRNKWI 196
           + +S K L TM+RR+  NK+I
Sbjct: 176 VDKSIKTLKTMTRRLVANKFI 196



>gb:BC055131_2551219 Danio rerio vesicle transport through
           interaction with t-SNAREs homolog 1B (yeast), mRNA (cDNA
           clone MGC:63525 IMAGE:3815110), complete cds.
          Length = 225

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 50/201 (24%), Positives = 88/201 (43%), Gaps = 2/201 (0%)
 Frame = -2

Query: 789 SQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEARS 610
           S+ FE     Y  L   +           GE++K+ + +    + +AE +++ M+ E   
Sbjct: 3   SEEFEKLHEMYKSLYDEVKLMPERVQKSQGEERKRIVRDFDERVSEAEEVLQGMEQELFG 62

Query: 609 LPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLE--SGMADAKMVSADQ 436
            P + +  +  K+R Y+ DL  L+ +++   +        D  L   +   D       Q
Sbjct: 63  APSSFRTPMSTKIRLYRRDLAKLQRDIRLSATPGLTGQLGDSRLGVYASQNDQSTHLQSQ 122

Query: 435 RQRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDNI 256
           R  L+  TE LN +S  I   +++  ET+++G  I               D L    +N+
Sbjct: 123 RALLIQGTESLNNASKSIERSQRIAAETDQIGTDIIEELGEQREQLDRTRDRLVNTGENL 182

Query: 255 SRSKKILTTMSRRMNRNKWII 193
           SRS+KIL  MSRR+  NK ++
Sbjct: 183 SRSRKILRAMSRRIVTNKLLL 203



>gb:CR382122_1655249 Kluyveromyces lactis strain NRRL Y-1140
           chromosome B of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 221

 Score = 73.9 bits (180), Expect = 4e-12
 Identities = 55/209 (26%), Positives = 102/209 (48%), Gaps = 10/209 (4%)
 Frame = -2

Query: 792 MSQVFEGYERQYCELSANLTK------KCTSATLLDGEQKKQKISEVKNGMEDAEALIRK 631
           MS + + YE + C+++ N  K      K  +  +L G  K   + +++   +++  L+ +
Sbjct: 1   MSSLLQNYESE-CQVAINQAKVLLANAKNDAGAVLKGG-KSDILLQIQQYHDESLELVDQ 58

Query: 630 MDLE----ARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLESGMA 463
           M++E      SL    +A   AK+R+YK    N   E+K        ++ R++LLE    
Sbjct: 59  MEIELNNTGNSLDSKTRASYKAKIRDYKRQCQN---EIKDPLKQLVQESDRNKLLEGRHF 115

Query: 462 DAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHD 283
           D    + +QRQ+L+ +   L +S D++++  ++  ETE +G  I            +A  
Sbjct: 116 D----NDEQRQQLLSNHALLQRSGDKLQDATRLASETENVGAQIMMDLRSQRETLENARQ 171

Query: 282 TLHGVDDNISRSKKILTTMSRRMNRNKWI 196
           TL   D  + +S + L TM+RR+  NK+I
Sbjct: 172 TLFHADSYVDKSIRTLKTMTRRLIANKFI 200



>gb:AK035895_1164277 Mus musculus 16 days neonate cerebellum cDNA,
           RIKEN full-length enriched library, clone:9630015E17
           product:vesicle transport through interaction with
           t-SNAREs 1 homolog, full insert sequence.
          Length = 127

 Score = 73.9 bits (180), Expect = 4e-12
 Identities = 32/91 (35%), Positives = 56/91 (61%)
 Frame = -2

Query: 792 MSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEAR 613
           MS  FEGYE+ +  L+A +T K      L  ++KKQ ++ V+  +E+A  L+ +MDLE R
Sbjct: 1   MSSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEARELLEQMDLEVR 60

Query: 612 SLPPNAKAMLLAKLREYKSDLNNLKTEVKRI 520
            +PP ++ M   ++R YK ++  L+T+  ++
Sbjct: 61  EIPPQSRGMYSNRMRSYKQEMGKLETDFGKL 91



>gb:AK014541_1158022 Mus musculus 0 day neonate skin cDNA, RIKEN
           full-length enriched library, clone:4631433P05
           product:vesicle transport through interaction with
           t-SNAREs 1 homolog, full insert sequence.
          Length = 95

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 32/87 (36%), Positives = 54/87 (62%)
 Frame = -2

Query: 792 MSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEAR 613
           MS  FEGYE+ +  L+A +T K      L  ++KKQ ++ V+  +E+A  L+ +MDLE R
Sbjct: 1   MSSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEARELLEQMDLEVR 60

Query: 612 SLPPNAKAMLLAKLREYKSDLNNLKTE 532
            +PP ++ M   ++R YK ++  L+T+
Sbjct: 61  EIPPQSRGMYSNRMRSYKQEMGKLETD 87



>gb:BT019346_2151303 Synthetic construct Homo sapiens vesicle
           transport through interaction with t-SNAREs homolog 1B
           (yeast) mRNA, partial cds.
          Length = 233

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 50/190 (26%), Positives = 86/190 (45%), Gaps = 3/190 (1%)
 Frame = -2

Query: 699 EQKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRI 520
           E+KK+ I +     ++A   + +M+ E R  P + +  +++KLR Y+ DL  L  EV R 
Sbjct: 39  EEKKKLIRDFDEKQQEANETLAEMEEELRYAPLSFRNPMMSKLRNYRKDLAKLHREV-RS 97

Query: 519 TSDNANQASRDELLESGMA---DAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETE 349
           T   A    R ++     A   +       QR  L+  TE LN+++  I    ++  ET+
Sbjct: 98  TPLTATPGGRGDMKYGIYAVENEHMNRLQSQRAMLLQGTESLNRATQSIERSHRIATETD 157

Query: 348 ELGVSIXXXXXXXXXXXLHAHDTLHGVDDNISRSKKILTTMSRRMNRNKWIIGSXXXXXX 169
           ++G  I                 L    +N+S+S+KIL +MSR++  NK ++        
Sbjct: 158 QIGSEIIEELGEQRDQLERTKSRLVNTSENLSKSRKILRSMSRKVTTNKLLLSIIILLEL 217

Query: 168 XXXXXXVYFK 139
                 VY+K
Sbjct: 218 AILGGLVYYK 227



>gb:AF060902_1879843 Homo sapiens vesicle soluble NSF attachment
           protein receptor VTI2 mRNA, complete
           cds.>gb:BC003142_1968722 Homo sapiens vesicle transport
           through interaction with t-SNAREs homolog 1B (yeast),
           mRNA (cDNA clone MGC:3767 IMAGE:2958320), complete
           cds.>gb:BT019348_1991031 Homo sapiens vesicle transport
           through interaction with t-SNAREs homolog 1B (yeast)
           mRNA, complete cds.>gb:CR456757_1992964 Homo sapiens
           full open reading frame cDNA clone RZPDo834C034D for
           gene VTI1B, vesicle transport through interaction with
           t-SNAREs homolog 1B (yeast); complete cds, incl.
           stopcodon.>gb:CR542095_1994321 Homo sapiens full open
           reading frame cDNA clone RZPDo834C0737D for gene VTI1B,
           vesicle transport through interaction with t-SNAREs
           homolog 1B (yeast); complete cds, without stopcodon.
          Length = 232

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 50/190 (26%), Positives = 86/190 (45%), Gaps = 3/190 (1%)
 Frame = -2

Query: 699 EQKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRI 520
           E+KK+ I +     ++A   + +M+ E R  P + +  +++KLR Y+ DL  L  EV R 
Sbjct: 39  EEKKKLIRDFDEKQQEANETLAEMEEELRYAPLSFRNPMMSKLRNYRKDLAKLHREV-RS 97

Query: 519 TSDNANQASRDELLESGMA---DAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETE 349
           T   A    R ++     A   +       QR  L+  TE LN+++  I    ++  ET+
Sbjct: 98  TPLTATPGGRGDMKYGIYAVENEHMNRLQSQRAMLLQGTESLNRATQSIERSHRIATETD 157

Query: 348 ELGVSIXXXXXXXXXXXLHAHDTLHGVDDNISRSKKILTTMSRRMNRNKWIIGSXXXXXX 169
           ++G  I                 L    +N+S+S+KIL +MSR++  NK ++        
Sbjct: 158 QIGSEIIEELGEQRDQLERTKSRLVNTSENLSKSRKILRSMSRKVTTNKLLLSIIILLEL 217

Query: 168 XXXXXXVYFK 139
                 VY+K
Sbjct: 218 AILGGLVYYK 227



>sp|O88384|VT1B_MOUSE Vesicle transport through interaction with
           t-SNAREs homolog 1B (Vesicle transport v-SNARE protein
           Vti1-like 1) (Vti1-rp1).>gb:AF035208_2051753 Mus
           musculus putative v-SNARE Vti1b mRNA, complete cds.
          Length = 232

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 47/189 (24%), Positives = 87/189 (46%), Gaps = 2/189 (1%)
 Frame = -2

Query: 699 EQKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRI 520
           E+KK+ + +     ++A   + +M+ E R  P   +  +++KLR Y+ DL  L  EV+  
Sbjct: 39  EEKKKLVRDFDENQQEANETLAEMEEELRYAPLTFRNPMMSKLRNYRKDLAKLHREVRST 98

Query: 519 TSDNANQASRDELLESGMADAKMVSADQRQR--LMMSTERLNKSSDRIREGRKVMLETEE 346
               A     D    +   + + ++  Q QR  L+  TE LN+++  I    ++  ET++
Sbjct: 99  PLTAAPGGRGDLKYGTYTLENEHLNRLQSQRALLLQGTESLNRATQSIERSHRIATETDQ 158

Query: 345 LGVSIXXXXXXXXXXXLHAHDTLHGVDDNISRSKKILTTMSRRMNRNKWIIGSXXXXXXX 166
           +G  I                 L   ++N+S+S+KIL +MSR++  NK ++         
Sbjct: 159 IGTEIIEELGEQRDQLERTKSRLVNTNENLSKSRKILRSMSRKVITNKLLLSVIILLELA 218

Query: 165 XXXXXVYFK 139
                VY+K
Sbjct: 219 ILVGLVYYK 227



>sp|Q9UEU0|VT1B_HUMAN Vesicle transport through interaction with
           t-SNAREs homolog 1B (Vesicle transport v-SNARE protein
           Vti1-like 1) (Vti1-rp1).>gb:AF035824_1877996 Homo
           sapiens vesicle soluble NSF attachment protein receptor
           (VTI1) mRNA, complete cds.
          Length = 232

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 50/190 (26%), Positives = 86/190 (45%), Gaps = 3/190 (1%)
 Frame = -2

Query: 699 EQKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRI 520
           E+KK+ I +     ++A   + +M+ E R  P + +  +++KLR Y+ DL  L  EV R 
Sbjct: 39  EEKKKLIRDFDEKQQEANETLAEMEEELRYAPLSFRNPMMSKLRNYRKDLAKLHREV-RS 97

Query: 519 TSDNANQASRDELLESGMA---DAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETE 349
           T   A    R ++     A   +       QR  L+  TE LN+++  I    ++  ET+
Sbjct: 98  TPLTATPGGRGDMKYGIYAVENEHMNRLQSQRAMLLQGTESLNRATQSIERSHRIATETD 157

Query: 348 ELGVSIXXXXXXXXXXXLHAHDTLHGVDDNISRSKKILTTMSRRMNRNKWIIGSXXXXXX 169
           ++G  I                 L    +N+S+S+KIL +MSR++  NK ++        
Sbjct: 158 QIGSEIIEELGEQRDQLERTKSRLVNTSENLSKSRKILRSMSRKVTTNKLLLSIIILLEL 217

Query: 168 XXXXXXVYFK 139
                 VY+K
Sbjct: 218 AILGGLVYYK 227



>gb:BC009810_2090868 Mus musculus vesicle transport through
           interaction with t-SNAREs 1B homolog, mRNA (cDNA clone
           MGC:13826 IMAGE:4220215), complete
           cds.>gb:BC080204_2107718 Mus musculus vesicle transport
           through interaction with t-SNAREs 1B homolog, mRNA (cDNA
           clone MGC:91047 IMAGE:3672445), complete cds.
          Length = 232

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 47/189 (24%), Positives = 87/189 (46%), Gaps = 2/189 (1%)
 Frame = -2

Query: 699 EQKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRI 520
           E+KK+ + +     ++A   + +M+ E R  P   +  +++KLR Y+ DL  L  EV+  
Sbjct: 39  EEKKKLVRDFDEKQQEANETLAEMEEELRYAPLTFRNPMMSKLRNYRKDLAKLHREVRST 98

Query: 519 TSDNANQASRDELLESGMADAKMVSADQRQR--LMMSTERLNKSSDRIREGRKVMLETEE 346
               A     D    +   + + ++  Q QR  L+  TE LN+++  I    ++  ET++
Sbjct: 99  PLTAAPGGRGDLKYGTYTLENEHLNRLQSQRALLLQGTESLNRATQSIERSHRIATETDQ 158

Query: 345 LGVSIXXXXXXXXXXXLHAHDTLHGVDDNISRSKKILTTMSRRMNRNKWIIGSXXXXXXX 166
           +G  I                 L   ++N+S+S+KIL +MSR++  NK ++         
Sbjct: 159 IGTEIIEELGEQRDQLERTKSRLVNTNENLSKSRKILRSMSRKVITNKLLLSVIILLELA 218

Query: 165 XXXXXVYFK 139
                VY+K
Sbjct: 219 ILVGLVYYK 227



>gb:AY490205_1430522 Sus scrofa NFS (NFS) mRNA, complete
           cds.>gb:AY509933_1430710 Sus scrofa vesicle transport
           through interaction with t-SNAREs protein mRNA, complete
           cds.
          Length = 232

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 47/189 (24%), Positives = 87/189 (46%), Gaps = 2/189 (1%)
 Frame = -2

Query: 699 EQKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRI 520
           E+KK+ I +     ++A   + +M+ E R  P + +  +++KLR Y+ DL  L  EV+  
Sbjct: 39  EEKKKLIRDFDEKQQEANETLAEMEEELRYAPLSFRNPMMSKLRTYRKDLAKLHREVRST 98

Query: 519 TSDNANQASRDELLESGMADAKMVSADQRQR--LMMSTERLNKSSDRIREGRKVMLETEE 346
               A     D    +   + + ++  Q QR  L+  T+ LN+++  I    ++  ET++
Sbjct: 99  PLTAAPGGRGDMKYGTYAVEDEHMNRLQSQRVLLLQGTDSLNRATQSIERSHRIAAETDQ 158

Query: 345 LGVSIXXXXXXXXXXXLHAHDTLHGVDDNISRSKKILTTMSRRMNRNKWIIGSXXXXXXX 166
           +G  I                 L    +N+S+S+KIL +MSR++  NK ++         
Sbjct: 159 IGSEIIEELGEQRDQLERTKSRLVNTSENLSKSRKILRSMSRKVTTNKLLLSLVILLELA 218

Query: 165 XXXXXVYFK 139
                VY+K
Sbjct: 219 ILGGLVYYK 227



>gb:BT019960_1991321 Homo sapiens vesicle transport through
           interaction with t-SNAREs homolog 1B (yeast) mRNA,
           complete cds.
          Length = 232

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 50/190 (26%), Positives = 85/190 (44%), Gaps = 3/190 (1%)
 Frame = -2

Query: 699 EQKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRI 520
           E+KK+ I +     ++A   + +M  E R  P + +  +++KLR Y+ DL  L  EV R 
Sbjct: 39  EEKKKLIRDFDEKQQEANETLAEMGEELRYAPLSFRNPMMSKLRNYRKDLAKLHREV-RS 97

Query: 519 TSDNANQASRDELLESGMA---DAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETE 349
           T   A    R ++     A   +       QR  L+  TE LN+++  I    ++  ET+
Sbjct: 98  TPLTATPGGRGDMKYGIYAVENEHMNRLQSQRAMLLQGTESLNRATQSIERSHRIATETD 157

Query: 348 ELGVSIXXXXXXXXXXXLHAHDTLHGVDDNISRSKKILTTMSRRMNRNKWIIGSXXXXXX 169
           ++G  I                 L    +N+S+S+KIL +MSR++  NK ++        
Sbjct: 158 QIGSEIIEELGEQRDQLERTKSRLVNTSENLSKSRKILRSMSRKVTTNKLLLSIIILLEL 217

Query: 168 XXXXXXVYFK 139
                 VY+K
Sbjct: 218 AILGGLVYYK 227



>gb:BT019347_2151304 Synthetic construct Homo sapiens vesicle
           transport through interaction with t-SNAREs homolog 1B
           (yeast) mRNA, partial cds.
          Length = 233

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 49/190 (25%), Positives = 86/190 (45%), Gaps = 3/190 (1%)
 Frame = -2

Query: 699 EQKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRI 520
           E+KK+ I +     ++A   + +M+ E R  P + +  +++KLR Y+ DL  L  EV R 
Sbjct: 39  EEKKKLIRDFDEKQQEANETLAEMEEELRYAPLSFRNPMMSKLRNYRKDLAKLHREV-RS 97

Query: 519 TSDNANQASRDELLESGMA---DAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETE 349
           T   A    R ++     A   +       QR  L+  TE LN+++  I    ++  ET+
Sbjct: 98  TPLTATPGGRGDMKYGIYAVENEHMNRLQSQRAMLLQGTESLNRATQSIERSHRIATETD 157

Query: 348 ELGVSIXXXXXXXXXXXLHAHDTLHGVDDNISRSKKILTTMSRRMNRNKWIIGSXXXXXX 169
           ++G  I                 L    +N+S+S+KIL +MSR++  +K ++        
Sbjct: 158 QIGSEIIEELGEQRDQLERTKSRLVNTSENLSKSRKILRSMSRKVTTDKLLLSIIILLEL 217

Query: 168 XXXXXXVYFK 139
                 VY+K
Sbjct: 218 AILGGLVYYK 227



>gb:AF035821_2051777 Mus musculus GES30 mRNA, complete cds.
          Length = 231

 Score = 67.8 bits (164), Expect = 3e-10
 Identities = 49/193 (25%), Positives = 87/193 (45%), Gaps = 6/193 (3%)
 Frame = -2

Query: 699 EQKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRI 520
           E+KK+ + +     ++A   + +M+ E R  P   +  +++KLR Y+  L  L + V R 
Sbjct: 39  EEKKKLVRDFDEKQQEANETLAEMEEELRYAPLTFRNPMMSKLRNYRKTL--LNSTVSRS 96

Query: 519 TSDNANQASRDEL------LESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKVML 358
           T   A    R +L      LE+   +       QR  L+  TE LN+++  I    ++  
Sbjct: 97  TPLTAAPGGRGDLKYGTYTLENEHLNRLQ---SQRALLLQGTESLNRATQSIERSHRIAT 153

Query: 357 ETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDNISRSKKILTTMSRRMNRNKWIIGSXXX 178
           ET+++G  I                 L   ++N+S+S+KIL +MSR++  NK ++     
Sbjct: 154 ETDQIGTEIIEELGEQRDQLERTKSRLVNTNENLSKSRKILRSMSRKVITNKLLLSVIIL 213

Query: 177 XXXXXXXXXVYFK 139
                    VY+K
Sbjct: 214 LELAILVGLVYYK 226



>gb:CR380958_1653528 Candida glabrata strain CBS138 chromosome L
           complete sequence.
          Length = 225

 Score = 67.0 bits (162), Expect = 5e-10
 Identities = 53/187 (28%), Positives = 91/187 (48%), Gaps = 9/187 (4%)
 Frame = -2

Query: 729 KCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEARSLPPNA--KAMLLAKLREYKS 556
           K ++ +L +     ++I E K+ + D   L+ +M LE  +   +   +A   AK+R++K+
Sbjct: 24  KASAQSLPERNATLKQIEEQKDELYD---LLDQMALEVNNSVSDMQQRANYKAKIRDWKT 80

Query: 555 DLNNLKTEVKRITSDNANQASRDELL-------ESGMADAKMVSADQRQRLMMSTERLNK 397
            +N    E+K       +   +DEL         +G  D + +S +QRQ+L+ +   L K
Sbjct: 81  QVNQ---ELKEPLQKLLDTRDKDELFGAAARSGANGNIDVEGMSEEQRQQLLSNHAILQK 137

Query: 396 SSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDNISRSKKILTTMSRR 217
           S D++R+  ++  ETE +G  I            +A DTL   D  + +S K L  MSRR
Sbjct: 138 SGDKLRDASRLANETEGIGSQIMMDLRSQRETLENARDTLFQADSYVDKSIKTLKVMSRR 197

Query: 216 MNRNKWI 196
           +  NK I
Sbjct: 198 LIANKAI 204



>gb:AE017347_1757910 Cryptococcus neoformans var. neoformans JEC21
           chromosome 7, complete sequence.
          Length = 188

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 42/159 (26%), Positives = 73/159 (45%), Gaps = 8/159 (5%)
 Frame = -2

Query: 783 VFEGYERQYCELSANLTKKCTS-ATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEARSL 607
           +FE Y+    +L  +L  K    A  L GEQ+K  +  V   +++AE ++ +M++E  S+
Sbjct: 8   LFENYDEDLKQLFGSLKSKLDGEAKSLTGEQRKAALKRVSEEIDEAEEIVAQMEVELPSM 67

Query: 606 PPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLES-GMADAKMVSADQ-- 436
           P + +     +L   K  L+ ++  +K    D   Q+ R +LL   G         D   
Sbjct: 68  PTSIRQTYQGRLAASKQSLDKIRKTLK----DLRLQSQRSDLLSGPGFPHGDDPYTDDPE 123

Query: 435 ----RQRLMMSTERLNKSSDRIREGRKVMLETEELGVSI 331
               R RL+  T+ L   + R+    ++ LETE +G  I
Sbjct: 124 PYSTRSRLLAGTQTLEDGTTRLDNAHRIALETEGVGSEI 162



>gb:AE016819_1748670 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 215

 Score = 57.4 bits (137), Expect = 4e-07
 Identities = 41/201 (20%), Positives = 90/201 (44%), Gaps = 2/201 (0%)
 Frame = -2

Query: 792 MSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEAR 613
           M+ + + YE  +        +    A      Q+   +  ++   +D   ++ +M++E  
Sbjct: 1   MASLLKSYEADFQATLEQCQRLLRQAQGEPVAQRNATLQTLEQHKDDLYDILDQMEVEVN 60

Query: 612 SL--PPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKMVSAD 439
           ++   P  +    + LR+ + +   +K +++ +     +   RD L  +G AD   +  +
Sbjct: 61  NMVGDPARQVASRSALRDLRREAGMVKQQLRELM----DARDRDALFPAGAAD---MDNE 113

Query: 438 QRQRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDN 259
           QRQ+L+ +   L ++ +R+ +  ++  ETE +G  +            H+   L   D  
Sbjct: 114 QRQQLLSNHAMLQQTGERLVDAMRLANETEGIGNQVMMDLRSQRETLEHSRQNLFLADSY 173

Query: 258 ISRSKKILTTMSRRMNRNKWI 196
           + +S + L TMSRR+  NK+I
Sbjct: 174 VDKSVRTLKTMSRRLVANKFI 194



>gb:AP003267_1826763 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0496H05.>gb:AP003924_1835341 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:B1064G04.
          Length = 216

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 28/68 (41%), Positives = 41/68 (60%)
 Frame = -2

Query: 420 MSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDNISRSKK 241
           M+TE    + D IR+ ++ MLETE++GV +           +HAHD LH VDDNI +S++
Sbjct: 1   MATEH---TIDMIRDSKRTMLETEDIGVFLLQDLHQQRGRLIHAHDILHNVDDNIGKSRR 57

Query: 240 ILTTMSRR 217
           I+  M  R
Sbjct: 58  IIGAMHAR 65



>gb:AF282728_1258694 Culex pipiens Twin-Cp5 SINE retroposon, genomic
           sequence and v-SNARE-like gene, partial sequence.
          Length = 113

 Score = 53.9 bits (128), Expect = 4e-06
 Identities = 26/106 (24%), Positives = 53/106 (50%)
 Frame = -2

Query: 450 VSADQRQRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHG 271
           +  DQ++RL+ ++ERL ++ + +++  +V+LETE++G  +             A   L  
Sbjct: 7   IQEDQKRRLLDNSERLERTGNHLKDSYRVVLETEQIGTQVLQDLSDQRETTQRARGRLRE 66

Query: 270 VDDNISRSKKILTTMSRRMNRNKWIIGSXXXXXXXXXXXXVYFKLS 133
            D  + RS ++L +M  R  R+K ++ +            +YF +S
Sbjct: 67  TDAELGRSSRLLNSMMMRALRDKIVLIAVAVALFLVLFLSIYFSVS 112



>pir|T31036|T31036 hypothetical protein 630B - Sulfolobus sp.
           plasmid pNOB8>gb:SUL010405_195209 Sulfolobus sp. NOB8H2
           conjugative plasmid pNOB8.
          Length = 312

 Score = 41.2 bits (95), Expect = 0.029
 Identities = 31/138 (22%), Positives = 72/138 (52%), Gaps = 1/138 (0%)
 Frame = -2

Query: 753 ELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAK 574
           ++S   TK+    T L  E+ + KISE+K  M+D + +I+KM ++        + +L  +
Sbjct: 92  KVSTQPTKQQIQPTSLKLEELEPKISELKQQMKDEKDIIKKMKIK--------RELLSYE 143

Query: 573 LREYKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKS 394
           ++ Y +++NN++  ++++    A     D++ +S ++        +R  L  S  ++N  
Sbjct: 144 VQYYTAEINNVEQRIQQL---KAKMKDADKVTKSKISIKLRELYKKRSELYKSKNKINA- 199

Query: 393 SDRIREGRKV-MLETEEL 343
              +R+  K+ +++ EE+
Sbjct: 200 --ELRKFEKITLIDNEEI 215



>gb:AF435011_1902074 Homo sapiens NUANCE (NUA) mRNA, complete cds.
          Length = 6885

 Score = 38.9 bits (89), Expect = 0.14
 Identities = 40/193 (20%), Positives = 80/193 (41%), Gaps = 12/193 (6%)
 Frame = -2

Query: 768  ERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEARSLPP---- 601
            E+  C L   + KK       D   K+++I ++K   E+ + L + +      L P    
Sbjct: 3092 EKAKC-LCDEIIKKLNENKTFDDSSKEKEILQIKLNAEENDKLYKVLQNMVLELSPKELD 3150

Query: 600  --NAKAML---LAKLREYKSDLNN---LKTEVKRITSDNANQASRDELLESGMADAKMVS 445
              N +  L   L  L + KS L     +  E+K I ++  N  +  E + + M   K V+
Sbjct: 3151 EKNCQDKLETSLHVLNQIKSQLQQPLLINLEIKHIQNEKDNCGAFQEQVWAEMCSIKAVT 3210

Query: 444  ADQRQRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVD 265
            A ++QR         ++S    +    + E E+L + +            HA++ L    
Sbjct: 3211 AIEKQR--------EENSSEASDVETKLREFEDLQMQLNTSIDLRTNVLNHAYENLTRYK 3262

Query: 264  DNISRSKKILTTM 226
            + ++R+ + +T++
Sbjct: 3263 EAVTRAVESITSL 3275



>gb:AC082644_1733146 Oryza sativa chromosome 3 BAC OSJNBa0013M12
           genomic sequence, complete sequence.
          Length = 275

 Score = 38.5 bits (88), Expect = 0.19
 Identities = 35/184 (19%), Positives = 77/184 (41%), Gaps = 13/184 (7%)
 Frame = -2

Query: 705 DGEQKKQKISEVKNGMEDAEALIRKMDL----EARSLPPNAKAMLLAKLREYKSDLNNLK 538
           D  ++ +++ ++   M++ + LI++ D     E  + PP     L  + +    +LN+  
Sbjct: 37  DSSRQAKQLEDLTAKMKECKRLIKEFDRILKDEESNNPPEVHKQLNDRKQYMIKELNSYV 96

Query: 537 TEVKRITSDNANQASRDELLESGMADA--------KMVSADQRQRLM-MSTERLNKSSDR 385
           T  K   S   N   R EL + G   +        ++ SA   Q+LM    E++ ++   
Sbjct: 97  TLRKTYQSSLGNNNKRVELFDMGAGSSEPAAEDNIQIASAMTNQQLMDAGREQMTQTDQA 156

Query: 384 IREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDNISRSKKILTTMSRRMNRN 205
           I   + V+ +T E G                  + L  V  ++ ++ +++  + R++  +
Sbjct: 157 IDRSKMVVAQTIETGTQTASALSQQTEQMKRIGNELDTVHFSLKKASQLVKEIGRQVATD 216

Query: 204 KWII 193
           K I+
Sbjct: 217 KCIM 220



>gb:AY740015_1626149 Oryza sativa (japonica cultivar-group) SNARE 12
           (NPSN12) mRNA, complete cds.
          Length = 275

 Score = 38.5 bits (88), Expect = 0.19
 Identities = 35/184 (19%), Positives = 77/184 (41%), Gaps = 13/184 (7%)
 Frame = -2

Query: 705 DGEQKKQKISEVKNGMEDAEALIRKMDL----EARSLPPNAKAMLLAKLREYKSDLNNLK 538
           D  ++ +++ ++   M++ + LI++ D     E  + PP     L  + +    +LN+  
Sbjct: 37  DSSRQAKQLEDLTAKMKECKRLIKEFDRILKDEESNNPPEVHKQLNDRKQYMIKELNSYV 96

Query: 537 TEVKRITSDNANQASRDELLESGMADA--------KMVSADQRQRLM-MSTERLNKSSDR 385
           T  K   S   N   R EL + G   +        ++ SA   Q+LM    E++ ++   
Sbjct: 97  TLRKTYQSSLGNNNKRVELFDMGAGSSEPAAEDNIQIASAMTNQQLMDAGREQMTQTDQA 156

Query: 384 IREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDNISRSKKILTTMSRRMNRN 205
           I   + V+ +T E G                  + L  V  ++ ++ +++  + R++  +
Sbjct: 157 IDRSKMVVAQTIETGTQTASALSQQTERMKRIGNELDTVHFSLKKASQLVKEIGRQVATD 216

Query: 204 KWII 193
           K I+
Sbjct: 217 KCIM 220



>gb:AF164622_1887183 Homo sapiens golgin-67 (GOLGA5) mRNA, complete
           cds.
          Length = 459

 Score = 38.1 bits (87), Expect = 0.24
 Identities = 27/116 (23%), Positives = 55/116 (47%)
 Frame = -2

Query: 693 KKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRITS 514
           K++K  +     E   +L R  +  A  LPP+A A+        + +L +L+ E++R+  
Sbjct: 116 KEEKKHDTHRVEELERSLSRLKNQMAEPLPPDAPAV------SSEVELQDLRKELERVAG 169

Query: 513 DNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETEE 346
           +   Q   ++ +        +++  Q++RL    ERL +  +R+RE  K + +  E
Sbjct: 170 ELQAQVENNQCI-------SLLNRGQKERLREQEERLQEQQERLREQEKRLQQLSE 218



>gb:AF204231_1889899 Homo sapiens 88-kDa Golgi protein (GM88) mRNA,
           complete cds.
          Length = 631

 Score = 37.7 bits (86), Expect = 0.32
 Identities = 27/116 (23%), Positives = 55/116 (47%)
 Frame = -2

Query: 693 KKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRITS 514
           K++K  +     E   +L R  +  A  LPP+A A+        + +L +L+ E++R+  
Sbjct: 287 KEEKKHDTHRVEELERSLSRLKNQMAEPLPPDAPAV------SSEVELQDLRKELERVAG 340

Query: 513 DNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETEE 346
           +   Q   ++ +        +++  Q++RL    ERL +  +R+RE  K + +  E
Sbjct: 341 ELQAQVENNQCI-------SLLNRGQKERLREQEERLQEQQERLREREKRLQQLAE 389



>gb:AF163441_1887142 Homo sapiens golgin 67 mRNA, complete cds.
          Length = 460

 Score = 37.7 bits (86), Expect = 0.32
 Identities = 27/116 (23%), Positives = 55/116 (47%)
 Frame = -2

Query: 693 KKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRITS 514
           K++K  +     E   +L R  +  A  LPP+A A+        + +L +L+ E++R+  
Sbjct: 116 KEEKKHDTHRVEELERSLSRLKNQMAEPLPPDAPAV------SSEVELQDLRKELERVAG 169

Query: 513 DNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETEE 346
           +   Q   ++ +        +++  Q++RL    ERL +  +R+RE  K + +  E
Sbjct: 170 ELQAQVENNQCI-------SLLNRGQKERLREQEERLQEQQERLREQEKRLQQLAE 218



>gb:AB020662_1865260 Homo sapiens mRNA for KIAA0855 protein, partial
           cds.
          Length = 632

 Score = 37.7 bits (86), Expect = 0.32
 Identities = 27/116 (23%), Positives = 55/116 (47%)
 Frame = -2

Query: 693 KKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRITS 514
           K++K  +     E   +L R  +  A  LPP+A A+        + +L +L+ E++R+  
Sbjct: 288 KEEKKHDTHRVEELERSLSRLKNQMAEPLPPDAPAV------SSEVELQDLRKELERVAG 341

Query: 513 DNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETEE 346
           +   Q   ++ +        +++  Q++RL    ERL +  +R+RE  K + +  E
Sbjct: 342 ELQAQVENNQCI-------SLLNRGQKERLREQEERLQEQQERLREREKRLQQLAE 390



>gb:CR382130_1663372 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 242

 Score = 37.7 bits (86), Expect = 0.32
 Identities = 33/144 (22%), Positives = 65/144 (45%), Gaps = 14/144 (9%)
 Frame = -2

Query: 768 ERQYCELSANLTKKCTSATLLDG--EQKKQKISEVKNGMEDAEALIRKMDLEARSLPPNA 595
           +R+  E+S  + +        DG  E++K+K  ++++ + D +  +  +  E+ +LPP+ 
Sbjct: 84  KRKVEEISKEVEELAQEVVAKDGALEEQKEKKKKLQSELADVQKQVSALQDESHNLPPHL 143

Query: 594 KAMLLAKLREYKSDLNNLK----------TEVKRITSDNANQASRDELLESGMADAKMVS 445
             M+   L+E +  L   K          T+V+       NQ   D+  E+G     ++ 
Sbjct: 144 AEMMGQSLQELEIQLEQSKAELQTSKEMVTQVEEELVPQLNQELADKKAETGALQGDLLH 203

Query: 444 AD-QRQRLMMSTERL-NKSSDRIR 379
           A  +  R +   ERL  K +D+ R
Sbjct: 204 ATAEADRAVAERERLKGKYNDKER 227



>gb:HSM802091_1186602 Homo sapiens mRNA; cDNA DKFZp434J052 (from
           clone DKFZp434J052).
          Length = 494

 Score = 37.7 bits (86), Expect = 0.32
 Identities = 27/116 (23%), Positives = 55/116 (47%)
 Frame = -2

Query: 693 KKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRITS 514
           K++K  +     E   +L R  +  A  LPP+A A+        + +L +L+ E++R+  
Sbjct: 151 KEEKKHDTHRVEELERSLSRLKNQMAEPLPPDAPAV------SSEVELQDLRKELERVAG 204

Query: 513 DNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETEE 346
           +   Q   ++ +        +++  Q++RL    ERL +  +R+RE  K + +  E
Sbjct: 205 ELQAQVENNQCI-------SLLNRGQKERLREQEERLQEQQERLREREKRLQQLAE 253



>gb:AE017025_380744 Bacillus anthracis str. Ames section 2 of 18 of
            the complete genome.>gb:AE017225_405861 Bacillus
            anthracis str. Sterne, complete
            genome.>gb:AE017334_450593 Bacillus anthracis str. 'Ames
            Ancestor', complete genome.>gb:AE016879_1010449 Bacillus
            anthracis str. Ames complete genome.
          Length = 1311

 Score = 37.7 bits (86), Expect = 0.32
 Identities = 33/126 (26%), Positives = 57/126 (45%), Gaps = 10/126 (7%)
 Frame = -2

Query: 699  EQKKQ--KISEVKNGMEDA-----EALIRKMDLEARSLPP---NAKAMLLAKLREYKSDL 550
            E+K Q  ++ E K+ +++A     EAL  + D     +     N K  L  + +E K   
Sbjct: 637  ERKSQIDRLKEEKDSIKEASDAKKEALKSEFDSRKERVKEQINNEKEALKERQQEQKEAF 696

Query: 549  NNLKTEVKRITSDNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGR 370
               K E  +  S++ N+A  D L E   A+   +  +  +R    +ERL+   D +RE  
Sbjct: 697  QQNKQENLKAISES-NKAQLDSLREVNQANLSALKENHNERKQALSERLSDEMDAVRESH 755

Query: 369  KVMLET 352
            +  LE+
Sbjct: 756  RAELES 761



>sp|Q9NZW0|GO67_HUMAN Golgi autoantigen golgin-67 (88-kDa Golgi
           protein) (Gm88 autoantigen).>gb:CR749361_1180988 Homo
           sapiens mRNA; cDNA DKFZp779P0341 (from clone
           DKFZp779P0341).
          Length = 460

 Score = 37.7 bits (86), Expect = 0.32
 Identities = 27/116 (23%), Positives = 55/116 (47%)
 Frame = -2

Query: 693 KKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRITS 514
           K++K  +     E   +L R  +  A  LPP+A A+        + +L +L+ E++R+  
Sbjct: 116 KEEKKHDTHRVEELERSLSRLKNQMAEPLPPDAPAV------SSEVELQDLRKELERVAG 169

Query: 513 DNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETEE 346
           +   Q   ++ +        +++  Q++RL    ERL +  +R+RE  K + +  E
Sbjct: 170 ELQAQVENNQCI-------SLLNRGQKERLREQEERLQEQQERLREREKRLQQLAE 218



>gb:AF380358_2490455 Gallus gallus AG9C5 mRNA, complete
           cds.>gb:AF389351_2491101 Gallus gallus FIP-2 (FIP-2)
           mRNA, complete cds.
          Length = 556

 Score = 37.4 bits (85), Expect = 0.41
 Identities = 35/148 (23%), Positives = 65/148 (43%), Gaps = 3/148 (2%)
 Frame = -2

Query: 768 ERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKA 589
           ER++ E      K+C  A  ++ EQ +Q++  +K   E AE       +E  + P     
Sbjct: 82  EREFYETKFKEAKQCLLAKCVENEQLQQQLQSLKEREEGAE-------MEGCATPEKEAR 134

Query: 588 MLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKMVSADQRQRLMMSTE 409
            L +K++  +++  +L   +  +       ++ D  +E GM +   V+   R+    S+E
Sbjct: 135 QLKSKVQRLQAEKADLLAIISELQVKLNIASAEDSFVEIGMNEE--VNRTARENQDNSSE 192

Query: 408 RLNKSSDRIRE---GRKVMLETEELGVS 334
             +  +  IR         LE+EEL VS
Sbjct: 193 MASNIAVYIRSKSADESKNLESEELTVS 220



>pir|C96667|C96667 unknown protein, 71502-69704 [imported] -
           Arabidopsis thaliana>gb:AE005173_894089 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC066689_1540289 Arabidopsis thaliana
           chromosome 1 BAC F15H21 genomic sequence, complete
           sequence.>gb:BT012293_1641499 Arabidopsis thaliana
           At1g64330 gene, complete cds.
          Length = 555

 Score = 37.4 bits (85), Expect = 0.41
 Identities = 35/169 (20%), Positives = 74/169 (43%), Gaps = 24/169 (14%)
 Frame = -2

Query: 822 KVISVNLANRMSQVFEGYERQYCELSANLTKKC----------TSATLLDGEQKKQK--- 682
           +++   L     + +E    QY +L+  + KK           +S++  D ++K ++   
Sbjct: 56  RLVVAELVKDFYKEYESLYHQYDDLTGEIRKKVHGKGENDSSSSSSSDSDSDKKSKRNGR 115

Query: 681 ----ISEVKNGMEDAEALIRKMDLEARSLPPNAKAM------LLAKLREYKSDLNNLKTE 532
               I  +K  MEDA   I  + ++  +   + +A+      +L KL+E      NL+ E
Sbjct: 116 GENEIELLKKQMEDANLEIADLKMKLATTDEHKEAVESEHQEILKKLKESDEICGNLRVE 175

Query: 531 VKRITSDNANQASRDELLESGMADAKMVSAD-QRQRLMMSTERLNKSSD 388
            +++TS+N     + E+     +D      D +++R  +  E  +K+ D
Sbjct: 176 TEKLTSENKELNEKLEVAGETESDLNQKLEDVKKERDGLEAELASKAKD 224



>gb:AE017206_405174 Lactobacillus johnsonii NCC 533, section 7 of 7 of
            the complete genome.>gb:AE017198_1123661 Lactobacillus
            johnsonii NCC 533, complete genome.
          Length = 2209

 Score = 37.0 bits (84), Expect = 0.54
 Identities = 34/143 (23%), Positives = 62/143 (43%), Gaps = 1/143 (0%)
 Frame = -2

Query: 771  YERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEA-LIRKMDLEARSLPPNA 595
            Y  +  E  +N  KK  +  L + +  K ++ E  + +  AE  L+ K   E+      A
Sbjct: 1795 YTSESAENLSNALKK-VNQVLTNKDANKAQVQEALDSLSQAEKDLVEKT--ESNKDVETA 1851

Query: 594  KAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKMVSADQRQRLMMS 415
            K  L  +L ++K +      +  + T D+A      E +  G+ D+K   AD+       
Sbjct: 1852 KEQLREELNKHKDE------DKSQYTDDSAKVKDNAEKISEGVLDSKDAQADE------- 1898

Query: 414  TERLNKSSDRIREGRKVMLETEE 346
               +NK+ D + E  K +++ EE
Sbjct: 1899 ---VNKAKDSLVEAEKGLVKKEE 1918



>gb:AE017343_1755892 Cryptococcus neoformans var. neoformans JEC21
            chromosome 3, complete sequence.
          Length = 1625

 Score = 36.6 bits (83), Expect = 0.70
 Identities = 29/125 (23%), Positives = 56/125 (44%), Gaps = 12/125 (9%)
 Frame = -2

Query: 798  NRMSQVFEGYERQYCELSANLTKKCTS------------ATLLDGEQKKQKISEVKNGME 655
            NR++   E   RQY +L A+ TK   S            A  L+ E+K +++ E +    
Sbjct: 1452 NRLNADLEDLARQYDQLKASKTKDARSARASLGPEEKDVAMALEDERKTRRVLESRLAAM 1511

Query: 654  DAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLE 475
            + +   ++  L A SL     + + +K    +++  NL+ +  ++  +N       E L+
Sbjct: 1512 EKDVQEQRKQLSAASLSATTYSSMESKYARLENEFFNLEDQHNQVVEEN-------EKLK 1564

Query: 474  SGMAD 460
            S +AD
Sbjct: 1565 SELAD 1569



>gb:A13463_1447488 P.falciparum gene for 41kd antigen, clone 41-8.
          Length = 78

 Score = 36.6 bits (83), Expect = 0.70
 Identities = 21/63 (33%), Positives = 35/63 (55%)
 Frame = -2

Query: 735 TKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKS 556
           TK+  +A+   G++ KQ  S+ K   ED E  +  + LE  ++ PN K  ++  ++E K 
Sbjct: 6   TKQNLNASYSSGQENKQNESDGKENEEDEENKVYDLILE--NIEPNKKIPIIKIVKEIKK 63

Query: 555 DLN 547
           DLN
Sbjct: 64  DLN 66



>gb:BX842653_825518 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 8/11.
          Length = 407

 Score = 36.2 bits (82), Expect = 0.92
 Identities = 31/131 (23%), Positives = 61/131 (46%), Gaps = 1/131 (0%)
 Frame = -2

Query: 744 ANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLRE 565
           A   +K  + T    E+ KQ+ ++ +  +E     +RK    A      +K  +     E
Sbjct: 274 AESERKKVAETKSQEEKLKQQAAKARQELEGNRNNLRKEQATANLEIARSKKAIA----E 329

Query: 564 YKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDR 385
           Y+S++   ++E+KR+T +        E LES +  AK  +  +  R+ ++T + N  ++ 
Sbjct: 330 YESEVARSESELKRLTEETEKAKKEREKLESRLDSAK--NEAEEIRIKVATAKANFEAEE 387

Query: 384 IR-EGRKVMLE 355
            R E  K+ L+
Sbjct: 388 SRLEAVKIRLD 398



>sp|Q10973|YT27_MYCTU Hypothetical protein
           Rv2927c/MT2997/Mb2952c.>pir|G70748|G70748 hypothetical
           protein Rv2927c - Mycobacterium tuberculosis  (strain
           H37RV)>gb:BX248344_760309 Mycobacterium bovis subsp.
           bovis AF2122/97 complete genome; segment
           11/14.>gb:BX842581_821019 Mycobacterium tuberculosis
           H37Rv complete genome; segment 10/13.
          Length = 245

 Score = 36.2 bits (82), Expect = 0.92
 Identities = 32/159 (20%), Positives = 65/159 (40%), Gaps = 13/159 (8%)
 Frame = -2

Query: 792 MSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNG----MEDAEALIRKMD 625
           M +VFE  +     +        T+  ++      + I ++K+     ++DA+ ++   D
Sbjct: 1   MYRVFEALDELSAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGELDDAQDVLDARD 60

Query: 624 LEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASR---------DELLES 472
              +    +A +M+ +   E +S LN+ +TE  RI SD   QA R         + ++  
Sbjct: 61  SMLQDAKTHADSMVSSATTEAESILNHARTEADRILSDAKAQADRMVSEARQHSERMVAD 120

Query: 471 GMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLE 355
              +A  ++   ++    S  R     DR+ E   +  E
Sbjct: 121 AREEAIRIATAAKREYEASVSRAQAECDRLIENGNISYE 159



>gb:AB020719_1865317 Homo sapiens mRNA for KIAA0912 protein, partial
            cds.
          Length = 1300

 Score = 35.8 bits (81), Expect = 1.2
 Identities = 34/147 (23%), Positives = 65/147 (44%), Gaps = 1/147 (0%)
 Frame = -2

Query: 786  QVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEARSL 607
            Q+FE YER + +L + L K     T +     ++   EV    ++ E  +RK   + +  
Sbjct: 635  QLFEAYERTHLQLRSELDKLNKEVTAV-----QECYLEVCREKDNLELTLRKTTEKEQQT 689

Query: 606  PPNAKAMLLAKL-REYKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKMVSADQRQ 430
                K  L+ +L +E++S L+     +K+ T D  +Q   D++  S +   K ++    +
Sbjct: 690  QEKIKEKLIQQLEKEWQSKLDQTIKAMKKKTLDCGSQT--DQVTTSDVISKKEMAIMIEE 747

Query: 429  RLMMSTERLNKSSDRIREGRKVMLETE 349
            +     + L +  D   +G    LE E
Sbjct: 748  QKCTIQQNLEQEKDIAIKGAMKKLEIE 774



>gb:AP004856_1846062 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1570_H12.
          Length = 722

 Score = 35.8 bits (81), Expect = 1.2
 Identities = 29/117 (24%), Positives = 49/117 (41%), Gaps = 7/117 (5%)
 Frame = -2

Query: 699 EQKKQKISEVKNGMEDAEALIRKMDLEARSLPPN------AKAMLLAKLREYKSDLNNLK 538
           E  K +  +V+  MED  + +++M  EAR    N            AKL+E    LNN +
Sbjct: 443 ESSKYECEKVRKAMEDMASALQEMSAEARESQENYLHKEKEIEHTRAKLQELNISLNNTR 502

Query: 537 TEVKRITSD-NANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGR 370
              + +  + N  +      +E   A+AK  S + R + +     + KS + I   R
Sbjct: 503 DNYEVMLDEANYERICLKNKVEQLEAEAKTTSEEWRSKELSFVSSITKSEEEIMSMR 559



>gb:CR380955_1651847 Candida glabrata strain CBS138 chromosome I
           complete sequence.
          Length = 574

 Score = 35.8 bits (81), Expect = 1.2
 Identities = 28/119 (23%), Positives = 55/119 (46%), Gaps = 8/119 (6%)
 Frame = -2

Query: 678 SEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQ 499
           +++K GME+ E  + + + E +      K  L     +YK+ +     E+K +T D  N 
Sbjct: 248 NKLKVGMEEFEEELLQKNTELQKAKKTYKDKLKKSEDKYKTIIKKYIAELKIMTDDKNNT 307

Query: 498 A--------SRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETEE 346
           A        S ++ L+  +A  +  S D   R    TE+L K ++++ E  + ++  +E
Sbjct: 308 ACKELIDFDSMNQALKQRIAILESESNDLDTRNKALTEKLEKMTEKVGEVSRQLITMQE 366



>gb:PFA929354_1393147 Plasmodium falciparum strain 3D7, chromosome
           5, segment 4/4.
          Length = 257

 Score = 35.8 bits (81), Expect = 1.2
 Identities = 21/63 (33%), Positives = 35/63 (55%)
 Frame = -2

Query: 735 TKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKS 556
           TK+  +A+   G++ KQ  S+ K   ED E  +  + LE  ++ PN K  ++  ++E K 
Sbjct: 156 TKQNLNASNSSGQENKQNESDGKENEEDEENKVYDLILE--NIEPNKKIPIIKIVKEIKK 213

Query: 555 DLN 547
           DLN
Sbjct: 214 DLN 216



>gb:AE000516_23093 Mycobacterium tuberculosis CDC1551, complete
           genome.
          Length = 247

 Score = 35.8 bits (81), Expect = 1.2
 Identities = 25/111 (22%), Positives = 48/111 (43%), Gaps = 9/111 (8%)
 Frame = -2

Query: 660 MEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASR--- 490
           ++DA+ ++   D   +    +A +M+ +   E +S LN+ +TE  RI SD   QA R   
Sbjct: 51  LDDAQDVLDARDSMLQDAKTHADSMVSSATTEAESILNHARTEADRILSDAKAQADRMVS 110

Query: 489 ------DELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLE 355
                 + ++     +A  ++   ++    S  R     DR+ E   +  E
Sbjct: 111 EARQHSERMVADAREEAIRIATAAKREYEASVSRAQAECDRLIENGNISYE 161



>gb:AY062270_1565013 Exophiala dermatitidis strain 8656 calcineurin
           (CNA) gene, complete cds.
          Length = 537

 Score = 35.4 bits (80), Expect = 1.6
 Identities = 25/103 (24%), Positives = 48/103 (46%)
 Frame = -2

Query: 822 KVISVNLANRMSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEA 643
           K++++   +R+ QV     ++  EL      +  + TL+ G +    I +  +  EDA  
Sbjct: 432 KILAIGRLSRVFQVLREESQRVTELKTQAGGRLPAGTLMLGAEG---IKQAIHNFEDA-- 486

Query: 642 LIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRITS 514
             RK+DL+   LPP+ + +      + K+ L    TE +  T+
Sbjct: 487 --RKVDLQNERLPPSPEEIEKRSAEDRKAALERAATEAENDTT 527



>gb:AB019228_1514106 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MCK7.
          Length = 589

 Score = 35.4 bits (80), Expect = 1.6
 Identities = 32/128 (25%), Positives = 58/128 (45%), Gaps = 12/128 (9%)
 Frame = -2

Query: 693 KKQKISEVKNGMED--AEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRI 520
           K Q    + +G++D  +E      +L+  +L    +   L +LRE +     ++ EV++ 
Sbjct: 302 KSQLARYLPSGLDDEQSEGAASTQELDIETLSEELRITSL-RLREAEKQNGIMRKEVEKS 360

Query: 519 TSDNANQASRDELLESGMADA----KMVSADQRQ------RLMMSTERLNKSSDRIREGR 370
            SD+A   S  ++LES   +A       SAD+R+      R+ M    L      IR+ +
Sbjct: 361 KSDDAKLKSLQDMLESAQKEAAAWKSKASADKREVVKLLDRISMLKSSLAGRDHEIRDLK 420

Query: 369 KVMLETEE 346
             + + EE
Sbjct: 421 TALSDAEE 428



>gb:AE014134_1129660 Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE003661_1219767 Drosophila melanogaster
            chromosome 2L, section 70 of 83 of the complete sequence.
          Length = 1732

 Score = 35.4 bits (80), Expect = 1.6
 Identities = 27/124 (21%), Positives = 54/124 (43%), Gaps = 2/124 (1%)
 Frame = -2

Query: 711  LLDGEQKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTE 532
            LL+ +QK+Q+  E + G +D + +++ +  + ++    AKA     +   + ++ N K +
Sbjct: 657  LLNEQQKEQEHKEKQKGEDDGKVIVKTISAKTKAPIEVAKAKAKTSIVITRPEIKNAKAK 716

Query: 531  VKR--ITSDNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKVML 358
            V    +   N NQ  + E  E     A    A        S+     SS  I  GR  ++
Sbjct: 717  VNSFPVQKSNTNQVKKPEKQEKSDTTAPAAIA--------SSSNTRNSSHSICVGRNSII 768

Query: 357  ETEE 346
            + ++
Sbjct: 769  KRQK 772



>gb:AY039661_586219 Streptococcus pyogenes strain NS90 M protein
           (emm) gene, partial cds.
          Length = 240

 Score = 35.4 bits (80), Expect = 1.6
 Identities = 39/164 (23%), Positives = 68/164 (41%), Gaps = 5/164 (3%)
 Frame = -2

Query: 843 RQSCDHFKVISVNLAN---RMSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISE 673
           RQ  D ++V +  L N   ++    +    +  EL     +  T    L  E +K K + 
Sbjct: 37  RQIIDKYEVENHELKNTNGKLQSRNDDLTSENAELKQRSDQLSTEKQALKEEAEKTKQNN 96

Query: 672 VKNGMEDAEALIRKMDL-EARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQA 496
                ++A     K  L EA     + K  L  + +E K+D ++LK E  R+T+DN    
Sbjct: 97  EALQTQNANLTSEKDRLTEANKTLTSEKENLTNRNQELKADNDDLKAEKNRLTTDNRGLT 156

Query: 495 SRDELLESGMADAKMVSADQRQRLMMSTERLNKS-SDRIREGRK 367
            + E  +    + +  S +  + L    E L K+  D+I   +K
Sbjct: 157 EKLEKAKEESVNKERESKENEKTLNDLNELLKKTVEDKIAREQK 200



>pir|E81366|E81366 probable membrane protein Cj0926 [imported] -
           Campylobacter jejuni (strain NCTC
           11168)>gb:CJ11168X3_847302 Campylobacter jejuni subsp.
           jejuni NCTC 11168 complete genome; segment
           3/6.>gb:CP000025_878755 Campylobacter jejuni RM1221,
           complete genome.
          Length = 110

 Score = 35.4 bits (80), Expect = 1.6
 Identities = 23/81 (28%), Positives = 44/81 (54%)
 Frame = -2

Query: 714 TLLDGEQKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKT 535
           TLL+ E+  +    +KN ++D E +IRK+ ++ +    N   +L  +L + K+DL +L+T
Sbjct: 27  TLLNKEKTSKDF--IKNNLDDTEIVIRKLQIQLQRSLGNID-ILTEELNKIKADLTSLRT 83

Query: 534 EVKRITSDNANQASRDELLES 472
              +   +N     R + LE+
Sbjct: 84  RNSQYRLENDKLRQRIKELEA 104



>sp|Q91ZU8|BP1E_MOUSE Bullous pemphigoid antigen 1, isoform 5 (BPA)
            (Hemidesmosomal plaque protein) (Dystonia musculorum
            protein) (Dystonin).>gb:AF396877_2064834 Mus musculus
            bullous pemphigoid antigen 1-e (Bpag1) mRNA, complete
            cds, alternatively spliced.
          Length = 2611

 Score = 35.4 bits (80), Expect = 1.6
 Identities = 33/134 (24%), Positives = 57/134 (42%), Gaps = 11/134 (8%)
 Frame = -2

Query: 705  DGEQKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLRE------YKSDLNN 544
            D  Q +  +SE K   +    +I+K + E RSL     A    K RE       ++ +  
Sbjct: 1614 DLAQSQNLVSEFKQKCDQQSMIIQKTEKEVRSLSAELSASKEEKRREEQKAQLQRAQVQE 1673

Query: 543  LKTEVKRITSDNANQASRDEL----LESGMADAKMV-SADQRQRLMMSTERLNKSSDRIR 379
            L   +KR+         +DEL    +E  M   KM+   ++  +   S +   K  +++ 
Sbjct: 1674 LNDRLKRV---------QDELHLKTIEEQMTHRKMILLQEESDKFKRSADEFRKKMEKLM 1724

Query: 378  EGRKVMLETEELGV 337
            E  KV+ ET+  G+
Sbjct: 1725 ES-KVVTETDLSGI 1737



>gb:AE017342_1754872 Cryptococcus neoformans var. neoformans JEC21
           chromosome 2, complete sequence.
          Length = 358

 Score = 35.0 bits (79), Expect = 2.1
 Identities = 30/115 (26%), Positives = 53/115 (46%), Gaps = 4/115 (3%)
 Frame = -2

Query: 699 EQKKQKISEVKNGMEDAEAL---IRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEV 529
           E+  +K  E+   + +A+AL   IR M+LE   +           + +    L++   E+
Sbjct: 150 EENAKKHEEMSQQLVEAQALQKQIRDMELELARIKATHPPENRMTINQANDTLDSQIVEI 209

Query: 528 KRITSDN-ANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRK 367
           +++T +  A QA  D+  E+    AK     + QRL    ER    +  +REGR+
Sbjct: 210 QQLTDEREATQAQIDQTREAVARIAK-----ELQRLSKDREREEARAKEVREGRE 259



>gb:YSCINTANA_1729387 Saccharomyces cerevisiae integrin analogue gene,
            complete cds.
          Length = 1015

 Score = 35.0 bits (79), Expect = 2.1
 Identities = 25/117 (21%), Positives = 52/117 (44%)
 Frame = -2

Query: 696  QKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRIT 517
            +K   IS +    +D E L  K+ +EA+S          ++L   K +LNN + +++   
Sbjct: 771  EKSDLISRINESEKDIEELKSKLRIEAKSS---------SELETVKQELNNAQEKIRVNA 821

Query: 516  SDNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETEE 346
             +N    S+ E +E  + D +      ++   + T RL +    +   ++   ++EE
Sbjct: 822  EENTVLKSKLEDIERELKDKQAEIKSNQEEKELLTSRLKELEQELDSTQQKAQKSEE 878



>gb:AB015484_1193578 Dugesia japonica mRNA for myosin heavy chain,
            complete cds.
          Length = 1958

 Score = 35.0 bits (79), Expect = 2.1
 Identities = 41/197 (20%), Positives = 83/197 (42%), Gaps = 16/197 (8%)
 Frame = -2

Query: 753  ELSANLTKK--CTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEARSLPPN------ 598
            ELS  L ++   TSA L   ++++ ++ ++K  +E+A     +M  ++R    +      
Sbjct: 1138 ELSDRLEEQGGATSAQLELNKKREAELLKLKRDLEEANMQHDQMIAQSRKKQQDVANEFS 1197

Query: 597  --------AKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKMVSA 442
                    AKA +  +  E K DLN+L+++++ +    AN   + + LES  A+ +    
Sbjct: 1198 DQLDQLQKAKAKIEKEKNEMKEDLNDLQSQLEALNKAKANSDKKIKELESQNAELQGKLE 1257

Query: 441  DQRQRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDD 262
            +  + +    +  N S    +   ++    EE    I               +    +DD
Sbjct: 1258 ELNRHI---NDANNTSGKNQQLNAELQARLEEAESQINQLTKVKQQMQTQLEEARQNLDD 1314

Query: 261  NISRSKKILTTMSRRMN 211
              SR+K  L++  R +N
Sbjct: 1315 E-SRTKAKLSSDVRNLN 1330



>gb:AJ748324_530339 Sulfolobus islandicus plasmid pHVE14.
          Length = 303

 Score = 35.0 bits (79), Expect = 2.1
 Identities = 26/122 (21%), Positives = 69/122 (56%), Gaps = 3/122 (2%)
 Frame = -2

Query: 699 EQKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRI 520
           E+ + KISE+K  M++ + +I+KM +         + +L  +L+ Y S+++N++  ++++
Sbjct: 114 EELELKISELKQQMKNEKDIIKKMKIR--------RELLNYELQYYTSEISNIEQRIQQL 165

Query: 519 TS--DNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKV-MLETE 349
            +    A++ +RD++        K+   ++++  +   +  NK++  +++  KV ++E E
Sbjct: 166 KAKIKGADKITRDKI------SKKLKELNKKRSELYKMK--NKANAELKKFEKVTLIENE 217

Query: 348 EL 343
           E+
Sbjct: 218 EI 219



>pir|A60776|A60776 230k bullous pemphigoid antigen BPM1 - mouse
           (fragment)
          Length = 997

 Score = 35.0 bits (79), Expect = 2.1
 Identities = 32/131 (24%), Positives = 56/131 (42%), Gaps = 11/131 (8%)
 Frame = -2

Query: 696 QKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLRE------YKSDLNNLKT 535
           Q +  +SE K   +    +I+K + E RSL     A    K RE       ++ +  L  
Sbjct: 3   QSQNLVSEFKQKCDQQSMIIQKTEKEVRSLSAELSASKEEKRREEQKAQLQRAQVQELND 62

Query: 534 EVKRITSDNANQASRDEL----LESGMADAKMV-SADQRQRLMMSTERLNKSSDRIREGR 370
            +KR+         +DEL    +E  M   KM+   ++  +   S +   K  +++ E  
Sbjct: 63  RLKRV---------QDELHLKTIEEQMTHRKMILLQEESDKFKRSADEFRKKMEKLMES- 112

Query: 369 KVMLETEELGV 337
           KV+ ET+  G+
Sbjct: 113 KVVTETDLSGI 123



>gb:AY398408_2531938 Danio rerio clone RK112A2B01 ribosome binding
            protein 1 homolog 180kDa (RRBP1) mRNA, complete cds.
          Length = 978

 Score = 34.7 bits (78), Expect = 2.7
 Identities = 34/188 (18%), Positives = 72/188 (38%), Gaps = 29/188 (15%)
 Frame = -2

Query: 831  DHFKVISVNLANRMSQ--VFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGM 658
            +  +V    L NR  +  +    E    E+ A + K              +++ ++++ +
Sbjct: 507  ERMRVTETELKNRCEELEILRAQENPTVEIEATVQKI-----------NSEEVEQLRSSL 555

Query: 657  EDAEALIRKMDLEARSLPPNAKAMLLA--------------KLREYKSDLNNLKTEVKRI 520
            ++ E  +  M+ E   L    + +  A              + REY +++  LKT VK  
Sbjct: 556  KEREEQLTSMEAELTQLREELETVKRAQAEETQNRVNEADTRCREYTTEIQQLKTSVKEK 615

Query: 519  TS------------DNANQASRDELLESGMADAKMVSADQR-QRLMMSTERLNKSSDRIR 379
                          ++ N    +   E+   DA+M+S ++  Q++    ER+   S+ +R
Sbjct: 616  EDLVASLQAELEKMESTNTVEAEPPFENLEKDARMISLEEELQQIKEEMERMKAKSNELR 675

Query: 378  EGRKVMLE 355
            E     +E
Sbjct: 676  EKNYAAVE 683



>gb:AY035224_2508896 Gallus gallus cardiac muscle factor 1 gene,
            partial cds.
          Length = 1625

 Score = 34.7 bits (78), Expect = 2.7
 Identities = 26/129 (20%), Positives = 59/129 (45%), Gaps = 6/129 (4%)
 Frame = -2

Query: 699  EQKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRI 520
            ++ ++K+ E++   ED+  LIR+++ E + +P N      +   +   + N+L   ++ +
Sbjct: 723  QKLQEKLKELETNKEDSAKLIRRLEREVK-IPTNLLETAKSDTDQLSGEKNHLLQNLQSL 781

Query: 519  TSDNANQASRDELLESGMADAK------MVSADQRQRLMMSTERLNKSSDRIREGRKVML 358
              D  +    +E L++ +AD        M  ++  Q  + + E  N    R  +G  ++ 
Sbjct: 782  EKDALSFRLEEEKLQNQVADLNKEKEVLMRESEMMQSKLSALETENSKLSRYLDG--LIT 839

Query: 357  ETEELGVSI 331
            E  EL   +
Sbjct: 840  EKRELAARL 848



>gb:CNS07EGI_1374577 chromosome IX of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 414

 Score = 34.7 bits (78), Expect = 2.7
 Identities = 32/122 (26%), Positives = 60/122 (49%), Gaps = 7/122 (5%)
 Frame = -2

Query: 720 SATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAM--LLAKLREYKSDLN 547
           S  +L   Q KQK S +++ ++    L++ +D  A  +    K    ++++L   K+ L 
Sbjct: 229 SFIILKMAQSKQKESMLQSSIDK---LLQDIDQVAEKIQDTQKMKDGMMSRLHTKKNHLR 285

Query: 546 NLKTEVKRITSDNAN-----QASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRI 382
           NL+  +K +           + SR+ELL+     +KM+  DQR +L +  +     SDRI
Sbjct: 286 NLQINIKEVEVQRGRTLALIRLSRNELLKL----SKMID-DQRSKLALLEDEEKIFSDRI 340

Query: 381 RE 376
           ++
Sbjct: 341 KK 342



>gb:AF151102_1245420 Polysphondylium pallidum cortexillin II gene,
           complete cds.
          Length = 449

 Score = 34.7 bits (78), Expect = 2.7
 Identities = 33/123 (26%), Positives = 62/123 (50%), Gaps = 11/123 (8%)
 Frame = -2

Query: 807 NLANRMS---QVFEGYERQYCELSANLTKKCTSATLL--DGEQKKQKISEVKNGMEDA-- 649
           +LAN+++   Q  EG +    EL+    +   S  L+    EQ+ Q+I+++++ ++DA  
Sbjct: 247 SLANKLASLEQSLEGEKTSQDELARQKKELEESLRLIRQQNEQRNQRIADIQSKIDDALR 306

Query: 648 ---EALIRKMDLEAR-SLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDEL 481
              +  + K+DLE+R S     KA+L  KL E   +   L+ +++      A +A    L
Sbjct: 307 GIDDEKMAKLDLESRLSKTEKDKAILELKLAETLDENERLRNKIEEDKKRAAAEAEGLGL 366

Query: 480 LES 472
           L +
Sbjct: 367 LRT 369



>gb:AY137529_591602 Streptococcus equi strain CF32 immunoreactive
           protein Se89.9 gene, partial cds.
          Length = 210

 Score = 34.7 bits (78), Expect = 2.7
 Identities = 29/122 (23%), Positives = 58/122 (47%), Gaps = 9/122 (7%)
 Frame = -2

Query: 684 KISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNA 505
           KIS++++ +E A+A   K+D +   L  N K  L  +L   K +   LK  + +  +  A
Sbjct: 64  KISQLQHQLEAAQAKSHKLDQQVEQL-ANTKDSLRTQLLAAKEEQAQLKANLDKALALLA 122

Query: 504 NQASRDELLESGMADAK---MVSADQRQRL------MMSTERLNKSSDRIREGRKVMLET 352
           +  +    LE+ M +AK      A Q+ +L        +  R+  + +++   +K + +T
Sbjct: 123 SSKATLHKLEAAMEEAKARVAGLASQKAQLEDLLAFEKNPNRIELAQEKVAAAKKALADT 182

Query: 351 EE 346
           E+
Sbjct: 183 ED 184



>pir|T29095|T29095 cardiac muscle factor 1 -
            chicken>gb:GGU62026_2573716 Gallus gallus cardiac muscle
            factor 1 CMF1 mRNA, complete cds.
          Length = 1538

 Score = 34.7 bits (78), Expect = 2.7
 Identities = 26/129 (20%), Positives = 59/129 (45%), Gaps = 6/129 (4%)
 Frame = -2

Query: 699  EQKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRI 520
            ++ ++K+ E++   ED+  LIR+++ E + +P N      +   +   + N+L   ++ +
Sbjct: 708  QKLQEKLKELETNKEDSAKLIRRLEREVK-IPTNLLETAKSDTDQLSGEKNHLLQNLQSL 766

Query: 519  TSDNANQASRDELLESGMADAK------MVSADQRQRLMMSTERLNKSSDRIREGRKVML 358
              D  +    +E L++ +AD        M  ++  Q  + + E  N    R  +G  ++ 
Sbjct: 767  EKDALSFRLEEEKLQNQVADLNKEKEVLMRESEMMQSKLSALETENSKLSRYLDG--LIT 824

Query: 357  ETEELGVSI 331
            E  EL   +
Sbjct: 825  EKRELAARL 833



>gb:SCYDL057W_1711619 S.cerevisiae chromosome IV reading frame ORF
            YDL057w.
          Length = 1268

 Score = 34.3 bits (77), Expect = 3.5
 Identities = 25/117 (21%), Positives = 52/117 (44%)
 Frame = -2

Query: 696  QKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRIT 517
            +K   IS +    +D E L  K+ +EA+S          ++L   K +LNN + +++   
Sbjct: 1030 EKSDLISRINESEKDIEELKSKLRIEAKSG---------SELETVKQELNNAQEKIRINA 1080

Query: 516  SDNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETEE 346
             +N    S+ E +E  + D +      ++   + T RL +    +   ++   ++EE
Sbjct: 1081 EENTVLKSKLEDIERELKDKQAEIKSNQEEKELLTSRLKELEQELDSTQQKAQKSEE 1137



>gb:BX649607_1643499 Aspergillus fumigatus BAC pilot project
            supercontig; segment 3/3.
          Length = 1061

 Score = 34.3 bits (77), Expect = 3.5
 Identities = 37/178 (20%), Positives = 76/178 (42%), Gaps = 22/178 (12%)
 Frame = -2

Query: 825  FKVISVNLANRMSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAE 646
            FK +S++ A+++ Q+ E  +R + +  A L ++   A     +Q   ++  + N +++  
Sbjct: 717  FKDLSISEASKIRQINESLQRNHEQELARLEEQHNYAKNELLKQHGDQLRAIDNQLKETS 776

Query: 645  ALIRKMDLEARSLPPNAKAML----------LAKLREYKSD-LNNLKTEVKRITSDN--- 508
            A   +   + + L     A L          L ++RE  +D +  L++ ++ + S+    
Sbjct: 777  AEYERRSQKVKKLHDTEVADLQKKLQSLELELTRVREQSADEIGGLQSTIQTMRSEADQS 836

Query: 507  --------ANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKVML 358
                    A   S  + L S + + K   ADQ   L  +  RL    D+ +EG +  L
Sbjct: 837  KGQHWAQVAELESTIQSLRSELDENKANHADQVSNLSDTIRRLQSELDKAKEGHEAEL 894



>gb:AE009900_257151 Pyrobaculum aerophilum strain IM2 section 155 of
           201 of the complete genome.>gb:AE009441_899777
           Pyrobaculum aerophilum strain IM2 complete genome.
          Length = 702

 Score = 34.3 bits (77), Expect = 3.5
 Identities = 25/104 (24%), Positives = 58/104 (55%), Gaps = 5/104 (4%)
 Frame = -2

Query: 807 NLANRMSQV---FEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALI 637
           ++A R+ +V    E  E++  E+S+ L+            Q  +++ EVK+ +E+AEAL 
Sbjct: 456 DVAERIKEVRRRLEENEKRLKEVSSRLS------------QIDREVEEVKSSLEEAEALY 503

Query: 636 RKMDLEARSLPPNAKAM--LLAKLREYKSDLNNLKTEVKRITSD 511
           +++ ++          +  L A+L++ +S+L ++KTE++++  +
Sbjct: 504 QQLRVKHDEYLATEALVRELKAQLKDAESELESVKTEIEKMRGE 547



>pir|S67593|S67593 transport protein USO1 - yeast (Saccharomyces
            cerevisiae)>gb:SCYDL058W_1711621 S.cerevisiae chromosome
            IV reading frame ORF YDL058w.
          Length = 1790

 Score = 34.3 bits (77), Expect = 3.5
 Identities = 25/117 (21%), Positives = 52/117 (44%)
 Frame = -2

Query: 696  QKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRIT 517
            +K   IS +    +D E L  K+ +EA+S          ++L   K +LNN + +++   
Sbjct: 1552 EKSDLISRINESEKDIEELKSKLRIEAKSG---------SELETVKQELNNAQEKIRINA 1602

Query: 516  SDNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETEE 346
             +N    S+ E +E  + D +      ++   + T RL +    +   ++   ++EE
Sbjct: 1603 EENTVLKSKLEDIERELKDKQAEIKSNQEEKELLTSRLKELEQELDSTQQKAQKSEE 1659



>sp|P25386|USO1_YEAST Intracellular protein transport protein
            USO1.>gb:SCUSO1_1710680 S.cerevisiae gene for Uso1
            protein, involved in intracellular protein transport.
          Length = 1790

 Score = 34.3 bits (77), Expect = 3.5
 Identities = 25/117 (21%), Positives = 52/117 (44%)
 Frame = -2

Query: 696  QKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRIT 517
            +K   IS +    +D E L  K+ +EA+S          ++L   K +LNN + +++   
Sbjct: 1552 EKSDLISRINESEKDIEELKSKLRIEAKSG---------SELETVKQELNNAQEKIRINA 1602

Query: 516  SDNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETEE 346
             +N    S+ E +E  + D +      ++   + T RL +    +   ++   ++EE
Sbjct: 1603 EENTVLKSKLEDIERELKDKQAEIKSNQEEKELLTSRLKELEQELDSTQQKAQKSEE 1659



>sp|Q8VZU2|S132_ARATH Syntaxin 132 (AtSYP132).>gb:AY063836_1565785
           Arabidopsis thaliana putative syntaxin (At5g08080) mRNA,
           complete cds.>gb:AY117244_1579285 Arabidopsis thaliana
           putative syntaxin (At5g08080) mRNA, complete cds.
          Length = 304

 Score = 34.3 bits (77), Expect = 3.5
 Identities = 27/145 (18%), Positives = 64/145 (44%), Gaps = 12/145 (8%)
 Frame = -2

Query: 594 KAMLLAKLREYKSDLNNLKTE--------VKRITSDNANQASRDELLESGMAD---AKMV 448
           K  L  K+ E++    N++ E        V  +T + A++ + DEL+E+G ++    K +
Sbjct: 133 KKKLKDKMAEFQVLRENIQQEYRDVVDRRVYTVTGERADEDTIDELIETGNSEQIFQKAI 192

Query: 447 SADQRQRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGV 268
               R ++M +   + +  D +R+  K +L+ +++ + +            +    +   
Sbjct: 193 QEQGRGQVMDTLAEIQERHDAVRDLEKKLLDLQQIFLDMAVLVDAQGEMLDNIESQVSSA 252

Query: 267 DDNI-SRSKKILTTMSRRMNRNKWI 196
            D++ S +  +    S + N  KW+
Sbjct: 253 VDHVQSGNTALQRAKSLQKNSRKWM 277



>gb:BC070659_2555634 Xenopus laevis hypothetical protein LOC431812,
           mRNA (cDNA clone IMAGE:4031902), partial cds.
          Length = 648

 Score = 33.9 bits (76), Expect = 4.6
 Identities = 35/128 (27%), Positives = 56/128 (43%), Gaps = 11/128 (8%)
 Frame = -2

Query: 696 QKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAML------LAKLRE-YKSDL---- 550
           Q KQ+  E+    E+ E L+RK + E  +L    K  +      + KL+E Y  +L    
Sbjct: 79  QMKQRFQEILLVKEEQEDLLRKRERELTALKGALKEEVSTHDQEIDKLKEQYDKELKKIR 138

Query: 549 NNLKTEVKRITSDNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGR 370
           +NL  EVK  +SD ANQ +    L++   +   V   + + L    E L      +R+  
Sbjct: 139 DNLNEEVKN-SSDIANQKNEASQLKAVFENKVKVLLQENEELKWKIENLEDKIAGLRQEI 197

Query: 369 KVMLETEE 346
             + E  E
Sbjct: 198 NDLSEENE 205



>gb:AF495911_1905254 Homo sapiens nesprin-2 mRNA, complete cds.
          Length = 6884

 Score = 33.9 bits (76), Expect = 4.6
 Identities = 39/193 (20%), Positives = 79/193 (40%), Gaps = 12/193 (6%)
 Frame = -2

Query: 768  ERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEARSLPP---- 601
            E+  C L   + KK       D   K+++I ++K   E+ + L + +      L P    
Sbjct: 3091 EKAKC-LCDEIIKKLNENKTFDDSFKEKEILQIKLNAEENDKLYKVLQNMVLELSPKELD 3149

Query: 600  --NAKAML---LAKLREYKSDLNN---LKTEVKRITSDNANQASRDELLESGMADAKMVS 445
              N +  L   L  L + KS L     +  E+K I ++  N  +  E + + M   K V+
Sbjct: 3150 EKNCQDKLETSLHVLNQIKSQLQQPLLINLEIKHIQNEKDNCEAFQEQVWAEMCSIKAVT 3209

Query: 444  ADQRQRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVD 265
            A ++QR         ++S    +    + E E+L + +             A++ L    
Sbjct: 3210 AIEKQR--------EENSSEASDVETKLREFEDLQMQLNTSIDLRTNVLNDAYENLTRYK 3261

Query: 264  DNISRSKKILTTM 226
            + ++R+ + +T++
Sbjct: 3262 EAVTRAVESITSL 3274



>gb:ANI291452_1819462 Aspergillus nidulans kinA gene for
           conventional kinesin, exons 1-5.
          Length = 927

 Score = 33.9 bits (76), Expect = 4.6
 Identities = 33/146 (22%), Positives = 65/146 (44%), Gaps = 3/146 (2%)
 Frame = -2

Query: 696 QKKQKISEVKNGMEDAEALIRKM-DLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKR- 523
           +K+  I+ ++ G+ +A   +R + +  ARS   N K  L A++ E +  L  +  E K  
Sbjct: 462 EKESHIATIERGLREARDELRTLKENSARSGKDNEK--LNAEVNELRMHLEKVSYESKEA 519

Query: 522 -ITSDNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETEE 346
            IT D+  +A+ +  L + + + K    D R +   +T  L++   +  E    M+   +
Sbjct: 520 AITMDSLREANSE--LTAELDEVKQQLLDVRMKAKETTAALDEKEKKKAEKMAKMMAGFD 577

Query: 345 LGVSIXXXXXXXXXXXLHAHDTLHGV 268
           LG  +           +   D+LH +
Sbjct: 578 LGGEVFSDNERKLQNLIQRVDSLHQI 603



>gb:CFC3VS_1438585 Canis familiaris mRNA for C3VS protein.
          Length = 1388

 Score = 33.9 bits (76), Expect = 4.6
 Identities = 39/160 (24%), Positives = 73/160 (45%), Gaps = 2/160 (1%)
 Frame = -2

Query: 840  QSCDH-FKVISVNLANRMSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKN 664
            + C+  FK     L  ++S+  + Y  +  E  A   K+       + ++ K++I  ++ 
Sbjct: 964  EECERKFKATEKELKEQLSEQMQKYHVR--EEEAKKYKQ-------ENDKLKKEIFTLQK 1014

Query: 663  GMEDAEALIRKMDLEARSLPPNAKAMLLAK-LREYKSDLNNLKTEVKRITSDNANQASRD 487
             ++D   LI       R+L  N KA  L K L++     + +KTE +++  DNA Q S +
Sbjct: 1015 DLKDKNVLIENSHDMERAL--NRKAEELNKQLKDLLQKYSEIKTEKEKLVDDNARQTS-E 1071

Query: 486  ELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRK 367
             L    +   + V  +Q + L  S   LN + + ++E  K
Sbjct: 1072 LLAAQTLLQKQHVPLEQVETLKKS---LNSTIEHLKEELK 1108



>gb:AB045982_1195788 Patinopecten yessoensis mRNA for myosin, partial
            cds.
          Length = 1154

 Score = 33.9 bits (76), Expect = 4.6
 Identities = 29/123 (23%), Positives = 58/123 (47%), Gaps = 1/123 (0%)
 Frame = -2

Query: 699  EQKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLR-EYKSDLNNLKTEVKR 523
            E    K+ + K  ME+     R  ++ A  +    KA  L KL+ +Y+S +++L+  +++
Sbjct: 1016 EDTNHKLLKEKRAMEE-----RMSEVTAHLVEEEEKAKQLGKLKNKYESIISDLEERLRK 1070

Query: 522  ITSDNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETEEL 343
             T            LES + D +    ++RQ+L     +L+K  + ++   K   + +E 
Sbjct: 1071 ETQARQELEKIRRRLESELNDLREQLMEKRQQLEDLQAQLSKREEEVQHALK---KVDEE 1127

Query: 342  GVS 334
            GV+
Sbjct: 1128 GVA 1130



>sp|Q8WXH0|SNE2_HUMAN Nesprin 2 (Nuclear envelope spectrin repeat
            protein 2) (Syne-2) (Synaptic nuclear envelope protein 2)
            (Nucleus and actin connecting element protein) (NUANCE
            protein).
          Length = 6885

 Score = 33.9 bits (76), Expect = 4.6
 Identities = 39/193 (20%), Positives = 79/193 (40%), Gaps = 12/193 (6%)
 Frame = -2

Query: 768  ERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLEARSLPP---- 601
            E+  C L   + KK       D   K+++I ++K   E+ + L + +      L P    
Sbjct: 3092 EKAKC-LCDEIIKKLNENKTFDDSFKEKEILQIKLNAEENDKLYKVLQNMVLELSPKELD 3150

Query: 600  --NAKAML---LAKLREYKSDLNN---LKTEVKRITSDNANQASRDELLESGMADAKMVS 445
              N +  L   L  L + KS L     +  E+K I ++  N  +  E + + M   K V+
Sbjct: 3151 EKNCQDKLETSLHVLNQIKSQLQQPLLINLEIKHIQNEKDNCEAFQEQVWAEMCSIKAVT 3210

Query: 444  ADQRQRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVD 265
            A ++QR         ++S    +    + E E+L + +             A++ L    
Sbjct: 3211 AIEKQR--------EENSSEASDVETKLREFEDLQMQLNTSIDLRTNVLNDAYENLTRYK 3262

Query: 264  DNISRSKKILTTM 226
            + ++R+ + +T++
Sbjct: 3263 EAVTRAVESITSL 3275



>gb:AF115383_2055038 Mus musculus dystonin (Bpag1-n) mRNA, partial
           cds.
          Length = 992

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 31/126 (24%), Positives = 54/126 (42%), Gaps = 11/126 (8%)
 Frame = -2

Query: 681 ISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLRE------YKSDLNNLKTEVKRI 520
           +SE K   +    +I+K + E RSL     A    K RE       ++ +  L   +KR+
Sbjct: 3   VSEFKQKCDQQSMIIQKTEKEVRSLSAELSASKEEKRREEQKAQLQRAQVQELNDRLKRV 62

Query: 519 TSDNANQASRDEL----LESGMADAKMV-SADQRQRLMMSTERLNKSSDRIREGRKVMLE 355
                    +DEL    +E  M   KM+   ++  +   S +   K  +++ E  KV+ E
Sbjct: 63  ---------QDELHLKTIEEQMTHRKMILLQEESDKFKRSADEFRKKMEKLMES-KVVTE 112

Query: 354 TEELGV 337
           T+  G+
Sbjct: 113 TDLSGI 118



>gb:AK097432_1914862 Homo sapiens cDNA FLJ40113 fis, clone
           TESTI2008621.
          Length = 466

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 38/179 (21%), Positives = 72/179 (40%), Gaps = 31/179 (17%)
 Frame = -2

Query: 789 SQVFEGYERQYCELS----------ANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEAL 640
           S   E  E QY EL+          + LT+   S      E+KK +I  V+   +   +L
Sbjct: 81  STTLEDLESQYQELAVALDSSSAIISQLTENINSLVRTSKEEKKHEIHLVQ---KLGRSL 137

Query: 639 IRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELL------ 478
            +  +  A  L P   A   +K+ + + + N+L+ E++ +      +   +++L      
Sbjct: 138 FKLKNQTAEPLAPEPPAGP-SKVEQLQDETNHLRKELESVGRQLQAEVENNQMLSLLNRR 196

Query: 477 ---------------ESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETEE 346
                          E  + + +    +Q +RL    ERL +  +R+RE  + + E EE
Sbjct: 197 QEERLREQEERLREQEERLREQEERLHEQEERLCEQEERLCEQEERLREHEERLCEQEE 255



>gb:NCB14D6_1689307 Neurospora crassa DNA linkage group II BAC
           contig B14D6.
          Length = 1968

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 42/184 (22%), Positives = 76/184 (41%), Gaps = 21/184 (11%)
 Frame = -2

Query: 696 QKKQKISEVKNGMEDAEALIRKMDLEARSLPP----------NAKAMLLA------KLRE 565
           Q K +I +V  G  D +A+I ++  E   L            + ++MLLA      +  E
Sbjct: 444 QSKPRIQQVDEG--DKQAIIERLKAEVAFLREQIRSSERGGGDRRSMLLAPGERSERQNE 501

Query: 564 YKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKMVSADQRQRLMMS-----TERLN 400
            +++L N   + +    +    + R   L S MA A+     + Q L  S     TERLN
Sbjct: 502 REAELQNQLLDARE---NYTTLSQRHAKLISEMAKARENEFAENQHLEESLGESATERLN 558

Query: 399 KSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDNISRSKKILTTMSR 220
           +S+   +   +V+LE E+   S+            +   TL   +   + ++ I T +  
Sbjct: 559 RSNSFAQAVEQVVLEYEKTIQSLEQSLASTRATLANTEATLLEKETKCAYTETINTQLQA 618

Query: 219 RMNR 208
           R+ +
Sbjct: 619 RLQK 622



>gb:CR382123_1656012 Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 872

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 41/161 (25%), Positives = 74/161 (45%), Gaps = 21/161 (13%)
 Frame = -2

Query: 807 NLANRMSQVFEGYERQYCELSANLTK--KCTSATLLDGEQKKQKISEVKNGME--DAEAL 640
           N+A   S V E     Y E++  L+K  K  S TL+   +K ++++ +   +   D + L
Sbjct: 514 NIAKGSSNVDEYEATSYQEIAKELSKHKKEHSETLIAIYEKTKEVTPLLEILRQTDQKRL 573

Query: 639 IRKMDLEARSLPPN-AKAMLL----AKLREYKSD--------LNNLKTEVKRITSDNANQ 499
           I  ++   + LP   +K ML     + L++Y  D        +NNL  +VKR+ S   + 
Sbjct: 574 INYLNTHFQELPDTYSKEMLTDDISSALKDYNDDTVSDVLQLINNLNLDVKRLISSIEDP 633

Query: 498 ASRDELLE----SGMADAKMVSADQRQRLMMSTERLNKSSD 388
            ++  LLE    S   D   +    + +L +   +L +SS+
Sbjct: 634 DTKVLLLEKLGASSTQDLTFLYEYYKAKLTVLNSKLIESSN 674



>gb:AB009054_1510728 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MUL8.
          Length = 331

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 16/51 (31%), Positives = 31/51 (60%)
 Frame = +1

Query: 127 LMAKLEINNQYDCNH*DSND*TDDPFVPVHPS*HCGQYLLAPADIVIHPMK 279
           L+ + E+ +  +  +   +D ++ PFV VHP  H  Q LLA ++++++ MK
Sbjct: 276 LLGEFEVQDDENGGNQCDDDGSNGPFVLVHPPRHVCQDLLALSNVIVYSMK 326



>gb:AX763686_1474396 Sequence 3 from Patent
           EP1312615.>gb:BC027824_2096136 Mus musculus angiomotin
           like 2, mRNA (cDNA clone MGC:36419 IMAGE:5323888),
           complete cds.>gb:BC088644_2565771 Xenopus laevis
           hypothetical LOC496271, mRNA (cDNA clone MGC:98561
           IMAGE:7199271), complete cds.
          Length = 772

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 28/129 (21%), Positives = 57/129 (44%), Gaps = 2/129 (1%)
 Frame = -2

Query: 804 LANRMSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKI--SEVKNGMEDAEALIRK 631
           L N + ++ E +E      S     + T    +DGE ++ +    +++  +E A   +  
Sbjct: 344 LENEIQRLSEAHESLMRTSSKREALEKTMRNKMDGEMRRLQDFNRDLRERLESANRHLAS 403

Query: 630 MDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKM 451
              EA++   +  A LLA+  E + +   L+ E+  +     +Q    ELLE  + +A+ 
Sbjct: 404 KTQEAQAGSQDMVAKLLAQSYEQQQEQEKLEREMALLRGAIEDQRRHAELLEQALGNAQS 463

Query: 450 VSADQRQRL 424
            +A   + L
Sbjct: 464 RAARAEEEL 472



>gb:U64862_1405900 Caenorhabditis elegans cosmid ZC8, complete
            sequence.
          Length = 2315

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 42/183 (22%), Positives = 77/183 (42%), Gaps = 14/183 (7%)
 Frame = -2

Query: 855  RRIFRQSCDHFKVISVNLANRMSQVFEGYERQYCELSANLTKKCTSAT---LLDGEQKKQ 685
            RR+ +Q  D  + IS NL   + +      R   +L A+  ++  +      L+ E  K 
Sbjct: 537  RRLDKQFADAKREIS-NLQKSVDEAERNSRRTDDKLRASEAERVAAEKARKFLEDELAKL 595

Query: 684  KISEVKNGMEDAEALIRKMDLEARSLPPNAKAM----------LLAKLREYKSDLNNLKT 535
            + S  K+  +DA  L  +MD    S+    K            LL +    KS++N LK 
Sbjct: 596  QASFQKSSTDDARKLRDEMDEHTNSIQEEFKTRIDELNRRVENLLRENNRLKSEVNPLKD 655

Query: 534  EVKRITSDNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIR-EGRKVML 358
            + + + ++  +   R E  E+ +      S D R+ +    + L +  DR+  +  K++ 
Sbjct: 656  KYRDLENEYNSTQRRIEEKETQI----RYSDDIRRNIQKDLDDLREKYDRVHTDNEKILG 711

Query: 357  ETE 349
            E E
Sbjct: 712  ELE 714



>gb:U64862_1405899 Caenorhabditis elegans cosmid ZC8, complete
            sequence.
          Length = 2350

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 42/183 (22%), Positives = 77/183 (42%), Gaps = 14/183 (7%)
 Frame = -2

Query: 855  RRIFRQSCDHFKVISVNLANRMSQVFEGYERQYCELSANLTKKCTSAT---LLDGEQKKQ 685
            RR+ +Q  D  + IS NL   + +      R   +L A+  ++  +      L+ E  K 
Sbjct: 572  RRLDKQFADAKREIS-NLQKSVDEAERNSRRTDDKLRASEAERVAAEKARKFLEDELAKL 630

Query: 684  KISEVKNGMEDAEALIRKMDLEARSLPPNAKAM----------LLAKLREYKSDLNNLKT 535
            + S  K+  +DA  L  +MD    S+    K            LL +    KS++N LK 
Sbjct: 631  QASFQKSSTDDARKLRDEMDEHTNSIQEEFKTRIDELNRRVENLLRENNRLKSEVNPLKD 690

Query: 534  EVKRITSDNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIR-EGRKVML 358
            + + + ++  +   R E  E+ +      S D R+ +    + L +  DR+  +  K++ 
Sbjct: 691  KYRDLENEYNSTQRRIEEKETQI----RYSDDIRRNIQKDLDDLREKYDRVHTDNEKILG 746

Query: 357  ETE 349
            E E
Sbjct: 747  ELE 749



>gb:U64862_1405898 Caenorhabditis elegans cosmid ZC8, complete
            sequence.
          Length = 2396

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 42/183 (22%), Positives = 77/183 (42%), Gaps = 14/183 (7%)
 Frame = -2

Query: 855  RRIFRQSCDHFKVISVNLANRMSQVFEGYERQYCELSANLTKKCTSAT---LLDGEQKKQ 685
            RR+ +Q  D  + IS NL   + +      R   +L A+  ++  +      L+ E  K 
Sbjct: 645  RRLDKQFADAKREIS-NLQKSVDEAERNSRRTDDKLRASEAERVAAEKARKFLEDELAKL 703

Query: 684  KISEVKNGMEDAEALIRKMDLEARSLPPNAKAM----------LLAKLREYKSDLNNLKT 535
            + S  K+  +DA  L  +MD    S+    K            LL +    KS++N LK 
Sbjct: 704  QASFQKSSTDDARKLRDEMDEHTNSIQEEFKTRIDELNRRVENLLRENNRLKSEVNPLKD 763

Query: 534  EVKRITSDNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIR-EGRKVML 358
            + + + ++  +   R E  E+ +      S D R+ +    + L +  DR+  +  K++ 
Sbjct: 764  KYRDLENEYNSTQRRIEEKETQI----RYSDDIRRNIQKDLDDLREKYDRVHTDNEKILG 819

Query: 357  ETE 349
            E E
Sbjct: 820  ELE 822



>gb:AK040912_1165785 Mus musculus adult male aorta and vein cDNA,
           RIKEN full-length enriched library, clone:A530044H24
           product:Leman coiled-coil protein, full insert sequence.
          Length = 463

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 28/129 (21%), Positives = 57/129 (44%), Gaps = 2/129 (1%)
 Frame = -2

Query: 804 LANRMSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKI--SEVKNGMEDAEALIRK 631
           L N + ++ E +E      S     + T    +DGE ++ +    +++  +E A   +  
Sbjct: 35  LENEIQRLSEAHESLMRTSSKREALEKTMRNKMDGEMRRLQDFNRDLRERLESANRHLAS 94

Query: 630 MDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKM 451
              EA++   +  A LLA+  E + +   L+ E+  +     +Q    ELLE  + +A+ 
Sbjct: 95  KTQEAQAGSQDMVAKLLAQSYEQQQEQEKLEREMALLRGAIEDQRRHAELLEQALGNAQS 154

Query: 450 VSADQRQRL 424
            +A   + L
Sbjct: 155 RAARAEEEL 163



>pir|T29999|T29999 hypothetical protein ZC8.4 - Caenorhabditis elegans
          Length = 2288

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 42/183 (22%), Positives = 77/183 (42%), Gaps = 14/183 (7%)
 Frame = -2

Query: 855  RRIFRQSCDHFKVISVNLANRMSQVFEGYERQYCELSANLTKKCTSAT---LLDGEQKKQ 685
            RR+ +Q  D  + IS NL   + +      R   +L A+  ++  +      L+ E  K 
Sbjct: 537  RRLDKQFADAKREIS-NLQKSVDEAERNSRRTDDKLRASEAERVAAEKARKFLEDELAKL 595

Query: 684  KISEVKNGMEDAEALIRKMDLEARSLPPNAKAM----------LLAKLREYKSDLNNLKT 535
            + S  K+  +DA  L  +MD    S+    K            LL +    KS++N LK 
Sbjct: 596  QASFQKSSTDDARKLRDEMDEHTNSIQEEFKTRIDELNRRVENLLRENNRLKSEVNPLKD 655

Query: 534  EVKRITSDNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIR-EGRKVML 358
            + + + ++  +   R E  E+ +      S D R+ +    + L +  DR+  +  K++ 
Sbjct: 656  KYRDLENEYNSTQRRIEEKETQI----RYSDDIRRNIQKDLDDLREKYDRVHTDNEKILG 711

Query: 357  ETE 349
            E E
Sbjct: 712  ELE 714



>pir|S41009|S41009 hypothetical protein T05G5.9 - Caenorhabditis
           elegans
          Length = 690

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 33/156 (21%), Positives = 68/156 (43%), Gaps = 3/156 (1%)
 Frame = -2

Query: 843 RQSCDHFKVISVNLANRMSQVFEGYERQYCE-LSANLTKKCTSATLLDGEQKKQKISEVK 667
           ++  ++ K+I+  L    ++  E    +  E LS +         + + ++K  +   + 
Sbjct: 113 KKDAENLKLINEKLTTESAKKVENNPTECTECLSKSGALIELEKEVFEWKEKATRADMIS 172

Query: 666 NGMEDAEALIRKMDLEARSLPPNAKAMLLAK--LREYKSDLNNLKTEVKRITSDNANQAS 493
             + D E+   K+D   R+L    +A++ A+  + E   ++NN+K E     S       
Sbjct: 173 LELRDLES---KVDQLNRALRDKTEALIKAQEVITENDLEVNNMKKEKNNTKSSIEKLTE 229

Query: 492 RDELLESGMADAKMVSADQRQRLMMSTERLNKSSDR 385
            +  L   + D K+ SAD   RL  +  R+ + SD+
Sbjct: 230 ENTRLTKALQDEKIKSADFEARLRSAECRIVELSDQ 265



>pir|T49451|T49451 kinesin-like protein Kif21a related protein
           [imported] - Neurospora crassa
          Length = 1742

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 42/184 (22%), Positives = 76/184 (41%), Gaps = 21/184 (11%)
 Frame = -2

Query: 696 QKKQKISEVKNGMEDAEALIRKMDLEARSLPP----------NAKAMLLA------KLRE 565
           Q K +I +V  G  D +A+I ++  E   L            + ++MLLA      +  E
Sbjct: 431 QSKPRIQQVDEG--DKQAIIERLKAEVAFLREQIRSSERGGGDRRSMLLAPGERSERQNE 488

Query: 564 YKSDLNNLKTEVKRITSDNANQASRDELLESGMADAKMVSADQRQRLMMS-----TERLN 400
            +++L N   + +    +    + R   L S MA A+     + Q L  S     TERLN
Sbjct: 489 REAELQNQLLDARE---NYTTLSQRHAKLISEMAKARENEFAENQHLEESLGESATERLN 545

Query: 399 KSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDNISRSKKILTTMSR 220
           +S+   +   +V+LE E+   S+            +   TL   +   + ++ I T +  
Sbjct: 546 RSNSFAQAVEQVVLEYEKTIQSLEQSLASTRATLANTEATLLEKETKCAYTETINTQLQA 605

Query: 219 RMNR 208
           R+ +
Sbjct: 606 RLQK 609



>pir|E88564|E88564 protein T05G5.9 [imported] - Caenorhabditis
           elegans
          Length = 705

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 33/156 (21%), Positives = 68/156 (43%), Gaps = 3/156 (1%)
 Frame = -2

Query: 843 RQSCDHFKVISVNLANRMSQVFEGYERQYCE-LSANLTKKCTSATLLDGEQKKQKISEVK 667
           ++  ++ K+I+  L    ++  E    +  E LS +         + + ++K  +   + 
Sbjct: 113 KKDAENLKLINEKLTTESAKKVENNPTECTECLSKSGALIELEKEVFEWKEKATRADMIS 172

Query: 666 NGMEDAEALIRKMDLEARSLPPNAKAMLLAK--LREYKSDLNNLKTEVKRITSDNANQAS 493
             + D E+   K+D   R+L    +A++ A+  + E   ++NN+K E     S       
Sbjct: 173 LELRDLES---KVDQLNRALRDKTEALIKAQEVITENDLEVNNMKKEKNNTKSSIEKLTE 229

Query: 492 RDELLESGMADAKMVSADQRQRLMMSTERLNKSSDR 385
            +  L   + D K+ SAD   RL  +  R+ + SD+
Sbjct: 230 ENTRLTKALQDEKIKSADFEARLRSAECRIVELSDQ 265



>sp|P34562|YNP9_CAEEL Hypothetical GRIP and coiled-coil
           domain-containing protein T05G5.9 in chromosome
           III.>gb:CET05G5_1367284 Caenorhabditis elegans cosmid
           T05G5, complete sequence.
          Length = 660

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 33/156 (21%), Positives = 68/156 (43%), Gaps = 3/156 (1%)
 Frame = -2

Query: 843 RQSCDHFKVISVNLANRMSQVFEGYERQYCE-LSANLTKKCTSATLLDGEQKKQKISEVK 667
           ++  ++ K+I+  L    ++  E    +  E LS +         + + ++K  +   + 
Sbjct: 68  KKDAENLKLINEKLTTESAKKVENNPTECTECLSKSGALIELEKEVFEWKEKATRADMIS 127

Query: 666 NGMEDAEALIRKMDLEARSLPPNAKAMLLAK--LREYKSDLNNLKTEVKRITSDNANQAS 493
             + D E+   K+D   R+L    +A++ A+  + E   ++NN+K E     S       
Sbjct: 128 LELRDLES---KVDQLNRALRDKTEALIKAQEVITENDLEVNNMKKEKNNTKSSIEKLTE 184

Query: 492 RDELLESGMADAKMVSADQRQRLMMSTERLNKSSDR 385
            +  L   + D K+ SAD   RL  +  R+ + SD+
Sbjct: 185 ENTRLTKALQDEKIKSADFEARLRSAECRIVELSDQ 220



>sp|O26885|THSB_METTH Thermosome beta subunit (Thermosome subunit 2)
           (Chaperonin beta subunit).>pir|H69205|H69205 chaperonin
           - Methanobacterium thermoautotrophicum (strain Delta
           H)>gb:AE000857_28490 Methanobacterium
           thermoautotrophicum from bases 714254 to 725965 (section
           63 of 148) of the complete genome.>gb:AE000666_925572
           Methanobacterium thermoautotrophicum str. Delta H
           complete genome.
          Length = 538

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 2/90 (2%)
 Frame = -2

Query: 699 EQKKQKISEVKNGMED--AEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVK 526
           EQ++Q I ++ N + D  A  L  +  ++  +    AKA +LA  R  KSD+  L     
Sbjct: 263 EQEEQMIRDMVNSIVDTGANVLFCQKGIDDLAQHYLAKAGVLAVRRVKKSDMEKLSKATG 322

Query: 525 RITSDNANQASRDELLESGMADAKMVSADQ 436
                N    S ++L E+G+   K +S ++
Sbjct: 323 ANIVTNIEDLSPEDLGEAGVVSEKKISGEE 352



>sp|Q967Z0|MYSP_DERFA Paramyosin (Allergen Der f 11) (Antigen Df642)
            (Fragment).>gb:AF352244_1264654 Dermatophagoides farinae
            paramyosin-like allergen mRNA, partial cds.
          Length = 692

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 41/213 (19%), Positives = 84/213 (39%), Gaps = 16/213 (7%)
 Frame = -2

Query: 804  LANRMSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKIS---------EVKNGMED 652
            L   ++++ + Y+ Q  EL  +L     +   L    KKQ +          EV   ++ 
Sbjct: 446  LKTEIARLKKKYQAQITELELSLDAANKANIDLQKTIKKQALQITELQAHYDEVHRQLQQ 505

Query: 651  AEALIRKMDLEARSLPPNAKAMLLA--KLREYKSDLNNLKTE----VKRITSDNANQASR 490
            A   +       ++L    + M +A  +    K     L  E    V  +T+ N N AS 
Sbjct: 506  AVDQLGVTQRRCQALQAELEEMRIALEQANRAKRQAEQLHEEAVVRVNELTTINVNLASA 565

Query: 489  DELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXX 310
               LES  +  +    +  + L +S ER+ K +  ++  + +++E +E  V +       
Sbjct: 566  KSKLESEFSALQADYDEVHKELRISDERVQKLTIELKSTKDLLIEEQERLVKLETVKKSL 625

Query: 309  XXXXLHAHDTLHGVDDN-ISRSKKILTTMSRRM 214
                   H  +  V+ N ++  K+++  +  R+
Sbjct: 626  EQEVRTLHVRIEEVEANALAGGKRVIAKLESRI 658



>sp|Q60824|BP1N_MOUSE Bullous pemphigoid antigen 1, isoforms 6/7 (BPA)
            (Hemidesmosomal plaque protein) (Dystonia musculorum
            protein) (Dystonin) (Fragments).
          Length = 1678

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 31/126 (24%), Positives = 54/126 (42%), Gaps = 11/126 (8%)
 Frame = -2

Query: 681  ISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLRE------YKSDLNNLKTEVKRI 520
            +SE K   +    +I+K + E RSL     A    K RE       ++ +  L   +KR+
Sbjct: 689  VSEFKQKCDQQSMIIQKTEKEVRSLSAELSASKEEKRREEQKAQLQRAQVQELNDRLKRV 748

Query: 519  TSDNANQASRDEL----LESGMADAKMV-SADQRQRLMMSTERLNKSSDRIREGRKVMLE 355
                     +DEL    +E  M   KM+   ++  +   S +   K  +++ E  KV+ E
Sbjct: 749  ---------QDELHLKTIEEQMTHRKMILLQEESDKFKRSADEFRKKMEKLMES-KVVTE 798

Query: 354  TEELGV 337
            T+  G+
Sbjct: 799  TDLSGI 804



>gb:BC064528_1986533 Homo sapiens hypothetical protein
           DKFZp434L0117, mRNA (cDNA clone MGC:74928
           IMAGE:5585742), complete cds.
          Length = 762

 Score = 33.1 bits (74), Expect = 7.8
 Identities = 27/130 (20%), Positives = 52/130 (40%), Gaps = 12/130 (9%)
 Frame = -2

Query: 696 QKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSD----------LN 547
           Q  QK   +     D E  +   ++E + +  + K  L     E K            +N
Sbjct: 397 QFAQKTEALSREKIDLEKKLSASEVEVQLIRESLKVALQKHSEEVKKQEERVKGRDKHIN 456

Query: 546 NLKTEVKRITSDNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKS--SDRIREG 373
           NLK + ++ +  N  +  R E LE  +AD   +   Q+Q   +    L  +   +++ E 
Sbjct: 457 NLKKKCQKESEQNREKQQRIETLERYLADLPTLEDHQKQSQQLKDSELKSTELQEKVTEL 516

Query: 372 RKVMLETEEL 343
             ++ ET+ +
Sbjct: 517 ESLLEETQAI 526



>gb:BC063848_1986391 Homo sapiens multimerin 1, mRNA (cDNA clone
           MGC:75051 IMAGE:6180674), complete cds.
          Length = 1228

 Score = 33.1 bits (74), Expect = 7.8
 Identities = 21/114 (18%), Positives = 52/114 (45%), Gaps = 1/114 (0%)
 Frame = -2

Query: 681 ISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNAN 502
           +S +   +E    +I+K++    S+    K +L+ + R   +D+  L+  +  +  +   
Sbjct: 413 VSSLSEDLESTRQIIQKVNESVVSIAAQQKFVLVQENRPTLTDIVELRNHIVNVRQEMTL 472

Query: 501 QASRD-ELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETEEL 343
              +  + LE      +     +  R ++  E LNK+  +++E  + +L TE++
Sbjct: 473 TCEKPIKELEVKQTHLEGALEQEHSRSILYYESLNKTLSKLKEVHEQLLSTEQV 526



>gb:AY125465_1936727 Homo sapiens mutant desmin mRNA, complete cds.
          Length = 470

 Score = 33.1 bits (74), Expect = 7.8
 Identities = 43/181 (23%), Positives = 76/181 (41%), Gaps = 22/181 (12%)
 Frame = -2

Query: 711 LLDGEQK-KQKISEVKNGMEDAE------------ALIRKMDLEARSLPPNAKAMLLAK- 574
           LLD  Q+ K K+ E     E+AE            A + ++DLE R    N +   L K 
Sbjct: 183 LLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKV 242

Query: 573 ----LREYKSDLNNLKTEVKR-ITSDNANQASRDELLESGMADAKMVSADQ---RQRLMM 418
               +RE ++ L   + +V+  ++  +   A RD   +     AK +S  +   + ++  
Sbjct: 243 HEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSD 302

Query: 417 STERLNKSSDRIREGRKVMLETEELGVSIXXXXXXXXXXXLHAHDTLHGVDDNISRSKKI 238
            T+  NK++D +R+ ++ M+E      S                D L G DD++ R  + 
Sbjct: 303 LTQAANKNNDALRQAKQEMMEYRHQIQSYTCEI-----------DALKGTDDSLMRQMRE 351

Query: 237 L 235
           L
Sbjct: 352 L 352



>gb:AL355877_1924121 Human DNA sequence from clone RP11-231P20 on
           chromosome 1 Contains three novel genes and the 5' end
           of a novel gene (DKFZP434L0117), the 3' end of the gene
           for connector enhancer of KSR-like (Drosophila kinase
           suppressor of ras) (CNK1), complete
           sequence.>gb:AL451139_1928258 Human DNA sequence from
           clone RP11-569G9 on chromosome 1 Contains the 3' end of
           a novel gene (DKFZP434L0117), the SH3BGRL3 gene for SH3
           domain binding glutamic acid-rich protein like 3, the
           gene for socius (SOC), the CDW52 gene for CDW52 antigen
           (CAMPATH-1 antigen), the AIM1L gene for absent in
           melanoma 1-like and a novel gene,, complete sequence.
          Length = 761

 Score = 33.1 bits (74), Expect = 7.8
 Identities = 27/130 (20%), Positives = 52/130 (40%), Gaps = 12/130 (9%)
 Frame = -2

Query: 696 QKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSD----------LN 547
           Q  QK   +     D E  +   ++E + +  + K  L     E K            +N
Sbjct: 397 QFAQKTEALSREKIDLEKKLSASEVEVQLIRESLKVALQKHSEEVKKQEERVKGRDKHIN 456

Query: 546 NLKTEVKRITSDNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKS--SDRIREG 373
           NLK + ++ +  N  +  R E LE  +AD   +   Q+Q   +    L  +   +++ E 
Sbjct: 457 NLKKKCQKESEQNREKQQRIETLERYLADLPTLEDHQKQSQQLKDSELKSTELQEKVTEL 516

Query: 372 RKVMLETEEL 343
             ++ ET+ +
Sbjct: 517 ESLLEETQAI 526



>gb:CR380950_1649691 Candida glabrata strain CBS138 chromosome D
            complete sequence.
          Length = 1980

 Score = 33.1 bits (74), Expect = 7.8
 Identities = 28/120 (23%), Positives = 59/120 (49%), Gaps = 2/120 (1%)
 Frame = -2

Query: 696  QKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKA-MLLAKLREYKSDLNNLKTEVKR- 523
            +K   I+++K  ++D E      D  +  L   AKA ML+ +L + K+DL N ++E+K+ 
Sbjct: 1766 KKDSDIAQLKKKIKDIE------DKLSNILEEKAKAAMLMTQLEKDKTDLKNSESELKQE 1819

Query: 522  ITSDNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETEEL 343
            +    +  +S +  L+S     K V  + R++    +  L  + D+++     + E + +
Sbjct: 1820 LEHYRSKYSSLESKLKSTEEAKKHVEEESREQHQSMSLDLKATKDKLKSAEISISEMDAI 1879



>gb:CR380947_1649096 Candida glabrata strain CBS138 chromosome A
           complete sequence.
          Length = 872

 Score = 33.1 bits (74), Expect = 7.8
 Identities = 36/165 (21%), Positives = 72/165 (43%), Gaps = 5/165 (3%)
 Frame = -2

Query: 696 QKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKA----MLLAKLREYKSDLNNLKTEV 529
           +  +K+ +VK   +D E+ ++KM+ E        K     ++     EY  +  ++  E+
Sbjct: 176 ETNEKLLKVK---QDFESYVQKMEQEKEVNTDQEKTKEPEVIPIDNPEYIKEREHILEEL 232

Query: 528 KRITSDNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETE 349
           +R+T D  N   R   LE      +    +++Q    ST RLN+    +    K  ++ +
Sbjct: 233 ERVTEDFKNLRDRYNDLEIKFLSIQNELDEKKQEFESSTARLNEEIHTL----KSTIDDK 288

Query: 348 ELGVSIXXXXXXXXXXXLHAHDTLHGVDD-NISRSKKILTTMSRR 217
           +  +S             +A D L  +DD N ++++K+L  +  R
Sbjct: 289 DATIS------EFKRKLGNAEDQLASIDDQNGNQNQKLLHDLKER 327



>gb:AX883438_1479337 Sequence 18343 from Patent
           EP1074617.>gb:AK024038_1909861 Homo sapiens cDNA
           FLJ13976 fis, clone Y79AA1001594, weakly similar to
           HYALURONAN-MEDIATED MOTILITY RECEPTOR.
          Length = 762

 Score = 33.1 bits (74), Expect = 7.8
 Identities = 27/130 (20%), Positives = 52/130 (40%), Gaps = 12/130 (9%)
 Frame = -2

Query: 696 QKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSD----------LN 547
           Q  QK   +     D E  +   ++E + +  + K  L     E K            +N
Sbjct: 398 QFAQKTEALSREKIDLEKKLSASEVEVQLIRESLKVALQKHSEEVKKQEERVKGRDKHIN 457

Query: 546 NLKTEVKRITSDNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKS--SDRIREG 373
           NLK + ++ +  N  +  R E LE  +AD   +   Q+Q   +    L  +   +++ E 
Sbjct: 458 NLKKKCQKESEQNREKQQRIETLERYLADLPTLEDHQKQSQQLKDSELKSTELQEKVTEL 517

Query: 372 RKVMLETEEL 343
             ++ ET+ +
Sbjct: 518 ESLLEETQAI 527



>gb:BLA271077_1355337 Branchiostoma lanceolatum mRNA for nuclear
           lamin (lamin gene).
          Length = 630

 Score = 33.1 bits (74), Expect = 7.8
 Identities = 45/194 (23%), Positives = 91/194 (46%), Gaps = 27/194 (13%)
 Frame = -2

Query: 843 RQSCDHFKVISVNLANRMSQVFEGYE--RQYCE--LSANLTKKCTSATLLDGEQKKQKIS 676
           R   +   ++ V+L N++  + E  E  +Q  E  L+ + T+K  S T +D  +     +
Sbjct: 198 RNELEEETLLRVDLENKVQTLREEVEFNKQVYEQELTESRTRKEVSITEVDAGE-----A 252

Query: 675 EVKNGMEDAEALIRKM-DLEARSLPPNAKAMLLAKLREYKSD------------------ 553
           E ++ +++A   +R+  +LEARS+    + M   K+   KSD                  
Sbjct: 253 EFESRLQEALREMREQHELEARSMREELETMYTQKMTSMKSDSERGSNALSVAREEMRES 312

Query: 552 ---LNNLKTEVKRITSDNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRI 382
              +++L ++V  +   NA+  +R + LE  MA    +S + R     S+E+  +   ++
Sbjct: 313 RARIDSLMSQVSGLQGQNASLEARCKELEGMMA---RMSEESRS----SSEQYERGIRQL 365

Query: 381 REG-RKVMLETEEL 343
           RE   ++M++ +EL
Sbjct: 366 REEISQMMVDYQEL 379



>gb:BLA132255_1355330 Branchiostoma lanceolatum mRNA for lamin,
           partial.
          Length = 454

 Score = 33.1 bits (74), Expect = 7.8
 Identities = 45/194 (23%), Positives = 91/194 (46%), Gaps = 27/194 (13%)
 Frame = -2

Query: 843 RQSCDHFKVISVNLANRMSQVFEGYE--RQYCE--LSANLTKKCTSATLLDGEQKKQKIS 676
           R   +   ++ V+L N++  + E  E  +Q  E  L+ + T+K  S T +D  +     +
Sbjct: 22  RNELEEETLLRVDLENKVQTLREEVEFNKQVYEQELTESRTRKEVSITEVDAGE-----A 76

Query: 675 EVKNGMEDAEALIRKM-DLEARSLPPNAKAMLLAKLREYKSD------------------ 553
           E ++ +++A   +R+  +LEARS+    + M   K+   KSD                  
Sbjct: 77  EFESRLQEALREMREQHELEARSMREELETMYTQKMTSMKSDSERGSNALSVAREEMRES 136

Query: 552 ---LNNLKTEVKRITSDNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRI 382
              +++L ++V  +   NA+  +R + LE  MA    +S + R     S+E+  +   ++
Sbjct: 137 RARIDSLMSQVSGLQGQNASLEARCKELEGMMA---RMSEESRS----SSEQYERGIRQL 189

Query: 381 REG-RKVMLETEEL 343
           RE   ++M++ +EL
Sbjct: 190 REEISQMMVDYQEL 203



>gb:AY189697_1308714 Dermatophagoides pteronyssinus HDM allergen mRNA,
            complete cds.
          Length = 875

 Score = 33.1 bits (74), Expect = 7.8
 Identities = 41/213 (19%), Positives = 84/213 (39%), Gaps = 16/213 (7%)
 Frame = -2

Query: 804  LANRMSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKIS---------EVKNGMED 652
            L   ++++ + Y+ Q  EL  +L     +   L    KKQ +          EV   ++ 
Sbjct: 532  LKTEIARLKKKYQAQITELELSLDAANKANIDLQKTIKKQALQITELQAHYDEVHRQLQQ 591

Query: 651  AEALIRKMDLEARSLPPNAKAMLLA--KLREYKSDLNNLKTE----VKRITSDNANQASR 490
            A   +       ++L    + M +A  +    K     L  E    V  +T+ N N AS 
Sbjct: 592  AVDQLGVTQRRCQALQAELEEMRIALEQASRAKRQAEQLHEEAVVRVNELTTINVNLASA 651

Query: 489  DELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETEELGVSIXXXXXXX 310
               LES  +  +    +  + L +S ER+ K +  ++  + +++E +E  V +       
Sbjct: 652  KSKLESEFSALQADYDEVHKELRISDERVQKLTIELKSTKDLLIEEQERLVKLETVKKSL 711

Query: 309  XXXXLHAHDTLHGVDDN-ISRSKKILTTMSRRM 214
                   H  +  V+ N ++  K+++  +  R+
Sbjct: 712  EQEVRTLHVRIEEVEANALAGGKRVIAKLESRI 744



>gb:AB159602_1201650 Babesia equi Be158 mRNA, complete cds.
          Length = 991

 Score = 33.1 bits (74), Expect = 7.8
 Identities = 36/149 (24%), Positives = 66/149 (44%), Gaps = 5/149 (3%)
 Frame = -2

Query: 777  EGYERQYCELSANLTKKCTSATLLDG--EQKKQKISEVKNGMEDAEALIRKM-DLEARSL 607
            +G++ +  EL A   +     T LD   +Q   K  E+KN  E   +  +++ D  A+S 
Sbjct: 559  KGHQTKSAELLAFEAQLKNQQTQLDATKQQLDAKEKELKNNQEQLNSKKKELEDAVAKSK 618

Query: 606  PPNAKAMLLAKLREYKSD-LNNLKTEVKRITSDNANQASRDELLESGMADAKMVSADQRQ 430
                K   + +  E  ++ L+  K E+    +DNA   +R + LE+ +   K    D + 
Sbjct: 619  ELEEKQKEMKQQAEKDAENLSAAKNELTTAKADNAALENRKKELETELEKYKADLEDSKN 678

Query: 429  RLMMSTERLNK-SSDRIREGRKVMLETEE 346
             +      LNK  SD   +  ++  +T+E
Sbjct: 679  TVTTKESELNKLKSDLESKADQLQQKTQE 707



>gb:HSM801466_1186189 Homo sapiens mRNA; cDNA DKFZp434L0117 (from
           clone DKFZp434L0117).>gb:AL355877_1924122 Human DNA
           sequence from clone RP11-231P20 on chromosome 1 Contains
           three novel genes and the 5' end of a novel gene
           (DKFZP434L0117), the 3' end of the gene for connector
           enhancer of KSR-like (Drosophila kinase suppressor of
           ras) (CNK1), complete sequence.>gb:AL451139_1928259
           Human DNA sequence from clone RP11-569G9 on chromosome 1
           Contains the 3' end of a novel gene (DKFZP434L0117), the
           SH3BGRL3 gene for SH3 domain binding glutamic acid-rich
           protein like 3, the gene for socius (SOC), the CDW52
           gene for CDW52 antigen (CAMPATH-1 antigen), the AIM1L
           gene for absent in melanoma 1-like and a novel gene,,
           complete sequence.
          Length = 434

 Score = 33.1 bits (74), Expect = 7.8
 Identities = 27/130 (20%), Positives = 52/130 (40%), Gaps = 12/130 (9%)
 Frame = -2

Query: 696 QKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSD----------LN 547
           Q  QK   +     D E  +   ++E + +  + K  L     E K            +N
Sbjct: 70  QFAQKTEALSREKIDLEKKLSASEVEVQLIRESLKVALQKHSEEVKKQEERVKGRDKHIN 129

Query: 546 NLKTEVKRITSDNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKS--SDRIREG 373
           NLK + ++ +  N  +  R E LE  +AD   +   Q+Q   +    L  +   +++ E 
Sbjct: 130 NLKKKCQKESEQNREKQQRIETLERYLADLPTLEDHQKQSQQLKDSELKSTELQEKVTEL 189

Query: 372 RKVMLETEEL 343
             ++ ET+ +
Sbjct: 190 ESLLEETQAI 199



>gb:BA000033_710548 Staphylococcus aureus subsp. aureus MW2 DNA,
           complete genome, strain:MW2.>gb:BX571857_782471
           Staphylococcus aureus strain MSSA476, complete genome.
          Length = 507

 Score = 33.1 bits (74), Expect = 7.8
 Identities = 34/148 (22%), Positives = 63/148 (42%), Gaps = 12/148 (8%)
 Frame = -2

Query: 750 LSANLTKKCTSATLLDGEQKK--QKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLA 577
           LS   TKK T A L + ++ K  +K+ E +   +D E  I+K   + +    +  A + +
Sbjct: 242 LSRADTKKITLAVLEEAKKDKDLKKLMEEQGATKDFEKDIKKAIDDVKETKKDEFAKIQS 301

Query: 576 KLREYK----------SDLNNLKTEVKRITSDNANQASRDELLESGMADAKMVSADQRQR 427
           K+   K          +D  N KT++K   +   ++   D  L+          A    +
Sbjct: 302 KIYTEKHTIVKREITITDKENNKTKIKGTNTLEDDKLKLDYALDFDQDKYTYAEAKYTIK 361

Query: 426 LMMSTERLNKSSDRIREGRKVMLETEEL 343
            + S E+ NK SD+   G+K   +  ++
Sbjct: 362 GVSSKEKDNKYSDKYEFGKKTEYDESKI 389



>gb:AY596297_633190 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 908

 Score = 33.1 bits (74), Expect = 7.8
 Identities = 34/158 (21%), Positives = 65/158 (41%), Gaps = 8/158 (5%)
 Frame = -2

Query: 798 NRMSQVFEGYERQYCELSANLTKKCTSATLLDGEQKKQKISEVKNGMEDAEALIRKMDLE 619
           + +    E  E Q       LT+    + L + E+K+ ++S ++  +ED EA I + + E
Sbjct: 233 SELQDEIEHIEDQKATAEETLTQ--AESVLEEYEEKRDELSTLEADIEDLEATITETETE 290

Query: 618 ARSLPPNAKAM--LLAKLRE------YKSDLNNLKTEVKRITSDNANQASRDELLESGMA 463
              L      +      LRE       K+DL++ + + + + +      SRD+ L+S + 
Sbjct: 291 RTELKEQVSDLQDQRESLREDLSETVAKTDLDSSEPDPETVDARLDELQSRDDELQSRIE 350

Query: 462 DAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETE 349
           D ++ + D         E       R  + R+   E E
Sbjct: 351 DQRVDAKDHSSTADALAESAADLESRAEDKREEAAELE 388



>gb:AE017263_420571 Mesoplasma florum L1 complete genome.
          Length = 604

 Score = 33.1 bits (74), Expect = 7.8
 Identities = 32/129 (24%), Positives = 51/129 (39%), Gaps = 3/129 (2%)
 Frame = -2

Query: 732 KKCTSATLLDGEQKKQKISEVKNGMEDAEALIRK---MDLEARSLPPNAKAMLLAKLREY 562
           K+  ++T  + +Q  +K+ E K     A +  +K      E      N K ++  K+ E 
Sbjct: 45  KEAINSTNKNSKQPTKKVVEPKTSTVVANSNTKKPLSKSEEKLINKINEKELIKQKIAED 104

Query: 561 KSDLNNLKTEVKRITSDNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKSSDRI 382
           K      K E KRI  +   Q     LLE    D K +   + +   M  E       RI
Sbjct: 105 KKLKKQNKAEAKRIYQEQIKQEKNRILLEKQEKDLKQIQEAEAKAKKMEAE-------RI 157

Query: 381 REGRKVMLE 355
            + +K+ LE
Sbjct: 158 ADAKKLALE 166



>gb:CR767821_116834 Ehrlichia ruminantium strain Welgevonden,
           complete genome.>gb:CR925678_118706 Ehrlichia
           ruminantium str. Welgevonden, complete genome.
          Length = 639

 Score = 33.1 bits (74), Expect = 7.8
 Identities = 28/123 (22%), Positives = 54/123 (43%), Gaps = 9/123 (7%)
 Frame = -2

Query: 699 EQKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRI 520
           E+ K K+S      E  ++ +   +  ++SLP +   + ++KL   K D   L TE K  
Sbjct: 186 EKDKAKVSTESKSSELDKSKVHIKEDNSKSLPEDTSKLDISKLPAIKEDKAKLSTESKSS 245

Query: 519 TSDNANQASRDELLES-----GMADAKMVSADQRQRLMMSTE----RLNKSSDRIREGRK 367
             D +    +++  +S       +D   + A +  +  +STE     L+K+   I+E + 
Sbjct: 246 ELDKSKVHVKEDKSKSLPEDTSKSDVSELPAIKEDKAKLSTESKSSELDKNKVHIKEDKS 305

Query: 366 VML 358
             L
Sbjct: 306 KSL 308



>pir|T43448|T43448 hypothetical protein DKFZp434L0117.1 - human
           (fragment)
          Length = 434

 Score = 33.1 bits (74), Expect = 7.8
 Identities = 27/130 (20%), Positives = 52/130 (40%), Gaps = 12/130 (9%)
 Frame = -2

Query: 696 QKKQKISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSD----------LN 547
           Q  QK   +     D E  +   ++E + +  + K  L     E K            +N
Sbjct: 70  QFAQKTEALSREKIDLEKKLSASEVEVQLIRESLKVALQKHSEEVKKQEERVKGRDKHIN 129

Query: 546 NLKTEVKRITSDNANQASRDELLESGMADAKMVSADQRQRLMMSTERLNKS--SDRIREG 373
           NLK + ++ +  N  +  R E LE  +AD   +   Q+Q   +    L  +   +++ E 
Sbjct: 130 NLKKKCQKESEQNREKQQRIETLERYLADLPTLEDHQKQSQQLKDSELKSTELQEKVTEL 189

Query: 372 RKVMLETEEL 343
             ++ ET+ +
Sbjct: 190 ESLLEETQAI 199



>pir|A57384|A57384 multimerin, endothelial cell, precursor - human
          Length = 1228

 Score = 33.1 bits (74), Expect = 7.8
 Identities = 21/114 (18%), Positives = 52/114 (45%), Gaps = 1/114 (0%)
 Frame = -2

Query: 681 ISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNAN 502
           +S +   +E    +I+K++    S+    K +L+ + R   +D+  L+  +  +  +   
Sbjct: 413 VSSLSEDLESTRQIIQKVNESVVSIAAQQKFVLVQENRPTLTDIVELRNHIVNVRQEMTL 472

Query: 501 QASRD-ELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETEEL 343
              +  + LE      +     +  R ++  E LNK+  +++E  + +L TE++
Sbjct: 473 TCEKPIKELEVKQTHLEGALEQEHSRSILYYESLNKTLSKLKEVHEQLLSTEQV 526



>sp|Q13201|EMI4_HUMAN Multimerin 1 precursor (Endothelial cell
           multimerin 1) (EMILIN 4) (Elastin microfibril interface
           located protein 4) (Elastin microfibril interfacer
           4).>gb:HSU27109_2023091 Human prepromultimerin mRNA,
           complete cds.
          Length = 1228

 Score = 33.1 bits (74), Expect = 7.8
 Identities = 21/114 (18%), Positives = 52/114 (45%), Gaps = 1/114 (0%)
 Frame = -2

Query: 681 ISEVKNGMEDAEALIRKMDLEARSLPPNAKAMLLAKLREYKSDLNNLKTEVKRITSDNAN 502
           +S +   +E    +I+K++    S+    K +L+ + R   +D+  L+  +  +  +   
Sbjct: 413 VSSLSEDLESTRQIIQKVNESVVSIAAQQKFVLVQENRPTLTDIVELRNHIVNVRQEMTL 472

Query: 501 QASRD-ELLESGMADAKMVSADQRQRLMMSTERLNKSSDRIREGRKVMLETEEL 343
              +  + LE      +     +  R ++  E LNK+  +++E  + +L TE++
Sbjct: 473 TCEKPIKELEVKQTHLEGALEQEHSRSILYYESLNKTLSKLKEVHEQLLSTEQV 526


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 917,387,652
Number of Sequences: 1806583
Number of extensions: 18417710
Number of successful extensions: 50926
Number of sequences better than 10.0: 135
Number of HSP's better than 10.0 without gapping: 47831
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 50747
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 65138106306
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)