BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10731
         (1190 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T00502|T00502 probable receptor-like protein kinase At2g2330...   386   e-106   Arabidopsis thaliana [mouse-ear cress]
gb:AB025614_1516378 Arabidopsis thaliana genomic DNA, chromosome...   377   e-103   
gb:AY054256_1563076 Arabidopsis thaliana AT5g67280/K3G17_4 mRNA,...   374   e-102   
gb:AY065068_1566222 Arabidopsis thaliana AT4g37250/C7A10_110 mRN...   373   e-102   
pir|B85440|B85440 receptor kinase-like protein [imported] - Arab...   373   e-102   Arabidopsis thaliana [mouse-ear cress]
gb:AP003573_1831100 Oryza sativa (japonica cultivar-group) genom...   310   5e-83   
gb:AP005709_1856432 Oryza sativa (japonica cultivar-group) genom...   285   1e-75   
gb:AY035109_1559880 Arabidopsis thaliana putative receptor prote...   258   2e-67   
pir|T05414|T05414 protein kinase homolog F28A23.20 - Arabidopsis...   255   1e-66   Arabidopsis thaliana [mouse-ear cress]
pir|C84527|C84527 probable receptor-like protein kinase [importe...   239   1e-61   Arabidopsis thaliana [mouse-ear cress]
pir|H84421|H84421 probable receptor-like protein kinase [importe...   236   9e-61   Arabidopsis thaliana [mouse-ear cress]
gb:AP003202_1825076 Oryza sativa (japonica cultivar-group) genom...   232   1e-59   
pir|A86383|A86383 76.4K protein kinase homolog F4F7.29 - Arabido...   225   2e-57   Arabidopsis thaliana [mouse-ear cress]
pir|T02154|T02154 protein kinase homolog T1F15.2 - Arabidopsis t...   212   1e-53   Arabidopsis thaliana [mouse-ear cress]
gb:AC013288_1537852 Arabidopsis thaliana chromosome 1 BAC F4N21 ...   186   1e-45   
gb:BT010733_1640679 Arabidopsis thaliana At3g57830 gene, complet...   169   8e-41   
pir|T46005|T46005 receptor-like protein kinase - Arabidopsis tha...   169   8e-41   Arabidopsis thaliana [mouse-ear cress]
pir|B84852|B84852 probable receptor-like protein kinase [importe...   166   9e-40   Arabidopsis thaliana [mouse-ear cress]
gb:AX196315_1463942 Sequence 22 from Patent WO0151627.                162   9e-39   
gb:AX196312_1463939 Sequence 19 from Patent WO0151627.>gb:AX1963...   162   9e-39   
gb:AX196311_1463938 Sequence 18 from Patent WO0151627.>gb:AX1963...   162   9e-39   
gb:AX196310_1463937 Sequence 17 from Patent WO0151627.                162   9e-39   
gb:AX196309_1463936 Sequence 16 from Patent WO0151627.                162   9e-39   
gb:AX196306_1463933 Sequence 13 from Patent WO0151627.                160   6e-38   
gb:AX196305_1463932 Sequence 12 from Patent WO0151627.                160   6e-38   
gb:AX196304_1463931 Sequence 11 from Patent WO0151627.                160   6e-38   
gb:AX196303_1463930 Sequence 10 from Patent WO0151627.                160   6e-38   
gb:AX196296_1463926 Sequence 3 from Patent WO0151627.>gb:AX19630...   160   6e-38   
gb:AX196295_1463925 Sequence 2 from Patent WO0151627.>gb:AX19630...   160   6e-38   
gb:AF506516_1806898 Glycine max receptor-like kinase RHG1 gene, ...   159   1e-37   
gb:AP005245_1849450 Oryza sativa (japonica cultivar-group) genom...   155   2e-36   
pir|B84664|B84664 probable receptor-like protein kinase [importe...   155   2e-36   Arabidopsis thaliana [mouse-ear cress]
gb:AY050870_1562365 Arabidopsis thaliana putative receptor prote...   152   2e-35   
pir|T46070|T46070 hypothetical protein T18N14.120 - Arabidopsis ...   149   8e-35   Arabidopsis thaliana [mouse-ear cress]
gb:AP003255_1826441 Oryza sativa (japonica cultivar-group) genom...   147   3e-34   
gb:AF084034_1767051 Arabidopsis thaliana receptor-like protein k...   146   7e-34   
pir|G96524|G96524 protein T1N15.9 [imported] - Arabidopsis thali...   146   9e-34   Arabidopsis thaliana [mouse-ear cress]
gb:AP003302_1827702 Oryza sativa (japonica cultivar-group) genom...   143   6e-33   
gb:AC144737_1744140 Oryza sativa (japonica cultivar-group) chrom...   142   1e-32   
gb:AY102147_1577752 Arabidopsis thaliana At1g68400/T2E12_5 mRNA,...   142   1e-32   
gb:AY086189_1571244 Arabidopsis thaliana clone 22221 mRNA, compl...   142   1e-32   
gb:AB019230_1514140 Arabidopsis thaliana genomic DNA, chromosome...   142   1e-32   
pir|T48210|T48210 hypothetical protein T20L15.160 - Arabidopsis ...   142   1e-32   Arabidopsis thaliana [mouse-ear cress]
gb:AP001800_1821417 Oryza sativa (japonica cultivar-group) genom...   142   1e-32   
pir|H96707|H96707 probable receptor kinase T2E12.5 [imported] - ...   142   1e-32   Arabidopsis thaliana [mouse-ear cress]
gb:AP005099_1847794 Oryza sativa (japonica cultivar-group) genom...   141   2e-32   
gb:AP006168_1861232 Oryza sativa (japonica cultivar-group) genom...   141   3e-32   
pir|B84782|B84782 probable receptor-like protein kinase [importe...   141   3e-32   Arabidopsis thaliana [mouse-ear cress]
gb:AB028616_1518004 Arabidopsis thaliana genomic DNA, chromosome...   140   4e-32   
pir|B86440|B86440 probable protein kinase [imported] - Arabidops...   140   4e-32   Arabidopsis thaliana [mouse-ear cress]
gb:AP004991_1846852 Oryza sativa (japonica cultivar-group) genom...   139   1e-31   
gb:AP002882_1823607 Oryza sativa (japonica cultivar-group) genom...   139   1e-31   
gb:AP000391_1819980 Oryza sativa (japonica cultivar-group) genom...   139   1e-31   
gb:AY756174_1627010 Oryza rufipogon putative leucine-rich repeat...   139   1e-31   
gb:AY332474_1600056 Oryza sativa (japonica cultivar-group) trans...   139   1e-31   
gb:AY244746_1592517 Arabidopsis thaliana ERECTA-like kinase 2 (E...   139   1e-31   
pir|T48489|T48489 receptor-like protein kinase - Arabidopsis tha...   139   1e-31   Arabidopsis thaliana [mouse-ear cress]
pir|D86466|D86466 69.4K hypothetical protein F23M19.11 - Arabido...   138   2e-31   Arabidopsis thaliana [mouse-ear cress]
gb:AP007224_1863293 Oryza sativa (japonica cultivar-group) genom...   138   3e-31   
gb:AF384969_1794544 Arabidopsis thaliana somatic embryogenesis r...   138   3e-31   
gb:AC135209_1742079 Oryza sativa (japonica cultivar-group) chrom...   138   3e-31   
gb:AY756174_1627015 Oryza rufipogon putative leucine-rich repeat...   138   3e-31   
gb:OSJN00299_1698204 Oryza sativa genomic DNA, chromosome 4, BAC...   137   3e-31   
gb:AP004140_1838185 Oryza sativa (japonica cultivar-group) genom...   137   4e-31   
gb:ATH550163_1552879 Arabidopsis thaliana mRNA for LRR receptor-...   137   4e-31   
pir|H84770|H84770 probable receptor-like protein kinase [importe...   137   4e-31   Arabidopsis thaliana [mouse-ear cress]
gb:AC114983_1739204 Oryza sativa (japonica cultivar-group) chrom...   137   6e-31   
gb:AY714494_1624025 Oryza sativa (indica cultivar-group) clone O...   137   6e-31   
gb:AC012562_1537725 Arabidopsis thaliana chromosome 3 BAC F17O14...   137   6e-31   
gb:AP005473_1852497 Oryza sativa (japonica cultivar-group) genom...   136   7e-31   
gb:AF384970_1794545 Arabidopsis thaliana somatic embryogenesis r...   136   7e-31   
gb:AB018111_1513765 Arabidopsis thaliana genomic DNA, chromosome...   136   7e-31   
gb:AX120065_1461712 Sequence 48 from Patent WO0129240.                136   7e-31   
pir|T05994|T05994 protein kinase homolog F17M5.190 - Arabidopsis...   136   7e-31   Arabidopsis thaliana [mouse-ear cress]
sp|Q94F62|BAK1_ARATH|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated re...   136   7e-31   Arabidopsis thaliana [mouse-ear cress]
gb:AB092809_1525111 Lotus corniculatus var. japonicus HAR1 gene ...   136   1e-30   
gb:AP003214_1825331 Oryza sativa (japonica cultivar-group) genom...   135   1e-30   
gb:AC104280_1737456 Oryza sativa (japonica cultivar-group) chrom...   135   1e-30   
gb:AC082645_1733172 Oryza sativa chromosome 3 BAC OSJNBb0033N16 ...   135   1e-30   
gb:BT006178_1639070 Arabidopsis thaliana clone RAFL16-01-D23 (R2...   135   1e-30   
gb:AE005173_895101 Arabidopsis thaliana chromosome 1, bottom arm...   135   1e-30   
gb:AY070033_1566676 Arabidopsis thaliana unknown protein (At3g56...   135   2e-30   
pir|T49038|T49038 hypothetical protein T5P19.20 - Arabidopsis th...   135   2e-30   Arabidopsis thaliana [mouse-ear cress]
pir|B84659|B84659 probable receptor-like protein kinase, ERECTA ...   135   2e-30   Arabidopsis thaliana [mouse-ear cress]
gb:AY048200_1561662 Arabidopsis thaliana At1g71830/F14O23_24 mRN...   135   2e-30   
gb:ATAC010871_1543204 Arabidopsis thaliana chromosome III BAC T1...   135   2e-30   
gb:AP004121_1837906 Oryza sativa (japonica cultivar-group) genom...   134   3e-30   
gb:AP004087_1837530 Oryza sativa (japonica cultivar-group) genom...   134   3e-30   
gb:AP004014_1836377 Oryza sativa (japonica cultivar-group) genom...   134   3e-30   
gb:AP000816_1820640 Oryza sativa (japonica cultivar-group) genom...   134   3e-30   
gb:AC134344_1741739 Oryza sativa (japonica cultivar-group) chrom...   134   3e-30   
gb:AY632360_1618711 Gossypium hirsutum BAC 106I22, complete sequ...   134   3e-30   
gb:A67827_1450282 Sequence 32 from Patent WO9743427.>gb:CQ768543...   134   3e-30   
pir|H96740|H96740 hypothetical protein F14O23.21 [imported] - Ar...   134   3e-30   Arabidopsis thaliana [mouse-ear cress]
sp|P43298|TMK1_ARATH|TMK1_ARATH Putative receptor protein kinase TMK1 precu...   134   3e-30   Arabidopsis thaliana [mouse-ear cress]
gb:AP005810_1858257 Oryza sativa (japonica cultivar-group) genom...   134   4e-30   
gb:OSJN00019_1693370 Oryza sativa genomic DNA, chromosome 4, BAC...   134   4e-30   
gb:AY632359_1618697 Gossypium hirsutum BAC 155C17, complete sequ...   134   4e-30   
gb:AE005173_894080 Arabidopsis thaliana chromosome 1, bottom arm...   134   4e-30   
gb:AF084037_1767054 Arabidopsis thaliana receptor-like protein k...   134   5e-30   
gb:AC104427_1737594 Oryza sativa (japonica cultivar-group) chrom...   134   5e-30   
gb:PSA495759_1701999 Pisum sativum sym29 gene for serine-threoni...   134   5e-30   
gb:OSJN00072_1694323 Oryza sativa genomic DNA, chromosome 4, BAC...   134   5e-30   
gb:AY140033_1582473 Arabidopsis thaliana protein kinase-like pro...   134   5e-30   
gb:AB020746_1514621 Arabidopsis thaliana genomic DNA, chromosome...   134   5e-30   
pir|T04842|T04842 protein kinase AK4 (EC 2.7.1.-) - Arabidopsis ...   134   5e-30   Arabidopsis thaliana [mouse-ear cress]
pir|T14354|T14354 probable somatic embryogenesis receptor-like k...   134   5e-30   Daucus carota [carrots]
gb:BT015370_1642198 Arabidopsis thaliana At5g01560 gene, complet...   133   6e-30   
gb:AY188755_1588361 Zea mays atypical receptor-like kinase MARK ...   133   6e-30   
pir|T48177|T48177 receptor like protein kinase - Arabidopsis tha...   133   6e-30   Arabidopsis thaliana [mouse-ear cress]
pir|T05606|T05606 protein kinase homolog F9D16.210 - Arabidopsis...   133   6e-30   Arabidopsis thaliana [mouse-ear cress]
gb:AP005742_1856983 Oryza sativa (japonica cultivar-group) genom...   133   8e-30   
gb:BT008409_1639626 Arabidopsis thaliana At3g24600 gene, complet...   133   8e-30   
gb:AB092811_1525116 Glycine max NTS1 gene for LRR receptor-like ...   133   8e-30   
gb:AB020746_1514623 Arabidopsis thaliana genomic DNA, chromosome...   133   8e-30   
gb:AE016959_1020675 Oryza sativa (japonica cultivar-group) chrom...   133   8e-30   
pir|T50850|T50850 receptor protein kinase homolog [imported] - s...   133   8e-30   Glycine max [soybeans]
pir|T50851|T50851 receptor protein kinase homolog [imported] - s...   133   8e-30   Glycine max [soybeans]
gb:AC145120_1744276 Solanum demissum chromosome 5 BAC PGEC446O19...   132   1e-29   
gb:AC135288_1742197 Solanum demissum chromosome 5 BAC PGEC219 ge...   132   1e-29   
gb:AY730335_1625407 Solanum tuberosum strain P6/210 clone BAC BA...   132   1e-29   
gb:AC144737_1744149 Oryza sativa (japonica cultivar-group) chrom...   132   1e-29   
gb:AC099732_1737183 Oryza sativa (japonica cultivar-group) chrom...   132   1e-29   
gb:OSJN00075_1694384 Oryza sativa genomic DNA, chromosome 4, BAC...   132   1e-29   
gb:AY652735_1620180 Oryza sativa (japonica cultivar-group) somat...   132   1e-29   
gb:AE016959_1020855 Oryza sativa (japonica cultivar-group) chrom...   132   1e-29   
sp|Q9LYN8|EXS_ARATH|EXS_ARATH Leucine-rich repeat receptor protein kinase ...   132   1e-29   Arabidopsis thaliana [mouse-ear cress]
gb:AP003434_1829307 Oryza sativa (japonica cultivar-group) genom...   132   2e-29   
gb:AC093018_1735842 Oryza sativa chromosome 3 BAC OSJNBb0081B07 ...   132   2e-29   
gb:ZMA277703_1731488 Zea mays mRNA for SERK2 protein.                 132   2e-29   
gb:OSJN00019_1693374 Oryza sativa genomic DNA, chromosome 4, BAC...   132   2e-29   
gb:AB115767_1527521 Citrus unshiu SERK mRNA for somatic embryoge...   132   2e-29   
gb:AB054061_1521307 Brassica rapa SRK22 mRNA for S locus recepto...   132   2e-29   
gb:AB008270_1510484 Arabidopsis thaliana genomic DNA, chromosome...   132   2e-29   
gb:AP005905_1859878 Oryza sativa (japonica cultivar-group) genom...   131   2e-29   
gb:AP004858_1846106 Oryza sativa (japonica cultivar-group) genom...   131   2e-29   
gb:AY182166_1587874 Elaeis guineensis clone Rlk-OPmf receptor-li...   131   2e-29   
gb:AB005231_1509264 Arabidopsis thaliana genomic DNA, chromosome...   131   2e-29   
pir|T48176|T48176 receptor like protein kinase - Arabidopsis tha...   131   2e-29   Arabidopsis thaliana [mouse-ear cress]
gb:AP003863_1834478 Oryza sativa (japonica cultivar-group) genom...   131   3e-29   
gb:AC137001_1743353 Oryza sativa (japonica cultivar-group) chrom...   131   3e-29   
gb:AC091532_1734806 Oryza sativa chromosome 3 BAC OSJNBa0078A17 ...   131   3e-29   
gb:AY244745_1592516 Arabidopsis thaliana ERECTA-like kinase 1 (E...   131   3e-29   
gb:AY224526_1590723 Oryza sativa (japonica cultivar-group) isola...   131   3e-29   
gb:AY080606_1568350 Arabidopsis thaliana putative receptor prote...   131   3e-29   
gb:AX088876_1461047 Sequence 1 from Patent WO0114563.>gb:AX82570...   131   3e-29   
pir|T48175|T48175 receptor like protein kinase - Arabidopsis tha...   131   3e-29   Arabidopsis thaliana [mouse-ear cress]
pir|T04587|T04587 hypothetical protein F23E13.70 - Arabidopsis t...   131   3e-29   Arabidopsis thaliana [mouse-ear cress]
pir|T04124|T04124 receptor-like protein kinase (EC 2.7.1.-) - ri...   131   3e-29   Oryza sativa [red rice]
gb:AP005679_1855870 Oryza sativa (japonica cultivar-group) genom...   130   4e-29   
gb:AP003736_1832655 Oryza sativa (japonica cultivar-group) genom...   130   4e-29   
gb:AY463361_1607685 Oryza sativa (indica cultivar-group) benzoth...   130   4e-29   
gb:AY162176_1585779 Medicago truncatula somatic embryogenesis re...   130   4e-29   
gb:AY059897_1564741 Arabidopsis thaliana receptor protein kinase...   130   4e-29   
gb:AB188247_1529358 Oryza sativa (japonica cultivar-group) OsSER...   130   4e-29   
gb:AB020742_1514573 Arabidopsis thaliana genomic DNA, chromosome...   130   4e-29   
pir|F85057|F85057 receptor-like protein kinase [imported] - Arab...   130   4e-29   Arabidopsis thaliana [mouse-ear cress]
pir|G85056|G85056 probable receptor-like protein kinase [importe...   130   4e-29   Arabidopsis thaliana [mouse-ear cress]
pir|S31429|S31429 S-receptor kinase (EC 2.7.1.-) precursor - wil...   130   4e-29   Brassica oleracea
gb:AP004326_1840210 Oryza sativa (japonica cultivar-group) genom...   130   5e-29   
gb:AP004084_1837460 Oryza sativa (japonica cultivar-group) genom...   130   5e-29   
gb:AK118052_1816052 Arabidopsis thaliana At5g62230 mRNA for unkn...   130   5e-29   
gb:BT006440_1639327 Arabidopsis thaliana At1g60630 gene, complet...   130   5e-29   
gb:AY085517_1570586 Arabidopsis thaliana clone 15535 mRNA, compl...   130   5e-29   
gb:AB032474_1518697 Brassica oleracea SRK60 mRNA for S60 S-locus...   130   5e-29   
gb:AB024421S2_1515950 Brassica oleracea SRK13-b gene, exon 2, 3,...   130   5e-29   
gb:AB024419S2_1515949 Brassica oleracea SRK13 gene, exon 2, 3, 4...   130   5e-29   
pir|E96631|E96631 probable receptor kinase F8A5.15 [imported] - ...   130   5e-29   Arabidopsis thaliana [mouse-ear cress]
pir|T51453|T51453 serine/threonine specific protein kinase-like ...   130   5e-29   Arabidopsis thaliana [mouse-ear cress]
sp|P17801|KPRO_MAIZE|KPRO_MAIZE Putative receptor protein kinase ZmPK1 prec...   130   5e-29   Zea mays [maize]
gb:AJ841697_1814400 Poa pratensis serk2 gene for somatic embryog...   130   7e-29   
gb:AC129720_1740666 Oryza sativa (japonica cultivar-group) chrom...   130   7e-29   
gb:ZMA277702_1731487 Zea mays mRNA for SERK1 protein.>gb:ZMA4008...   130   7e-29   
gb:AX138085_1462208 Sequence 31 from Patent EP1094113.                130   7e-29   
gb:CQ768545_1451790 Sequence 40 from Patent WO2004007712.>gb:AY0...   130   7e-29   
pir|T10569|T10569 probable serine/threonine-specific protein kin...   130   7e-29   Arabidopsis thaliana [mouse-ear cress]
pir|E96633|E96633 probable Serine/Threonine protein kinase F8A5....   130   7e-29   Arabidopsis thaliana [mouse-ear cress]
pir|T00574|T00574 probable protein kinase [imported] - Arabidops...   130   7e-29   Arabidopsis thaliana [mouse-ear cress]
gb:AC098693_1736830 Oryza sativa (japonica cultivar-group) chrom...   123   8e-29   
gb:AP003411_1829038 Oryza sativa (japonica cultivar-group) genom...   129   9e-29   
gb:AC133333_1741337 Oryza sativa chromosome 3 BAC OJ1785_A05 gen...   129   9e-29   
gb:AC119292_1739707 Oryza sativa (japonica cultivar-group) chrom...   129   9e-29   
gb:BT020268_1642663 Arabidopsis thaliana At1g26970 mRNA, complet...   129   9e-29   
gb:AY090250_1574003 Arabidopsis thaliana AT4g23250/F21P8_140 mRN...   129   9e-29   
sp|Q9FE20|PBS1_ARATH|PBS1_ARATH Serine/threonine-protein kinase PBS1 (EC 2....   129   9e-29   Arabidopsis thaliana [mouse-ear cress]
gb:AP003615_1831433 Oryza sativa (japonica cultivar-group) genom...   129   1e-28   
gb:AC108875_1738611 Oryza sativa (japonica cultivar-group) chrom...   129   1e-28   
gb:ZMA400869_1731517 Zea mays serk2 gene for somatic embryogenes...   129   1e-28   
gb:AB012245_1511781 Arabidopsis thaliana genomic DNA, chromosome...   129   1e-28   
pir|C85057|C85057 probable receptor-like protein kinase [importe...   129   1e-28   Arabidopsis thaliana [mouse-ear cress]
pir|T52400|T52400 receptor-like protein kinase [imported] - Arab...   129   1e-28   Arabidopsis thaliana [mouse-ear cress]
pir|C96641|C96641 hypothetical protein T25B24.6 [imported] - Ara...   129   1e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AF436829_1799881 Arabidopsis thaliana AT4g26540/M3E9_30 mRNA,...   129   2e-28   
gb:AB052755_1521237 Arabidopsis lyrata mRNA for SRKa, partial cds.    129   2e-28   
gb:AF485384_1804095 Helianthus annuus SERK1 mRNA, partial cds.        128   2e-28   
gb:AF083790_1767020 Arabidopsis thaliana clone sps866 unknown mRNA.   128   2e-28   
gb:AF078082_1766256 Phaseolus vulgaris receptor-like protein kin...   128   2e-28   
gb:OSJN00019_1693373 Oryza sativa genomic DNA, chromosome 4, BAC...   128   2e-28   
gb:BT005954_1638876 Arabidopsis thaliana At4g23180 gene, complet...   128   2e-28   
gb:BOLRPKB_1633858 Brassica campestris mRNA for receptor protein...   128   2e-28   
gb:AC000103_1530024 Genomic sequence for Arabidopsis thaliana BA...   128   2e-28   
gb:AB125890_1528232 Ipomoea batatas SRF6 mRNA for leucine-rich r...   128   2e-28   
gb:AE005172_891418 Arabidopsis thaliana chromosome 1, top arm co...   128   2e-28   
pir|T04835|T04835 probable serine/threonine-specific protein kin...   128   2e-28   Arabidopsis thaliana [mouse-ear cress]
pir|T14375|T14375 S-receptor kinase (EC 2.7.1.-) 1 - turnip>gb:A...   128   2e-28   Brassica rapa
gb:AP005786_1857838 Oryza sativa (japonica cultivar-group) genom...   128   3e-28   
gb:AP003991_1836031 Oryza sativa (japonica cultivar-group) genom...   128   3e-28   
gb:AP003863_1834484 Oryza sativa (japonica cultivar-group) genom...   128   3e-28   
gb:AP002536_1822468 Oryza sativa (japonica cultivar-group) genom...   128   3e-28   
gb:AK117952_1815959 Arabidopsis thaliana At5g01020 mRNA for puta...   128   3e-28   
gb:AF084035_1767052 Arabidopsis thaliana receptor-like protein k...   128   3e-28   
pir|D85065|D85065 receptor protein kinase-like protein [imported...   128   3e-28   Arabidopsis thaliana [mouse-ear cress]
pir|T45878|T45878 receptor lectin kinase-like protein - Arabidop...   128   3e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AP004685_1843366 Oryza sativa (japonica cultivar-group) genom...   127   3e-28   
gb:AF024648_1762136 Arabidopsis thaliana receptor-like serine/th...   127   3e-28   
gb:AC079288_1732513 Arabidopsis thaliana chromosome 1 BAC T3M22 ...   127   3e-28   
gb:AY091006_1574238 Arabidopsis thaliana putative receptor serin...   127   3e-28   
gb:ATCHRIV12_1544293 Arabidopsis thaliana DNA chromosome 4, cont...   127   3e-28   
gb:AB019235_1514215 Arabidopsis thaliana genomic DNA, chromosome...   127   3e-28   
pir|A86421|A86421 Receptor-like serine/threonine kinase (RFK1) [...   127   3e-28   Arabidopsis thaliana [mouse-ear cress]
pir|T14377|T14377 S-receptor kinase (EC 2.7.1.-) SRK29 - turnip>...   127   3e-28   Brassica rapa
pir|JC2482|JC2482 S-receptor kinase (EC 2.7.1.-) 12 precursor - ...   127   3e-28   Brassica rapa
gb:AK117901_1815909 Arabidopsis thaliana At5g49660 mRNA for puta...   127   4e-28   
gb:OSJN00055_1693993 Oryza sativa genomic DNA, chromosome 4, BAC...   127   4e-28   
pir|H85056|H85056 probable receptor-like protein kinase [importe...   127   4e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AP005156_1848353 Oryza sativa (japonica cultivar-group) genom...   127   6e-28   
gb:AP004584_1841867 Oryza sativa (japonica cultivar-group) genom...   127   6e-28   
gb:BT003347_1636770 Arabidopsis thaliana serine/threonine-specif...   127   6e-28   
gb:BT000431_1634709 Arabidopsis thaliana serine/threonine-specif...   127   6e-28   
pir|E96787|E96787 protein T4O12.5 [imported] - Arabidopsis thali...   127   6e-28   Arabidopsis thaliana [mouse-ear cress]
pir|T47684|T47684 serine/threonine-specific protein kinase-like ...   127   6e-28   Arabidopsis thaliana [mouse-ear cress]
sp|Q9SYQ8|CLV1_ARATH|CLV1_ARATH Receptor protein kinase CLAVATA1 precursor ...   127   6e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AP004570_1841747 Oryza sativa (japonica cultivar-group) genom...   126   8e-28   
gb:AP003277_1827082 Oryza sativa (japonica cultivar-group) genom...   126   8e-28   
gb:AJ841698_1814401 Poa pratensis serk1 gene for somatic embryog...   126   8e-28   
gb:OSJN00033_1693630 Oryza sativa genomic DNA, chromosome 4, BAC...   126   8e-28   
gb:BT006486_1639373 Arabidopsis thaliana At5g49760 gene, complet...   126   8e-28   
gb:AY056243_1563564 Arabidopsis thaliana unknown protein (At2g13...   126   8e-28   
gb:ATAC018363_1543678 Arabidopsis thaliana chromosome III BAC F1...   126   8e-28   
gb:AB025613_1516372 Arabidopsis thaliana genomic DNA, chromosome...   126   8e-28   
gb:AX120071_1461715 Sequence 54 from Patent WO0129240.                126   8e-28   
gb:CQ768567_1451801 Sequence 62 from Patent WO2004007712.             126   8e-28   
pir|T01086|T01086 probable serine/threonine-specific protein kin...   126   8e-28   Arabidopsis thaliana [mouse-ear cress]
pir|G84510|G84510 probable receptor-like protein kinase [importe...   126   8e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AP003736_1832662 Oryza sativa (japonica cultivar-group) genom...   126   1e-27   
gb:ZMA400870_1731518 Zea mays partial mRNA for somatic embryogen...   126   1e-27   
gb:PSY250467_1702600 Pinus sylvestris mRNA for receptor protein ...   126   1e-27   
gb:AY088040_1573064 Arabidopsis thaliana clone 40594 mRNA, compl...   126   1e-27   
gb:AB103395_1526454 Oryza sativa (japonica cultivar-group) MSP1 ...   126   1e-27   
gb:AE016959_1021800 Oryza sativa (japonica cultivar-group) chrom...   126   1e-27   
pir|T01551|T01551 receptor kinase homolog A_TM018A10.19 - Arabid...   126   1e-27   Arabidopsis thaliana [mouse-ear cress]
pir|T05754|T05754 S-receptor kinase (EC 2.7.1.-) M4I22.110 precu...   126   1e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AP004744_1844232 Oryza sativa (japonica cultivar-group) genom...   125   1e-27   
gb:AY094412_1575714 Arabidopsis thaliana At2g13800/F13J11.15 mRN...   125   1e-27   
gb:AB090881_1524972 Aster tripolium mRNA for serine/threonine pr...   125   1e-27   
gb:AX138094_1462211 Sequence 40 from Patent EP1094113.                125   1e-27   
gb:AX120069_1461714 Sequence 52 from Patent WO0129240.                125   1e-27   
gb:AX120059_1461709 Sequence 42 from Patent WO0129240.                125   1e-27   
gb:CQ768565_1451800 Sequence 60 from Patent WO2004007712.             125   1e-27   
gb:CQ768553_1451794 Sequence 48 from Patent WO2004007712.             125   1e-27   
pir|T51383|T51383 receptor protein kinase-like protein - Arabido...   125   1e-27   Arabidopsis thaliana [mouse-ear cress]
pir|T10659|T10659 probable serine/threonine-specific protein kin...   125   1e-27   Arabidopsis thaliana [mouse-ear cress]
pir|H84510|H84510 probable receptor-like protein kinase [importe...   125   1e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AY093964_1575470 Arabidopsis thaliana At1g01540/F22L4_6 mRNA,...   125   2e-27   
gb:ATY12776_1557476 Arabidopsis thaliana DNA, 40 kb surrounding ...   125   2e-27   
pir|T14519|T14519 probable S-receptor kinase (EC 2.7.1.-) SFR1 -...   125   2e-27   Brassica oleracea
gb:AF485387_1804098 Helianthus annuus SERK4 mRNA, partial cds.        125   2e-27   
gb:AY142503_1582932 Arabidopsis thaliana putative serine/threoni...   125   2e-27   
gb:AY070043_1566686 Arabidopsis thaliana putative receptor kinas...   125   2e-27   
gb:AY062569_1565225 Arabidopsis thaliana putative protein (At4g2...   125   2e-27   
gb:AB041622_1519689 Brassica rapa BcRK6 gene for receptor kinase...   125   2e-27   
gb:AB013717S2_1512251 Brassica rapa gene for SRK46Bra, exon 2, 3...   125   2e-27   
gb:AX120067_1461713 Sequence 50 from Patent WO0129240.                125   2e-27   
gb:CQ768563_1451799 Sequence 58 from Patent WO2004007712.             125   2e-27   
pir|T48335|T48335 receptor like protein kinase - Arabidopsis tha...   125   2e-27   Arabidopsis thaliana [mouse-ear cress]
pir|A85357|A85357 receptor-like kinase homolog [imported] - Arab...   125   2e-27   Arabidopsis thaliana [mouse-ear cress]
pir|JC2481|JC2481 S-receptor kinase (EC 2.7.1.-) 8 precursor - f...   125   2e-27   Brassica rapa
gb:AP005156_1848351 Oryza sativa (japonica cultivar-group) genom...   124   3e-27   
gb:AP004401_1841243 Oryza sativa (japonica cultivar-group) genom...   124   3e-27   
gb:AP003863_1834472 Oryza sativa (japonica cultivar-group) genom...   124   3e-27   
gb:AC093952_1736170 Oryza sativa (japonica cultivar-group) chrom...   124   3e-27   
gb:AY182165_1587873 Elaeis guineensis clone Rlk-OPff receptor-li...   124   3e-27   
gb:AB052756_1521238 Arabidopsis lyrata mRNA for SRKb, complete cds.   124   3e-27   
gb:AB012106_1511634 Brassica rapa mRNA for SRK45, complete cds.       124   3e-27   
gb:AX120057_1461708 Sequence 40 from Patent WO0129240.                124   3e-27   
gb:CQ768551_1451793 Sequence 46 from Patent WO2004007712.             124   3e-27   
pir|A96574|A96574 protein F12M16.30 [imported] - Arabidopsis tha...   124   3e-27   
pir|G84630|G84630 probable LRR receptor protein kinase [imported...   124   3e-27   
sp|O22476|BRI1_ARATH|BRI1_ARATH BRASSINOSTEROID INSENSITIVE 1 precursor (EC...   124   3e-27   
gb:AP003863_1834479 Oryza sativa (japonica cultivar-group) genom...   124   4e-27   
gb:AF224705_1778584 Arabidopsis thaliana receptor-like protein k...   124   4e-27   
gb:STU306629_1723040 Solanum tuberosum mRNA for putative recepto...   124   4e-27   
gb:STU306628_1723039 Solanum tuberosum mRNA for putative recepto...   124   4e-27   
gb:STU306627_1723038 Solanum tuberosum mRNA for putative recepto...   124   4e-27   
gb:AY283519_1594738 Brassica napus CLV1-like receptor kinase (CL...   124   4e-27   
gb:ATF8D20_1551119 Arabidopsis thaliana DNA chromosome 4, BAC cl...   124   4e-27   
pir|T04665|T04665 probable serine/threonine-specific protein kin...   124   4e-27   
pir|C85420|C85420 protein kinase-like protein [imported] - Arabi...   124   4e-27   
pir|T09349|T09349 S-receptor kinase (EC 2.7.1.-) T26M18.110 prec...   124   4e-27   
pir|JQ1677|JQ1677 S-receptor kinase (EC 2.7.1.-) precursor - rap...   124   4e-27   
sp|P27450|CX32_ARATH|CX32_ARATH Probable serine/threonine-protein kinase Cx...   124   4e-27   
gb:AP003863_1834475 Oryza sativa (japonica cultivar-group) genom...   124   5e-27   
gb:AP003856_1834380 Oryza sativa (japonica cultivar-group) genom...   124   5e-27   
gb:AP003282_1827220 Oryza sativa (japonica cultivar-group) genom...   124   5e-27   
gb:AF403126_1796414 Oryza sativa S-locus receptor-like kinase RL...   124   5e-27   
gb:AC132492_1741212 Oryza sativa (japonica cultivar-group) chrom...   124   5e-27   
gb:AC130597_1740689 Oryza sativa (japonica cultivar-group) chrom...   124   5e-27   
gb:OSJN00097_1694866 Oryza sativa genomic DNA, chromosome 4, BAC...   124   5e-27   
gb:BT000052_1634330 Arabidopsis thaliana serine/threonine kinase...   124   5e-27   
gb:AY087034_1572070 Arabidopsis thaliana clone 30775 mRNA, compl...   124   5e-27   
gb:ATAC018363_1543686 Arabidopsis thaliana chromosome III BAC F1...   124   5e-27   
gb:ATAC008261_1542788 Arabidopsis thaliana chromosome III BAC T4...   124   5e-27   
gb:AB013720_1512253 Brassica oleracea mRNA for SRK23Bol, partial...   124   5e-27   
gb:AE016959_1020856 Oryza sativa (japonica cultivar-group) chrom...   124   5e-27   
pir|T14471|T14471 probable S-receptor kinase (EC 2.7.1.-) srk29 ...   124   5e-27   
pir|T05181|T05181 S-receptor kinase (EC 2.7.1.-) T6K22.120 precu...   124   5e-27   
gb:AP004260_1839291 Oryza sativa (japonica cultivar-group) genom...   123   6e-27   
gb:AP003706_1832170 Oryza sativa (japonica cultivar-group) genom...   123   6e-27   
gb:AP002525_1822425 Oryza sativa (japonica cultivar-group) genom...   123   6e-27   
gb:AF527808_1808433 Sorghum bicolor clone BAC SBTXS_0040L6 php20...   123   6e-27   
gb:AF485385_1804096 Helianthus annuus SERK2 mRNA, partial cds.        123   6e-27   
gb:OSJN00019_1693376 Oryza sativa genomic DNA, chromosome 4, BAC...   123   6e-27   
gb:AY074844_1567697 Arabidopsis thaliana AT4g21410/T6K22_140 mRN...   123   6e-27   
gb:ATF7J8_1550981 Arabidopsis thaliana DNA chromosome 5, BAC clo...   123   6e-27   
pir|T04845|T04845 probable serine/threonine-specific protein kin...   123   6e-27   
pir|T06082|T06082 protein kinase homolog T9A14.110 - Arabidopsis...   123   6e-27   
pir|T05149|T05149 protein kinase homolog F18E5.30 - Arabidopsis ...   123   6e-27   
gb:AP003406_1828888 Oryza sativa (japonica cultivar-group) genom...   123   8e-27   
gb:AF083807_1767037 Arabidopsis thaliana clone sps952 unknown mRNA.   123   8e-27   
gb:OSJN00271_1697720 Oryza sativa genomic DNA, chromosome 4, BAC...   123   8e-27   
gb:OSJN00195_1696529 Oryza sativa genomic DNA, chromosome 4, BAC...   123   8e-27   
gb:BOY18260_1633945 Brassica oleracea mRNA for SRK15 protein, pa...   123   8e-27   
gb:AY074386_1567540 Arabidopsis thaliana putative receptor prote...   123   8e-27   
gb:AY062559_1565215 Arabidopsis thaliana receptor-like protein k...   123   8e-27   
gb:AB024416_1515946 Brassica oleracea SRK2-b mRNA, complete cds.      123   8e-27   
gb:AB020745_1514593 Arabidopsis thaliana genomic DNA, chromosome...   123   8e-27   
pir|T05753|T05753 S-receptor kinase (EC 2.7.1.-) M4I22.100 precu...   123   8e-27   
gb:AP003863_1834480 Oryza sativa (japonica cultivar-group) genom...   122   1e-26   
gb:AP003255_1826437 Oryza sativa (japonica cultivar-group) genom...   122   1e-26   
gb:BOY18259_1633944 Brassica oleracea mRNA for SRK5 protein, par...   122   1e-26   
gb:AB097116_1525939 Brassica rapa SRK-60, SLG-60 genes for S rec...   122   1e-26   
gb:AB028620_1518053 Arabidopsis thaliana genomic DNA, chromosome...   122   1e-26   
sp|P47735|RLK5_ARATH|RLK5_ARATH Receptor-like protein kinase 5 precursor (E...   122   1e-26   
gb:AP005810_1858259 Oryza sativa (japonica cultivar-group) genom...   122   1e-26   
gb:AP005469_1852408 Oryza sativa (japonica cultivar-group) genom...   122   1e-26   
gb:AP004762_1844627 Oryza sativa (japonica cultivar-group) genom...   122   1e-26   
gb:AP003736_1832653 Oryza sativa (japonica cultivar-group) genom...   122   1e-26   
gb:OSJN00019_1693377 Oryza sativa genomic DNA, chromosome 4, BAC...   122   1e-26   
gb:AY091071_1574298 Arabidopsis thaliana putative protein kinase...   122   1e-26   
gb:AB188249_1529360 Oryza sativa (japonica cultivar-group) OsSER...   122   1e-26   
gb:AE016959_1023603 Oryza sativa (japonica cultivar-group) chrom...   122   1e-26   
gb:AE005173_894228 Arabidopsis thaliana chromosome 1, bottom arm...   122   1e-26   
pir|T14470|T14470 receptor-like kinase (EC 2.7.1.-) SFR2 - wild ...   122   1e-26   
pir|T48228|T48228 probable protein kinase - Arabidopsis thaliana...   122   1e-26   
pir|E84587|E84587 probable protein kinase [imported] - Arabidops...   122   1e-26   
gb:AP004688_1843412 Oryza sativa (japonica cultivar-group) genom...   122   2e-26   
gb:AP003863_1834463 Oryza sativa (japonica cultivar-group) genom...   122   2e-26   
gb:AP003811_1833701 Oryza sativa (japonica cultivar-group) genom...   122   2e-26   
gb:AP003736_1832661 Oryza sativa (japonica cultivar-group) genom...   122   2e-26   
gb:AK176466_1818454 Arabidopsis thaliana mRNA, complete cds, clo...   122   2e-26   
gb:AC134931_1741948 Oryza sativa (japonica cultivar-group) chrom...   122   2e-26   
gb:BOARLKGEN_1633734 B.oleraceae gene encoding serine/threonine ...   122   2e-26   
gb:AB041621_1519688 Brassica rapa BcRK5 gene for receptor kinase...   122   2e-26   
gb:AE016959_1023590 Oryza sativa (japonica cultivar-group) chrom...   122   2e-26   
gb:AE005172_891020 Arabidopsis thaliana chromosome 1, top arm co...   122   2e-26   
pir|T04836|T04836 probable serine/threonine-specific protein kin...   122   2e-26   
pir|D85062|D85062 hypothetical protein AT4g04960 [imported] - Ar...   122   2e-26   
pir|T02728|T02728 serine/threonine-specific protein kinase (EC 2...   122   2e-26   
pir|B84431|B84431 probable receptor protein kinase [imported] - ...   122   2e-26   
gb:AP005742_1856979 Oryza sativa (japonica cultivar-group) genom...   121   2e-26   
gb:AP005111_1848028 Oryza sativa (japonica cultivar-group) genom...   121   2e-26   
gb:AP005111_1848027 Oryza sativa (japonica cultivar-group) genom...   121   2e-26   
gb:BT008663_1639865 Arabidopsis thaliana clone RAFL16-97-D11 (R5...   121   2e-26   
pir|T10566|T10566 probable serine/threonine-specific protein kin...   121   2e-26   
pir|T04848|T04848 protein kinase homolog F16G20.10 - Arabidopsis...   121   2e-26   
pir|T14450|T14450 serine/threonine kinase (EC 2.7.1.-) BRLK - wi...   121   2e-26   
gb:AP003368_1828580 Oryza sativa (japonica cultivar-group) genom...   121   3e-26   
gb:AC099774_1737232 Oryza sativa chromosome 10 BAC OSJNBa0073L20...   121   3e-26   
gb:ITU20948_1683300 Ipomoea trifida receptor protein kinase (IRK...   121   3e-26   
gb:BOLSRKA_1633859 Turnip mRNA for S-receptor kinase SRK9, parti...   121   3e-26   
gb:AY099582_1576608 Arabidopsis thaliana serine/threonine kinase...   121   3e-26   
gb:AB104529_1526474 Pisum sativum LKA mRNA for brassinosteroid r...   121   3e-26   
gb:AB041620_1519687 Brassica rapa BcRL3 gene for receptor kinase...   121   3e-26   
gb:AB032473_1518696 Brassica oleracea SRK18 mRNA for S18 S-locus...   121   3e-26   
gb:AB011476_1511391 Arabidopsis thaliana genomic DNA, chromosome...   121   3e-26   
gb:AE016959_1021799 Oryza sativa (japonica cultivar-group) chrom...   121   3e-26   
pir|T10568|T10568 probable serine/threonine-specific protein kin...   121   3e-26   
pir|T14472|T14472 S-receptor kinase (EC 2.7.1.-) - wild cabbage>...   121   3e-26   
pir|T14398|T14398 S-receptor kinase (EC 2.7.1.-) - turnip>gb:D88...   121   3e-26   
gb:OSJN00007_1693173 Oryza sativa genomic DNA, chromosome 4, BAC...   120   4e-26   
gb:ATH011674_1551954 Arabidopsis thaliana mRNA for receptor-like...   120   4e-26   
gb:AE016959_1021829 Oryza sativa (japonica cultivar-group) chrom...   120   4e-26   
gb:AE005173_893805 Arabidopsis thaliana chromosome 1, bottom arm...   120   4e-26   
pir|S70769|S70769 S-receptor kinase (EC 2.7.1.-) Ark1 precursor ...   120   4e-26   
gb:AP004553_1841478 Oryza sativa (japonica cultivar-group) genom...   120   5e-26   
gb:AP003238_1825990 Oryza sativa (japonica cultivar-group) genom...   120   5e-26   
gb:AP003238_1825989 Oryza sativa (japonica cultivar-group) genom...   120   5e-26   
pir|T04844|T04844 probable serine/threonine-specific protein kin...   120   5e-26   
pir|T04839|T04839 protein kinase homolog F21P8.110 - Arabidopsis...   120   5e-26   
pir|S51527|S51527 S-receptor kinase (EC 2.7.1.-) A14 precursor -...   120   5e-26   
gb:AF403128_1796416 Oryza sativa S-locus receptor-like kinase RL...   120   7e-26   
pir|T00788|T00788 probable protein kinase [imported] - Arabidops...   120   7e-26   
pir|T10573|T10573 probable serine/threonine-specific protein kin...   120   7e-26   
pir|B85122|B85122 serine/threonine kinase-like protein (partial)...   120   7e-26   
pir|T08960|T08960 serine/threonine-specific protein kinase (EC 2...   120   7e-26   
pir|T04841|T04841 protein kinase homolog F21P8.130 - Arabidopsis...   120   7e-26   
pir|T05180|T05180 S-receptor kinase (EC 2.7.1.-) ARK3 precursor ...   120   7e-26   
pir|T02053|T02053 S-receptor kinase (EC 2.7.1.-) KIK1 precursor ...   120   7e-26   
gb:AP004764_1844639 Oryza sativa (japonica cultivar-group) genom...   119   9e-26   
gb:AP004260_1839289 Oryza sativa (japonica cultivar-group) genom...   119   9e-26   
gb:AP003758_1833016 Oryza sativa (japonica cultivar-group) genom...   119   9e-26   
gb:AP003406_1828884 Oryza sativa (japonica cultivar-group) genom...   119   9e-26   
gb:AY358027_1601930 Medicago truncatula lectin-like receptor kin...   119   9e-26   
pir|H96723|H96723 hypothetical protein F20P5.16 [imported] - Ara...   119   9e-26   
pir|T14520|T14520 probable S-receptor kinase (EC 2.7.1.-) SFR3 p...   119   9e-26   
gb:AP006172_1861338 Oryza sativa (japonica cultivar-group) genom...   119   1e-25   
gb:AP004301_1839832 Oryza sativa (japonica cultivar-group) genom...   119   1e-25   
gb:AP004082_1837433 Oryza sativa (japonica cultivar-group) genom...   119   1e-25   
gb:AP005650_1855480 Oryza sativa (japonica cultivar-group) genom...   119   2e-25   
gb:AP003983_1835897 Oryza sativa (japonica cultivar-group) genom...   119   2e-25   
gb:AP003981_1835888 Oryza sativa (japonica cultivar-group) genom...   119   2e-25   
gb:AF224707_1778586 Arabidopsis thaliana receptor-like protein k...   119   2e-25   
gb:AC093018_1735833 Oryza sativa chromosome 3 BAC OSJNBb0081B07 ...   119   2e-25   
gb:AC091234_1734688 Oryza sativa chromosome 3 BAC OSJNBa0057E11 ...   119   2e-25   
gb:AC091233_1734637 Oryza sativa chromosome 3 BAC OSJNBa0053G10 ...   119   2e-25   
gb:AY142496_1582925 Arabidopsis thaliana putative protein kinase...   119   2e-25   
gb:AX008789_1456287 Sequence 1 from Patent WO9964600.>gb:AF05312...   119   2e-25   
gb:AP003227_1825640 Oryza sativa (japonica cultivar-group) genom...   118   2e-25   
gb:AP003044_1824341 Oryza sativa (japonica cultivar-group) genom...   118   2e-25   
gb:BT008569_1639786 Arabidopsis thaliana clone U51269 putative W...   118   2e-25   
gb:ATH9671_1552957 Arabidopsis thaliana gene encoding putative k...   118   2e-25   
pir|A96563|A96563 probable protein kinase 60711-62822 [imported]...   118   2e-25   
pir|A86296|A86296 hypothetical protein T24D18.21 - Arabidopsis t...   118   2e-25   
sp|Q8L899|BRI1_LYCPE|BRI1_LYCPE Systemin receptor SR160 precursor (EC 2.7.1...   118   2e-25   
gb:AC129718_1740653 Oryza sativa (japonica cultivar-group) chrom...   118   3e-25   
gb:AB099698_1526154 Arabidopsis thaliana CDG1 mRNA for protein k...   118   3e-25   
gb:AB026649_1517226 Arabidopsis thaliana genomic DNA, chromosome...   118   3e-25   
gb:AE005172_891598 Arabidopsis thaliana chromosome 1, top arm co...   118   3e-25   
pir|T10567|T10567 probable serine/threonine-specific protein kin...   118   3e-25   
pir|T49986|T49986 lectin-like protein kinase-like - Arabidopsis ...   118   3e-25   
pir|A96724|A96724 hypothetical protein F20P5.15 [imported] - Ara...   118   3e-25   
pir|T05335|T05335 hypothetical protein F1C12.190 - Arabidopsis t...   118   3e-25   
gb:AP005518_1853323 Oryza sativa (japonica cultivar-group) genom...   117   4e-25   
gb:AP004401_1841245 Oryza sativa (japonica cultivar-group) genom...   117   4e-25   
gb:AK175636_1817624 Arabidopsis thaliana mRNA for receptor-kinas...   117   4e-25   
gb:AK118105_1816102 Arabidopsis thaliana At1g16110 mRNA for unkn...   117   4e-25   
gb:U95973_1726602 Arabidopsis thaliana chromosome 1 BAC T19D16 g...   117   4e-25   
gb:AY150474_1585039 Arabidopsis thaliana putative protein kinase...   117   4e-25   
gb:AY092960_1574914 Arabidopsis thaliana receptor-kinase isolog ...   117   4e-25   
gb:AY080806_1568505 Arabidopsis thaliana putative protein kinase...   117   4e-25   
gb:AY056128_1563464 Arabidopsis thaliana putative receptor-kinas...   117   4e-25   
pir|A84483|A84483 probable protein kinase [imported] - Arabidops...   117   4e-25   
gb:AP004009_1836298 Oryza sativa (japonica cultivar-group) genom...   117   5e-25   
gb:OSJN00022_1693448 Oryza sativa genomic DNA, chromosome 4, BAC...   117   5e-25   
gb:AY133720_1581540 Arabidopsis thaliana clone C103370 putative ...   117   5e-25   
gb:AY128280_1580582 Arabidopsis thaliana AT3g13380/MRP15_1 mRNA,...   117   5e-25   
pir|T04832|T04832 probable serine/threonine-specific protein kin...   117   5e-25   
pir|A41369|A41369 S-receptor kinase (EC 2.7.1.-) 6 precursor - w...   117   5e-25   
sp|Q09092|SRK6_BRAOL|SRK6_BRAOL Putative serine/threonine-protein kinase re...   117   5e-25   
sp|Q8GUQ5|BRI1_LYCES|BRI1_LYCES Brassinosteroid LRR receptor kinase precurs...   117   5e-25   
gb:AP005679_1855873 Oryza sativa (japonica cultivar-group) genom...   117   6e-25   
gb:AP004006_1836240 Oryza sativa (japonica cultivar-group) genom...   117   6e-25   
gb:AF487461_1804285 Gossypium hirsutum receptor kinase Lecrk mRN...   117   6e-25   
gb:AC134237_1741677 Oryza sativa (japonica cultivar-group) chrom...   117   6e-25   
gb:AC113332_1738903 Oryza sativa (japonica cultivar-group) chrom...   117   6e-25   
pir|T04837|T04837 probable serine/threonine-specific protein kin...   117   6e-25   
pir|T04833|T04833 hypothetical protein F21P8.50 - Arabidopsis th...   117   6e-25   
gb:AP004301_1839833 Oryza sativa (japonica cultivar-group) genom...   116   8e-25   
gb:ATF24G16_1549841 Arabidopsis thaliana DNA chromosome 3, BAC c...   116   8e-25   
gb:AC007166_1535410 Arabidopsis thaliana chromosome 2 clone F14P...   116   8e-25   
pir|A84498|A84498 probable protein kinase [imported] - Arabidops...   116   8e-25   
pir|T49315|T49315 receptor lectin kinase 3 - Arabidopsis thalian...   116   8e-25   
pir|T47526|T47526 protein kinase-like - Arabidopsis thaliana>gb:...   116   8e-25   
pir|T47798|T47798 receptor lectin kinase 3 - Arabidopsis thalian...   116   8e-25   
pir|B84742|B84742 probable receptor-like protein kinase [importe...   116   8e-25   
gb:AP003760_1833073 Oryza sativa (japonica cultivar-group) genom...   116   1e-24   
gb:AP003760_1833071 Oryza sativa (japonica cultivar-group) genom...   116   1e-24   
gb:AK118493_1816466 Arabidopsis thaliana At4g23140 mRNA for puta...   116   1e-24   
gb:AF224706_1778585 Arabidopsis thaliana receptor-like protein k...   116   1e-24   
gb:AY603423_1617458 Pyrus pyrifolia isolate Kinchaku leucine-ric...   116   1e-24   
gb:AY603422_1617457 Pyrus pyrifolia isolate Kousui2 leucine-rich...   116   1e-24   
gb:AY603421_1617456 Pyrus pyrifolia isolate Kousui1 leucine-rich...   116   1e-24   
gb:ATU93161_1557393 Arabidopsis thaliana AthlecRK4 pseudogene, c...   116   1e-24   
pir|T04831|T04831 probable serine/threonine-specific protein kin...   116   1e-24   
pir|A85041|A85041 probable receptor kinase [imported] - Arabidop...   116   1e-24   
gb:AP004401_1841247 Oryza sativa (japonica cultivar-group) genom...   115   1e-24   
gb:AP003736_1832650 Oryza sativa (japonica cultivar-group) genom...   115   1e-24   
gb:AC104473_1737662 Oryza sativa (japonica cultivar-group) chrom...   115   1e-24   
gb:AP005772_1857602 Oryza sativa (japonica cultivar-group) genom...   115   2e-24   
pir|F86410|F86410 protein F3M18.12 [imported] - Arabidopsis thal...   115   2e-24   
pir|E86297|E86297 F3O9.6 protein - Arabidopsis thaliana>gb:AE005...   115   2e-24   
gb:AY085162_1570243 Arabidopsis thaliana clone 13461 mRNA, compl...   115   2e-24   
pir|E96721|E96721 hypothetical protein T17F3.6 [imported] - Arab...   115   2e-24   
pir|T10661|T10661 serine/threonine-specific protein kinase homol...   115   2e-24   
gb:AP004839_1845793 Oryza sativa (japonica cultivar-group) genom...   114   3e-24   
gb:AY303171_1597401 Solanum bulbocastanum chromosome 8 clone 177...   114   3e-24   
pir|G86295|G86295 hypothetical protein T24D18.19 - Arabidopsis t...   114   3e-24   
pir|T04849|T04849 protein kinase homolog F16G20.20 - Arabidopsis...   114   3e-24   
gb:AP006172_1861328 Oryza sativa (japonica cultivar-group) genom...   114   4e-24   
gb:AP004301_1839822 Oryza sativa (japonica cultivar-group) genom...   114   4e-24   


>pir|T00502|T00502 probable receptor-like protein kinase At2g23300
            [imported] - Arabidopsis thaliana>gb:AC002391_1530628
            Arabidopsis thaliana chromosome 2 clone T20D16 map
            CIC06C07, complete sequence.
          Length = 773

 Score =  386 bits (991), Expect = e-106
 Identities = 209/331 (63%), Positives = 244/331 (73%), Gaps = 5/331 (1%)
 Frame = -2

Query: 1132 KTGELVTVDGXXXXXXXXXXK-ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLD-- 962
            K G LVT+DG            ASAYILGA+GSSIMYKTVL+DGT LAVRR+GE+GL   
Sbjct: 434  KKGTLVTIDGGEKELEVETLLKASAYILGATGSSIMYKTVLEDGTVLAVRRLGENGLSQQ 493

Query: 961  -RFREFENQIRVISKLVHPNLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRH 785
             RF++FE  IR I KLVHPNLVR+RGFYWG DEKLVIYDFVPNGSL NA +RKGGSS  H
Sbjct: 494  RRFKDFEAHIRAIGKLVHPNLVRLRGFYWGTDEKLVIYDFVPNGSLVNARYRKGGSSPCH 553

Query: 784  LPWEVRLKIARGVARGLSYIHEKKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGES 605
            LPWE RLKI +G+ARGL+Y+H+KKHVHGNLKPSNILL  DMEPK+GDFGLERL +AG  S
Sbjct: 554  LPWETRLKIVKGLARGLAYLHDKKHVHGNLKPSNILLGQDMEPKIGDFGLERL-LAGDTS 612

Query: 604  SRKVYGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALG-ISPYIAPESLRSLKPNP 428
              +  GSSR F SKR TAS   F     + G TPSPSPS++G ISPY APESLR+LKPNP
Sbjct: 613  YNRASGSSRIFSSKRLTASSREFG----TIGPTPSPSPSSVGPISPYCAPESLRNLKPNP 668

Query: 427  KWDVFSFGVVLLELLTGKIIVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXX 248
            KWDVF FGV+LLELLTGKI+  DE+  G   + VE+ ++ L MADVAIR+++        
Sbjct: 669  KWDVFGFGVILLELLTGKIVSIDEVGVGNG-LTVEDGNRALIMADVAIRSELEGKEDFLL 727

Query: 247  XXXXXGYNCISPVPQKRPTMKEVVQALDNIP 155
                 GY+C S +PQKRPTMKE +   +  P
Sbjct: 728  GLFKLGYSCASQIPQKRPTMKEALVVFERYP 758



>gb:AB025614_1516378 Arabidopsis thaliana genomic DNA, chromosome 5,
            TAC clone:K3G17.>gb:BT001094_1635349 Arabidopsis thaliana
            At5g67280/K3G17_4 mRNA, complete cds.
          Length = 751

 Score =  377 bits (968), Expect = e-103
 Identities = 197/329 (59%), Positives = 245/329 (74%), Gaps = 2/329 (0%)
 Frame = -2

Query: 1135 QKTGELVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRF 956
            +K G LV +D           KASAYILGA+GSSIMYK VL DGTA+AVRR+ E GLDRF
Sbjct: 431  EKKGTLVNLDSEKELEIETLLKASAYILGATGSSIMYKAVLQDGTAVAVRRIAECGLDRF 490

Query: 955  REFENQIRVISKLVHPNLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPW 776
            R+FE Q+R ++KL+HPNLVRIRGFYWG+DEKLVIYDFVPNGSLANA +RK GSS  HLPW
Sbjct: 491  RDFEAQVRAVAKLIHPNLVRIRGFYWGSDEKLVIYDFVPNGSLANARYRKVGSSPCHLPW 550

Query: 775  EVRLKIARGVARGLSYIHEKKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRK 596
            + RLKIA+G+ARGL+Y+H+KK+VHGNLKPSNILL  DMEPKV DFGLE+L++  G+ S +
Sbjct: 551  DARLKIAKGIARGLTYVHDKKYVHGNLKPSNILLGLDMEPKVADFGLEKLLI--GDMSYR 608

Query: 595  VYGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDV 416
              GS+  FGSKRST S        +  G +PSPSPS++G+ PY APESLRS+KPN KWDV
Sbjct: 609  TGGSAPIFGSKRSTTS--------LEFGPSPSPSPSSVGL-PYNAPESLRSIKPNSKWDV 659

Query: 415  FSFGVVLLELLTGKIIVSDEM--VPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXX 242
            +SFGV+LLELLTGKI+V DE+  V G   + +++  + +RMAD AIRA++          
Sbjct: 660  YSFGVILLELLTGKIVVVDELGQVNG---LVIDDGERAIRMADSAIRAELEGKEEAVLAC 716

Query: 241  XXXGYNCISPVPQKRPTMKEVVQALDNIP 155
               G  C SP+PQ+RP +KE +Q L+  P
Sbjct: 717  LKMGLACASPIPQRRPNIKEALQVLERFP 745



>gb:AY054256_1563076 Arabidopsis thaliana AT5g67280/K3G17_4 mRNA,
            complete cds.
          Length = 751

 Score =  374 bits (961), Expect = e-102
 Identities = 196/329 (59%), Positives = 244/329 (74%), Gaps = 2/329 (0%)
 Frame = -2

Query: 1135 QKTGELVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRF 956
            +K G LV +D           KASAYILGA+GSSIMYK VL DGTA+AVRR+ E GLDRF
Sbjct: 431  EKKGTLVNLDSEKELEIETLLKASAYILGATGSSIMYKAVLQDGTAVAVRRIAECGLDRF 490

Query: 955  REFENQIRVISKLVHPNLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPW 776
            R+FE Q+R ++KL+HPNLVRIRGFYWG+DEKLVIYDFVPNGSLANA +RK GSS  HLPW
Sbjct: 491  RDFEAQVRAVAKLIHPNLVRIRGFYWGSDEKLVIYDFVPNGSLANARYRKVGSSPCHLPW 550

Query: 775  EVRLKIARGVARGLSYIHEKKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRK 596
            + RLKIA+G+ARGL+Y+H+KK+VHGN KPSNILL  DMEPKV DFGLE+L++  G+ S +
Sbjct: 551  DARLKIAKGIARGLTYVHDKKYVHGNHKPSNILLGLDMEPKVADFGLEKLLI--GDMSYR 608

Query: 595  VYGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDV 416
              GS+  FGSKRST S        +  G +PSPSPS++G+ PY APESLRS+KPN KWDV
Sbjct: 609  TGGSAPIFGSKRSTTS--------LEFGPSPSPSPSSVGL-PYNAPESLRSIKPNSKWDV 659

Query: 415  FSFGVVLLELLTGKIIVSDEM--VPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXX 242
            +SFGV+LLELLTGKI+V DE+  V G   + +++  + +RMAD AIRA++          
Sbjct: 660  YSFGVILLELLTGKIVVVDELGQVNG---LVIDDGERAIRMADSAIRAELEGKEEAVLAC 716

Query: 241  XXXGYNCISPVPQKRPTMKEVVQALDNIP 155
               G  C SP+PQ+RP +KE +Q L+  P
Sbjct: 717  LKMGLACASPIPQRRPNIKEALQVLERFP 745



>gb:AY065068_1566222 Arabidopsis thaliana AT4g37250/C7A10_110 mRNA,
            complete cds.>gb:BT002237_1635840 Arabidopsis thaliana
            At4g37250/C7A10_110 mRNA, complete cds.
          Length = 768

 Score =  373 bits (957), Expect = e-102
 Identities = 207/333 (62%), Positives = 243/333 (72%), Gaps = 7/333 (2%)
 Frame = -2

Query: 1141 AAQKTGE--LVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGESG 968
            A Q++G+  LVTVDG          KASAYILGA+GSSIMYK VL+DG   AVRR+GE+G
Sbjct: 424  ANQRSGDNKLVTVDGEKEMEIETLLKASAYILGATGSSIMYKAVLEDGRVFAVRRLGENG 483

Query: 967  LD--RFREFENQIRVISKLVHPNLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGG-- 800
            L   RF++FE  IR I KLVHPNLVR+ GFYWG DEKLVIYDFVPNGSL N  +RKGG  
Sbjct: 484  LSQRRFKDFEPHIRAIGKLVHPNLVRLCGFYWGTDEKLVIYDFVPNGSLVNPRYRKGGGS 543

Query: 799  SSHRHLPWEVRLKIARGVARGLSYIHEKKHVHGNLKPSNILLDADMEPKVGDFGLERLVV 620
            SS  HLPWE RLKIA+G+ARGL+Y+HEKKHVHGNLKPSNILL  DMEPK+GDFGLERL +
Sbjct: 544  SSPYHLPWETRLKIAKGIARGLAYLHEKKHVHGNLKPSNILLGHDMEPKIGDFGLERL-L 602

Query: 619  AGGESSRKVYGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALG-ISPYIAPESLRS 443
             G  S  +  GSSR F SKR T S   F     S G TPSPSPS++G +SPY APES RS
Sbjct: 603  TGETSYIRAGGSSRIFSSKRYTTSSREFS----SIGPTPSPSPSSVGAMSPYCAPESFRS 658

Query: 442  LKPNPKWDVFSFGVVLLELLTGKIIVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXX 263
            LKP+PKWDV+ FGV+LLELLTGKI+  +E+V G   + VE+  + +RMADVAIR ++   
Sbjct: 659  LKPSPKWDVYGFGVILLELLTGKIVSVEEIVLGNG-LTVEDGHRAVRMADVAIRGELDGK 717

Query: 262  XXXXXXXXXXGYNCISPVPQKRPTMKEVVQALD 164
                      GY+C SPVPQKRPTMKE +  L+
Sbjct: 718  QEFLLDCFKLGYSCASPVPQKRPTMKESLAVLE 750



>pir|B85440|B85440 receptor kinase-like protein [imported] -
            Arabidopsis thaliana>gb:ATAP21_1543972 Arabidopsis
            thaliana DNA chromosome 4, ESSA I AP2 contig fragment No.
            1.>gb:ATCHRIV87_1547680 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 87.
          Length = 766

 Score =  373 bits (957), Expect = e-102
 Identities = 207/333 (62%), Positives = 243/333 (72%), Gaps = 7/333 (2%)
 Frame = -2

Query: 1141 AAQKTGE--LVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGESG 968
            A Q++G+  LVTVDG          KASAYILGA+GSSIMYK VL+DG   AVRR+GE+G
Sbjct: 422  ANQRSGDNKLVTVDGEKEMEIETLLKASAYILGATGSSIMYKAVLEDGRVFAVRRLGENG 481

Query: 967  LD--RFREFENQIRVISKLVHPNLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGG-- 800
            L   RF++FE  IR I KLVHPNLVR+ GFYWG DEKLVIYDFVPNGSL N  +RKGG  
Sbjct: 482  LSQRRFKDFEPHIRAIGKLVHPNLVRLCGFYWGTDEKLVIYDFVPNGSLVNPRYRKGGGS 541

Query: 799  SSHRHLPWEVRLKIARGVARGLSYIHEKKHVHGNLKPSNILLDADMEPKVGDFGLERLVV 620
            SS  HLPWE RLKIA+G+ARGL+Y+HEKKHVHGNLKPSNILL  DMEPK+GDFGLERL +
Sbjct: 542  SSPYHLPWETRLKIAKGIARGLAYLHEKKHVHGNLKPSNILLGHDMEPKIGDFGLERL-L 600

Query: 619  AGGESSRKVYGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALG-ISPYIAPESLRS 443
             G  S  +  GSSR F SKR T S   F     S G TPSPSPS++G +SPY APES RS
Sbjct: 601  TGETSYIRAGGSSRIFSSKRYTTSSREFS----SIGPTPSPSPSSVGAMSPYCAPESFRS 656

Query: 442  LKPNPKWDVFSFGVVLLELLTGKIIVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXX 263
            LKP+PKWDV+ FGV+LLELLTGKI+  +E+V G   + VE+  + +RMADVAIR ++   
Sbjct: 657  LKPSPKWDVYGFGVILLELLTGKIVSVEEIVLGNG-LTVEDGHRAVRMADVAIRGELDGK 715

Query: 262  XXXXXXXXXXGYNCISPVPQKRPTMKEVVQALD 164
                      GY+C SPVPQKRPTMKE +  L+
Sbjct: 716  QEFLLDCFKLGYSCASPVPQKRPTMKESLAVLE 748



>gb:AP003573_1831100 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC clone:P0523F01.
          Length = 876

 Score =  310 bits (793), Expect = 5e-83
 Identities = 172/334 (51%), Positives = 218/334 (65%), Gaps = 12/334 (3%)
 Frame = -2

Query: 1120 LVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGESG-LDRFREFE 944
            LVTVDG          KASAYILGA+GSSI+YK VL DGTALAVRR+GESG  D+ ++FE
Sbjct: 525  LVTVDGDGELEMETLLKASAYILGATGSSIVYKAVLADGTALAVRRIGESGGADKLKDFE 584

Query: 943  NQIRVISKLVHPNLVRIRGFYWGADEKLVIYDFVPNGSLANAC--HRKGGSSHRHLPWEV 770
             Q+R +++  HPN++R+RGFYWGADEKL+I+D+  NGSLAN     R G SS   L  E 
Sbjct: 585  AQVRAVARFRHPNILRLRGFYWGADEKLLIHDYATNGSLANIAFSRRFGASSPLQLSLEA 644

Query: 769  RLKIARGVARGLSYIHEKKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVY 590
            RL+IARGVARGL++IHEKK VHGN+KPSNILL ADMEP +GDFGL+RL+ +G    R   
Sbjct: 645  RLRIARGVARGLAFIHEKKGVHGNVKPSNILLGADMEPWIGDFGLDRLL-SGEAVHRSTG 703

Query: 589  GSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGIS---------PYIAPESLRSLK 437
             S+R FGSKRS  S  S PD +   G   SP  S+   +         PY APE L++L+
Sbjct: 704  ASARLFGSKRSMHSTSSLPDLSQMPGAGASPCGSSSAATSAAAAAAPPPYQAPECLKNLR 763

Query: 436  PNPKWDVFSFGVVLLELLTGKIIVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXX 257
            PN KWDV+SFG+VLLELL+G++    E+        VEE+S++LRMAD  +R +      
Sbjct: 764  PNTKWDVYSFGMVLLELLSGRVYSEVELCQWHAGFVVEERSRLLRMADPTLRGEADGRED 823

Query: 256  XXXXXXXXGYNCISPVPQKRPTMKEVVQALDNIP 155
                     + C +  P KRP M++ V  LD IP
Sbjct: 824  ALLACFKLAFACCAMAPGKRPAMRDAVLVLDRIP 857



>gb:AP005709_1856432 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, PAC
            clone:P0646B04.>gb:AP005787_1857881 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 9, PAC
            clone:P0501E09.
          Length = 794

 Score =  285 bits (729), Expect = 1e-75
 Identities = 159/329 (48%), Positives = 208/329 (63%), Gaps = 6/329 (1%)
 Frame = -2

Query: 1120 LVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVG--ESGLDRFREF 947
            LVTVDG          KASAYILGA+GSSI+YK VL DG  LAVRR+G  ++G+ RF EF
Sbjct: 465  LVTVDGEVELEMETLLKASAYILGAAGSSIVYKAVLADGAVLAVRRIGSDDAGVRRFSEF 524

Query: 946  ENQIRVISKLVHPNLVRIRGFYWGADEKLVIYDFVPNGSLAN-ACHRKGGSSHRHLPWEV 770
            +  +R I++L H N++R+RGFYWG DE L+I+DF  NGSLAN +  RK GSS   L W  
Sbjct: 525  DAHMRAIARLRHANILRLRGFYWGPDEMLLIHDFAANGSLANISVKRKTGSSPISLSWSS 584

Query: 769  RLKIARGVARGLSYIHEKKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVY 590
            RL+IARGVARGL+++H+KK VHGN++PSNILLDADMEP + D G+ RL+  G        
Sbjct: 585  RLRIARGVARGLAFLHDKKFVHGNVRPSNILLDADMEPLLADLGIHRLIRGGDTLKPAAA 644

Query: 589  GSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALG---ISPYIAPESLRSLKPNPKWD 419
              +  FGSKRS     S PD +   G +P   PS  G   ++ Y APE +++ K N KWD
Sbjct: 645  AGAGRFGSKRSA---KSLPDLSPPPGASPLAGPSGSGDTAVAQYQAPEGVKNPKANAKWD 701

Query: 418  VFSFGVVLLELLTGKIIVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXX 239
            V+S G+VLLEL+ G+ + S E+         E   +V R+AD A+R +M           
Sbjct: 702  VYSLGMVLLELVAGRALTSLELCQWS--SAEESGQQVFRLADAALRGEMAGREEALASCL 759

Query: 238  XXGYNCISPVPQKRPTMKEVVQALDNIPT 152
              G+ C +  P KRP+MKEVV A+D IP+
Sbjct: 760  RLGFACCAMAPHKRPSMKEVVAAMDRIPS 788



>gb:AY035109_1559880 Arabidopsis thaliana putative receptor protein
            kinase (At4g34220) mRNA, complete
            cds.>gb:AY113903_1578314 Arabidopsis thaliana putative
            receptor protein kinase (At4g34220) mRNA, complete cds.
          Length = 757

 Score =  258 bits (658), Expect = 2e-67
 Identities = 154/335 (45%), Positives = 194/335 (57%), Gaps = 13/335 (3%)
 Frame = -2

Query: 1123 ELVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLD--RFRE 950
            +LVTVDG          KASAYILG +G+ I+YK VL++GTA AVRR+        + +E
Sbjct: 454  QLVTVDGETRLDLDTLLKASAYILGTTGTGIVYKAVLENGTAFAVRRIETESCAAAKPKE 513

Query: 949  FENQIRVISKLVHPNLVRIRGFYWGADEKLVIYDFVPNGSL--------ANACHRKGGSS 794
            FE ++R I+KL HPNLVRIRGF WG DEKL+I D+VPNGSL        A++      S 
Sbjct: 514  FEREVRAIAKLRHPNLVRIRGFCWGDDEKLLISDYVPNGSLLCFFTATKASSSSSSSSSL 573

Query: 793  HRHLPWEVRLKIARGVARGLSYIHEKKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAG 614
               L +E RLKIARG+ARGLSYI+EKK VHGN+KP+NILL+A+ EP + D GL+RL+   
Sbjct: 574  QNPLTFEARLKIARGMARGLSYINEKKQVHGNIKPNNILLNAENEPIITDLGLDRLMTPA 633

Query: 613  GESSRKVYGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKP 434
             ES                               HT  P+ S    SPY  PE   SLKP
Sbjct: 634  RES-------------------------------HTTGPTSS----SPYQPPEWSTSLKP 658

Query: 433  NPKWDVFSFGVVLLELLTGKIIVSD---EMVPGPPVMGVEEKSKVLRMADVAIRADMXXX 263
            NPKWDV+SFGV+LLELLT K+   D   +          EE  + LR+ D AIR+D+   
Sbjct: 659  NPKWDVYSFGVILLELLTSKVFSVDHDIDQFSNLSDSAAEENGRFLRLIDGAIRSDVARH 718

Query: 262  XXXXXXXXXXGYNCISPVPQKRPTMKEVVQALDNI 158
                      G  C+S +PQKRP+MKE+VQ L+ I
Sbjct: 719  EDAAMACFRLGIECVSSLPQKRPSMKELVQVLEKI 753



>pir|T05414|T05414 protein kinase homolog F28A23.20 - Arabidopsis
            thaliana>gb:ATCHRIV81_1547383 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 81.>gb:ATF28A23_1550293
            Arabidopsis thaliana DNA chromosome 4, BAC clone F28A23
            (ESSA project).
          Length = 980

 Score =  255 bits (651), Expect = 1e-66
 Identities = 152/335 (45%), Positives = 194/335 (57%), Gaps = 13/335 (3%)
 Frame = -2

Query: 1123 ELVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLD--RFRE 950
            +LVTVDG          KASAYILG +G+ I+YK VL++GTA AVRR+        + +E
Sbjct: 454  QLVTVDGETRLDLDTLLKASAYILGTTGTGIVYKAVLENGTAFAVRRIETESCAAAKPKE 513

Query: 949  FENQIRVISKLVHPNLVRIRGFYWGADEKLVIYDFVPNGSL--------ANACHRKGGSS 794
            FE ++R I+KL HPNLVRIRGF WG DEKL+I D+VPNGSL        A++      S 
Sbjct: 514  FEREVRAIAKLRHPNLVRIRGFCWGDDEKLLISDYVPNGSLLCFFTATKASSSSSSSSSL 573

Query: 793  HRHLPWEVRLKIARGVARGLSYIHEKKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAG 614
               L +E RLKIARG+ARGLSYI+EKK VHGN+KP+NILL+A+ EP + D GL+RL+   
Sbjct: 574  QNPLTFEARLKIARGMARGLSYINEKKQVHGNIKPNNILLNAENEPIITDLGLDRLMTPA 633

Query: 613  GESSRKVYGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKP 434
             ES                               HT  P+ S    SPY  PE   SLKP
Sbjct: 634  RES-------------------------------HTTGPTSS----SPYQPPEWSTSLKP 658

Query: 433  NPKWDVFSFGVVLLELLTGKIIVSD---EMVPGPPVMGVEEKSKVLRMADVAIRADMXXX 263
            NPKWDV+SFGV+LLELLT K+   D   +          EE  + LR+ D AIR+D+   
Sbjct: 659  NPKWDVYSFGVILLELLTSKVFSVDHDIDQFSNLSDSAAEENGRFLRLIDGAIRSDVARH 718

Query: 262  XXXXXXXXXXGYNCISPVPQKRPTMKEVVQALDNI 158
                      G  C+S +PQKRP+MKE+ + LD++
Sbjct: 719  EDAAMACFRLGIECVSSLPQKRPSMKELTRHLDSL 753



>pir|C84527|C84527 probable receptor-like protein kinase [imported] -
            Arabidopsis thaliana>gb:AC007267_1535749 Arabidopsis
            thaliana chromosome 2 clone F27O10 map mi398, complete
            sequence.
          Length = 744

 Score =  239 bits (609), Expect = 1e-61
 Identities = 140/328 (42%), Positives = 193/328 (58%), Gaps = 6/328 (1%)
 Frame = -2

Query: 1123 ELVTVDGXXXXXXXXXXKASAYILGASGSS-IMYKTVLDDGTALAVRRVGESGLD--RFR 953
            +LVTVDG          KASAY+LG + S  I+YK VL++G A AVRR+G       +F+
Sbjct: 454  QLVTVDGETQLELDTLLKASAYVLGTNRSDGIVYKAVLENGAAFAVRRIGAESCPAAKFK 513

Query: 952  EFENQIRVISKLVHPNLVRIRGFYWGADEKLVIYDFVPNGSL--ANACHRKGGSSHRHLP 779
            EFE +++ I+KL HPNLVR+RGF WG +EKL+I D+VPNG+L  ++   +    SH+ L 
Sbjct: 514  EFEKEVQGIAKLRHPNLVRVRGFVWGKEEKLLISDYVPNGNLPLSSISAKSSSFSHKPLS 573

Query: 778  WEVRLKIARGVARGLSYIHEKKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSR 599
            +E RLK+ARG+ARG++YIH+KKHVHGN+K +NILLD++ EP + D GL+R+         
Sbjct: 574  FEARLKLARGIARGIAYIHDKKHVHGNIKANNILLDSEFEPVITDMGLDRI--------- 624

Query: 598  KVYGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSP-SALGISPYIAPESLRSLKPNPKW 422
                                     ++  H  +  P S+L   P   PE   S KPNPKW
Sbjct: 625  -------------------------MTSAHLLTDGPLSSLQDQP---PEWSTSQKPNPKW 656

Query: 421  DVFSFGVVLLELLTGKIIVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXX 242
            DV+SFGV+LLELLTG +   D  +        +EKS  L++ D  IR ++          
Sbjct: 657  DVYSFGVILLELLTGIVFSVDRDLVRD--SETDEKSWFLKLVDGEIRVEVAHREDEAVAC 714

Query: 241  XXXGYNCISPVPQKRPTMKEVVQALDNI 158
               GY C+S +PQKRP+MKEVVQ L+ +
Sbjct: 715  LKLGYECVSSLPQKRPSMKEVVQVLEKM 742



>pir|H84421|H84421 probable receptor-like protein kinase [imported] -
            Arabidopsis thaliana>gb:AC006200_1533560 Arabidopsis
            thaliana chromosome 2 clone F10A8 map rga, complete
            sequence.
          Length = 716

 Score =  236 bits (601), Expect = 9e-61
 Identities = 136/335 (40%), Positives = 190/335 (56%), Gaps = 12/335 (3%)
 Frame = -2

Query: 1123 ELVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFE 944
            ++V +D           KASA++LG SG  I+YK VL++G  LAVRR+GE G  RF+EF+
Sbjct: 387  DIVPLDAQVAFNLEELLKASAFVLGKSGIGIVYKVVLENGLTLAVRRLGEGGSQRFKEFQ 446

Query: 943  NQIRVISKLVHPNLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGG-SSHRHLPWEVR 767
             ++  I KL HPN+  +R +YW  DEKL+IYD+V NG+LA A H K G  +   L W  R
Sbjct: 447  TEVEAIGKLKHPNIASLRAYYWSVDEKLLIYDYVSNGNLATALHGKPGMMTIAPLTWSER 506

Query: 766  LKIARGVARGLSYIHE---KKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRK 596
            L+I +G+A GL Y+HE   KK+VHG+LKPSNIL+  DMEPK+ DFGL RL    G SS  
Sbjct: 507  LRIMKGIATGLVYLHEFSPKKYVHGDLKPSNILIGQDMEPKISDFGLARLANIAGGSSPT 566

Query: 595  VYGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDV 416
            +  S+R   + +    R      +VS   T   S      S Y APE+L+ +KP+ KWDV
Sbjct: 567  IQ-SNRIIQTDQQPQERQQHHHKSVSSEFTAHSSSG----SYYQAPETLKMVKPSQKWDV 621

Query: 415  FSFGVVLLELLTGKIIVSDEMVPGPPVMG--------VEEKSKVLRMADVAIRADMXXXX 260
            +S+G++LLEL+ G+   S  +  G   M         +EEK  +  + D  + A      
Sbjct: 622  YSYGIILLELIAGR---SPAVEVGTSEMDLVRWVQVCIEEKKPLCDVLDPCL-APEAETE 677

Query: 259  XXXXXXXXXGYNCISPVPQKRPTMKEVVQALDNIP 155
                       +C++  P+KRPTM+ V   LD +P
Sbjct: 678  DEIVAVLKIAISCVNSSPEKRPTMRHVSDTLDRLP 712



>gb:AP003202_1825076 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, BAC clone:B1075D06.
          Length = 705

 Score =  232 bits (591), Expect = 1e-59
 Identities = 135/332 (40%), Positives = 198/332 (59%), Gaps = 10/332 (3%)
 Frame = -2

Query: 1123 ELVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFE 944
            +LV +D           KASA++LG SG  I+YK VL+DG  +AVRR+GE GL RF+EF+
Sbjct: 386  DLVPLDQQVRFDLDELLKASAFVLGKSGIGIVYKVVLEDGLTMAVRRLGEGGLQRFKEFQ 445

Query: 943  NQIRVISKLVHPNLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGS-SHRHLPWEVR 767
             ++  I K+ HP++V +R +YW  DEKL+IYD++PNGSL+ A H K G+ +   LPW+ R
Sbjct: 446  TEVEAIGKVRHPSIVTLRAYYWSYDEKLLIYDYIPNGSLSAAIHGKPGTMTFTPLPWDGR 505

Query: 766  LKIARGVARGLSYIHE---KKHVHGNLKPSNILLDADMEPKVGDFGLERLV-VAGGESSR 599
            LKI +GVA+GLS++HE   KK++HG+L+P+N+LL ++MEP + DFGL RL  +AGG    
Sbjct: 506  LKIMQGVAKGLSFLHEFSPKKYIHGDLRPNNVLLGSNMEPYISDFGLGRLANIAGGSP-- 563

Query: 598  KVYGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWD 419
                          T S  +  + A S     S SP     S Y APE+L++LKP+ KWD
Sbjct: 564  -------------FTQSDHAGIEKAQSQQSDASVSPLVGKGSCYQAPEALKTLKPSQKWD 610

Query: 418  VFSFGVVLLELLTGKI-IVSDEMVPGPPVMGV----EEKSKVLRMADVAIRADMXXXXXX 254
            V+S+GV+LLE++TG+  +V  E +    V  V    EEK     + D ++  D       
Sbjct: 611  VYSYGVILLEMITGRSPVVLLETMQMDLVQWVQFCIEEKKPSADVLDPSLARD-SEREDE 669

Query: 253  XXXXXXXGYNCISPVPQKRPTMKEVVQALDNI 158
                      C+   P++RP+M+ V + LD++
Sbjct: 670  MIAALKVALACVQANPERRPSMRHVAETLDHL 701



>pir|A86383|A86383 76.4K protein kinase homolog F4F7.29 - Arabidopsis
            thaliana>gb:AE005172_891453 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AY056441_1563749 Arabidopsis thaliana
            At1g25320/F4F7_17 mRNA, complete cds.>gb:BT010471_1640417
            Arabidopsis thaliana At1g25320/F4F7_17 gene, complete
            cds.>gb:AC079374_1732565 Arabidopsis thaliana chromosome
            1 BAC F4F7 genomic sequence, complete sequence.
          Length = 702

 Score =  225 bits (573), Expect = 2e-57
 Identities = 132/334 (39%), Positives = 190/334 (56%), Gaps = 12/334 (3%)
 Frame = -2

Query: 1123 ELVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFE 944
            +LV +D           KASA++LG  G+ I+YK VL+DG  +AVRR+GE G  R +EF+
Sbjct: 388  DLVLLDKHIALDLDELLKASAFVLGKGGNGIVYKVVLEDGLTVAVRRLGEGGSQRCKEFQ 447

Query: 943  NQIRVISKLVHPNLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGS-SHRHLPWEVR 767
             ++  I KL HPN+V ++ +YW  +EKL+IYD++PNGSL NA H   G  S + L W VR
Sbjct: 448  TEVEAIGKLRHPNIVSLKAYYWSVEEKLLIYDYIPNGSLTNALHGNPGMVSFKPLSWGVR 507

Query: 766  LKIARGVARGLSYIHE---KKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGG--ESS 602
            LKI RG++RGL Y+HE   KK+VHG+LK SNILL  DMEP + DFGL  L    G  ES+
Sbjct: 508  LKIMRGISRGLVYLHEFSPKKYVHGSLKLSNILLGQDMEPHISDFGLMHLSSIAGTLEST 567

Query: 601  RKVYGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLR-SLKPNPK 425
                 S++   S  S+A+  SF                      Y+APE+ + ++KP+ K
Sbjct: 568  TVDRPSNKTASSIGSSANLSSF----------------------YLAPEATKATVKPSQK 605

Query: 424  WDVFSFGVVLLELLTGKIIV-----SDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXX 260
            WDV+SFGV+LLE++TG++ +     S+  +     M ++EK ++  + D  +  +     
Sbjct: 606  WDVYSFGVILLEMITGRLPIVFVGKSEMEIVKWIQMCIDEKKEMSDILDPYLVPNDTEIE 665

Query: 259  XXXXXXXXXGYNCISPVPQKRPTMKEVVQALDNI 158
                        C+S  P+KRP MK +  AL  I
Sbjct: 666  EEVIAVLKIAMACVSTSPEKRPPMKHIADALTQI 699



>pir|T02154|T02154 protein kinase homolog T1F15.2 - Arabidopsis
            thaliana>gb:AE005173_894372 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:AC011020_1537196 Arabidopsis thaliana
            chromosome 1 BAC F12B7 genomic sequence, complete
            sequence.>gb:T1F15_1723568 Arabidopsis thaliana
            chromosome 1 BAC T1F15 sequence, complete sequence.
          Length = 719

 Score =  212 bits (539), Expect = 1e-53
 Identities = 134/343 (39%), Positives = 182/343 (53%), Gaps = 20/343 (5%)
 Frame = -2

Query: 1126 GELVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREF 947
            GELV +D           +ASAY+LG SG  I+YK VL +G  +AVRR+GE G  R++EF
Sbjct: 392  GELVAIDKGFSFELDELLRASAYVLGKSGLGIVYKVVLGNGVPVAVRRLGEGGEQRYKEF 451

Query: 946  ENQIRVISKLVHPNLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVR 767
              +++ + K+ HPN+V++R +YW  DEKL+I DFV NGSLA+A   + G     L W  R
Sbjct: 452  VTEVQAMGKVKHPNVVKLRAYYWAPDEKLLISDFVNNGSLADALRGRNGQPSPSLTWSTR 511

Query: 766  LKIARGVARGLSYIHE---KKHVHGNLKPSNILLDADMEPKVGDFGLERL--VVAGGESS 602
            +KIA+G ARGL+Y+HE   +K VHG++KPSNILLD+   P + DFGL RL  + A   SS
Sbjct: 512  IKIAKGAARGLAYLHECSPRKLVHGDVKPSNILLDSSFTPYISDFGLTRLITITAASASS 571

Query: 601  RKVYGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPES-LRSLKPNPK 425
             +   SS   G         S   S  S G              Y APE+ L   +P  K
Sbjct: 572  NEPSSSSAAGGFLGGALPYTSIKPSDRSNG--------------YKAPEARLPGGRPTQK 617

Query: 424  WDVFSFGVVLLELLTGK---------IIVSDEMVPGPPVM-----GVEEKSKVLRMADVA 287
            WDV+SFGVVL+ELLTGK            S  +V  P ++     G EE++ +  M D  
Sbjct: 618  WDVYSFGVVLMELLTGKSPDSSPLSSSSTSTVVVEVPDLVKWVRKGFEEETPLSDMVDPM 677

Query: 286  IRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVVQALDNI 158
            +  ++                C    P+ RP MK V + +D I
Sbjct: 678  LLQEV-HAKQQVLSVFHLALACTEGDPEVRPRMKNVSENIDKI 719



>gb:AC013288_1537852 Arabidopsis thaliana chromosome 1 BAC F4N21
            genomic sequence, complete sequence.
          Length = 685

 Score =  186 bits (471), Expect = 1e-45
 Identities = 118/311 (37%), Positives = 170/311 (54%), Gaps = 5/311 (1%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            ASA++LG S   ++YK VL++G  LAVRR+ + G  R +EF   +  ++K+ HPN++ ++
Sbjct: 398  ASAFLLGKSRIGLVYKVVLENGLMLAVRRLEDKGWLRLKEFLADVEAMAKIKHPNVLNLK 457

Query: 889  GFYWGADEKLVIYDFVPNGSLANACH-RKGGSSHRHLPWEVRLKIARGVARGLSYIHE-- 719
               W  +EKL+IYD++PNG L +A   R G  S + L W VRLKI RG+A+GL+YIHE  
Sbjct: 458  ACCWSPEEKLLIYDYIPNGDLGSAIQGRPGSVSCKQLTWTVRLKILRGIAKGLTYIHEFS 517

Query: 718  -KKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRD 542
             K++VHG++  SNILL  ++EPKV  FGL R+V                        S D
Sbjct: 518  PKRYVHGHINTSNILLGPNLEPKVSGFGLGRIV----------------------DTSSD 555

Query: 541  SFPDSAVSGGHTPSPSPSALGISPYIAPESLRSL-KPNPKWDVFSFGVVLLELLTGKIIV 365
               D  +S   T SP  S    S Y APE+   + KP+ KWDV+SFG+V+LE++TGK  V
Sbjct: 556  IRSDQ-ISPMETSSPILSR--ESYYQAPEAASKMTKPSQKWDVYSFGLVILEMVTGKSPV 612

Query: 364  SDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMK 185
            S EM     V    E++K        + A               G  C+   P KRP M+
Sbjct: 613  SSEMDLVMWVESASERNKPAWYVLDPVLARDRDLEDSMVQVIKIGLACVQKNPDKRPHMR 672

Query: 184  EVVQALDNIPT 152
             V+++ + + T
Sbjct: 673  SVLESFEKLVT 683



>gb:BT010733_1640679 Arabidopsis thaliana At3g57830 gene, complete
            cds.>gb:AK118626_1816593 Arabidopsis thaliana At3g57830
            mRNA for putative receptor-like protein kinase, complete
            cds, clone: RAFL19-89-A18.
          Length = 662

 Score =  169 bits (429), Expect = 8e-41
 Identities = 120/350 (34%), Positives = 184/350 (52%), Gaps = 24/350 (6%)
 Frame = -2

Query: 1135 QKTGELVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDG-----------TALAV 989
            +K G+ V +D           +ASAY++G S S I+Y+ V   G           T +AV
Sbjct: 327  EKEGKFVVMDEGFELELEDLLRASAYVVGKSRSGIVYRVVAGMGSGTVAATFTSSTVVAV 386

Query: 988  RRVGESGLD-RFREFENQIRVISKLVHPNLVRIRGFYWGADEKLVIYDFVPNGSLANACH 812
            RR+ +     R ++FEN++  IS++ HPN+VR+R +Y+  DE+L+I D++ NGSL +A H
Sbjct: 387  RRLSDGDATWRRKDFENEVEAISRVQHPNIVRLRAYYYAEDERLLITDYIRNGSLYSALH 446

Query: 811  RKGGSSHRHLPWEVRLKIARGVARGLSYIHE---KKHVHGNLKPSNILLDADMEPKVGDF 641
                ++   L W  RL IA+G ARGL YIHE   +K+VHGNLK + ILLD ++ P++  F
Sbjct: 447  GGPSNTLPSLSWPERLLIAQGTARGLMYIHEYSPRKYVHGNLKSTKILLDDELLPRISGF 506

Query: 640  GLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSAVSGGHTPS--PSPSALGISPY 467
            GL RL          V G S+  GS   +A+R S   + ++   T +   +P+      Y
Sbjct: 507  GLTRL----------VSGYSKLIGS--LSATRQSLDQTYLTSATTVTRITAPTV----AY 550

Query: 466  IAPESLRS--LKPNPKWDVFSFGVVLLELLTGKIIVSDEMVPGPPVM-----GVEEKSKV 308
            +APE+  S   K + K DV+SFGVVL+ELLTG++  +     G  ++      V+E+  +
Sbjct: 551  LAPEARASSGCKLSQKCDVYSFGVVLMELLTGRLPNASSKNNGEELVRVVRNWVKEEKPL 610

Query: 307  LRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVVQALDNI 158
              + D  I  +                NC    P+ RP M+ V ++L  I
Sbjct: 611  SEILDPEI-LNKGHADKQVIAAIHVALNCTEMDPEVRPRMRSVSESLGRI 659



>pir|T46005|T46005 receptor-like protein kinase - Arabidopsis
            thaliana>gb:ATT10K17_1554250 Arabidopsis thaliana DNA
            chromosome 3, BAC clone T10K17.
          Length = 662

 Score =  169 bits (429), Expect = 8e-41
 Identities = 120/350 (34%), Positives = 184/350 (52%), Gaps = 24/350 (6%)
 Frame = -2

Query: 1135 QKTGELVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDG-----------TALAV 989
            +K G+ V +D           +ASAY++G S S I+Y+ V   G           T +AV
Sbjct: 327  EKEGKFVVMDEGFELELEDLLRASAYVVGKSRSGIVYRVVAGMGSGTVAATFTSSTVVAV 386

Query: 988  RRVGESGLD-RFREFENQIRVISKLVHPNLVRIRGFYWGADEKLVIYDFVPNGSLANACH 812
            RR+ +     R ++FEN++  IS++ HPN+VR+R +Y+  DE+L+I D++ NGSL +A H
Sbjct: 387  RRLSDGDATWRRKDFENEVEAISRVQHPNIVRLRAYYYAEDERLLITDYIRNGSLYSALH 446

Query: 811  RKGGSSHRHLPWEVRLKIARGVARGLSYIHE---KKHVHGNLKPSNILLDADMEPKVGDF 641
                ++   L W  RL IA+G ARGL YIHE   +K+VHGNLK + ILLD ++ P++  F
Sbjct: 447  GGPSNTLPSLSWPERLLIAQGTARGLMYIHEYSPRKYVHGNLKSTKILLDDELLPRISGF 506

Query: 640  GLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSAVSGGHTPS--PSPSALGISPY 467
            GL RL          V G S+  GS   +A+R S   + ++   T +   +P+      Y
Sbjct: 507  GLTRL----------VSGYSKLIGS--LSATRQSLDQTYLTSATTVTRITAPTV----AY 550

Query: 466  IAPESLRS--LKPNPKWDVFSFGVVLLELLTGKIIVSDEMVPGPPVM-----GVEEKSKV 308
            +APE+  S   K + K DV+SFGVVL+ELLTG++  +     G  ++      V+E+  +
Sbjct: 551  LAPEARASSGCKLSQKCDVYSFGVVLMELLTGRLPNASSKNNGEELVRVVRNWVKEEKPL 610

Query: 307  LRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVVQALDNI 158
              + D  I  +                NC    P+ RP M+ V ++L  I
Sbjct: 611  SEILDPEI-LNKGHADKQVIAAIHVALNCTEMDPEVRPRMRSVSESLGRI 659



>pir|B84852|B84852 probable receptor-like protein kinase [imported] -
            Arabidopsis thaliana>gb:AC005956_1533227 Arabidopsis
            thaliana chromosome 2 clone MHK10 map EG05C12, complete
            sequence.
          Length = 646

 Score =  166 bits (420), Expect = 9e-40
 Identities = 122/339 (35%), Positives = 171/339 (50%), Gaps = 16/339 (4%)
 Frame = -2

Query: 1126 GELVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDG--TALAVRRVGESGLD--R 959
            G+ V  D           +ASAY++G S S I+Y+ V  +   T +AVRR+ + G D  R
Sbjct: 327  GKFVAFDEGFELELEDLLRASAYVIGKSRSGIVYRVVAAESSSTVVAVRRLSD-GNDTWR 385

Query: 958  FREFENQIRVISKLVHPNLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLP 779
            F++F N++  I ++ HPN+VR+R +Y+  DEKL+I DF+ NGSL +A H    ++   L 
Sbjct: 386  FKDFVNEVESIGRINHPNIVRLRAYYYAEDEKLLITDFINNGSLYSALHGGPSNTRPTLS 445

Query: 778  WEVRLKIARGVARGLSYIHE---KKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGE 608
            W  RL IA+G ARGL YIHE   +K+VHGNLK S ILLD ++ P V  FGL RLV     
Sbjct: 446  WAERLCIAQGTARGLMYIHEYSSRKYVHGNLKSSKILLDNELHPHVSGFGLTRLV----- 500

Query: 607  SSRKVYGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRS--LKP 434
                        G  + T    S    ++  G     S SA   + Y+APE+  S   K 
Sbjct: 501  -----------SGYPKVTDHSLSSMTQSIDQGFATRLSVSA-PAAAYLAPEARASSDCKL 548

Query: 433  NPKWDVFSFGVVLLELLTGKIIV-------SDEMVPGPPVMGVEEKSKVLRMADVAIRAD 275
            + K DV+SFGV+LLELLTG++          +E+V        EE+S    +    ++ D
Sbjct: 549  SHKCDVYSFGVILLELLTGRLPYGSSENEGEEELVNVLRKWHKEERSLAEILDPKLLKQD 608

Query: 274  MXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVVQALDNI 158
                            NC    P  RP M+ V + L  I
Sbjct: 609  F--ANKQVIATIHVALNCTEMDPDMRPRMRSVSEILGRI 645



>gb:AX196315_1463942 Sequence 22 from Patent WO0151627.
          Length = 877

 Score =  162 bits (411), Expect = 9e-39
 Identities = 109/334 (32%), Positives = 166/334 (49%), Gaps = 11/334 (3%)
 Frame = -2

Query: 1126 GELVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREF 947
            G+LV  DG           A+A I+G S    +YK +L+DG+ +AV+R+ E      REF
Sbjct: 573  GKLVHFDGPMAFTADDLLCATAEIMGKSTYGTVYKAILEDGSQVAVKRLREKITKGHREF 632

Query: 946  ENQIRVISKLVHPNLVRIRGFYWG-ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEV 770
            E+++ V+ K+ HPN++ +R +Y G   EKL+++D++  GSLA+  H  GG +   + W  
Sbjct: 633  ESEVSVLGKIRHPNVLALRAYYLGPKGEKLLVFDYMSKGSLASFLH--GGGTETFIDWPT 690

Query: 769  RLKIARGVARGLSYIHEKKH-VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKV 593
            R+KIA+ +ARGL  +H +++ +HGNL  SN+LLD +   K+ DFGL RL+          
Sbjct: 691  RMKIAQDLARGLFCLHSQENIIHGNLTSSNVLLDENTNAKIADFGLSRLM---------- 740

Query: 592  YGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVF 413
                       STA+  +   +A            ALG   Y APE  +  K N K D++
Sbjct: 741  -----------STAANSNVIATA-----------GALG---YRAPELSKLKKANTKTDIY 775

Query: 412  SFGVVLLELLTGKIIVSDEMVPGPPVMGVEEKSKVLRMA---------DVAIRADMXXXX 260
            S GV+LLELLT K        PG P+ G++    V  +          D  +  D     
Sbjct: 776  SLGVILLELLTRK-------SPGVPMNGLDLPQWVASVVKEEWTNEVFDADLMRDASTVG 828

Query: 259  XXXXXXXXXGYNCISPVPQKRPTMKEVVQALDNI 158
                       +C+ P P  RP + +V+Q L+ I
Sbjct: 829  DELLNTLKLALHCVDPSPSARPEVHQVLQQLEEI 862



>gb:AX196312_1463939 Sequence 19 from Patent
            WO0151627.>gb:AX196314_1463941 Sequence 21 from Patent
            WO0151627.>gb:AX196316_1463943 Sequence 23 from Patent
            WO0151627.
          Length = 854

 Score =  162 bits (411), Expect = 9e-39
 Identities = 109/334 (32%), Positives = 166/334 (49%), Gaps = 11/334 (3%)
 Frame = -2

Query: 1126 GELVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREF 947
            G+LV  DG           A+A I+G S    +YK +L+DG+ +AV+R+ E      REF
Sbjct: 550  GKLVHFDGPMAFTADDLLCATAEIMGKSTYGTVYKAILEDGSQVAVKRLREKITKGHREF 609

Query: 946  ENQIRVISKLVHPNLVRIRGFYWG-ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEV 770
            E+++ V+ K+ HPN++ +R +Y G   EKL+++D++  GSLA+  H  GG +   + W  
Sbjct: 610  ESEVSVLGKIRHPNVLALRAYYLGPKGEKLLVFDYMSKGSLASFLH--GGGTETFIDWPT 667

Query: 769  RLKIARGVARGLSYIHEKKH-VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKV 593
            R+KIA+ +ARGL  +H +++ +HGNL  SN+LLD +   K+ DFGL RL+          
Sbjct: 668  RMKIAQDLARGLFCLHSQENIIHGNLTSSNVLLDENTNAKIADFGLSRLM---------- 717

Query: 592  YGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVF 413
                       STA+  +   +A            ALG   Y APE  +  K N K D++
Sbjct: 718  -----------STAANSNVIATA-----------GALG---YRAPELSKLKKANTKTDIY 752

Query: 412  SFGVVLLELLTGKIIVSDEMVPGPPVMGVEEKSKVLRMA---------DVAIRADMXXXX 260
            S GV+LLELLT K        PG P+ G++    V  +          D  +  D     
Sbjct: 753  SLGVILLELLTRK-------SPGVPMNGLDLPQWVASVVKEEWTNEVFDADLMRDASTVG 805

Query: 259  XXXXXXXXXGYNCISPVPQKRPTMKEVVQALDNI 158
                       +C+ P P  RP + +V+Q L+ I
Sbjct: 806  DELLNTLKLALHCVDPSPSARPEVHQVLQQLEEI 839



>gb:AX196311_1463938 Sequence 18 from Patent
            WO0151627.>gb:AX196313_1463940 Sequence 20 from Patent
            WO0151627.
          Length = 877

 Score =  162 bits (411), Expect = 9e-39
 Identities = 109/334 (32%), Positives = 166/334 (49%), Gaps = 11/334 (3%)
 Frame = -2

Query: 1126 GELVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREF 947
            G+LV  DG           A+A I+G S    +YK +L+DG+ +AV+R+ E      REF
Sbjct: 573  GKLVHFDGPMAFTADDLLCATAEIMGKSTYGTVYKAILEDGSQVAVKRLREKITKGHREF 632

Query: 946  ENQIRVISKLVHPNLVRIRGFYWG-ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEV 770
            E+++ V+ K+ HPN++ +R +Y G   EKL+++D++  GSLA+  H  GG +   + W  
Sbjct: 633  ESEVSVLGKIRHPNVLALRAYYLGPKGEKLLVFDYMSKGSLASFLH--GGGTETFIDWPT 690

Query: 769  RLKIARGVARGLSYIHEKKH-VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKV 593
            R+KIA+ +ARGL  +H +++ +HGNL  SN+LLD +   K+ DFGL RL+          
Sbjct: 691  RMKIAQDLARGLFCLHSQENIIHGNLTSSNVLLDENTNAKIADFGLSRLM---------- 740

Query: 592  YGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVF 413
                       STA+  +   +A            ALG   Y APE  +  K N K D++
Sbjct: 741  -----------STAANSNVIATA-----------GALG---YRAPELSKLKKANTKTDIY 775

Query: 412  SFGVVLLELLTGKIIVSDEMVPGPPVMGVEEKSKVLRMA---------DVAIRADMXXXX 260
            S GV+LLELLT K        PG P+ G++    V  +          D  +  D     
Sbjct: 776  SLGVILLELLTRK-------SPGVPMNGLDLPQWVASVVKEEWTNEVFDADLMRDASTVG 828

Query: 259  XXXXXXXXXGYNCISPVPQKRPTMKEVVQALDNI 158
                       +C+ P P  RP + +V+Q L+ I
Sbjct: 829  DELLNTLKLALHCVDPSPSARPEVHQVLQQLEEI 862



>gb:AX196310_1463937 Sequence 17 from Patent WO0151627.
          Length = 854

 Score =  162 bits (411), Expect = 9e-39
 Identities = 109/334 (32%), Positives = 166/334 (49%), Gaps = 11/334 (3%)
 Frame = -2

Query: 1126 GELVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREF 947
            G+LV  DG           A+A I+G S    +YK +L+DG+ +AV+R+ E      REF
Sbjct: 550  GKLVHFDGPMAFTADDLLCATAEIMGKSTYGTVYKAILEDGSQVAVKRLREKITKGHREF 609

Query: 946  ENQIRVISKLVHPNLVRIRGFYWG-ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEV 770
            E+++ V+ K+ HPN++ +R +Y G   EKL+++D++  GSLA+  H  GG +   + W  
Sbjct: 610  ESEVSVLGKIRHPNVLALRAYYLGPKGEKLLVFDYMSKGSLASFLH--GGGTETFIDWPT 667

Query: 769  RLKIARGVARGLSYIHEKKH-VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKV 593
            R+KIA+ +ARGL  +H +++ +HGNL  SN+LLD +   K+ DFGL RL+          
Sbjct: 668  RMKIAQDLARGLFCLHSQENIIHGNLTSSNVLLDENTNAKIADFGLSRLM---------- 717

Query: 592  YGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVF 413
                       STA+  +   +A            ALG   Y APE  +  K N K D++
Sbjct: 718  -----------STAANSNVIATA-----------GALG---YRAPELSKLKKANTKTDIY 752

Query: 412  SFGVVLLELLTGKIIVSDEMVPGPPVMGVEEKSKVLRMA---------DVAIRADMXXXX 260
            S GV+LLELLT K        PG P+ G++    V  +          D  +  D     
Sbjct: 753  SLGVILLELLTRK-------SPGVPMNGLDLPQWVASVVKEEWTNEVFDADLMRDASTVG 805

Query: 259  XXXXXXXXXGYNCISPVPQKRPTMKEVVQALDNI 158
                       +C+ P P  RP + +V+Q L+ I
Sbjct: 806  DELLNTLKLALHCVDPSPSARPEVHQVLQQLEEI 839



>gb:AX196309_1463936 Sequence 16 from Patent WO0151627.
          Length = 877

 Score =  162 bits (411), Expect = 9e-39
 Identities = 109/334 (32%), Positives = 166/334 (49%), Gaps = 11/334 (3%)
 Frame = -2

Query: 1126 GELVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREF 947
            G+LV  DG           A+A I+G S    +YK +L+DG+ +AV+R+ E      REF
Sbjct: 573  GKLVHFDGPMAFTADDLLCATAEIMGKSTYGTVYKAILEDGSQVAVKRLREKITKGHREF 632

Query: 946  ENQIRVISKLVHPNLVRIRGFYWG-ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEV 770
            E+++ V+ K+ HPN++ +R +Y G   EKL+++D++  GSLA+  H  GG +   + W  
Sbjct: 633  ESEVSVLGKIRHPNVLALRAYYLGPKGEKLLVFDYMSKGSLASFLH--GGGTETFIDWPT 690

Query: 769  RLKIARGVARGLSYIHEKKH-VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKV 593
            R+KIA+ +ARGL  +H +++ +HGNL  SN+LLD +   K+ DFGL RL+          
Sbjct: 691  RMKIAQDLARGLFCLHSQENIIHGNLTSSNVLLDENTNAKIADFGLSRLM---------- 740

Query: 592  YGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVF 413
                       STA+  +   +A            ALG   Y APE  +  K N K D++
Sbjct: 741  -----------STAANSNVIATA-----------GALG---YRAPELSKLKKANTKTDIY 775

Query: 412  SFGVVLLELLTGKIIVSDEMVPGPPVMGVEEKSKVLRMA---------DVAIRADMXXXX 260
            S GV+LLELLT K        PG P+ G++    V  +          D  +  D     
Sbjct: 776  SLGVILLELLTRK-------SPGVPMNGLDLPQWVASVVKEEWTNEVFDADLMRDASTVG 828

Query: 259  XXXXXXXXXGYNCISPVPQKRPTMKEVVQALDNI 158
                       +C+ P P  RP + +V+Q L+ I
Sbjct: 829  DELLNTLKLALHCVDPSPSARPEVHQVLQQLEEI 862



>gb:AX196306_1463933 Sequence 13 from Patent WO0151627.
          Length = 854

 Score =  160 bits (404), Expect = 6e-38
 Identities = 109/327 (33%), Positives = 166/327 (50%), Gaps = 4/327 (1%)
 Frame = -2

Query: 1126 GELVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREF 947
            G+LV  DG           A+A I+G S    +YK +L+DG+ +AV+R+ E      REF
Sbjct: 550  GKLVHFDGPMAFTADDLLCATAEIMGKSTYGTVYKAILEDGSQVAVKRLREKITKGHREF 609

Query: 946  ENQIRVISKLVHPNLVRIRGFYWG-ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEV 770
            E+++ V+ K+ HPN++ +R +Y G   EKL+++D++  GSLA+  H  GG +   + W  
Sbjct: 610  ESEVSVLGKIRHPNVLALRAYYLGPKGEKLLVFDYMSKGSLASFLH--GGGTETFIDWPT 667

Query: 769  RLKIARGVARGLSYIHEKKH-VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKV 593
            R+KIA+ +ARGL  +H +++ +HGNL  SN+LLD +   K+ DFGL RL+          
Sbjct: 668  RMKIAQDLARGLFCLHSQENIIHGNLTSSNVLLDENTNAKIADFGLSRLM---------- 717

Query: 592  YGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVF 413
                       STA+  +   +A            ALG   Y APE  +  K N K D++
Sbjct: 718  -----------STAANSNVIATA-----------GALG---YRAPELSKLKKANTKTDIY 752

Query: 412  SFGVVLLELLTGKII-VSDEMVPGPP-VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXX 239
            S GV+LLELLT K   VS   +  P  V  V ++     + D  +  D            
Sbjct: 753  SLGVILLELLTRKSPGVSMNGLDLPQWVASVVKEEWTNEVFDADLMRDASTVGDELLNTL 812

Query: 238  XXGYNCISPVPQKRPTMKEVVQALDNI 158
                +C+ P P  RP + +V+Q L+ I
Sbjct: 813  KLALHCVDPSPSARPEVHQVLQQLEEI 839



>gb:AX196305_1463932 Sequence 12 from Patent WO0151627.
          Length = 877

 Score =  160 bits (404), Expect = 6e-38
 Identities = 109/327 (33%), Positives = 166/327 (50%), Gaps = 4/327 (1%)
 Frame = -2

Query: 1126 GELVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREF 947
            G+LV  DG           A+A I+G S    +YK +L+DG+ +AV+R+ E      REF
Sbjct: 573  GKLVHFDGPMAFTADDLLCATAEIMGKSTYGTVYKAILEDGSQVAVKRLREKITKGHREF 632

Query: 946  ENQIRVISKLVHPNLVRIRGFYWG-ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEV 770
            E+++ V+ K+ HPN++ +R +Y G   EKL+++D++  GSLA+  H  GG +   + W  
Sbjct: 633  ESEVSVLGKIRHPNVLALRAYYLGPKGEKLLVFDYMSKGSLASFLH--GGGTETFIDWPT 690

Query: 769  RLKIARGVARGLSYIHEKKH-VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKV 593
            R+KIA+ +ARGL  +H +++ +HGNL  SN+LLD +   K+ DFGL RL+          
Sbjct: 691  RMKIAQDLARGLFCLHSQENIIHGNLTSSNVLLDENTNAKIADFGLSRLM---------- 740

Query: 592  YGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVF 413
                       STA+  +   +A            ALG   Y APE  +  K N K D++
Sbjct: 741  -----------STAANSNVIATA-----------GALG---YRAPELSKLKKANTKTDIY 775

Query: 412  SFGVVLLELLTGKII-VSDEMVPGPP-VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXX 239
            S GV+LLELLT K   VS   +  P  V  V ++     + D  +  D            
Sbjct: 776  SLGVILLELLTRKSPGVSMNGLDLPQWVASVVKEEWTNEVFDADLMRDASTVGDELLNTL 835

Query: 238  XXGYNCISPVPQKRPTMKEVVQALDNI 158
                +C+ P P  RP + +V+Q L+ I
Sbjct: 836  KLALHCVDPSPSARPEVHQVLQQLEEI 862



>gb:AX196304_1463931 Sequence 11 from Patent WO0151627.
          Length = 854

 Score =  160 bits (404), Expect = 6e-38
 Identities = 109/327 (33%), Positives = 166/327 (50%), Gaps = 4/327 (1%)
 Frame = -2

Query: 1126 GELVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREF 947
            G+LV  DG           A+A I+G S    +YK +L+DG+ +AV+R+ E      REF
Sbjct: 550  GKLVHFDGPMAFTADDLLCATAEIMGKSTYGTVYKAILEDGSQVAVKRLREKITKGHREF 609

Query: 946  ENQIRVISKLVHPNLVRIRGFYWG-ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEV 770
            E+++ V+ K+ HPN++ +R +Y G   EKL+++D++  GSLA+  H  GG +   + W  
Sbjct: 610  ESEVSVLGKIRHPNVLALRAYYLGPKGEKLLVFDYMSKGSLASFLH--GGGTETFIDWPT 667

Query: 769  RLKIARGVARGLSYIHEKKH-VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKV 593
            R+KIA+ +ARGL  +H +++ +HGNL  SN+LLD +   K+ DFGL RL+          
Sbjct: 668  RMKIAQDLARGLFCLHSQENIIHGNLTSSNVLLDENTNAKIADFGLSRLM---------- 717

Query: 592  YGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVF 413
                       STA+  +   +A            ALG   Y APE  +  K N K D++
Sbjct: 718  -----------STAANSNVIATA-----------GALG---YRAPELSKLKKANTKTDIY 752

Query: 412  SFGVVLLELLTGKII-VSDEMVPGPP-VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXX 239
            S GV+LLELLT K   VS   +  P  V  V ++     + D  +  D            
Sbjct: 753  SLGVILLELLTRKSPGVSMNGLDLPQWVASVVKEEWTNEVFDADLMRDASTVGDELLNTL 812

Query: 238  XXGYNCISPVPQKRPTMKEVVQALDNI 158
                +C+ P P  RP + +V+Q L+ I
Sbjct: 813  KLALHCVDPSPSARPEVHQVLQQLEEI 839



>gb:AX196303_1463930 Sequence 10 from Patent WO0151627.
          Length = 877

 Score =  160 bits (404), Expect = 6e-38
 Identities = 109/327 (33%), Positives = 166/327 (50%), Gaps = 4/327 (1%)
 Frame = -2

Query: 1126 GELVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREF 947
            G+LV  DG           A+A I+G S    +YK +L+DG+ +AV+R+ E      REF
Sbjct: 573  GKLVHFDGPMAFTADDLLCATAEIMGKSTYGTVYKAILEDGSQVAVKRLREKITKGHREF 632

Query: 946  ENQIRVISKLVHPNLVRIRGFYWG-ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEV 770
            E+++ V+ K+ HPN++ +R +Y G   EKL+++D++  GSLA+  H  GG +   + W  
Sbjct: 633  ESEVSVLGKIRHPNVLALRAYYLGPKGEKLLVFDYMSKGSLASFLH--GGGTETFIDWPT 690

Query: 769  RLKIARGVARGLSYIHEKKH-VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKV 593
            R+KIA+ +ARGL  +H +++ +HGNL  SN+LLD +   K+ DFGL RL+          
Sbjct: 691  RMKIAQDLARGLFCLHSQENIIHGNLTSSNVLLDENTNAKIADFGLSRLM---------- 740

Query: 592  YGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVF 413
                       STA+  +   +A            ALG   Y APE  +  K N K D++
Sbjct: 741  -----------STAANSNVIATA-----------GALG---YRAPELSKLKKANTKTDIY 775

Query: 412  SFGVVLLELLTGKII-VSDEMVPGPP-VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXX 239
            S GV+LLELLT K   VS   +  P  V  V ++     + D  +  D            
Sbjct: 776  SLGVILLELLTRKSPGVSMNGLDLPQWVASVVKEEWTNEVFDADLMRDASTVGDELLNTL 835

Query: 238  XXGYNCISPVPQKRPTMKEVVQALDNI 158
                +C+ P P  RP + +V+Q L+ I
Sbjct: 836  KLALHCVDPSPSARPEVHQVLQQLEEI 862



>gb:AX196296_1463926 Sequence 3 from Patent
            WO0151627.>gb:AX196302_1463929 Sequence 9 from Patent
            WO0151627.>gb:AX196308_1463935 Sequence 15 from Patent
            WO0151627.
          Length = 854

 Score =  160 bits (404), Expect = 6e-38
 Identities = 109/327 (33%), Positives = 166/327 (50%), Gaps = 4/327 (1%)
 Frame = -2

Query: 1126 GELVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREF 947
            G+LV  DG           A+A I+G S    +YK +L+DG+ +AV+R+ E      REF
Sbjct: 550  GKLVHFDGPMAFTADDLLCATAEIMGKSTYGTVYKAILEDGSQVAVKRLREKITKGHREF 609

Query: 946  ENQIRVISKLVHPNLVRIRGFYWG-ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEV 770
            E+++ V+ K+ HPN++ +R +Y G   EKL+++D++  GSLA+  H  GG +   + W  
Sbjct: 610  ESEVSVLGKIRHPNVLALRAYYLGPKGEKLLVFDYMSKGSLASFLH--GGGTETFIDWPT 667

Query: 769  RLKIARGVARGLSYIHEKKH-VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKV 593
            R+KIA+ +ARGL  +H +++ +HGNL  SN+LLD +   K+ DFGL RL+          
Sbjct: 668  RMKIAQDLARGLFCLHSQENIIHGNLTSSNVLLDENTNAKIADFGLSRLM---------- 717

Query: 592  YGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVF 413
                       STA+  +   +A            ALG   Y APE  +  K N K D++
Sbjct: 718  -----------STAANSNVIATA-----------GALG---YRAPELSKLKKANTKTDIY 752

Query: 412  SFGVVLLELLTGKII-VSDEMVPGPP-VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXX 239
            S GV+LLELLT K   VS   +  P  V  V ++     + D  +  D            
Sbjct: 753  SLGVILLELLTRKSPGVSMNGLDLPQWVASVVKEEWTNEVFDADLMRDASTVGDELLNTL 812

Query: 238  XXGYNCISPVPQKRPTMKEVVQALDNI 158
                +C+ P P  RP + +V+Q L+ I
Sbjct: 813  KLALHCVDPSPSARPEVHQVLQQLEEI 839



>gb:AX196295_1463925 Sequence 2 from Patent
            WO0151627.>gb:AX196301_1463928 Sequence 8 from Patent
            WO0151627.>gb:AX196307_1463934 Sequence 14 from Patent
            WO0151627.
          Length = 877

 Score =  160 bits (404), Expect = 6e-38
 Identities = 109/327 (33%), Positives = 166/327 (50%), Gaps = 4/327 (1%)
 Frame = -2

Query: 1126 GELVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREF 947
            G+LV  DG           A+A I+G S    +YK +L+DG+ +AV+R+ E      REF
Sbjct: 573  GKLVHFDGPMAFTADDLLCATAEIMGKSTYGTVYKAILEDGSQVAVKRLREKITKGHREF 632

Query: 946  ENQIRVISKLVHPNLVRIRGFYWG-ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEV 770
            E+++ V+ K+ HPN++ +R +Y G   EKL+++D++  GSLA+  H  GG +   + W  
Sbjct: 633  ESEVSVLGKIRHPNVLALRAYYLGPKGEKLLVFDYMSKGSLASFLH--GGGTETFIDWPT 690

Query: 769  RLKIARGVARGLSYIHEKKH-VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKV 593
            R+KIA+ +ARGL  +H +++ +HGNL  SN+LLD +   K+ DFGL RL+          
Sbjct: 691  RMKIAQDLARGLFCLHSQENIIHGNLTSSNVLLDENTNAKIADFGLSRLM---------- 740

Query: 592  YGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVF 413
                       STA+  +   +A            ALG   Y APE  +  K N K D++
Sbjct: 741  -----------STAANSNVIATA-----------GALG---YRAPELSKLKKANTKTDIY 775

Query: 412  SFGVVLLELLTGKII-VSDEMVPGPP-VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXX 239
            S GV+LLELLT K   VS   +  P  V  V ++     + D  +  D            
Sbjct: 776  SLGVILLELLTRKSPGVSMNGLDLPQWVASVVKEEWTNEVFDADLMRDASTVGDELLNTL 835

Query: 238  XXGYNCISPVPQKRPTMKEVVQALDNI 158
                +C+ P P  RP + +V+Q L+ I
Sbjct: 836  KLALHCVDPSPSARPEVHQVLQQLEEI 862



>gb:AF506516_1806898 Glycine max receptor-like kinase RHG1 gene,
            complete cds.>gb:AF506517_1806899 Glycine max
            receptor-like kinase RHG1 mRNA, complete cds.
          Length = 855

 Score =  159 bits (402), Expect = 1e-37
 Identities = 108/327 (33%), Positives = 165/327 (50%), Gaps = 4/327 (1%)
 Frame = -2

Query: 1126 GELVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREF 947
            G LV  DG           A+A I+G S +  +YK +L+DG+ +AV+R+ E      REF
Sbjct: 551  GNLVHFDGPMAFTADDLLCATAEIMGKSTNGTVYKAILEDGSQVAVKRLREKIAKGHREF 610

Query: 946  ENQIRVISKLVHPNLVRIRGFYWG-ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEV 770
            E+++ V+ K+ HPN++ +R +Y G   EKL+++D++  GSLA+  H  GG +   + W  
Sbjct: 611  ESEVSVLGKIRHPNVLALRAYYLGPKGEKLLVFDYMSKGSLASFLH--GGGTETFIDWPT 668

Query: 769  RLKIARGVARGLSYIHEKKH-VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKV 593
            R+KIA+ +ARGL  +H +++ +HGNL  SN+LLD +   K+ DFGL RL+          
Sbjct: 669  RMKIAQDLARGLFCLHSQENIIHGNLTSSNVLLDENTNAKIADFGLSRLM---------- 718

Query: 592  YGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVF 413
                       ST +  +   +A            ALG   Y APE  +  K N K D++
Sbjct: 719  -----------STTANSNVIATA-----------GALG---YRAPELSKLKKANTKTDIY 753

Query: 412  SFGVVLLELLTGKII-VSDEMVPGPP-VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXX 239
            S GV+LLELLT K   VS   +  P  V  V ++     + D  +  D            
Sbjct: 754  SLGVILLELLTRKSPGVSMNGLDLPQWVASVVKEEWTNEVFDADLMRDASTVGDELLNTL 813

Query: 238  XXGYNCISPVPQKRPTMKEVVQALDNI 158
                +C+ P P  RP + +V+Q L+ I
Sbjct: 814  KLALHCVDPSPSARPEVHQVLQQLEEI 840



>gb:AP005245_1849450 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC clone:OSJNBa0025J22.
          Length = 657

 Score =  155 bits (391), Expect = 2e-36
 Identities = 119/358 (33%), Positives = 166/358 (46%), Gaps = 38/358 (10%)
 Frame = -2

Query: 1117 VTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGE---------SGL 965
            V VD           +ASA+++G S   I+Y+ V   G A+AVRR+ E         SG 
Sbjct: 339  VAVDDGFGMELEELLRASAFVVGKSRGGIVYRVVPGHGPAVAVRRLSEPDDGDGGSDSGW 398

Query: 964  DRFREFENQIRVISKLVHPNLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRH 785
             R R FE +   I +  HPN+ R+R +Y+  DEKL+IYD++ NGSL +A H    +S   
Sbjct: 399  RRRRAFETEAAAIGRARHPNVARLRAYYYAPDEKLLIYDYLSNGSLHSALHGGPTASPTP 458

Query: 784  LPWEVRLKIARGVARGLSYIHE---KKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAG 614
            LPW +RL I +G ARGL+Y+HE   +++VHG +K S ILLD ++   V  FGL RLV  G
Sbjct: 459  LPWSMRLSIVQGAARGLAYLHECSPRRYVHGCIKSSKILLDDELRAHVSGFGLARLVAGG 518

Query: 613  GESSRKVYGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLR---- 446
              + +     S+  G              A+ GG          G   Y+APE LR    
Sbjct: 519  --AHKAAAAQSKKLGGAA----------CALRGGG---------GALAYVAPE-LRTPGG 556

Query: 445  -SLKPNPKWDVFSFGVVLLELLTGKIIVSDE--------------------MVPGPPVMG 329
             +     K DVF+ GVVLLE +TG+     E                     V  P ++G
Sbjct: 557  AAAAATQKGDVFALGVVLLEAVTGREPTEGEGGLELEAWVRRAFKEERPLSEVVDPTLLG 616

Query: 328  -VEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVVQALDNI 158
             V  K +VL +  VA+                    C  P  + RP M+ V ++LD I
Sbjct: 617  EVHAKKQVLAVFHVAL-------------------GCTEPDAELRPRMRAVAESLDRI 655



>pir|B84664|B84664 probable receptor-like protein kinase [imported] -
            Arabidopsis thaliana>gb:AC003105_1531090 Arabidopsis
            thaliana chromosome 2 clone F18A8 map B68, complete
            sequence.
          Length = 658

 Score =  155 bits (391), Expect = 2e-36
 Identities = 102/310 (32%), Positives = 158/310 (50%), Gaps = 6/310 (1%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            ASA +LG       YK VL++GT + V+R+ +    + +EFE Q+ V+ K+ HPN++ +R
Sbjct: 352  ASAEVLGKGSVGTSYKAVLEEGTTVVVKRLKDVMASK-KEFETQMEVVGKIKHPNVIPLR 410

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIH-EKK 713
             +Y+  DEKL+++DF+P GSL+   H   GS    L W+ R++IA   ARGL+++H   K
Sbjct: 411  AYYYSKDEKLLVFDFMPTGSLSALLHGSRGSGRTPLDWDNRMRIAITAARGLAHLHVSAK 470

Query: 712  HVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFP 533
             VHGN+K SNILL  + +  V D+GL +L                           +S P
Sbjct: 471  LVHGNIKASNILLHPNQDTCVSDYGLNQLF-------------------------SNSSP 505

Query: 532  DSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK----IIV 365
             + ++G H               APE L + K   K DV+SFGV+LLELLTGK      +
Sbjct: 506  PNRLAGYH---------------APEVLETRKVTFKSDVYSFGVLLLELLTGKSPNQASL 550

Query: 364  SDEMVPGPP-VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTM 188
             +E +  P  V+ V  +     + DV +                    C+S VP +RP M
Sbjct: 551  GEEGIDLPRWVLSVVREEWTAEVFDVELMR-YHNIEEEMVQLLQIAMACVSTVPDQRPVM 609

Query: 187  KEVVQALDNI 158
            +EV++ ++++
Sbjct: 610  QEVLRMIEDV 619



>gb:AY050870_1562365 Arabidopsis thaliana putative receptor protein
            kinase (At2g26730) mRNA, complete cds.
          Length = 658

 Score =  152 bits (383), Expect = 2e-35
 Identities = 101/310 (32%), Positives = 157/310 (50%), Gaps = 6/310 (1%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            ASA +LG       YK VL++GT + V+R+ +    + +EFE Q+ V+ K+  PN++ +R
Sbjct: 352  ASAEVLGKGSVGTSYKAVLEEGTTVVVKRLKDVMASK-KEFETQMEVVGKIKRPNVIPLR 410

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIH-EKK 713
             +Y+  DEKL+++DF+P GSL+   H   GS    L W+ R++IA   ARGL+++H   K
Sbjct: 411  AYYYSKDEKLLVFDFMPTGSLSALLHGSRGSGRTPLDWDNRMRIAITAARGLAHLHVSAK 470

Query: 712  HVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFP 533
             VHGN+K SNILL  + +  V D+GL +L                           +S P
Sbjct: 471  LVHGNIKASNILLHPNQDTCVSDYGLNQLF-------------------------SNSSP 505

Query: 532  DSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK----IIV 365
             + ++G H               APE L + K   K DV+SFGV+LLELLTGK      +
Sbjct: 506  PNRLAGYH---------------APEVLETRKVTFKSDVYSFGVLLLELLTGKSPNQASL 550

Query: 364  SDEMVPGPP-VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTM 188
             +E +  P  V+ V  +     + DV +                    C+S VP +RP M
Sbjct: 551  GEEGIDLPRWVLSVVREEWTAEVFDVELMR-YHNIEEEMVQLLQIAMACVSTVPDQRPVM 609

Query: 187  KEVVQALDNI 158
            +EV++ ++++
Sbjct: 610  QEVLRMIEDV 619



>pir|T46070|T46070 hypothetical protein T18N14.120 - Arabidopsis
            thaliana>gb:ATT18N14_1554791 Arabidopsis thaliana DNA
            chromosome 3, BAC clone T18N14.>gb:AY054515_1563169
            Arabidopsis thaliana putative protein (At3g51740;
            T18N14.120) mRNA, complete cds.>gb:BT006350_1639237
            Arabidopsis thaliana At3g51740/T18N14_120 gene, complete
            cds.>gb:AF372978_1792690 Arabidopsis thaliana
            AT3g51740/T18N14_120 mRNA, complete cds.
          Length = 836

 Score =  149 bits (377), Expect = 8e-35
 Identities = 98/334 (29%), Positives = 156/334 (46%), Gaps = 11/334 (3%)
 Frame = -2

Query: 1126 GELVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREF 947
            G+LV  DG           A+A I+G S     YK  L+DG  +AV+R+ E      +EF
Sbjct: 519  GKLVHFDGPFVFTADDLLCATAEIMGKSTYGTAYKATLEDGNEVAVKRLREKTTKGVKEF 578

Query: 946  ENQIRVISKLVHPNLVRIRGFYWG-ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEV 770
            E ++  + K+ H NL+ +R +Y G   EKL+++D++  GSL+   H +G  +   +PWE 
Sbjct: 579  EGEVTALGKIRHQNLLALRAYYLGPKGEKLLVFDYMSKGSLSAFLHARGPET--LIPWET 636

Query: 769  RLKIARGVARGLSYIHEKKH-VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKV 593
            R+KIA+G++RGL+++H  ++ +H NL  SNILLD      + D+GL RL+ A   ++  V
Sbjct: 637  RMKIAKGISRGLAHLHSNENMIHENLTASNILLDEQTNAHIADYGLSRLMTAA--AATNV 694

Query: 592  YGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVF 413
              ++   G                                 Y APE  +    + K DV+
Sbjct: 695  IATAGTLG---------------------------------YRAPEFSKIKNASAKTDVY 721

Query: 412  SFGVVLLELLTGKIIVSDEMVPGPPVMGVEEKSKVLRMA---------DVAIRADMXXXX 260
            S G+++LELLTGK        PG P  G++    V  +          D+ +  +     
Sbjct: 722  SLGIIILELLTGK-------SPGEPTNGMDLPQWVASIVKEEWTNEVFDLELMRETQSVG 774

Query: 259  XXXXXXXXXGYNCISPVPQKRPTMKEVVQALDNI 158
                       +C+ P P  RP   +VV+ L+ I
Sbjct: 775  DELLNTLKLALHCVDPSPAARPEANQVVEQLEEI 808



>gb:AP003255_1826441 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC
            clone:P0454H12.>gb:AP003446_1829525 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 1, BAC
            clone:OJ1529_G03.
          Length = 637

 Score =  147 bits (372), Expect = 3e-34
 Identities = 100/314 (31%), Positives = 158/314 (50%), Gaps = 10/314 (3%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKL-VHPNLVRI 893
            ASA +LG       YK VL+DGT + V+R+ E  + + ++FE Q+ ++ ++  H N+V +
Sbjct: 344  ASAEVLGKGSYGTTYKAVLEDGTTVVVKRLKEVVVGK-KDFEQQMEIVGRVGQHQNVVPL 402

Query: 892  RGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK- 716
            R +Y+  DEKL++YD++P+GSLA   H    +    L WE R+KI+ GVARG++++H + 
Sbjct: 403  RAYYYSKDEKLLVYDYIPSGSLAVVLHGNKATGKAPLDWETRVKISLGVARGIAHLHAEG 462

Query: 715  --KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRD 542
              K +HGNLK SNILL  +++  V +FGL +L+                           
Sbjct: 463  GGKFIHGNLKSSNILLSQNLDGCVSEFGLAQLM--------------------------- 495

Query: 541  SFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIV- 365
                       T  P+P+ L    Y APE L + KP  K DV+SFGV++LE+LTGK  + 
Sbjct: 496  -----------TIPPAPARL--VGYRAPEVLETKKPTQKSDVYSFGVLVLEMLTGKAPLR 542

Query: 364  ---SDEMVPGPP--VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQK 200
                ++ +   P  V  V  +     + DV +                    C++  P +
Sbjct: 543  SPGREDSIEHLPRWVQSVVREEWTAEVFDVDLLRH-PNIEDEMVQMLQVAMACVAAPPDQ 601

Query: 199  RPTMKEVVQALDNI 158
            RP M EV++ +  I
Sbjct: 602  RPKMDEVIRRIVEI 615



>gb:AF084034_1767051 Arabidopsis thaliana receptor-like protein kinase
            (RKL1) gene, complete cds.
          Length = 645

 Score =  146 bits (369), Expect = 7e-34
 Identities = 103/311 (33%), Positives = 150/311 (48%), Gaps = 7/311 (2%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            ASA +LG       YK VLD  T +AV+R+ +  +   +EF+ +I ++  + H NLV +R
Sbjct: 362  ASAEVLGKGTFGTAYKAVLDAVTVVAVKRLKDVMMAD-KEFKEKIELVGAMDHENLVPLR 420

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK-- 716
             +Y+  DEKL++YDF+P GSL+   H   G+    L W+VR +IA G ARGL+Y+H +  
Sbjct: 421  AYYFSRDEKLLVYDFMPMGSLSALLHGNRGAGRSPLNWDVRSRIAIGAARGLNYLHSQGT 480

Query: 715  KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSF 536
               HGN+K SNILL    + KV DFGL +LV +   +  +  G                 
Sbjct: 481  STSHGNIKSSNILLTKSHDAKVSDFGLAQLVGSSATNPNRATG----------------- 523

Query: 535  PDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKI----I 368
                                  Y APE     + + K DV+SFGVVLLEL+TGK     +
Sbjct: 524  ----------------------YRAPEVTDPKRVSQKGDVYSFGVVLLELITGKAPSNSV 561

Query: 367  VSDEMVPGPP-VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
            +++E V  P  V  V        + D  + +               G  C S  P +RP 
Sbjct: 562  MNEEGVDLPRWVKSVARDEWRREVFDSELLSLATDEEEMMAEMVQLGLECTSQHPDQRPE 621

Query: 190  MKEVVQALDNI 158
            M EVV+ ++N+
Sbjct: 622  MSEVVRKMENL 632



>pir|G96524|G96524 protein T1N15.9 [imported] - Arabidopsis
            thaliana>gb:AE005173_892808 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:AC020889_1538634 Genomic sequence for
            Arabidopsis thaliana BAC T1N15 from chromosome I,
            complete sequence.
          Length = 655

 Score =  146 bits (368), Expect = 9e-34
 Identities = 103/311 (33%), Positives = 149/311 (47%), Gaps = 7/311 (2%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            ASA +LG       YK VLD  T +AV+R+ +  +   +EF+ +I ++  + H NLV +R
Sbjct: 372  ASAEVLGKGTFGTAYKAVLDAVTVVAVKRLKDVMMAD-KEFKEKIELVGAMDHENLVPLR 430

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK-- 716
             +Y+  DEKL++YDF+P GSL+   H   G+    L W+VR +IA G ARGL Y+H +  
Sbjct: 431  AYYFSRDEKLLVYDFMPMGSLSALLHGNRGAGRSPLNWDVRSRIAIGAARGLDYLHSQGT 490

Query: 715  KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSF 536
               HGN+K SNILL    + KV DFGL +LV +   +  +  G                 
Sbjct: 491  STSHGNIKSSNILLTKSHDAKVSDFGLAQLVGSSATNPNRATG----------------- 533

Query: 535  PDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKI----I 368
                                  Y APE     + + K DV+SFGVVLLEL+TGK     +
Sbjct: 534  ----------------------YRAPEVTDPKRVSQKGDVYSFGVVLLELITGKAPSNSV 571

Query: 367  VSDEMVPGPP-VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
            +++E V  P  V  V        + D  + +               G  C S  P +RP 
Sbjct: 572  MNEEGVDLPRWVKSVARDEWRREVFDSELLSLATDEEEMMAEMVQLGLECTSQHPDQRPE 631

Query: 190  MKEVVQALDNI 158
            M EVV+ ++N+
Sbjct: 632  MSEVVRKMENL 642



>gb:AP003302_1827702 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC
            clone:P0703B11.>gb:AP003348_1828476 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 1, PAC
            clone:P0485B12.
          Length = 947

 Score =  143 bits (361), Expect = 6e-33
 Identities = 101/303 (33%), Positives = 156/303 (51%), Gaps = 6/303 (1%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFRE-FENQIRVISKLVHPNLVRIRGFYW 878
            LG  G   +YKTVL DG  +A++++  S L + ++ FE Q++++SK+ H N+V +RGFYW
Sbjct: 669  LGRGGFGAVYKTVLRDGQPVAIKKLTVSSLVKSKDDFERQVKLLSKVRHHNVVALRGFYW 728

Query: 877  GADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKHVHGN 698
             +  +L+IYD++P G+L    H    +    L W  R  I  GVARGL+++H++  +H N
Sbjct: 729  TSSLQLLIYDYLPGGNLHKHLHEC--TEDNSLSWMERFDIILGVARGLTHLHQRGIIHYN 786

Query: 697  LKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSAVS 518
            LK SN+LLD++ EP+VGD+GL +L+                          D +  S   
Sbjct: 787  LKSSNVLLDSNGEPRVGDYGLAKLL-----------------------PMLDRYVLS--- 820

Query: 517  GGHTPSPSPSALGISPYIAPE-SLRSLKPNPKWDVFSFGVVLLELLTGK----IIVSDEM 353
                 S   SALG   Y+APE + +++K   K DV+ FGV++LE+LTG+     +  D +
Sbjct: 821  -----SKIQSALG---YMAPEFACKTVKITEKCDVYGFGVLVLEVLTGRRPVEYLEDDVV 872

Query: 352  VPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVVQ 173
            V    V    E+ ++    D  +  +                 C S VP  RP M EVV 
Sbjct: 873  VLCDLVRSALEEGRLEDCMDPRLCGEFPMEEALPIIKLGLV--CTSRVPSNRPDMGEVVN 930

Query: 172  ALD 164
             L+
Sbjct: 931  ILE 933



>gb:AC144737_1744140 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OSJNBa0018K15, complete sequence.
          Length = 917

 Score =  142 bits (359), Expect = 1e-32
 Identities = 101/305 (33%), Positives = 151/305 (49%), Gaps = 6/305 (1%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIRGFYW 878
            LG  G   +YK VL DG  +A++++  S L +   EF+ Q++++ K+ H N+V +RGFYW
Sbjct: 639  LGRGGFGTVYKAVLRDGQPVAIKKLTVSSLVKSEDEFKRQVKLLGKVRHHNVVTLRGFYW 698

Query: 877  GADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKHVHGN 698
             +  +L+IYDFVP G+L    H    S+ R + W  R  I  GVAR L+++H    +H N
Sbjct: 699  TSSLQLLIYDFVPGGNLYQHLHES--SAERSVSWMERFDIIIGVARALAHLHRHGIIHYN 756

Query: 697  LKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSAVS 518
            LK SN+LLD++ EP+VGD+GL +L+                          D +  S   
Sbjct: 757  LKSSNVLLDSNGEPRVGDYGLVKLL-----------------------PMLDRYVLS--- 790

Query: 517  GGHTPSPSPSALGISPYIAPE-SLRSLKPNPKWDVFSFGVVLLELLTGK----IIVSDEM 353
                 S   SALG   Y+APE + R++    K DV+ FGV++LE+LTG+     +  D +
Sbjct: 791  -----SKIQSALG---YMAPEFTCRTVNVTEKCDVYGFGVIVLEILTGRRPVEYLEDDVV 842

Query: 352  VPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVVQ 173
            V    V    +  +V    D  +  +                 C S VP  RP M EVV 
Sbjct: 843  VLCDVVRAALDDGRVEDCMDPRLSGEFSMEEAMLIIKLGLV--CTSQVPSHRPDMGEVVS 900

Query: 172  ALDNI 158
             L+ +
Sbjct: 901  MLEMV 905



>gb:AY102147_1577752 Arabidopsis thaliana At1g68400/T2E12_5 mRNA,
            complete cds.>gb:AF378890_1793475 Arabidopsis thaliana
            At1g68400/T2E12_5 mRNA, complete cds.
          Length = 671

 Score =  142 bits (359), Expect = 1e-32
 Identities = 89/257 (34%), Positives = 128/257 (49%), Gaps = 6/257 (2%)
 Frame = -2

Query: 1126 GELVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGESGL--DRFR 953
            G++V  +G          +ASA +LG  G    YK VL+DG  +AV+R+ ++     + +
Sbjct: 344  GKMVFFEGTRRFELEDLLRASAEMLGKGGFGTAYKAVLEDGNEVAVKRLKDAVTVAGKKK 403

Query: 952  EFENQIRVISKLVHPNLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWE 773
            EFE Q+ V+ +L H NLV ++ +Y+  +EKL++YD++PNGSL    H   G     L W 
Sbjct: 404  EFEQQMEVLGRLRHTNLVSLKAYYFAREEKLLVYDYMPNGSLFWLLHGNRGPGRTPLDWT 463

Query: 772  VRLKIARGVARGLSYIHEK----KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGES 605
             RLKIA G ARGL++IH      K  HG++K +N+LLD     +V DFGL          
Sbjct: 464  TRLKIAAGAARGLAFIHGSCKTLKLTHGDIKSTNVLLDRSGNARVSDFGLSIF------- 516

Query: 604  SRKVYGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPK 425
                                              +PS +    + Y APE +   K   K
Sbjct: 517  ----------------------------------APSQTVAKSNGYRAPELIDGRKHTQK 542

Query: 424  WDVFSFGVVLLELLTGK 374
             DV+SFGV+LLE+LTGK
Sbjct: 543  SDVYSFGVLLLEILTGK 559



>gb:AY086189_1571244 Arabidopsis thaliana clone 22221 mRNA, complete
            sequence.
          Length = 639

 Score =  142 bits (359), Expect = 1e-32
 Identities = 107/321 (33%), Positives = 144/321 (44%), Gaps = 17/321 (5%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            ASA +LG       YK VLD  T +AV+R+ +  +   REF+ +I V+  + H NLV +R
Sbjct: 358  ASAEVLGKGTFGTAYKAVLDAVTLVAVKRLKDVTMAD-REFKEKIEVVGAMDHENLVPLR 416

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH 710
             +Y+  DEKL++YDF+P GSL+   H   G+    L WEVR  IA G ARGL Y+H +  
Sbjct: 417  AYYYSGDEKLLVYDFMPMGSLSALLHGNKGAGRPPLNWEVRSGIALGAARGLDYLHSQDP 476

Query: 709  V--HGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSF 536
            +  HGN+K SNILL    + +V DFGL +LV A   +  +  G                 
Sbjct: 477  LSSHGNVKSSNILLTNSHDARVSDFGLAQLVSASSTTPNRATG----------------- 519

Query: 535  PDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDE 356
                                  Y APE     + + K DV+SFGVVLLELLTGK      
Sbjct: 520  ----------------------YRAPEVTDPRRVSQKADVYSFGVVLLELLTGK------ 551

Query: 355  MVPGPPVMGVEEKSKVLRMADVAIRAD---------------MXXXXXXXXXXXXXGYNC 221
              P   VM  EE   + R      R +               +             G +C
Sbjct: 552  -APSNSVMN-EEGMDLARWVHSVAREEWRNEVFDSELMSIETVVSVEEEMAEMLQLGIDC 609

Query: 220  ISPVPQKRPTMKEVVQALDNI 158
                P KRP M EVV+ +  +
Sbjct: 610  TEQHPDKRPVMVEVVRRIQEL 630



>gb:AB019230_1514140 Arabidopsis thaliana genomic DNA, chromosome 3,
            P1 clone: MEB5.>gb:AY095994_1575868 Arabidopsis thaliana
            AT3g17840/MEB5_6 mRNA, complete cds.>gb:BT002283_1635886
            Arabidopsis thaliana At3g17840/MEB5_6 mRNA, complete cds.
          Length = 647

 Score =  142 bits (359), Expect = 1e-32
 Identities = 107/321 (33%), Positives = 144/321 (44%), Gaps = 17/321 (5%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            ASA +LG       YK VLD  T +AV+R+ +  +   REF+ +I V+  + H NLV +R
Sbjct: 366  ASAEVLGKGTFGTAYKAVLDAVTLVAVKRLKDVTMAD-REFKEKIEVVGAMDHENLVPLR 424

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH 710
             +Y+  DEKL++YDF+P GSL+   H   G+    L WEVR  IA G ARGL Y+H +  
Sbjct: 425  AYYYSGDEKLLVYDFMPMGSLSALLHGNKGAGRPPLNWEVRSGIALGAARGLDYLHSQDP 484

Query: 709  V--HGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSF 536
            +  HGN+K SNILL    + +V DFGL +LV A   +  +  G                 
Sbjct: 485  LSSHGNVKSSNILLTNSHDARVSDFGLAQLVSASSTTPNRATG----------------- 527

Query: 535  PDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDE 356
                                  Y APE     + + K DV+SFGVVLLELLTGK      
Sbjct: 528  ----------------------YRAPEVTDPRRVSQKADVYSFGVVLLELLTGK------ 559

Query: 355  MVPGPPVMGVEEKSKVLRMADVAIRAD---------------MXXXXXXXXXXXXXGYNC 221
              P   VM  EE   + R      R +               +             G +C
Sbjct: 560  -APSNSVMN-EEGMDLARWVHSVAREEWRNEVFDSELMSIETVVSVEEEMAEMLQLGIDC 617

Query: 220  ISPVPQKRPTMKEVVQALDNI 158
                P KRP M EVV+ +  +
Sbjct: 618  TEQHPDKRPVMVEVVRRIQEL 638



>pir|T48210|T48210 hypothetical protein T20L15.160 - Arabidopsis
            thaliana>gb:ATT20L15_1555042 Arabidopsis thaliana DNA
            chromosome 5, BAC clone T20L15 (ESSA
            project).>gb:BT004520_1637554 Arabidopsis thaliana
            At5g01890/T20L15_160 gene, complete
            cds.>gb:AF424563_1798902 Arabidopsis thaliana
            AT5g01890/T20L15_160 mRNA, complete cds.
          Length = 967

 Score =  142 bits (359), Expect = 1e-32
 Identities = 105/305 (34%), Positives = 150/305 (49%), Gaps = 6/305 (1%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFRE-FENQIRVISKLVHPNLVRIRGFYW 878
            LG  G  ++YKT L DG  +AV+++  SGL + +E FE ++R + KL H N+V I+G+YW
Sbjct: 693  LGRGGFGVVYKTSLQDGRPVAVKKLTVSGLIKSQEEFEREMRKLGKLRHKNVVEIKGYYW 752

Query: 877  GADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKHVHGN 698
                +L+I++FV  GSL    H   G     L W  R  I  G+ARGL+++H     H N
Sbjct: 753  TQSLQLLIHEFVSGGSLYRHLH---GDESVCLTWRQRFSIILGIARGLAFLHSSNITHYN 809

Query: 697  LKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSAVS 518
            +K +N+L+DA  E KV DFGL RL+                           S  D  V 
Sbjct: 810  MKATNVLIDAAGEAKVSDFGLARLLA--------------------------SALDRCVL 843

Query: 517  GGHTPSPSPSALGISPYIAPE-SLRSLKPNPKWDVFSFGVVLLELLTGKIIV----SDEM 353
             G   S    ALG   Y APE + R++K   + DV+ FG+++LE++TGK  V     D +
Sbjct: 844  SGKVQS----ALG---YTAPEFACRTVKITDRCDVYGFGILVLEVVTGKRPVEYAEDDVV 896

Query: 352  VPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVVQ 173
            V    V    E+ +V    D  +R +                 C S VP  RP M+EVV+
Sbjct: 897  VLCETVREGLEEGRVEECVDPRLRGNFPAEEAIPVIKLGLV--CGSQVPSNRPEMEEVVK 954

Query: 172  ALDNI 158
             L+ I
Sbjct: 955  ILELI 959



>gb:AP001800_1821417 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC
            clone:P0443E05.>gb:AP002835_1822945 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 1, PAC
            clone:P0417G05.
          Length = 641

 Score =  142 bits (358), Expect = 1e-32
 Identities = 97/319 (30%), Positives = 146/319 (45%), Gaps = 15/319 (4%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            ASA +LG       Y+ VL+D T + V+R+ E    R R+FE Q+ ++ ++ H N+  +R
Sbjct: 340  ASAEVLGKGAFGTAYRAVLEDATTVVVKRLKEVSAGR-RDFEQQMELVGRIRHANVAELR 398

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK-- 716
             +Y+  DEKL++YDF   GS++N  H K G     L WE R++IA G ARG+++IH +  
Sbjct: 399  AYYYSKDEKLLVYDFYSRGSVSNMLHGKRGEDRTPLNWETRVRIALGAARGIAHIHTENN 458

Query: 715  -KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDS 539
             K VHGN+K SN+ L+      V D GL  L+         +   SR+ G          
Sbjct: 459  GKFVHGNIKASNVFLNNQQYGCVSDLGLASLM-------NPITARSRSLG---------- 501

Query: 538  FPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSD 359
                                   Y APE   S K +   DV+SFGV +LELLTG+   S 
Sbjct: 502  -----------------------YCAPEVTDSRKASQCSDVYSFGVFILELLTGR---SP 535

Query: 358  EMVPGPPVMGVEEKSKVLRMADVAIRADMXX------------XXXXXXXXXXXGYNCIS 215
              + G    G  E   ++R     +R +                             C+S
Sbjct: 536  VQITG----GGNEVVHLVRWVQSVVREEWTAEVFDVELMRYPNIEEEMVEMLQIAMACVS 591

Query: 214  PVPQKRPTMKEVVQALDNI 158
              P++RP M +VV+ L+++
Sbjct: 592  RTPERRPKMSDVVRMLEDV 610



>pir|H96707|H96707 probable receptor kinase T2E12.5 [imported] -
            Arabidopsis thaliana>gb:AE005173_894461 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC015986_1538060 Arabidopsis thaliana
            chromosome 1 BAC T2E12 genomic sequence, complete
            sequence.
          Length = 670

 Score =  142 bits (358), Expect = 1e-32
 Identities = 89/256 (34%), Positives = 128/256 (50%), Gaps = 5/256 (1%)
 Frame = -2

Query: 1126 GELVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGES-GLDRFRE 950
            G++V  +G          +ASA +LG  G    YK VL+DG  +AV+R+ ++  +   +E
Sbjct: 344  GKMVFFEGTRRFELEDLLRASAEMLGKGGFGTAYKAVLEDGNEVAVKRLKDAVTVAGKKE 403

Query: 949  FENQIRVISKLVHPNLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEV 770
            FE Q+ V+ +L H NLV ++ +Y+  +EKL++YD++PNGSL    H   G     L W  
Sbjct: 404  FEQQMEVLGRLRHTNLVSLKAYYFAREEKLLVYDYMPNGSLFWLLHGNRGPGRTPLDWTT 463

Query: 769  RLKIARGVARGLSYIHEK----KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESS 602
            RLKIA G ARGL++IH      K  HG++K +N+LLD     +V DFGL           
Sbjct: 464  RLKIAAGAARGLAFIHGSCKTLKLTHGDIKSTNVLLDRSGNARVSDFGLSIF-------- 515

Query: 601  RKVYGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKW 422
                                             +PS +    + Y APE +   K   K 
Sbjct: 516  ---------------------------------APSQTVAKSNGYRAPELIDGRKHTQKS 542

Query: 421  DVFSFGVVLLELLTGK 374
            DV+SFGV+LLE+LTGK
Sbjct: 543  DVYSFGVLLLEILTGK 558



>gb:AP005099_1847794 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OSJNBa0008J01.
          Length = 640

 Score =  141 bits (356), Expect = 2e-32
 Identities = 97/314 (30%), Positives = 153/314 (48%), Gaps = 10/314 (3%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKL-VHPNLVRI 893
            ASA +LG       YK +L+DGT + V+R+ +    + +EFE Q+ +I +L  H NLV +
Sbjct: 345  ASAEVLGKGSYGTAYKAILEDGTVVVVKRLKDVVAGK-KEFEQQMELIGRLGKHANLVPL 403

Query: 892  RGFYWGADEKLVIYDFVPNGSLANACHR-KGGSSHRHLPWEVRLKIARGVARGLSYIHEK 716
            R +Y+  DEKL++YD++ NGS +   H  +G +    L W  R+KI  G A G++++H +
Sbjct: 404  RAYYYSKDEKLIVYDYLTNGSFSTKLHGIRGVTEKTPLDWSTRVKIILGTAYGIAHVHAE 463

Query: 715  ---KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASR 545
               K  HGN+K +NILLD D    V D+GL  L+     +SR V G              
Sbjct: 464  GGAKLTHGNIKSTNILLDQDYSSYVSDYGLTALMSVPANASRVVVG-------------- 509

Query: 544  DSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIV 365
                                     Y APE++ + K   K DV+SFGV+L+E+LTGK  +
Sbjct: 510  -------------------------YRAPETIENRKITQKSDVYSFGVLLMEMLTGKAPL 544

Query: 364  ----SDEMVPGPP-VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQK 200
                +D++V  P  V  V  +     + DV +                    C S  P +
Sbjct: 545  QSQGNDDVVDLPRWVHSVVREEWTAEVFDVEL-IKQQNIEEELVQMLQIAMACTSRSPDR 603

Query: 199  RPTMKEVVQALDNI 158
            RP+M++V++ ++ +
Sbjct: 604  RPSMEDVIRMIEGL 617



>gb:AP006168_1861232 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:B1469H02.
          Length = 1047

 Score =  141 bits (355), Expect = 3e-32
 Identities = 103/312 (33%), Positives = 146/312 (46%), Gaps = 10/312 (3%)
 Frame = -2

Query: 1063 AYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGF 884
            A I+G  G  ++YK  L DG  +A++R+        REF+ ++  +SK  HPNLV ++G+
Sbjct: 768  ANIIGCGGFGLVYKATLPDGATIAIKRLSGDFGQMEREFKAEVETLSKAQHPNLVLLQGY 827

Query: 883  YWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIH---EKK 713
                +++L+IY ++ NGSL +  H K     R L W+ RL+IA+G ARGL+Y+H   +  
Sbjct: 828  CRIGNDRLLIYSYMENGSLDHWLHEKPDGPSR-LSWQTRLQIAKGAARGLAYLHLSCQPH 886

Query: 712  HVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFP 533
             +H ++K SNILLD D E  + DFGL RL+                              
Sbjct: 887  ILHRDIKSSNILLDEDFEAHLADFGLARLICP---------------------------- 918

Query: 532  DSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEM 353
                   +    +   +G   YI PE  +S   N K DV+SFG+VLLELLTGK  V    
Sbjct: 919  -------YDTHVTTDLVGTLGYIPPEYGQSSVANFKGDVYSFGIVLLELLTGKRPVD--- 968

Query: 352  VPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYN-------CISPVPQKRP 194
                P    E  S VL M +    A++                       CIS  P+ RP
Sbjct: 969  -MCKPKGARELVSWVLHMKEKNCEAEVLDRAMYDKKFEMQMVQMIDIACLCISESPKLRP 1027

Query: 193  TMKEVVQALDNI 158
               E+V  LDNI
Sbjct: 1028 LTHELVLWLDNI 1039



>pir|B84782|B84782 probable receptor-like protein kinase [imported] -
            Arabidopsis thaliana>gb:AC006919_1534725 Arabidopsis
            thaliana chromosome 2 clone F1O11 map g6825, complete
            sequence.
          Length = 672

 Score =  141 bits (355), Expect = 3e-32
 Identities = 100/328 (30%), Positives = 153/328 (46%), Gaps = 24/328 (7%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDG-TALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRI 893
            ASA +LG      +YK VLDDG T +AV+R+ ++     +EFE  + +I +L H N+V++
Sbjct: 358  ASAEMLGKGSLGTVYKAVLDDGSTTVAVKRLKDANPCPRKEFEQYMEIIGRLKHQNVVKL 417

Query: 892  RGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK- 716
            R +Y+  +EKL++Y+++PNGSL +  H   G     L W  R+ +  G ARGL+ IH++ 
Sbjct: 418  RAYYYAKEEKLLVYEYLPNGSLHSLLHGNRGPGRIPLDWTTRISLMLGAARGLAKIHDEY 477

Query: 715  ---KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASR 545
               K  HGN+K SN+LLD +    + DFGL  L+                          
Sbjct: 478  SISKIPHGNIKSSNVLLDRNGVALIADFGLSLLL-------------------------- 511

Query: 544  DSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK--- 374
                          +P  +   +  Y APE     + + K DV+SFGV+LLE+LTGK   
Sbjct: 512  --------------NPVHAIARLGGYRAPEQSEIKRLSQKADVYSFGVLLLEVLTGKAPS 557

Query: 373  IIVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXX----------------XXXX 242
            I  S         + VEE+ + +      +R+ +                          
Sbjct: 558  IFPSPSRPRSAASVAVEEEEEAVVDLPKWVRSVVKEEWTAEVFDPELLRYKNIEEEMVAM 617

Query: 241  XXXGYNCISPVPQKRPTMKEVVQALDNI 158
               G  C+ P P+KRPTM EVV+ ++ I
Sbjct: 618  LHIGLACVVPQPEKRPTMAEVVKMVEEI 645



>gb:AB028616_1518004 Arabidopsis thaliana genomic DNA, chromosome 3,
            P1 clone:MMG15.
          Length = 1016

 Score =  140 bits (354), Expect = 4e-32
 Identities = 101/315 (32%), Positives = 154/315 (48%), Gaps = 16/315 (5%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVL-DDGTALAVRRVGESG-LDRFREFENQIRVISKLVHPNLVRIRGFY 881
            +G      +YK  L + G  LAV+++  S  L    +F+ ++R+++K  HPNLV I+G++
Sbjct: 732  IGEGVFGTVYKAPLGEQGRNLAVKKLVPSPILQNLEDFDREVRILAKAKHPNLVSIKGYF 791

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH--- 710
            W  D  L++ +++PNG+L +  H +  S+   L W+VR KI  G A+GL+Y+H       
Sbjct: 792  WTPDLHLLVSEYIPNGNLQSKLHEREPSTPP-LSWDVRYKIILGTAKGLAYLHHTFRPTT 850

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H NLKP+NILLD    PK+ DFGL RL+                     +T + + F +
Sbjct: 851  IHFNLKPTNILLDEKNNPKISDFGLSRLLTT----------------QDGNTMNNNRFQN 894

Query: 529  SAVSGGHTPSPSPSALGISPYIAPE-SLRSLKPNPKWDVFSFGVVLLELLTGK------- 374
                          ALG   Y+APE   ++L+ N K DV+ FGV++LEL+TG+       
Sbjct: 895  --------------ALG---YVAPELECQNLRVNEKCDVYGFGVLILELVTGRRPVEYGE 937

Query: 373  ---IIVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQ 203
               +I+SD       V  + E+  VL   D  +                    C S +P 
Sbjct: 938  DSFVILSDH------VRVMLEQGNVLECIDPVMEEQYSEDEVLPVLKLALV--CTSQIPS 989

Query: 202  KRPTMKEVVQALDNI 158
             RPTM E+VQ L  I
Sbjct: 990  NRPTMAEIVQILQVI 1004



>pir|B86440|B86440 probable protein kinase [imported] - Arabidopsis
            thaliana>gb:AE005172_892007 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC027135_1539879 Arabidopsis thaliana
            chromosome 1 BAC T8E3 genomic sequence, complete
            sequence.
          Length = 590

 Score =  140 bits (354), Expect = 4e-32
 Identities = 98/311 (31%), Positives = 150/311 (48%), Gaps = 11/311 (3%)
 Frame = -2

Query: 1060 YILGASGSSIMYKTVLDDGTALAVRRVGE--SGLDRFREFENQIRVISKLVHPNLVRIRG 887
            +I+G  G   +YK  +DDG   A++R+ +   G DRF  FE ++ ++  + H  LV +RG
Sbjct: 309  HIIGCGGFGTVYKLAMDDGKVFALKRILKLNEGFDRF--FERELEILGSIKHRYLVNLRG 366

Query: 886  FYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK--- 716
            +      KL++YD++P GSL  A H +G      L W+ R+ I  G A+GLSY+H     
Sbjct: 367  YCNSPTSKLLLYDYLPGGSLDEALHERG----EQLDWDSRVNIIIGAAKGLSYLHHDCSP 422

Query: 715  KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSF 536
            + +H ++K SNILLD ++E +V DFGL +L+    E S      +  FG           
Sbjct: 423  RIIHRDIKSSNILLDGNLEARVSDFGLAKLLE--DEESHITTIVAGTFG----------- 469

Query: 535  PDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDE 356
                                  Y+APE ++S +   K DV+SFGV++LE+L+GK      
Sbjct: 470  ----------------------YLAPEYMQSGRATEKTDVYSFGVLVLEVLSGKRPTDAS 507

Query: 355  MV-PGPPVMG-----VEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRP 194
             +  G  V+G     + EK    R  D+                      C+SP P++RP
Sbjct: 508  FIEKGLNVVGWLKFLISEK----RPRDIVDPNCEGMQMESLDALLSIATQCVSPSPEERP 563

Query: 193  TMKEVVQALDN 161
            TM  VVQ L++
Sbjct: 564  TMHRVVQLLES 574



>gb:AP004991_1846852 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, BAC clone:OSJNBa0016O19.
          Length = 978

 Score =  139 bits (350), Expect = 1e-31
 Identities = 97/302 (32%), Positives = 143/302 (47%), Gaps = 3/302 (0%)
 Frame = -2

Query: 1060 YILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFY 881
            YI+G   SS +YK V  +   +AV+++       F+EFE ++  +  + H NLV ++G+ 
Sbjct: 649  YIIGYGASSTVYKCVSKNRKPVAVKKLYAHYPQSFKEFETELETVGSIKHRNLVSLQGYS 708

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KH 710
                  L+ YD++ NGSL +  H +G +  + L WE RL+IA G A+GL+Y+H     + 
Sbjct: 709  LSPVGNLLFYDYMENGSLWDVLH-EGPTKKKKLDWETRLRIALGAAQGLAYLHHDCSPRI 767

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K  NILLD D E  + DFG+ + +                               
Sbjct: 768  IHRDVKSKNILLDKDYEAHLTDFGIAKSL------------------------------- 796

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMV 350
              VS  HT   S   +G   YI PE  R+ + N K DV+S+G+VLLELLTGK  V +E  
Sbjct: 797  -CVSKTHT---STYVMGTIGYIDPEYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN 852

Query: 349  PGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVVQA 170
                ++     + V+   D  I AD                 C    P  RPTM EVV+ 
Sbjct: 853  LHHLILSKTANNAVMETVDPDI-ADTCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVVRV 911

Query: 169  LD 164
            LD
Sbjct: 912  LD 913



>gb:AP002882_1823607 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0439B06.
          Length = 698

 Score =  139 bits (349), Expect = 1e-31
 Identities = 103/316 (32%), Positives = 149/316 (47%), Gaps = 12/316 (3%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            A+  +LG  G   +YK  L DG  +AV+++   G    REF+ ++ +IS++ H +LV + 
Sbjct: 361  AAKNLLGEGGFGSVYKGCLADGREVAVKKLKGGGGQGEREFQAEVEIISRVHHRHLVSLV 420

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH 710
            G+    D++L++YDFVPN +L +  H +G      L W  R+KIA G ARG++Y+HE  H
Sbjct: 421  GYCISGDQRLLVYDFVPNDTLHHHLHGRGMPV---LEWSARVKIAAGSARGIAYLHEDCH 477

Query: 709  ---VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDS 539
               +H ++K SNILLD + E +V DFGL RL +                           
Sbjct: 478  PRIIHRDIKSSNILLDNNFEAQVADFGLARLAM--------------------------- 510

Query: 538  FPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSD 359
                AV+   T       +G   Y+APE   S K   + DVFSFGVVLLEL+TG+  V  
Sbjct: 511  ---DAVTHVTT-----RVMGTFGYLAPEYASSGKLTERSDVFSFGVVLLELITGRKPVDA 562

Query: 358  EMVPG---------PPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVP 206
                G         P +    E   V  + D   R D                 CI    
Sbjct: 563  SKPLGDESLVEWARPLLTEAIETGNVGELID--SRLDKNFNEAEMFRMIEAAAACIRHSA 620

Query: 205  QKRPTMKEVVQALDNI 158
             +RP M +VV+ LD++
Sbjct: 621  SRRPRMSQVVRVLDSL 636



>gb:AP000391_1819980 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC
            clone:P0538C01.>gb:AP000559_1820304 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 6,
            clone:P0493C11.
          Length = 980

 Score =  139 bits (349), Expect = 1e-31
 Identities = 99/301 (32%), Positives = 138/301 (45%), Gaps = 3/301 (0%)
 Frame = -2

Query: 1060 YILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFY 881
            YI+G   SS +YK  L  G A+AV+R+        REFE ++  I  + H NLV + GF 
Sbjct: 657  YIIGYGASSTVYKCELKSGKAIAVKRLYSQYNHSLREFETELETIGSIRHRNLVSLHGFS 716

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KH 710
                  L+ YD++ NGSL +  H  G S    L W+ RL+IA G A+GL+Y+H     + 
Sbjct: 717  LSPHGNLLFYDYMENGSLWDLLH--GPSKKVKLNWDTRLRIAVGAAQGLAYLHHDCNPRI 774

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K SNILLD + E  + DFG+ + V                  S +S AS      
Sbjct: 775  IHRDVKSSNILLDENFEAHLSDFGIAKCVP-----------------SAKSHAST----- 812

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMV 350
                           LG   YI PE  R+ + N K DV+SFG+VLLELLTGK  V +E  
Sbjct: 813  -------------YVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN 859

Query: 349  PGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVVQA 170
                ++   + + V+   D  +                    C    P  RPTM EV + 
Sbjct: 860  LHQLILSKADDNTVMEAVDSEVSVTCTDMGLVRKAFQLALL-CTKRHPSDRPTMHEVARV 918

Query: 169  L 167
            L
Sbjct: 919  L 919



>gb:AY756174_1627010 Oryza rufipogon putative leucine-rich repeat
            receptor-like kinase genes, complete cds.
          Length = 1049

 Score =  139 bits (349), Expect = 1e-31
 Identities = 98/309 (31%), Positives = 148/309 (47%), Gaps = 8/309 (2%)
 Frame = -2

Query: 1060 YILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFY 881
            +I+G  G  ++YK  L DG+ +A++++        REF  ++  +S   H NLV + G+ 
Sbjct: 774  HIIGCGGYGLVYKAQLPDGSMIAIKKLNGEMCLMEREFSAEVETLSMARHDNLVPLWGYC 833

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIH---EKKH 710
               + +L+IY ++ NGSL +  H K   +   L W  RLKIA+G + GLSYIH   + + 
Sbjct: 834  IQGNSRLLIYSYMENGSLDDWLHNKDDDTSTILDWPRRLKIAKGASHGLSYIHNICKPRI 893

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            VH ++K SNILLD + +  + DFGL RL++                            P+
Sbjct: 894  VHRDIKSSNILLDKEFKAYIADFGLSRLIL----------------------------PN 925

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK-----IIV 365
                  H P+     LG   YI PE  ++     K DV+SFGVVLLELLTG+     +  
Sbjct: 926  KT----HVPTELVGTLG---YIPPEYAQAWVATLKGDVYSFGVVLLELLTGRRPVPILST 978

Query: 364  SDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMK 185
            S E+VP   V  +    K + + D+  +                   C+   P +RPTM 
Sbjct: 979  SKELVPW--VQEMVSNGKQIEVLDLTFQG--TGCEEQMLKVLEIACKCVKGDPLRRPTMI 1034

Query: 184  EVVQALDNI 158
            EVV +L +I
Sbjct: 1035 EVVASLHSI 1043



>gb:AY332474_1600056 Oryza sativa (japonica cultivar-group)
            transmembrane protein kinase (PK3) mRNA, complete cds.
          Length = 999

 Score =  139 bits (349), Expect = 1e-31
 Identities = 99/301 (32%), Positives = 138/301 (45%), Gaps = 3/301 (0%)
 Frame = -2

Query: 1060 YILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFY 881
            YI+G   SS +YK  L  G A+AV+R+        REFE ++  I  + H NLV + GF 
Sbjct: 676  YIIGYGASSTVYKCELKSGKAIAVKRLYSQYNHSLREFETELETIGSIRHRNLVSLHGFS 735

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KH 710
                  L+ YD++ NGSL +  H  G S    L W+ RL+IA G A+GL+Y+H     + 
Sbjct: 736  LSPHGNLLFYDYMENGSLWDLLH--GPSKKVKLNWDTRLRIAVGAAQGLAYLHHDCNPRI 793

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K SNILLD + E  + DFG+ + V                  S +S AS      
Sbjct: 794  IHRDVKSSNILLDENFEAHLSDFGIAKCVP-----------------SAKSHAST----- 831

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMV 350
                           LG   YI PE  R+ + N K DV+SFG+VLLELLTGK  V +E  
Sbjct: 832  -------------YVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESN 878

Query: 349  PGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVVQA 170
                ++   + + V+   D  +                    C    P  RPTM EV + 
Sbjct: 879  LHQLILSKADDNTVMEAVDSEVSVTCTDMGLVRKAFQLALL-CTKRHPSDRPTMHEVARV 937

Query: 169  L 167
            L
Sbjct: 938  L 938



>gb:AY244746_1592517 Arabidopsis thaliana ERECTA-like kinase 2 (ERL2)
            mRNA, ERL2-erl2 allele, complete cds.
          Length = 967

 Score =  139 bits (349), Expect = 1e-31
 Identities = 93/301 (30%), Positives = 138/301 (45%), Gaps = 3/301 (0%)
 Frame = -2

Query: 1060 YILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFY 881
            YI+G   SS +YK        +A++R+       FREFE ++  I  + H N+V + G+ 
Sbjct: 655  YIIGYGASSTVYKCTSKTSRPIAIKRIYNQYPSNFREFETELETIGSIRHRNIVSLHGYA 714

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KH 710
                  L+ YD++ NGSL +  H  G      L WE RLKIA G A+GL+Y+H     + 
Sbjct: 715  LSPFGNLLFYDYMENGSLWDLLH--GPGKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRI 772

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K SNILLD + E ++ DFG+ + + A      K Y S+                 
Sbjct: 773  IHRDIKSSNILLDGNFEARLSDFGIAKSIPA-----TKTYASTY---------------- 811

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMV 350
                           LG   YI PE  R+ + N K D++SFG+VLLELLTGK  V +E  
Sbjct: 812  --------------VLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEAN 857

Query: 349  PGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVVQA 170
                ++   + + V+   D  +                    C    P +RPTM+EV + 
Sbjct: 858  LHQMILSKADDNTVMEAVDAEVSVTCMDSGHIKKTFQLALL-CTKRNPLERPTMQEVSRV 916

Query: 169  L 167
            L
Sbjct: 917  L 917



>pir|T48489|T48489 receptor-like protein kinase - Arabidopsis
            thaliana>gb:ATT28J14_1555599 Arabidopsis thaliana DNA
            chromosome 5, BAC clone T28J14 (ESSA project).
          Length = 932

 Score =  139 bits (349), Expect = 1e-31
 Identities = 93/301 (30%), Positives = 138/301 (45%), Gaps = 3/301 (0%)
 Frame = -2

Query: 1060 YILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFY 881
            YI+G   SS +YK        +A++R+       FREFE ++  I  + H N+V + G+ 
Sbjct: 620  YIIGYGASSTVYKCTSKTSRPIAIKRIYNQYPSNFREFETELETIGSIRHRNIVSLHGYA 679

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KH 710
                  L+ YD++ NGSL +  H  G      L WE RLKIA G A+GL+Y+H     + 
Sbjct: 680  LSPFGNLLFYDYMENGSLWDLLH--GPGKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRI 737

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K SNILLD + E ++ DFG+ + + A      K Y S+                 
Sbjct: 738  IHRDIKSSNILLDGNFEARLSDFGIAKSIPA-----TKTYASTY---------------- 776

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMV 350
                           LG   YI PE  R+ + N K D++SFG+VLLELLTGK  V +E  
Sbjct: 777  --------------VLGTIGYIDPEYARTSRLNEKSDIYSFGIVLLELLTGKKAVDNEAN 822

Query: 349  PGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVVQA 170
                ++   + + V+   D  +                    C    P +RPTM+EV + 
Sbjct: 823  LHQMILSKADDNTVMEAVDAEVSVTCMDSGHIKKTFQLALL-CTKRNPLERPTMQEVSRV 881

Query: 169  L 167
            L
Sbjct: 882  L 882



>pir|D86466|D86466 69.4K hypothetical protein F23M19.11 - Arabidopsis
            thaliana>gb:AE005172_892224 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:CQ768559_1451797 Sequence 54 from Patent
            WO2004007712.>gb:AX120063_1461711 Sequence 46 from Patent
            WO0129240.>gb:F23M19_1677952 Arabidopsis thaliana
            chromosome 1 BAC F23M19 sequence, complete sequence.
          Length = 628

 Score =  138 bits (348), Expect = 2e-31
 Identities = 101/309 (32%), Positives = 158/309 (51%), Gaps = 11/309 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIRGFY 881
            ILG  G   +YK  L DGT +AV+R+ E        +F+ ++ +IS  VH NL+R+RGF 
Sbjct: 310  ILGRGGFGKVYKGRLADGTLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFC 369

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KH 710
                E+L++Y ++ NGS+A+ C R+   S   L W +R +IA G ARGLSY+H+    K 
Sbjct: 370  MTPTERLLVYPYMANGSVAS-CLRERPPSQLPLAWSIRQQIALGSARGLSYLHDHCDPKI 428

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLD + E  VGDFGL RL+                         +D+   
Sbjct: 429  IHRDVKAANILLDEEFEAVVGDFGLARLM-----------------------DYKDTHVT 465

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG-------KI 371
            +AV G          +G   +IAPE L + K + K DVF +G++LLEL+TG       ++
Sbjct: 466  TAVRG---------TIG---HIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARL 513

Query: 370  IVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
               D+++    V G+ ++ K+  + D  ++++                 C    P +RP 
Sbjct: 514  ANDDDVMLLDWVKGLLKEKKLEMLVDPDLQSNYTEAEVEQLIQVALL--CTQSSPMERPK 571

Query: 190  MKEVVQALD 164
            M EVV+ L+
Sbjct: 572  MSEVVRMLE 580



>gb:AP007224_1863293 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC clone:P0463E12.
          Length = 1063

 Score =  138 bits (347), Expect = 3e-31
 Identities = 103/309 (33%), Positives = 150/309 (48%), Gaps = 9/309 (2%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRV-GESGLDRFREFENQIRVISKLVHPNLVRIRGFY 881
            I+G  G  ++YK  L DGT LA++++ GE  L   REF  ++  +S   H NLV + G+ 
Sbjct: 783  IIGCGGYGLVYKADLPDGTKLAIKKLFGEMCLME-REFTAEVEALSMAQHDNLVPLWGYC 841

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE--KKH- 710
               + +L+IY ++ NGSL +  H +   +   L W  RLKIA+G  RGLSYIH+  K H 
Sbjct: 842  IQGNSRLLIYSYMENGSLDDWLHNRDDDASTFLDWPKRLKIAQGAGRGLSYIHDACKPHI 901

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K SNILLD + +  V DFGL RL++A                             
Sbjct: 902  IHRDIKSSNILLDKEFKAYVADFGLARLILA----------------------------- 932

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK-----IIV 365
               +  H  +     LG   YI PE  +      K D++SFGVVLLELLTG+     +  
Sbjct: 933  ---NKTHVTTELVGTLG---YIPPEYGQGWVATLKGDIYSFGVVLLELLTGRRPVHILSS 986

Query: 364  SDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMK 185
            S E+V    V  ++ +   + + D  +R                   C++  P  RPT+K
Sbjct: 987  SKELVKW--VQEMKSEGNQIEVLDPILRG--TGYDEQMLKVLETACKCVNCNPCMRPTIK 1042

Query: 184  EVVQALDNI 158
            EVV  LD+I
Sbjct: 1043 EVVSCLDSI 1051



>gb:AF384969_1794544 Arabidopsis thaliana somatic embryogenesis
            receptor-like kinase 2 (SERK2) mRNA, complete cds.
          Length = 628

 Score =  138 bits (347), Expect = 3e-31
 Identities = 101/309 (32%), Positives = 157/309 (50%), Gaps = 11/309 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIRGFY 881
            ILG  G   +YK  L DGT +AV+R+ E        +F+ ++ +IS  VH NL+R+RGF 
Sbjct: 310  ILGRGGFGKVYKGRLADGTLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFC 369

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KH 710
                E+L++Y ++ NGS+A+ C R+   S   L W +R +IA G ARGLSY+H+    K 
Sbjct: 370  MTPTERLLVYPYMANGSVAS-CLRERPPSQLPLAWSIRQQIALGSARGLSYLHDHCDPKI 428

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLD + E  VGDFGL RL+                         +D+   
Sbjct: 429  IHRDVKAANILLDEEFEAVVGDFGLARLM-----------------------DYKDTHVT 465

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG-------KI 371
            +AV G          +G   +IAPE L + K + K DVF +G++LLEL+TG       ++
Sbjct: 466  TAVRG---------TIG---HIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARL 513

Query: 370  IVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
               D+++    V G+ ++ K+  + D  ++ +                 C    P +RP 
Sbjct: 514  ANDDDVMLLDWVKGLLKEKKLEMLVDPDLQGNYTEAEVEQLIQVALL--CTQSSPMERPK 571

Query: 190  MKEVVQALD 164
            M EVV+ L+
Sbjct: 572  MSEVVRMLE 580



>gb:AC135209_1742079 Oryza sativa (japonica cultivar-group) chromosome
            3 clone OSJNBa0071M09, complete sequence.
          Length = 503

 Score =  138 bits (347), Expect = 3e-31
 Identities = 87/234 (37%), Positives = 123/234 (52%), Gaps = 3/234 (1%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYW 878
            ++G  G   +Y+  L DGT +A++++        REF  ++ +I+++ H NLV + GF  
Sbjct: 232  VIGQGGFGCVYRGTLQDGTEVAIKKLKTESKQGDREFRAEVEIITRVHHRNLVSLVGFCI 291

Query: 877  GADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE---KKHV 707
              +E+L++Y+FVPN +L    H   G+    L W+ R KIA G ARGL+Y+H+    K +
Sbjct: 292  SGNERLLVYEFVPNKTLDTHLH---GNKGPPLDWQQRWKIAVGSARGLAYLHDDCSPKII 348

Query: 706  HGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDS 527
            H ++K SNILLD D EPKV DFGL +                                  
Sbjct: 349  HRDVKASNILLDHDFEPKVADFGLAKY--------------------------------- 375

Query: 526  AVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIV 365
               G HT   S   +G   YIAPE L S K   K DVF+FGVVLLEL+TG++ V
Sbjct: 376  -QPGNHT-HVSTRIMGTFGYIAPEFLSSGKLTDKADVFAFGVVLLELITGRLPV 427



>gb:AY756174_1627015 Oryza rufipogon putative leucine-rich repeat
            receptor-like kinase genes, complete cds.
          Length = 1063

 Score =  138 bits (347), Expect = 3e-31
 Identities = 103/309 (33%), Positives = 150/309 (48%), Gaps = 9/309 (2%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRV-GESGLDRFREFENQIRVISKLVHPNLVRIRGFY 881
            I+G  G  ++YK  L DGT LA++++ GE  L   REF  ++  +S   H NLV + G+ 
Sbjct: 783  IIGCGGYGLVYKADLPDGTKLAIKKLFGEMCLME-REFTAEVEALSMAQHDNLVPLWGYC 841

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE--KKH- 710
               + +L+IY ++ NGSL +  H +   +   L W  RLKIA+G  RGLSYIH+  K H 
Sbjct: 842  IQGNSRLLIYSYMENGSLDDWLHNRDDDASTFLDWPKRLKIAQGAGRGLSYIHDACKPHI 901

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K SNILLD + +  V DFGL RL++A                             
Sbjct: 902  IHRDIKSSNILLDKEFKAYVADFGLARLILA----------------------------- 932

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK-----IIV 365
               +  H  +     LG   YI PE  +      K D++SFGVVLLELLTG+     +  
Sbjct: 933  ---NKTHVTTELVGTLG---YIPPEYGQGWVATLKGDIYSFGVVLLELLTGRRPVHILSS 986

Query: 364  SDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMK 185
            S E+V    V  ++ +   + + D  +R                   C++  P  RPT+K
Sbjct: 987  SKELVKW--VQEMKSEGNQIEVLDPILRG--TGYDEQMLKVLETACKCVNCNPCMRPTIK 1042

Query: 184  EVVQALDNI 158
            EVV  LD+I
Sbjct: 1043 EVVSCLDSI 1051



>gb:OSJN00299_1698204 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: B1358B12, complete sequence.
          Length = 669

 Score =  137 bits (346), Expect = 3e-31
 Identities = 103/320 (32%), Positives = 146/320 (45%), Gaps = 16/320 (5%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            ASA +LG       YK  L+ G  +AV+R+ E+ L   REF +++  I  L HPN+V ++
Sbjct: 366  ASAEVLGKGTYGTTYKAALETGPVVAVKRLKETSLPE-REFRDKVAAIGGLDHPNVVPLQ 424

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE--K 716
             +Y+  DEKL++Y+FV  GSL++  H   GS    L WE R +IA   ARGL YIH    
Sbjct: 425  AYYFSKDEKLMVYEFVAMGSLSSMLHGNRGSGRSPLLWESRRRIALASARGLEYIHATGS 484

Query: 715  KHVHGNLKPSNILLD-ADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDS 539
            K VHGN+K SN+LL  + ++ +V D GL  LV   G  S +V G                
Sbjct: 485  KVVHGNIKSSNVLLSRSSVDARVADHGLAHLVGPAGAPSSRVAG---------------- 528

Query: 538  FPDSAVSGGHTPSPSPSALGISPYIAPESLRS-LKPNPKWDVFSFGVVLLELLTGKIIVS 362
                                   Y APE +    + + K DV+SFGV+LLELLTGK    
Sbjct: 529  -----------------------YRAPEVVADPWRLSQKADVYSFGVLLLELLTGK---- 561

Query: 361  DEMVPGPPVMGVEEKSKVLRMADVAIRADMXX------------XXXXXXXXXXXGYNCI 218
                P   V+  +E   + R A   +R +                            +C 
Sbjct: 562  ---APTHAVLHDDEGVDLPRWARSVVREEWTSEVFDTELLRHPGAEDEMVEMLRLAMDCT 618

Query: 217  SPVPQKRPTMKEVVQALDNI 158
              VP +RP M E+V  ++ +
Sbjct: 619  VTVPDQRPAMPEIVVRIEQL 638



>gb:AP004140_1838185 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1534_E09.
          Length = 392

 Score =  137 bits (345), Expect = 4e-31
 Identities = 96/302 (31%), Positives = 141/302 (46%), Gaps = 3/302 (0%)
 Frame = -2

Query: 1060 YILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFY 881
            YI+G   SS +YK VL +   +A++++        +EFE ++  +  + H NLV ++G+ 
Sbjct: 63   YIIGYGASSTVYKCVLKNCKPVAIKKLYAHYPQSLKEFETELETVGSIKHRNLVSLQGYS 122

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KH 710
                  L+ YD++ NGSL +  H  G S  + L WE RL+IA G A+GL+Y+H     + 
Sbjct: 123  LSPAGNLLFYDYLENGSLWDVLHA-GSSKKQKLDWEARLRIALGAAQGLAYLHHDCNPRI 181

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K  NILLD D E  + DFG+ + +                               
Sbjct: 182  IHRDVKSKNILLDKDYEAHLADFGIAKSL------------------------------- 210

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMV 350
               S  HT   S   +G   YI PE   + + N K DV+S+G+VLLELLTGK  V +E  
Sbjct: 211  -CTSKTHT---STYVMGTIGYIDPEYACTSRLNEKSDVYSYGIVLLELLTGKKPVDNECN 266

Query: 349  PGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVVQA 170
                ++     + V+ M D  I AD                 C    P  RPTM EVV+ 
Sbjct: 267  LHHLILSKAADNTVMEMVDPDI-ADTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVVRV 325

Query: 169  LD 164
            LD
Sbjct: 326  LD 327



>gb:ATH550163_1552879 Arabidopsis thaliana mRNA for LRR receptor-like
            kinase 2 (rch2 gene).
          Length = 1120

 Score =  137 bits (345), Expect = 4e-31
 Identities = 93/315 (29%), Positives = 152/315 (48%), Gaps = 15/315 (4%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFRE---------FENQIRVISKLVHPN 905
            ++G   S ++Y+  +D+G  +AV+++  + ++   +         F  +++ +  + H N
Sbjct: 791  VIGKGCSGVVYRADVDNGEVIAVKKLWPAMVNGGHDEKTKNVRDSFSAEVKTLGTIRHKN 850

Query: 904  LVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYI 725
            +VR  G  W  + +L++YD++PNGSL +  H + GSS   L W++R +I  G A+GL+Y+
Sbjct: 851  IVRFLGCCWNRNTRLLMYDYMPNGSLGSLLHERRGSS---LDWDLRYRILLGAAQGLAYL 907

Query: 724  HE---KKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAG--GESSRKVYGSSRNFGSKR 560
            H       VH ++K +NIL+  D EP + DFGL +LV  G  G  S  V GS   +G   
Sbjct: 908  HHDCLPPIVHRDIKANNILIGLDFEPYIADFGLAKLVDEGDIGRCSNTVAGS---YG--- 961

Query: 559  STASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLT 380
                                          YIAPE   S+K   K DV+S+GVV+LE+LT
Sbjct: 962  ------------------------------YIAPEYGYSMKITEKSDVYSYGVVVLEVLT 991

Query: 379  GKIIVSDEMVPGPPVMG-VEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQ 203
            GK  +   +  G  ++  V +    L + D  +R+                  C++  P 
Sbjct: 992  GKQPIDPTVPEGIHLVDWVRQNRGSLEVLDSTLRSRTEAEADEMMQVLGTALLCVNSSPD 1051

Query: 202  KRPTMKEVVQALDNI 158
            +RPTMK+V   L  I
Sbjct: 1052 ERPTMKDVAAMLKEI 1066



>pir|H84770|H84770 probable receptor-like protein kinase [imported] -
            Arabidopsis thaliana>gb:AC006068_1533368 Arabidopsis
            thaliana chromosome 2 clone T20F21 map ve016, complete
            sequence.
          Length = 567

 Score =  137 bits (345), Expect = 4e-31
 Identities = 92/310 (29%), Positives = 152/310 (49%), Gaps = 10/310 (3%)
 Frame = -2

Query: 1060 YILGASGSSIMYKTVLDDGTALAVRRVGE--SGLDRFREFENQIRVISKLVHPNLVRIRG 887
            +I+G  G   +YK  +DDG   A++R+ +   G DRF  FE ++ ++  + H  LV +RG
Sbjct: 286  HIIGCGGFGTVYKLSMDDGNVFALKRIVKLNEGFDRF--FERELEILGSIKHRYLVNLRG 343

Query: 886  FYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK--- 716
            +      KL++YD++P GSL  A H++G      L W+ R+ I  G A+GL+Y+H     
Sbjct: 344  YCNSPTSKLLLYDYLPGGSLDEALHKRG----EQLDWDSRVNIIIGAAKGLAYLHHDCSP 399

Query: 715  KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSF 536
            + +H ++K SNILLD ++E +V DFGL +L+    E S      +  FG           
Sbjct: 400  RIIHRDIKSSNILLDGNLEARVSDFGLAKLLE--DEESHITTIVAGTFG----------- 446

Query: 535  PDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDE 356
                                  Y+APE ++S +   K DV+SFGV++LE+L+GK+     
Sbjct: 447  ----------------------YLAPEYMQSGRATEKTDVYSFGVLVLEVLSGKLPTDAS 484

Query: 355  MV-PGPPVMG----VEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
             +  G  ++G    +  +++   + D++                     C+S  P +RPT
Sbjct: 485  FIEKGFNIVGWLNFLISENRAKEIVDLSCEG---VERESLDALLSIATKCVSSSPDERPT 541

Query: 190  MKEVVQALDN 161
            M  VVQ L++
Sbjct: 542  MHRVVQLLES 551



>gb:AC114983_1739204 Oryza sativa (japonica cultivar-group) chromosome
            3 clone OSJNBa0032H19 map E30331S, complete sequence.
          Length = 834

 Score =  137 bits (344), Expect = 6e-31
 Identities = 100/313 (31%), Positives = 146/313 (46%), Gaps = 17/313 (5%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            LG  GS I+YK  LDDG  +AV+ + E+      EF+ ++R+I K+ H NLVRI GF   
Sbjct: 527  LGRGGSGIVYKGTLDDGRVVAVKML-ENVRQCEEEFQAELRIIGKINHMNLVRIWGFCSE 585

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---VH 704
               ++++ +++ NGSLAN    +    +  L W  R  IA GVA+GL+Y+H +     +H
Sbjct: 586  NSHRMLVTEYIENGSLANILFNE----NILLEWRQRFNIAVGVAKGLAYLHHECLEWVIH 641

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             ++KP NILLD + EPK+ DFGL +L+  GG        S++N    R T          
Sbjct: 642  CDVKPENILLDGNFEPKIADFGLAKLLNRGG--------SNQNVSRVRGTIG-------- 685

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMVPG 344
                              YIAPE + SL+   K DV+S+GVVLLEL++GK ++       
Sbjct: 686  ------------------YIAPEWISSLQITAKVDVYSYGVVLLELVSGKRVLDLATSAN 727

Query: 343  PPV--------------MGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVP 206
              V              +   E S +    D  +                    C+    
Sbjct: 728  EEVHVVLRRLVKMFANNLSGNEPSWIAEFVDCRLSGQFNYTQVRTMITLAVA--CLDEER 785

Query: 205  QKRPTMKEVVQAL 167
             KRPTM+ +VQ L
Sbjct: 786  SKRPTMESIVQLL 798



>gb:AY714494_1624025 Oryza sativa (indica cultivar-group) clone
            OsInlk6 putative leucine-rich repeat receptor-like kinase
            mRNA, complete cds.>gb:AY730046_1625388 Oryza sativa
            (indica cultivar-group) putative leucine-rich repeat
            receptor-like kinase genes, complete cds.
          Length = 1065

 Score =  137 bits (344), Expect = 6e-31
 Identities = 103/309 (33%), Positives = 149/309 (48%), Gaps = 9/309 (2%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRV-GESGLDRFREFENQIRVISKLVHPNLVRIRGFY 881
            I+G  G  ++YK  L DGT LA++++ GE  L   REF  ++  +S   H NLV + G+ 
Sbjct: 785  IIGCGGYGLVYKADLPDGTKLAIKKLFGEMCLME-REFTAEVEALSMAQHDNLVPLWGYC 843

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE--KKH- 710
               + +L+IY ++ NGSL +  H +   +   L W  RLKIA G  RGLSYIH+  K H 
Sbjct: 844  IQGNSRLLIYSYMENGSLDDWLHNRDDDASTFLDWPKRLKIAPGAGRGLSYIHDACKPHI 903

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K SNILLD + +  V DFGL RL++A                             
Sbjct: 904  IHRDIKSSNILLDKEFKAYVADFGLARLILA----------------------------- 934

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK-----IIV 365
               +  H  +     LG   YI PE  +      K D++SFGVVLLELLTG+     +  
Sbjct: 935  ---NKTHVTTELVGTLG---YIPPEYGQGWVATLKGDIYSFGVVLLELLTGRRPVHILSS 988

Query: 364  SDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMK 185
            S E+V    V  ++ +   + + D  +R                   C++  P  RPT+K
Sbjct: 989  SKELVKW--VQEMKSEGNQIEVLDPILRG--TGYDEQMLKVLETACKCVNCNPCMRPTIK 1044

Query: 184  EVVQALDNI 158
            EVV  LD+I
Sbjct: 1045 EVVSCLDSI 1053



>gb:AC012562_1537725 Arabidopsis thaliana chromosome 3 BAC F17O14
            genomic sequence, complete sequence.
          Length = 640

 Score =  137 bits (344), Expect = 6e-31
 Identities = 98/313 (31%), Positives = 145/313 (46%), Gaps = 9/313 (2%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLV-HPNLVRI 893
            ASA +LG       YK +L++GT + V+R+ E    + REFE Q+  + ++  H N+  +
Sbjct: 342  ASAEVLGKGSYGTTYKAILEEGTTVVVKRLKEVAAGK-REFEQQMEAVGRISPHVNVAPL 400

Query: 892  RGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE-- 719
            R +Y+  DEKL++YD+   G+ +   H         L WE RL+I    ARG+S+IH   
Sbjct: 401  RAYYFSKDEKLLVYDYYQGGNFSMLLHGNNEGGRAALDWETRLRICLEAARGISHIHSAS 460

Query: 718  -KKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRD 542
              K +HGN+K  N+LL  ++   V DFG+  L+                           
Sbjct: 461  GAKLLHGNIKSPNVLLTQELHVCVSDFGIAPLM--------------------------- 493

Query: 541  SFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVS 362
                      HT  PS S LG   Y APE++ + K   K DV+SFGV+LLE+LTGK    
Sbjct: 494  --------SHHTLIPSRS-LG---YRAPEAIETRKHTQKSDVYSFGVLLLEMLTGKAAGK 541

Query: 361  ----DEMVPGPP-VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKR 197
                +E+V  P  V  V  +     + DV +                    C+S  P  R
Sbjct: 542  TTGHEEVVDLPKWVQSVVREEWTGEVFDVELIKQQHNVEEEMVQMLQIAMACVSKHPDSR 601

Query: 196  PTMKEVVQALDNI 158
            P+M+EVV  ++ I
Sbjct: 602  PSMEEVVNMMEEI 614



>gb:AP005473_1852497 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OSJNBa0077B15.
          Length = 1065

 Score =  136 bits (343), Expect = 7e-31
 Identities = 111/340 (32%), Positives = 162/340 (47%), Gaps = 17/340 (5%)
 Frame = -2

Query: 1126 GELVTVDGXXXXXXXXXXKASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREF 947
            GEL  +D           +A A +LG S     Y+  L++G  L V+ + E      +EF
Sbjct: 765  GELHFLDETITLTPEELSRAPAEVLGRSSHGTSYRATLENGVFLTVKWLREGVARPKKEF 824

Query: 946  ENQIRVISKLVHPNLVRIRGFYWG--ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWE 773
              + +  + + HPN+V +RG+YWG  A EKL++ D+V  GSLA+  + + G     L W 
Sbjct: 825  SKEAKKFANIRHPNVVGLRGYYWGPTAHEKLILSDYVSPGSLASFLYDRPGRRGPPLTWA 884

Query: 772  VRLKIARGVARGLSYIH-EKKHVHGNLKPSNILLDA-DMEPKVGDFGLERLVVAGGESSR 599
             RLKIA  VARGL+Y+H ++   HGNLK +NILLD  D+  +V D+ L RL+   G   +
Sbjct: 885  QRLKIAVDVARGLNYLHFDRAMPHGNLKATNILLDGLDLNARVADYCLHRLMTQAGVVEQ 944

Query: 598  KVYGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNP--K 425
             +                                    LG+  Y APE   S KP+P  K
Sbjct: 945  IL-----------------------------------DLGVLGYRAPELAASKKPSPSFK 969

Query: 424  WDVFSFGVVLLELLTGKIIVSDEMVPGPPVMGVEEKSKV-LRMAD----------VAIRA 278
             DV++FGVVLLELLTG+   + ++V G    GV+    V LR+A+          +A  +
Sbjct: 970  SDVYAFGVVLLELLTGR--CAGDVVSGSE-GGVDLTDWVRLRVAEGRGSDCFDPAMASDS 1026

Query: 277  DMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVVQALDNI 158
            +                 CI PV  +RP +K V + L +I
Sbjct: 1027 ENQVSVKGMKDVLGIALRCIRPV-SERPGIKSVYEDLSSI 1065



>gb:AF384970_1794545 Arabidopsis thaliana somatic embryogenesis
            receptor-like kinase 3 (SERK3) mRNA, complete cds.
          Length = 615

 Score =  136 bits (343), Expect = 7e-31
 Identities = 101/309 (32%), Positives = 157/309 (50%), Gaps = 11/309 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIRGFY 881
            ILG  G   +YK  L DGT +AV+R+ E        +F+ ++ +IS  VH NL+R+RGF 
Sbjct: 294  ILGRGGFGKVYKGRLADGTLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFC 353

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KH 710
                E+L++Y ++ NGS+A+ C R+   S   L W  R +IA G ARGL+Y+H+    K 
Sbjct: 354  MTPTERLLVYPYMANGSVAS-CLRERPESQPPLDWPKRQRIALGSARGLAYLHDHCDPKI 412

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLD + E  VGDFGL +L+                         +D+   
Sbjct: 413  IHRDVKAANILLDEEFEAVVGDFGLAKLM-----------------------DYKDTHVT 449

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG-------KI 371
            +AV G          +G   +IAPE L + K + K DVF +GV+LLEL+TG       ++
Sbjct: 450  TAVRG---------TIG---HIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARL 497

Query: 370  IVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
               D+++    V G+ ++ K+  + DV ++ +                 C    P +RP 
Sbjct: 498  ANDDDVMLLDWVKGLLKEKKLEALVDVDLQGNYKDEEVEQLIQVALL--CTQSSPMERPK 555

Query: 190  MKEVVQALD 164
            M EVV+ L+
Sbjct: 556  MSEVVRMLE 564



>gb:AB018111_1513765 Arabidopsis thaliana genomic DNA, chromosome 5,
            TAC clone:K2A11.
          Length = 640

 Score =  136 bits (343), Expect = 7e-31
 Identities = 94/313 (30%), Positives = 149/313 (47%), Gaps = 9/313 (2%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKL-VHPNLVRI 893
            ASA +LG       YK VL+D TA+ V+R+ E    + +EFE Q+ ++ K+  H N V +
Sbjct: 348  ASAEVLGKGSFGTAYKAVLEDTTAVVVKRLREVVASK-KEFEQQMEIVGKINQHSNFVPL 406

Query: 892  RGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKK 713
              +Y+  DEKL++Y ++  GSL    H  G    R + WE R+KIA G ++ +SY+H  K
Sbjct: 407  LAYYYSKDEKLLVYKYMTKGSLFGIMH--GNRGDRGVDWETRMKIATGTSKAISYLHSLK 464

Query: 712  HVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFP 533
             VHG++K SNILL  D+EP + D  L  L                               
Sbjct: 465  FVHGDIKSSNILLTEDLEPCLSDTSLVTLF------------------------------ 494

Query: 532  DSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKI------ 371
                   + P+ +P  +G   Y APE + + + + + DV+SFGVV+LE+LTGK       
Sbjct: 495  -------NLPTHTPRTIG---YNAPEVIETRRVSQRSDVYSFGVVILEMLTGKTPLTQPG 544

Query: 370  IVSDEMVPGPP--VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKR 197
            +  + +V   P  V  V  +     + DV +                    C++  P+ R
Sbjct: 545  LEDERVVIDLPRWVRSVVREEWTAEVFDVEL-LKFQNIEEEMVQMLQLALACVARNPESR 603

Query: 196  PTMKEVVQALDNI 158
            P M+EV + ++++
Sbjct: 604  PKMEEVARMIEDV 616



>gb:AX120065_1461712 Sequence 48 from Patent WO0129240.
          Length = 591

 Score =  136 bits (343), Expect = 7e-31
 Identities = 101/309 (32%), Positives = 157/309 (50%), Gaps = 11/309 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIRGFY 881
            ILG  G   +YK  L DGT +AV+R+ E        +F+ ++ +IS  VH NL+R+RGF 
Sbjct: 270  ILGRGGFGKVYKGRLADGTLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFC 329

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KH 710
                E+L++Y ++ NGS+A+ C R+   S   L W  R +IA G ARGL+Y+H+    K 
Sbjct: 330  MTPTERLLVYPYMANGSVAS-CLRERPESQPPLDWPKRQRIALGSARGLAYLHDHCDPKI 388

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLD + E  VGDFGL +L+                         +D+   
Sbjct: 389  IHRDVKAANILLDEEFEAVVGDFGLAKLM-----------------------DYKDTHVT 425

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG-------KI 371
            +AV G          +G   +IAPE L + K + K DVF +GV+LLEL+TG       ++
Sbjct: 426  TAVRG---------TIG---HIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARL 473

Query: 370  IVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
               D+++    V G+ ++ K+  + DV ++ +                 C    P +RP 
Sbjct: 474  ANDDDVMLLDWVKGLLKEKKLEALVDVDLQGNYKDEEVEQLIQVALL--CTQSSPMERPK 531

Query: 190  MKEVVQALD 164
            M EVV+ L+
Sbjct: 532  MSEVVRMLE 540



>pir|T05994|T05994 protein kinase homolog F17M5.190 - Arabidopsis
            thaliana>gb:ATCHRIV79_1547263 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 79.>gb:ATF17M5_1549022
            Arabidopsis thaliana DNA chromosome 4, BAC clone F17M5
            (ESSA project).
          Length = 523

 Score =  136 bits (343), Expect = 7e-31
 Identities = 101/309 (32%), Positives = 157/309 (50%), Gaps = 11/309 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIRGFY 881
            ILG  G   +YK  L DGT +AV+R+ E        +F+ ++ +IS  VH NL+R+RGF 
Sbjct: 202  ILGRGGFGKVYKGRLADGTLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFC 261

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KH 710
                E+L++Y ++ NGS+A+ C R+   S   L W  R +IA G ARGL+Y+H+    K 
Sbjct: 262  MTPTERLLVYPYMANGSVAS-CLRERPESQPPLDWPKRQRIALGSARGLAYLHDHCDPKI 320

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLD + E  VGDFGL +L+                         +D+   
Sbjct: 321  IHRDVKAANILLDEEFEAVVGDFGLAKLM-----------------------DYKDTHVT 357

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG-------KI 371
            +AV G          +G   +IAPE L + K + K DVF +GV+LLEL+TG       ++
Sbjct: 358  TAVRG---------TIG---HIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARL 405

Query: 370  IVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
               D+++    V G+ ++ K+  + DV ++ +                 C    P +RP 
Sbjct: 406  ANDDDVMLLDWVKGLLKEKKLEALVDVDLQGNYKDEEVEQLIQVALL--CTQSSPMERPK 463

Query: 190  MKEVVQALD 164
            M EVV+ L+
Sbjct: 464  MSEVVRMLE 472



>sp|Q94F62|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated
            receptor kinase 1 precursor (EC 2.7.1.37)
            (BRI1-associated receptor kinase 1) (Somatic
            embryogenesis receptor-like kinase
            3).>gb:CQ768561_1451798 Sequence 56 from Patent
            WO2004007712.
          Length = 615

 Score =  136 bits (343), Expect = 7e-31
 Identities = 101/309 (32%), Positives = 157/309 (50%), Gaps = 11/309 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIRGFY 881
            ILG  G   +YK  L DGT +AV+R+ E        +F+ ++ +IS  VH NL+R+RGF 
Sbjct: 294  ILGRGGFGKVYKGRLADGTLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFC 353

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KH 710
                E+L++Y ++ NGS+A+ C R+   S   L W  R +IA G ARGL+Y+H+    K 
Sbjct: 354  MTPTERLLVYPYMANGSVAS-CLRERPESQPPLDWPKRQRIALGSARGLAYLHDHCDPKI 412

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLD + E  VGDFGL +L+                         +D+   
Sbjct: 413  IHRDVKAANILLDEEFEAVVGDFGLAKLM-----------------------DYKDTHVT 449

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG-------KI 371
            +AV G          +G   +IAPE L + K + K DVF +GV+LLEL+TG       ++
Sbjct: 450  TAVRG---------TIG---HIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARL 497

Query: 370  IVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
               D+++    V G+ ++ K+  + DV ++ +                 C    P +RP 
Sbjct: 498  ANDDDVMLLDWVKGLLKEKKLEALVDVDLQGNYKDEEVEQLIQVALL--CTQSSPMERPK 555

Query: 190  MKEVVQALD 164
            M EVV+ L+
Sbjct: 556  MSEVVRMLE 564



>gb:AB092809_1525111 Lotus corniculatus var. japonicus HAR1 gene for
            LRR receptor-like kinase, hypothetical proteins, complete
            and partial cds, clone:BAC259.12D-2.>gb:AB092810_1525115
            Lotus corniculatus var. japonicus HAR1 mRNA for LRR
            receptor-like kinase, complete cds.>gb:LCO580824_1684036
            Lotus corniculatus var. japonicus har1 gene and genes for
            transcription factor homolog BTF3-like protein,
            S-receptor kinase-like protein 1, S-receptor kinase-like
            protein 2, S-receptor kinase-like protein 3 and SAR
            DNA-binding protein-like protein.>gb:LJA495843_1684981
            Lotus japonicus har1 gene for hypernodulation aberrant
            root formation protein, exons 1-2.>gb:LJA495844_1684982
            Lotus japonicus mRNA for hypernodulation aberrant root
            formation protein, (har1 gene).
          Length = 986

 Score =  136 bits (342), Expect = 1e-30
 Identities = 100/313 (31%), Positives = 152/313 (48%), Gaps = 12/313 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRR-VGESGLDRFREFENQIRVISKLVHPNLVRIRGFY 881
            I+G  G+ I+Y+  + +GT +A++R VG+        F  +I  + K+ H N++R+ G+ 
Sbjct: 700  IIGKGGAGIVYRGSMPNGTDVAIKRLVGQGSGRNDYGFRAEIETLGKIRHRNIMRLLGYV 759

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH--- 710
               D  L++Y+++PNGSL    H   G+   HL WE+R KIA   ARGL Y+H       
Sbjct: 760  SNKDTNLLLYEYMPNGSLGEWLH---GAKGGHLRWEMRYKIAVEAARGLCYMHHDCSPLI 816

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLDAD E  V DFGL + +   G S                         
Sbjct: 817  IHRDVKSNNILLDADFEAHVADFGLAKFLYDPGASQSM---------------------- 854

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMV 350
            S+++G +             YIAPE   +LK + K DV+SFGVVLLEL+ G+  V  E  
Sbjct: 855  SSIAGSY------------GYIAPEYAYTLKVDEKSDVYSFGVVLLELIIGRKPVG-EFG 901

Query: 349  PGPPVMGVEEK--SKVLRMADVAIRADMXXXXXXXXXXXXXGY------NCISPVPQKRP 194
             G  ++G   K  S++ + +D A+   +              +       C+  +   RP
Sbjct: 902  DGVDIVGWVNKTMSELSQPSDTALVLAVVDPRLSGYPLTSVIHMFNIAMMCVKEMGPARP 961

Query: 193  TMKEVVQALDNIP 155
            TM+EVV  L N P
Sbjct: 962  TMREVVHMLTNPP 974



>gb:AP003214_1825331 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, BAC clone:OSJNBa0083M16.
          Length = 791

 Score =  135 bits (341), Expect = 1e-30
 Identities = 103/328 (31%), Positives = 151/328 (46%), Gaps = 24/328 (7%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGES--GLDRFREFENQIRVISKLVHPNLVR 896
            ASA +LG  G    YK VL DG+ +AV+R+ ++       ++FE+ + V+ +L HPN+V 
Sbjct: 475  ASAEMLGKGGCGTAYKAVLGDGSVVAVKRLRDATAAAASKKDFEHHMAVLGRLRHPNIVP 534

Query: 895  IRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK 716
            +  +Y+  DEKL++Y+F+PNGSL +  H   G     L W  R++IA   ARGL+YIH  
Sbjct: 535  LNAYYYARDEKLLVYEFMPNGSLFSLLHGNRGPGRTPLDWAARMRIASAAARGLAYIHHA 594

Query: 715  KH--------VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKR 560
                       HGN+K +NILLD     ++ D GL +L            GS        
Sbjct: 595  SRRGSGTPRLAHGNIKSTNILLDKAGVGRLADCGLAQL------------GS-------- 634

Query: 559  STASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKP--NPKWDVFSFGVVLLEL 386
                               SP+ +A   + Y APE+    +P  + K DV++FGVVLLEL
Sbjct: 635  -------------------SPAAAAARSAGYRAPEAPPPPRPWASQKGDVYAFGVVLLEL 675

Query: 385  LTGKIIVSDEMVPGPPVMGVEEKSKVLR------------MADVAIRADMXXXXXXXXXX 242
            LTG+   S+    G  V        V+R            M D  I  +M          
Sbjct: 676  LTGRCPGSELPNGGVVVELPRWVQSVVREEWTSEVFDLELMKDKGIEEEM-------VAM 728

Query: 241  XXXGYNCISPVPQKRPTMKEVVQALDNI 158
                 +C S  P +RP +  VV+ ++ I
Sbjct: 729  LQLALSCASAAPDQRPKIGYVVKMIEEI 756



>gb:AC104280_1737456 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OJ1430_B02, complete sequence.
          Length = 424

 Score =  135 bits (341), Expect = 1e-30
 Identities = 96/310 (30%), Positives = 146/310 (47%), Gaps = 11/310 (3%)
 Frame = -2

Query: 1063 AYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGF 884
            A+++G      +Y+ VL DG  +AV+ +   G     EFE ++ ++S+L  P L+ + G 
Sbjct: 132  AHVVGQGSFGAVYRGVLPDGRKVAVKLMDRPGKQGEEEFEMEVELLSRLRSPYLLGLIGH 191

Query: 883  YWGADEKLVIYDFVPNGSLANACHRKGGSSH--RHLPWEVRLKIARGVARGLSYIHEKKH 710
                  +L++Y+F+ NG L    +  GGS      L W  R++IA   A+GL Y+HE+ +
Sbjct: 192  CSEGGHRLLVYEFMANGGLQEHLYPNGGSCGGISKLDWPTRMRIALEAAKGLEYLHERVN 251

Query: 709  ---VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDS 539
               +H + K SNILLD D   +V DFGL +L            GS R             
Sbjct: 252  PPVIHRDFKSSNILLDKDFRARVSDFGLAKL------------GSDR------------- 286

Query: 538  FPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSD 359
                  +GGH    S   LG   Y+APE   +     K DV+S+GVVLLELLTG++ V  
Sbjct: 287  ------AGGHV---STRVLGTQGYVAPEYALTGHLTTKSDVYSYGVVLLELLTGRVPVDM 337

Query: 358  EMVPGPPVM------GVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKR 197
            +  PG  V+       + ++ KV+++ D A+                    C+      R
Sbjct: 338  KRPPGEGVLVNWALPMLTDREKVVQILDPALEGQYSLKDAVQVAAIAAM--CVQQEADYR 395

Query: 196  PTMKEVVQAL 167
            P M +VVQ+L
Sbjct: 396  PLMADVVQSL 405



>gb:AC082645_1733172 Oryza sativa chromosome 3 BAC OSJNBb0033N16
            genomic sequence, complete sequence.
          Length = 686

 Score =  135 bits (341), Expect = 1e-30
 Identities = 102/311 (32%), Positives = 142/311 (45%), Gaps = 7/311 (2%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            ASA +LG       YK VL+ G  +AV+R+ +  L    EF ++I  I +L H  +V +R
Sbjct: 378  ASAEVLGKGAFGTTYKAVLESGATVAVKRLKDVTLTE-PEFRDRIADIGELQHEFIVPLR 436

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIH--EK 716
             +Y+  DEKL++YDF+P GSL+   H   GS    L WE R  IA   ARG+ YIH    
Sbjct: 437  AYYYSKDEKLLVYDFMPMGSLSAVLHGNRGSGRTPLNWETRSSIALAAARGVEYIHSTSS 496

Query: 715  KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSF 536
               HGN+K SN+LL+   + ++ D GL  LV                             
Sbjct: 497  SASHGNIKSSNVLLNKSYQARLSDNGLSALV----------------------------- 527

Query: 535  PDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK----II 368
                      PS +PS    S Y APE     + + K DV+SFGV+LLELLTGK      
Sbjct: 528  ---------GPSSAPSR--ASGYRAPEVTDPRRVSQKADVYSFGVLLLELLTGKAPSQAA 576

Query: 367  VSDEMVPGPP-VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
            ++DE V  P  V  V        + D+ +                   +C++ VP  RP+
Sbjct: 577  LNDEGVDLPRWVQSVVRSEWTAEVFDMEL-LRYQNVEEQMVQLLQLAIDCVAQVPDARPS 635

Query: 190  MKEVVQALDNI 158
            M  VV  ++ I
Sbjct: 636  MPHVVLRIEEI 646



>gb:BT006178_1639070 Arabidopsis thaliana clone RAFL16-01-D23 (R20950)
            putative receptor protein kinase (TMK1) (At1g66150) mRNA,
            complete cds.
          Length = 942

 Score =  135 bits (341), Expect = 1e-30
 Identities = 101/319 (31%), Positives = 156/319 (48%), Gaps = 15/319 (4%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGL---DRFREFENQIRVISKLVHPNLV 899
            +S  ILG+ G  ++YK  L DGT +AV+R+ E+G+     F EF+++I V++K+ H +LV
Sbjct: 589  SSDNILGSGGFGVVYKGELHDGTKIAVKRM-ENGVIAGKGFAEFKSEIAVLTKVRHRHLV 647

Query: 898  RIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE 719
             + G+    +EKL++Y+++P G+L+           + L W+ RL +A  VARG+ Y+H 
Sbjct: 648  TLLGYCLDGNEKLLVYEYMPQGTLSRHLFEWSEEGLKPLLWKQRLTLALDVARGVEYLHG 707

Query: 718  KKH---VHGNLKPSNILLDADMEPKVGDFGLERLVVAG-GESSRKVYGSSRNFGSKRSTA 551
              H   +H +LKPSNILL  DM  KV DFGL RL   G G    ++ G+   FG      
Sbjct: 708  LAHQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPEGKGSIETRIAGT---FG------ 758

Query: 550  SRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKI 371
                                       Y+APE   + +   K DV+SFGV+L+EL+TG+ 
Sbjct: 759  ---------------------------YLAPEYAVTGRVTTKVDVYSFGVILMELITGRK 791

Query: 370  IVSDEMVPGPPV--------MGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCIS 215
             + DE  P   +        M + +++   +  D  I  D              G+ C S
Sbjct: 792  SL-DESQPEESIHLVSWFKRMYINKEASFKKAIDTTIDLDEETLASVHTVAELAGH-CCS 849

Query: 214  PVPQKRPTMKEVVQALDNI 158
              P +RP M   V  L ++
Sbjct: 850  REPYQRPDMGHAVNILSSL 868



>gb:AE005173_895101 Arabidopsis thaliana chromosome 1, bottom arm
            complete sequence.>gb:AC006434_1534219 Genomic sequence
            for Arabidopsis thaliana BAC F10A5, complete sequence.
          Length = 1140

 Score =  135 bits (341), Expect = 1e-30
 Identities = 77/229 (33%), Positives = 119/229 (51%), Gaps = 1/229 (0%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYW 878
            +L      +++K    DG  L+VRR+ +        F NQ   + ++ H N+  +RG+Y 
Sbjct: 844  VLSRGRYGLVFKATFRDGMVLSVRRLMDGASITDATFRNQAEALGRVKHKNITVLRGYYC 903

Query: 877  GA-DEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKHVHG 701
            G  D +L++YD++PNG+LA             L W +R  IA G+ARGLS++H    +HG
Sbjct: 904  GPPDLRLLVYDYMPNGNLATLLQEASHQDGHVLNWPMRHLIALGIARGLSFLHSLSIIHG 963

Query: 700  NLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSAV 521
            +LKP N+L DAD E  + +FGL+RL                                +A+
Sbjct: 964  DLKPQNVLFDADFEAHLSEFGLDRL--------------------------------TAL 991

Query: 520  SGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
            +    PS S + +G   YIAPE+  + + + + DV+SFG+VLLE+LTGK
Sbjct: 992  TPAEEPSTSSTPVGSLGYIAPEAGLTGETSKESDVYSFGIVLLEILTGK 1040



>gb:AY070033_1566676 Arabidopsis thaliana unknown protein (At3g56370)
            mRNA, complete cds.
          Length = 964

 Score =  135 bits (340), Expect = 2e-30
 Identities = 98/302 (32%), Positives = 145/302 (48%), Gaps = 6/302 (1%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIRGFYW 878
            LG  G   +Y+TV+ DG  +A++++  S L + + EFE +++ + KL H NLV++ G+YW
Sbjct: 684  LGRGGFGAVYRTVIRDGYPVAIKKLTVSSLVKSQDEFEREVKKLGKLRHSNLVKLEGYYW 743

Query: 877  GADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKHVHGN 698
                +L+IY+F+  GSL    H   G +   L W  R  I  G A+ L+Y+H+   +H N
Sbjct: 744  TTSLQLLIYEFLSGGSLYKQLHEAPGGNSS-LSWNDRFNIILGTAKCLAYLHQSNIIHYN 802

Query: 697  LKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSAVS 518
            +K SN+LLD+  EPKVGD+GL RL+                          D +  S   
Sbjct: 803  IKSSNVLLDSSGEPKVGDYGLARLL-----------------------PMLDRYVLS--- 836

Query: 517  GGHTPSPSPSALGISPYIAPE-SLRSLKPNPKWDVFSFGVVLLELLTGK----IIVSDEM 353
                 S   SALG   Y+APE + R++K   K DV+ FGV++LE++TGK     +  D +
Sbjct: 837  -----SKIQSALG---YMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDDVV 888

Query: 352  VPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVVQ 173
            V    V    E  +     D  ++                   C S VP  RP M E V 
Sbjct: 889  VLCDMVREALEDGRADECIDPRLQGKFPVEEAVAVIKLGLI--CTSQVPSSRPHMGEAVN 946

Query: 172  AL 167
             L
Sbjct: 947  IL 948



>pir|T49038|T49038 hypothetical protein T5P19.20 - Arabidopsis
            thaliana>gb:AB076906_1523529 Arabidopsis thaliana IRK
            mRNA for inflorescence and root apices receptor-like
            kinase, complete cds.>gb:AB076907_1523530 Arabidopsis
            thaliana IRK gene for inflorescence and root apices
            receptor-like kinase, complete cds.>gb:ATT5P19_1556242
            Arabidopsis thaliana DNA chromosome 3, BAC clone T5P19.
          Length = 964

 Score =  135 bits (340), Expect = 2e-30
 Identities = 98/302 (32%), Positives = 145/302 (48%), Gaps = 6/302 (1%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIRGFYW 878
            LG  G   +Y+TV+ DG  +A++++  S L + + EFE +++ + KL H NLV++ G+YW
Sbjct: 684  LGRGGFGAVYRTVIRDGYPVAIKKLTVSSLVKSQDEFEREVKKLGKLRHSNLVKLEGYYW 743

Query: 877  GADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKHVHGN 698
                +L+IY+F+  GSL    H   G +   L W  R  I  G A+ L+Y+H+   +H N
Sbjct: 744  TTSLQLLIYEFLSGGSLYKQLHEAPGGNSS-LSWNDRFNIILGTAKCLAYLHQSNIIHYN 802

Query: 697  LKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSAVS 518
            +K SN+LLD+  EPKVGD+GL RL+                          D +  S   
Sbjct: 803  IKSSNVLLDSSGEPKVGDYGLARLL-----------------------PMLDRYVLS--- 836

Query: 517  GGHTPSPSPSALGISPYIAPE-SLRSLKPNPKWDVFSFGVVLLELLTGK----IIVSDEM 353
                 S   SALG   Y+APE + R++K   K DV+ FGV++LE++TGK     +  D +
Sbjct: 837  -----SKIQSALG---YMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKKPVEYMEDDVV 888

Query: 352  VPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVVQ 173
            V    V    E  +     D  ++                   C S VP  RP M E V 
Sbjct: 889  VLCDMVREALEDGRADECIDPRLQGKFPVEEAVAVIKLGLI--CTSQVPSSRPHMGEAVN 946

Query: 172  AL 167
             L
Sbjct: 947  IL 948



>pir|B84659|B84659 probable receptor-like protein kinase, ERECTA
            [imported] - Arabidopsis thaliana>gb:AC004484_1531781
            Arabidopsis thaliana chromosome 2 clone T1D16 map B68,
            complete sequence.>gb:ATHER_1553162 Arabidopsis thaliana
            DNA for receptor protein kinase, complete
            cds.>gb:ATU47029_1557030 Arabidopisis thaliana ERECTA
            mRNA, complete cds.>gb:AY035110_1559881 Arabidopsis
            thaliana putative receptor protein kinase, ERECTA
            (At2g26330) mRNA, complete cds.
          Length = 976

 Score =  135 bits (340), Expect = 2e-30
 Identities = 93/301 (30%), Positives = 144/301 (47%), Gaps = 3/301 (0%)
 Frame = -2

Query: 1060 YILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFY 881
            YI+G   SS +YK VL +   +A++R+        ++FE ++ ++S + H NLV ++ + 
Sbjct: 652  YIIGHGASSTVYKCVLKNCKPVAIKRLYSHNPQSMKQFETELEMLSSIKHRNLVSLQAYS 711

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KH 710
                  L+ YD++ NGSL +  H  G +  + L W+ RLKIA G A+GL+Y+H     + 
Sbjct: 712  LSHLGSLLFYDYLENGSLWDLLH--GPTKKKTLDWDTRLKIAYGAAQGLAYLHHDCSPRI 769

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K SNILLD D+E ++ DFG+ + +                               
Sbjct: 770  IHRDVKSSNILLDKDLEARLTDFGIAKSL------------------------------- 798

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMV 350
              VS  HT   S   +G   YI PE  R+ +   K DV+S+G+VLLELLT +  V DE  
Sbjct: 799  -CVSKSHT---STYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESN 854

Query: 349  PGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVVQA 170
                +M     ++V+ MAD  I +                  C    P  RPTM +V + 
Sbjct: 855  LHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALL-CTKRQPNDRPTMHQVTRV 913

Query: 169  L 167
            L
Sbjct: 914  L 914



>gb:AY048200_1561662 Arabidopsis thaliana At1g71830/F14O23_24 mRNA,
            complete cds.>gb:BT002217_1635820 Arabidopsis thaliana
            At1g71830/F14O23_24 mRNA, complete cds.
          Length = 625

 Score =  135 bits (339), Expect = 2e-30
 Identities = 100/309 (32%), Positives = 156/309 (50%), Gaps = 11/309 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIRGFY 881
            ILG  G   +YK  L DGT +AV+R+ E        +F+ ++ +IS  VH NL+R+RGF 
Sbjct: 307  ILGRGGFGKVYKGRLADGTLIAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFC 366

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KH 710
                E+L++Y ++ NGS+A+ C R+   S   L W  R +IA G ARGLSY+H+    K 
Sbjct: 367  MTPTERLLVYPYMANGSVAS-CLRERPPSQPPLDWPTRKRIALGSARGLSYLHDHCDPKI 425

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLD + E  VGDFGL +L+                         +D+   
Sbjct: 426  IHRDVKAANILLDEEFEAVVGDFGLAKLM-----------------------DYKDTHVT 462

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG-------KI 371
            +AV G          +G   +IAPE L + K + K DVF +G++LLEL+TG       ++
Sbjct: 463  TAVRG---------TIG---HIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARL 510

Query: 370  IVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
               D+++    V G+ ++ K+  + D  ++ +                 C    P +RP 
Sbjct: 511  ANDDDVMLLDWVKGLLKEKKLEMLVDPDLQTNYEERELEQVIQVALL--CTQGSPMERPK 568

Query: 190  MKEVVQALD 164
            M EVV+ L+
Sbjct: 569  MSEVVRMLE 577



>gb:ATAC010871_1543204 Arabidopsis thaliana chromosome III BAC T16O11
            genomic sequence, complete sequence.
          Length = 693

 Score =  135 bits (339), Expect = 2e-30
 Identities = 93/308 (30%), Positives = 149/308 (48%), Gaps = 7/308 (2%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYW 878
            I+G  G  I+Y+  L     +AV+++  + L   REF  +I  + +L H NLV ++G+  
Sbjct: 373  IIGTGGFGIVYRGNLSSSGPIAVKKITSNSLQGVREFMAEIESLGRLGHKNLVNLQGWCK 432

Query: 877  GADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---V 707
              +E L+IYD++PNGSL +  ++    +   LPW+VR +I +G+A GL Y+HE+     V
Sbjct: 433  HKNELLLIYDYIPNGSLDSLLYQTPRRNGIVLPWDVRFEIIKGIASGLLYLHEEWEQIVV 492

Query: 706  HGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDS 527
            H ++KPSN+L+D DM  K+GDFGL RL   G                             
Sbjct: 493  HRDVKPSNVLIDEDMNAKLGDFGLARLYERG----------------------------- 523

Query: 526  AVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG-KIIVSDEMV 350
                  T + +   +G   Y+APE  R+ K +   DVF+FGV+LLE++ G K   ++   
Sbjct: 524  ------TLTQTTKIVGTLGYMAPELTRNGKGSTASDVFAFGVLLLEIVCGNKPTNAENFF 577

Query: 349  PGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVVQA 170
                VM       +L + D  + +                  C    P+ RP+M+ V++ 
Sbjct: 578  LADWVMEFHTNGGILCVVDQNLGSSFNGREAKLALVVGLL--CCHQKPKFRPSMRMVLRY 635

Query: 169  L---DNIP 155
            L   +N+P
Sbjct: 636  LNGEENVP 643



>gb:AP004121_1837906 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1442_E05.
          Length = 1060

 Score =  134 bits (338), Expect = 3e-30
 Identities = 102/314 (32%), Positives = 152/314 (48%), Gaps = 14/314 (4%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYW 878
            I+G  G  ++Y+  L DG  +AV+R+        REF  ++  +S++ H NLV ++G+  
Sbjct: 781  IVGCGGFGMVYRATLADGREVAVKRLSGDFWQMEREFRAEVETLSRVRHRNLVTLQGYCR 840

Query: 877  GADEKLVIYDFVPNGSLANACHRK----GGSSHRHLPWEVRLKIARGVARGLSYIH---E 719
               ++L+IY ++ NGSL +  H +    GG +   LPW  RL IARG ARGL+++H   E
Sbjct: 841  VGKDRLLIYPYMENGSLDHWLHERADVEGGGA---LPWPARLSIARGAARGLAHLHATSE 897

Query: 718  KKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDS 539
             + +H ++K SNILLDA +EP++ DFGL RLV A  ++                      
Sbjct: 898  PRVLHRDIKSSNILLDARLEPRLADFGLARLVRAHDDT---------------------- 935

Query: 538  FPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSD 359
                     H  +     LG   YI PE   S     + DV+S GVVLLEL+TG+  V  
Sbjct: 936  ---------HVTTDLVGTLG---YIPPEYGHSSVATYRGDVYSLGVVLLELVTGRRPVD- 982

Query: 358  EMVPGPPVMGVEEKSKVLRM-----ADVAIRADMXXXXXXXXX--XXXXGYNCISPVPQK 200
              +  P   G +  S  LRM      D  + A +                  C+S  P+ 
Sbjct: 983  --MARPAGGGRDVTSWALRMRREARGDEVVDASVGERRHRDEACRVLDVACACVSDNPKS 1040

Query: 199  RPTMKEVVQALDNI 158
            RPT +++V+ LD I
Sbjct: 1041 RPTAQQLVEWLDAI 1054



>gb:AP004087_1837530 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1297_C09.
          Length = 523

 Score =  134 bits (338), Expect = 3e-30
 Identities = 94/303 (31%), Positives = 139/303 (45%), Gaps = 9/303 (2%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYW 878
            +LGA G   +YK   + G   AV+R G  G D  +EFEN++ ++  + H N+V + GF  
Sbjct: 207  LLGAGGFGCVYKANFEGGLVAAVKRFGHRGQDCEKEFENELDLLGSIRHLNIVSLLGFCI 266

Query: 877  GADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---V 707
              + + ++Y+ + NGSL    H  G S    L W +R+KIA   ARGL Y+HE  +   +
Sbjct: 267  HEENRFIVYELMENGSLEAQLH--GPSHGSALSWHIRMKIALDTARGLEYLHEHCNPPVI 324

Query: 706  HGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDS 527
            H +LK SNILLD+D   K+ DFGL                                    
Sbjct: 325  HRDLKSSNILLDSDFNAKISDFGL------------------------------------ 348

Query: 526  AVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSD---- 359
            AV+ G+    S    G   Y+APE L   K   K DV++FGVVLLELL G+  V      
Sbjct: 349  AVTSGNHSKGSLKLSGTLGYVAPEYLLDGKLTEKSDVYAFGVVLLELLLGRRPVEKTAQS 408

Query: 358  --EMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMK 185
              + +    +  + ++SK+  + D  I+  M                C+ P P  RP + 
Sbjct: 409  QCQSIVTWAMPQLTDRSKLPNIIDPMIKNTMDLKHLYQVAAVAVL--CVQPEPSYRPLIT 466

Query: 184  EVV 176
            +V+
Sbjct: 467  DVI 469



>gb:AP004014_1836377 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OJ1606_D04.>gb:AP006172_1861345 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OSJNBa0088O14.
          Length = 647

 Score =  134 bits (338), Expect = 3e-30
 Identities = 97/308 (31%), Positives = 145/308 (47%), Gaps = 9/308 (2%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTA-LAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFY 881
            ILG  G   +YK VL D    +A++RV        +EF  +I  I ++ H NLV++ G+ 
Sbjct: 331  ILGVGGFGKVYKGVLPDSKLEVAIKRVSHESKQGIKEFIAEIVSIGRIRHRNLVQLLGYC 390

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH--- 710
               DE L++YD++PNGSL    H K G     L W  R +I RGVA GL Y+HEK     
Sbjct: 391  RRKDELLLVYDYMPNGSLDKYLHCKEGK--YTLDWAKRFQIIRGVASGLFYLHEKWEKVV 448

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K SN+LLDA+M   +GDFGL RL   G +                          
Sbjct: 449  IHRDIKASNVLLDAEMNGHLGDFGLARLYEHGNDPQ------------------------ 484

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMV 350
                       +    G   YIAPE  R+ K +P  DV++F + +LE+  G+  +++   
Sbjct: 485  -----------TTHVAGTFGYIAPEMARTGKASPLTDVYAFAIFVLEVTCGRRPINNYTH 533

Query: 349  PGPPVM---GVE--EKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMK 185
              P ++    VE  +K  +    DV ++ D                 C +P+  +RP M+
Sbjct: 534  DSPTILVDWVVEHWQKGSLTSTLDVRLQGDHNADEVNLVLKLGLL--CANPICTRRPGMR 591

Query: 184  EVVQALDN 161
            +V+Q LDN
Sbjct: 592  QVMQYLDN 599



>gb:AP000816_1820640 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, clone:P0503G09.
          Length = 708

 Score =  134 bits (338), Expect = 3e-30
 Identities = 101/310 (32%), Positives = 148/310 (47%), Gaps = 13/310 (4%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYW 878
            +LG  G   ++K VL DGTA+A++++   G    +EF  ++ ++S+L H NLV++ G+Y 
Sbjct: 372  MLGEGGFGRVFKGVLTDGTAVAIKKLTSGGHQGDKEFLVEVEMLSRLHHRNLVKLIGYYS 431

Query: 877  G--ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH-- 710
               + + L+ Y+ VPNGSL    H   G+S R L W+ R++IA   ARGL+Y+HE     
Sbjct: 432  NRESSQNLLCYELVPNGSLEAWLHGTLGAS-RPLDWDTRMRIALDAARGLAYLHEDSQPC 490

Query: 709  -VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFP 533
             +H + K SNILL+ D   KV DFGL +    G            N+ S R         
Sbjct: 491  VIHRDFKASNILLEDDFHAKVSDFGLAKQAPEG----------CTNYLSTR--------- 531

Query: 532  DSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEM 353
                            +G   Y+APE   +     K DV+S+GVVLLELLTG+  V    
Sbjct: 532  ---------------VMGTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLTGRRPVDMSQ 576

Query: 352  VPGP--------PVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKR 197
              G         P++   +K  +  +AD  +                    C+SP   +R
Sbjct: 577  PSGQENLVTWARPIL--RDKDTLEELADPKLGGQYPKDDFVRVCTIAAA--CVSPEASQR 632

Query: 196  PTMKEVVQAL 167
            PTM EVVQ+L
Sbjct: 633  PTMGEVVQSL 642



>gb:AC134344_1741739 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OSJNBb0059K16, complete sequence.
          Length = 640

 Score =  134 bits (338), Expect = 3e-30
 Identities = 97/309 (31%), Positives = 146/309 (47%), Gaps = 9/309 (2%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYW 878
            +LGA G   +Y+ VL DGT +AV+           +  N++RV+S++ H +LVR+ G   
Sbjct: 353  LLGAGGYGEVYRGVLADGTVVAVKCAKLGNTKSTEQVLNEVRVLSQVNHRSLVRLLGCCV 412

Query: 877  GADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIH---EKKHV 707
              ++ L++Y+F+PNG+LA+  H  G  SH  LPW  RL IA   A+G++Y+H        
Sbjct: 413  DLEQPLMVYEFIPNGTLAD--HLYGPLSHPPLPWRRRLAIAHHTAQGIAYLHFSAVPPIY 470

Query: 706  HGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDS 527
            H ++K SNILLD  M+ KV DFGL RL   G                             
Sbjct: 471  HRDIKSSNILLDERMDGKVSDFGLSRLAEQG----------------------------- 501

Query: 526  AVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIV-----S 362
                      S  A G   Y+ PE  R+ +   K DV+SFGVVLLELLT K  +     +
Sbjct: 502  ------LSHVSTCAQGTLGYLDPEYYRNYQLTDKSDVYSFGVVLLELLTCKRAIDFGRGA 555

Query: 361  DEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXX-XXXXXXXXXGYNCISPVPQKRPTMK 185
            D++     V    E+ +++ + D  ++ +                  C+    Q RP+MK
Sbjct: 556  DDVNLAVHVQRAAEEERLMDVVDPVLKDNATQLQCDTIKALGFLALGCLEERRQNRPSMK 615

Query: 184  EVVQALDNI 158
            EV + ++ I
Sbjct: 616  EVAEEIEYI 624



>gb:AY632360_1618711 Gossypium hirsutum BAC 106I22, complete sequence.
          Length = 618

 Score =  134 bits (338), Expect = 3e-30
 Identities = 99/316 (31%), Positives = 150/316 (47%), Gaps = 13/316 (4%)
 Frame = -2

Query: 1066 SAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRG 887
            S  ILG  G  ++YK  L + + +AV+R+ +       +F+ ++ +I   +H NL+R+ G
Sbjct: 299  SKNILGQGGYGVVYKGCLPNRSVVAVKRLKDPNFTGEVQFQTEVEMIGLALHRNLLRLYG 358

Query: 886  FYWGADEKLVIYDFVPNGSLA----NACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE 719
            F    DE+L++Y ++PNGS+A    +ACH K       L W  R+ IA G ARGL Y+HE
Sbjct: 359  FCMTPDERLLVYPYMPNGSVADRLRDACHGKPA-----LNWSRRMHIALGAARGLLYLHE 413

Query: 718  K---KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTAS 548
            +   K +H ++K +NILLD   E  VGDFGL +L+                         
Sbjct: 414  QCNPKIIHRDVKAANILLDESFEAVVGDFGLAKLL-----------------------DK 450

Query: 547  RDSFPDSAVSG--GHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
            RDS   +AV G  GH              IAPE L + + + K DVF FG++LLEL+TG+
Sbjct: 451  RDSHVTTAVRGTVGH--------------IAPEYLSTGQSSEKTDVFGFGILLLELITGQ 496

Query: 373  --IIVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMX--XXXXXXXXXXXXGYNCISPVP 206
              +   +  V    ++         R  +V +  D+                  C  P P
Sbjct: 497  KTLDAGNGQVQKGMILDWVRTLHEERRLEVLVDRDLQGCFDTIELETVTELALQCTRPQP 556

Query: 205  QKRPTMKEVVQALDNI 158
              RP M EV++ L+ +
Sbjct: 557  HLRPKMSEVLKVLEGL 572



>gb:A67827_1450282 Sequence 32 from Patent
            WO9743427.>gb:CQ768543_1451789 Sequence 38 from Patent
            WO2004007712.>gb:AX120037_1461704 Sequence 20 from Patent
            WO0129240.>gb:AX138071_1462207 Sequence 17 from Patent
            EP1094113.
          Length = 625

 Score =  134 bits (338), Expect = 3e-30
 Identities = 100/309 (32%), Positives = 156/309 (50%), Gaps = 11/309 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIRGFY 881
            ILG  G   +YK  L DGT +AV+R+ E        +F+ ++ +IS  VH NL+R+RGF 
Sbjct: 307  ILGRGGFGKVYKGRLADGTLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFC 366

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KH 710
                E+L++Y ++ NGS+A+ C R+   S   L W  R +IA G ARGLSY+H+    K 
Sbjct: 367  MTPTERLLVYPYMANGSVAS-CLRERPPSQPPLDWPTRKRIALGSARGLSYLHDHCDPKI 425

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLD + E  VGDFGL +L+                         +D+   
Sbjct: 426  IHRDVKAANILLDEEFEAVVGDFGLAKLM-----------------------DYKDTHVT 462

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG-------KI 371
            +AV G          +G   +IAPE L + K + K DVF +G++LLEL+TG       ++
Sbjct: 463  TAVRG---------TIG---HIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARL 510

Query: 370  IVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
               D+++    V G+ ++ K+  + D  ++ +                 C    P +RP 
Sbjct: 511  ANDDDVMLLDWVKGLLKEKKLEMLVDPDLQTNYEERELEQVIQVALL--CTQGSPMERPK 568

Query: 190  MKEVVQALD 164
            M EVV+ L+
Sbjct: 569  MSEVVRMLE 577



>pir|H96740|H96740 hypothetical protein F14O23.21 [imported] -
            Arabidopsis thaliana>gb:AE005173_894730 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:F14O23_1677509 Arabidopsis thaliana
            chromosome 1 BAC F14O23 sequence, complete sequence.
          Length = 601

 Score =  134 bits (338), Expect = 3e-30
 Identities = 100/309 (32%), Positives = 156/309 (50%), Gaps = 11/309 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIRGFY 881
            ILG  G   +YK  L DGT +AV+R+ E        +F+ ++ +IS  VH NL+R+RGF 
Sbjct: 283  ILGRGGFGKVYKGRLADGTLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFC 342

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KH 710
                E+L++Y ++ NGS+A+ C R+   S   L W  R +IA G ARGLSY+H+    K 
Sbjct: 343  MTPTERLLVYPYMANGSVAS-CLRERPPSQPPLDWPTRKRIALGSARGLSYLHDHCDPKI 401

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLD + E  VGDFGL +L+                         +D+   
Sbjct: 402  IHRDVKAANILLDEEFEAVVGDFGLAKLM-----------------------DYKDTHVT 438

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG-------KI 371
            +AV G          +G   +IAPE L + K + K DVF +G++LLEL+TG       ++
Sbjct: 439  TAVRG---------TIG---HIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARL 486

Query: 370  IVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
               D+++    V G+ ++ K+  + D  ++ +                 C    P +RP 
Sbjct: 487  ANDDDVMLLDWVKGLLKEKKLEMLVDPDLQTNYEERELEQVIQVALL--CTQGSPMERPK 544

Query: 190  MKEVVQALD 164
            M EVV+ L+
Sbjct: 545  MSEVVRMLE 553



>sp|P43298|TMK1_ARATH Putative receptor protein kinase TMK1 precursor
            (EC 2.7.1.-).>pir|JQ1674|JQ1674 protein kinase TMK1 (EC
            2.7.1.-), receptor type precursor - Arabidopsis
            thaliana>gb:AE005173_894263 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:AC026480_1539648 Arabidopsis thaliana
            chromosome 1 BAC F15E12 genomic sequence, complete
            sequence.>gb:ATHTMK_1553431 Arabidopsis thaliana protein
            kinase (TMK1) gene, complete cds.
          Length = 942

 Score =  134 bits (338), Expect = 3e-30
 Identities = 100/319 (31%), Positives = 156/319 (48%), Gaps = 15/319 (4%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGL---DRFREFENQIRVISKLVHPNLV 899
            +S  ILG+ G  ++YK  L DGT +AV+R+ E+G+     F EF+++I V++K+ H +LV
Sbjct: 589  SSDNILGSGGFGVVYKGELHDGTKIAVKRM-ENGVIAGKGFAEFKSEIAVLTKVRHRHLV 647

Query: 898  RIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE 719
             + G+    +EKL++Y+++P G+L+           + L W+ RL +A  VARG+ Y+H 
Sbjct: 648  TLLGYCLDGNEKLLVYEYMPQGTLSRHLFEWSEEGLKPLLWKQRLTLALDVARGVEYLHG 707

Query: 718  KKH---VHGNLKPSNILLDADMEPKVGDFGLERLVVAG-GESSRKVYGSSRNFGSKRSTA 551
              H   +H +LKPSNILL  DM  KV DFGL RL   G G    ++ G+   FG      
Sbjct: 708  LAHQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPEGKGSIETRIAGT---FG------ 758

Query: 550  SRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKI 371
                                       Y+APE   + +   K DV+SFGV+L+EL+TG+ 
Sbjct: 759  ---------------------------YLAPEYAVTGRVTTKVDVYSFGVILMELITGRK 791

Query: 370  IVSDEMVPGPPV--------MGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCIS 215
             + DE  P   +        M + +++   +  D  I  D              G+ C +
Sbjct: 792  SL-DESQPEESIHLVSWFKRMYINKEASFKKAIDTTIDLDEETLASVHTVAELAGH-CCA 849

Query: 214  PVPQKRPTMKEVVQALDNI 158
              P +RP M   V  L ++
Sbjct: 850  REPYQRPDMGHAVNILSSL 868



>gb:AP005810_1858257 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC clone:P0696F12.
          Length = 638

 Score =  134 bits (337), Expect = 4e-30
 Identities = 88/230 (38%), Positives = 121/230 (52%), Gaps = 3/230 (1%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            LG  G   +YK VL DG  +AV+R+ +S      E +N++ +++KL H NLV + G    
Sbjct: 332  LGEGGFGAVYKGVLPDGYEIAVKRLSKSSTQGVEELKNELALVAKLKHKNLVSLVGVCLE 391

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KHVH 704
              E+L++Y+FVPN SL         S    L WE R KI  G+ARGL Y+HE    K VH
Sbjct: 392  QQERLLVYEFVPNRSLDLILFDTEKSEQ--LDWEKRYKIINGIARGLQYLHEDSQLKVVH 449

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             +LK SNILLD +M PK+ DFGL R+                 FG       RD      
Sbjct: 450  RDLKASNILLDVNMNPKISDFGLARI-----------------FG-------RDQ----- 480

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                 T + + + +G   Y+APE L     + K DVFSFGV++LE++TG+
Sbjct: 481  -----TQAVTKNVIGTYGYMAPEYLTRGNYSVKSDVFSFGVMVLEIVTGR 525



>gb:OSJN00019_1693370 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0043L09, complete sequence.
          Length = 827

 Score =  134 bits (337), Expect = 4e-30
 Identities = 94/309 (30%), Positives = 145/309 (46%), Gaps = 7/309 (2%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYW 878
            +LG  G   +YK +LDDG  +A++R+ +       EF N++ +I+KL H NLVR+ G+  
Sbjct: 525  MLGQGGFGKVYKGMLDDGKEVAIKRLSKGSGQGAEEFRNEVVLIAKLQHRNLVRLLGYCI 584

Query: 877  GADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---V 707
              DEKL+IY+++PN SL         ++   L W  R KI +GVARGL Y+H+      +
Sbjct: 585  YGDEKLLIYEYLPNKSLDAFIFDH--ANKYVLDWPTRFKIIKGVARGLLYLHQDSRLTVI 642

Query: 706  HGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDS 527
            H +LKPSNILLD DM PK+ DFG+ R+                 FG  +  A+ +     
Sbjct: 643  HRDLKPSNILLDVDMSPKISDFGMARI-----------------FGGNQHEANTNR---- 681

Query: 526  AVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMVP 347
                          +G   Y++PE       + K D +SFGV+LLE+++   I    +  
Sbjct: 682  -------------VVGTYGYMSPEYAMDGAFSVKSDTYSFGVILLEIVSCLKISLPRLTD 728

Query: 346  GPPVM----GVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEV 179
             P ++     + +  + + + D +I                    C+   P  RP M  V
Sbjct: 729  FPNLLAYAWNLWKNDRAMDLMDSSISKSCSPTEVLLCIQIGLL--CVQDNPNNRPLMSSV 786

Query: 178  VQALDNIPT 152
            V  L+N  T
Sbjct: 787  VSMLENETT 795



>gb:AY632359_1618697 Gossypium hirsutum BAC 155C17, complete sequence.
          Length = 618

 Score =  134 bits (337), Expect = 4e-30
 Identities = 98/313 (31%), Positives = 149/313 (47%), Gaps = 13/313 (4%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYW 878
            ILG  G  ++YK  L + + +AV+R+ +       +F+ ++ +I   +H NL+R+ GF  
Sbjct: 302  ILGQGGYGVVYKGCLPNRSVVAVKRLKDPNFTGEVQFQTEVEMIGLALHRNLLRLYGFCM 361

Query: 877  GADEKLVIYDFVPNGSLA----NACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK-- 716
              DE+L++Y ++PNGS+A    +ACH K       L W  R+ IA G ARGL Y+HE+  
Sbjct: 362  TPDERLLVYPYMPNGSVADRLRDACHGKPA-----LNWSRRMHIALGAARGLLYLHEQCN 416

Query: 715  -KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDS 539
             K +H ++K +NILLD   E  VGDFGL +L+                         RDS
Sbjct: 417  PKIIHRDVKAANILLDESFEAVVGDFGLAKLL-----------------------DKRDS 453

Query: 538  FPDSAVSG--GHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK--I 371
               +AV G  GH              IAPE L + + + K DVF FG++LLEL+TG+  +
Sbjct: 454  HVTTAVRGTVGH--------------IAPEYLSTGQSSEKTDVFGFGILLLELITGQKTL 499

Query: 370  IVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMX--XXXXXXXXXXXXGYNCISPVPQKR 197
               +  V    ++         R  +V +  D+                  C  P P  R
Sbjct: 500  DAGNGQVQKGMILDWVRTLHEERRLEVLVDRDLQGCFDTIELETVTELALQCTRPQPHLR 559

Query: 196  PTMKEVVQALDNI 158
            P M EV++ L+ +
Sbjct: 560  PKMSEVLKVLEGL 572



>gb:AE005173_894080 Arabidopsis thaliana chromosome 1, bottom arm
            complete sequence.>gb:AC007764_1536165 Genomic sequence
            for Arabidopsis thaliana BAC F22C12 from chromosome I,
            complete sequence.
          Length = 587

 Score =  134 bits (337), Expect = 4e-30
 Identities = 98/314 (31%), Positives = 145/314 (46%), Gaps = 10/314 (3%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            +SA +LG       YK  ++D + + V+R+ E  + R REFE Q+ +I  + H N+  ++
Sbjct: 308  SSAEVLGKGAFGTTYKVTMEDMSTVVVKRLKEVVVGR-REFEQQMEIIGMIRHENVAELK 366

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHR-HLPWEVRLKIARGVARGLSYIHEKK 713
             +Y+  D+KL +Y +  +GSL    H   G  HR  L W+ RL+IA G ARGL+ IHE K
Sbjct: 367  AYYYSKDDKLAVYSYYNHGSLFEILHGNRGRYHRVPLDWDARLRIATGAARGLAKIHEGK 426

Query: 712  HVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFP 533
             +HGN+K SNI LD+     +GD GL                          T    S P
Sbjct: 427  FIHGNIKSSNIFLDSQCYGCIGDVGL--------------------------TTIMRSLP 460

Query: 532  DSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSD-E 356
             +                 S Y APE   + +     DV+SFGVVLLELLTGK  VS  E
Sbjct: 461  QTTCL-------------TSGYHAPEITDTRRSTQFSDVYSFGVVLLELLTGKSPVSQAE 507

Query: 355  MVP--------GPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQK 200
            +VP           +  V  K     + D+ I +               G  C++   Q+
Sbjct: 508  LVPTGGENMDLASWIRSVVAKEWTGEVFDMEILSQSGGFEEEMVEMLQIGLACVALKQQE 567

Query: 199  RPTMKEVVQALDNI 158
            RP + +V++ +++I
Sbjct: 568  RPHIAQVLKLIEDI 581



>gb:AF084037_1767054 Arabidopsis thaliana receptor-like protein kinase
            (RKC1) gene, complete cds.
          Length = 684

 Score =  134 bits (336), Expect = 5e-30
 Identities = 97/305 (31%), Positives = 148/305 (48%), Gaps = 9/305 (2%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            LGA G   +YK +L +GT +AV+R+ ++      EF+N++ V++KL H NLVR+ GF   
Sbjct: 363  LGAGGFGEVYKGMLLNGTEIAVKRLSKTSGQGEIEFKNEVVVVAKLQHINLVRLLGFSLQ 422

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KHVH 704
             +EKL++Y+FVPN SL         +    L W VR  I  G+ RG+ Y+H+    K +H
Sbjct: 423  GEEKLLVYEFVPNKSLDYFLFDP--NKRNQLDWTVRRNIIGGITRGILYLHQDSRLKIIH 480

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             +LK SNILLDADM PK+ DFG+ R+                 FG  ++ A+        
Sbjct: 481  RDLKASNILLDADMNPKIADFGMARI-----------------FGVDQTVAN-------- 515

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMVPG 344
                     +   +G   Y++PE +   + + K DV+SFGV++LE+++GK   S   + G
Sbjct: 516  ---------TARVVGTFGYMSPEYVTHGQFSMKSDVYSFGVLILEIISGKKNSSFYQMDG 566

Query: 343  ------PPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKE 182
                    V  + E   +  + D  I+ D                 C+   P  RPTM  
Sbjct: 567  LVNNLVTYVWKLWENKTMHELIDPFIKEDCKSDEVIRYVHIGLL--CVQENPADRPTMST 624

Query: 181  VVQAL 167
            + Q L
Sbjct: 625  IHQVL 629



>gb:AC104427_1737594 Oryza sativa (japonica cultivar-group) chromosome
            3 clone OJ1015F07, complete sequence.
          Length = 891

 Score =  134 bits (336), Expect = 5e-30
 Identities = 100/314 (31%), Positives = 152/314 (48%), Gaps = 12/314 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIRGFY 881
            ++G      +YK   ++G ++AV+++   G  R + EFE ++  +  L HPNLV  +G+Y
Sbjct: 611  LVGGGSVGTVYKATFENGLSIAVKKLETLGRVRSQDEFEQEMGQLGNLSHPNLVAFQGYY 670

Query: 880  WGADEKLVIYDFVPNGSLANACHR-----KGGSSHRHLPWEVRLKIARGVARGLSYIH-- 722
            W +  +L++ +F+ NGSL +  H       G SS   L WE R K+A G AR L+Y+H  
Sbjct: 671  WSSSTQLILSEFMVNGSLYDHLHGSPHTFSGSSSRVGLSWEQRFKVALGTARALAYLHHD 730

Query: 721  -EKKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASR 545
               + +H N+K SNI+LD D E K+ D+G  +L+                          
Sbjct: 731  CRPQVLHLNIKSSNIMLDKDFEAKLSDYGFGKLL-------------------------- 764

Query: 544  DSFPDSAVSGGHTPSPSPSALGISPYIAPE-SLRSLKPNPKWDVFSFGVVLLELLTGKII 368
                   + G +  S   +A+G   YIAPE +  SL+ + K DVFSFGVVLLE++TG+  
Sbjct: 765  ------PILGSYELSRLHAAIG---YIAPELASPSLRYSDKSDVFSFGVVLLEIVTGRKP 815

Query: 367  VSDEMVPGPPVMG--VEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRP 194
            V    V    V+   V    +   ++D   R+               G  C S  P  RP
Sbjct: 816  VESPGVATAVVLRDYVRAILEDGTVSDCFDRSMKGFVEAELVQVLKLGLVCTSNTPSARP 875

Query: 193  TMKEVVQALDNIPT 152
             M EVVQ L+++ T
Sbjct: 876  NMAEVVQYLESVRT 889



>gb:PSA495759_1701999 Pisum sativum sym29 gene for serine-threonine
            protein kinase, exons 1-2.
          Length = 976

 Score =  134 bits (336), Expect = 5e-30
 Identities = 97/313 (30%), Positives = 153/313 (48%), Gaps = 12/313 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRR-VGESGLDRFREFENQIRVISKLVHPNLVRIRGFY 881
            I+G  G+ I+Y+  + +GT +A++R VG+        F+ +I  + ++ H N++R+ G+ 
Sbjct: 691  IIGKGGAGIVYRGSMPNGTDVAIKRLVGQGSGRNDYGFKAEIETLGRIRHRNIMRLLGYV 750

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH--- 710
               D  L++Y+++PNGSL    H   G+   HL WE+R KIA    +GL Y+H       
Sbjct: 751  SNKDTNLLLYEYMPNGSLGEWLH---GAKGCHLSWEMRYKIAVEAGKGLCYLHHDCSPLI 807

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLDAD E  V DFGL + +   G S                         
Sbjct: 808  IHRDVKSNNILLDADFEAHVADFGLAKFLYDPGASQSM---------------------- 845

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMV 350
            S+++G +             YIAPE   +LK + K DV+SFGVVLLEL+ G+  V  E  
Sbjct: 846  SSIAGSY------------GYIAPEYAYTLKVDEKSDVYSFGVVLLELIIGRKPVG-EFG 892

Query: 349  PGPPVMGVEEKS--KVLRMADVAIRADMXXXXXXXXXXXXXGY------NCISPVPQKRP 194
             G  ++G   K+  ++ + +D A+ + +              Y       C+  +   RP
Sbjct: 893  DGVDIVGWINKTELELYQPSDKALVSAVVDPRLTGYPMASVIYMFNIAMMCVKEMGPARP 952

Query: 193  TMKEVVQALDNIP 155
            TM+EVV  L N P
Sbjct: 953  TMREVVHMLTNPP 965



>gb:OSJN00072_1694323 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0020J04, complete sequence.
          Length = 1104

 Score =  134 bits (336), Expect = 5e-30
 Identities = 77/235 (32%), Positives = 121/235 (51%), Gaps = 7/235 (2%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLD-----RFREFENQIRVISKLVHPNLVRI 893
            +L      +++K   +DGT LA+ R+  +  D         F  +   + K+ H NL  +
Sbjct: 801  VLSRGRHGLVFKACYNDGTVLAILRLPSTSSDGAVVIEEGSFRKEAESLGKVKHRNLTVL 860

Query: 892  RGFYWGA--DEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE 719
            RG+Y G   D +L++YD++PNG+LA             L W +R  IA GV+RGL+++H+
Sbjct: 861  RGYYAGPPPDVRLLVYDYMPNGNLATLLQEASHQDGHILNWPMRHLIALGVSRGLAFLHQ 920

Query: 718  KKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDS 539
               VHG++KP NIL DAD EP + DFGLE +VV  G                        
Sbjct: 921  SGVVHGDVKPQNILFDADFEPHLSDFGLEPMVVTAG------------------------ 956

Query: 538  FPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
               +A +     + + + +G   Y+AP++  + +   + DV+SFG+VLLELLTG+
Sbjct: 957  ---AAAAAAAASTSATTTVGSLGYVAPDAAAAGQATREGDVYSFGIVLLELLTGR 1008



>gb:AY140033_1582473 Arabidopsis thaliana protein kinase-like protein
            (At4g23250) mRNA, complete cds.
          Length = 608

 Score =  134 bits (336), Expect = 5e-30
 Identities = 97/305 (31%), Positives = 148/305 (48%), Gaps = 9/305 (2%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            LGA G   +YK +L +GT +AV+R+ ++      EF+N++ V++KL H NLVR+ GF   
Sbjct: 287  LGAGGFGEVYKGMLLNGTEIAVKRLSKTSGQGEIEFKNEVVVVAKLQHINLVRLLGFSLQ 346

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KHVH 704
             +EKL++Y+FVPN SL         +    L W VR  I  G+ RG+ Y+H+    K +H
Sbjct: 347  GEEKLLVYEFVPNKSLDYFLFDP--NKRNQLDWTVRRNIIGGITRGILYLHQDSRLKIIH 404

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             +LK SNILLDADM PK+ DFG+ R+                 FG  ++ A+        
Sbjct: 405  RDLKASNILLDADMNPKIADFGMARI-----------------FGVDQTVAN-------- 439

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMVPG 344
                     +   +G   Y++PE +   + + K DV+SFGV++LE+++GK   S   + G
Sbjct: 440  ---------TARVVGTFGYMSPEYVTHGQFSMKSDVYSFGVLILEIISGKKNSSFYQMDG 490

Query: 343  ------PPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKE 182
                    V  + E   +  + D  I+ D                 C+   P  RPTM  
Sbjct: 491  LVNNLVTYVWKLWENKTMHELIDPFIKEDCKSDEVIRYVHIGLL--CVQENPADRPTMST 548

Query: 181  VVQAL 167
            + Q L
Sbjct: 549  IHQVL 553



>gb:AB020746_1514621 Arabidopsis thaliana genomic DNA, chromosome 3,
            P1 clone: MOB24.
          Length = 567

 Score =  134 bits (336), Expect = 5e-30
 Identities = 92/314 (29%), Positives = 154/314 (49%), Gaps = 12/314 (3%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            + A +LG  G   +YK +L++G  +AV+++        +EF+ ++ +IS++ H NLV + 
Sbjct: 272  SEANLLGEGGFGFVYKGILNNGNEVAVKQLKVGSAQGEKEFQAEVNIISQIHHRNLVSLV 331

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK-- 716
            G+     ++L++Y+FVPN +L    H KG  +   + W +RLKIA   ++GLSY+HE   
Sbjct: 332  GYCIAGAQRLLVYEFVPNNTLEFHLHGKGRPT---MEWSLRLKIAVSSSKGLSYLHENCN 388

Query: 715  -KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDS 539
             K +H ++K +NIL+D   E KV DFGL ++ +   +++  V                  
Sbjct: 389  PKIIHRDIKAANILIDFKFEAKVADFGLAKIAL---DTNTHV------------------ 427

Query: 538  FPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK----- 374
                          S   +G   Y+APE   S K   K DV+SFGVVLLEL+TG+     
Sbjct: 428  --------------STRVMGTFGYLAPEYAASGKLTEKSDVYSFGVVLLELITGRRPVDA 473

Query: 373  --IIVSDEMV--PGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVP 206
              +   D +V    P ++   E+S    +AD+ +  +                 C+    
Sbjct: 474  NNVYADDSLVDWARPLLVQALEESNFEGLADIKLNNEYDREEMARMVACAAA--CVRYTA 531

Query: 205  QKRPTMKEVVQALD 164
            ++RP M +VV+ L+
Sbjct: 532  RRRPRMDQVVRVLE 545



>pir|T04842|T04842 protein kinase AK4 (EC 2.7.1.-) - Arabidopsis
            thaliana>gb:ATCHRIV59_1546162 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 59.>gb:ATF21P8_1549627
            Arabidopsis thaliana DNA chromosome 4, BAC clone F21P8
            (ESSA project).
          Length = 998

 Score =  134 bits (336), Expect = 5e-30
 Identities = 97/305 (31%), Positives = 148/305 (48%), Gaps = 9/305 (2%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            LGA G   +YK +L +GT +AV+R+ ++      EF+N++ V++KL H NLVR+ GF   
Sbjct: 346  LGAGGFGEVYKGMLLNGTEIAVKRLSKTSGQGEIEFKNEVVVVAKLQHINLVRLLGFSLQ 405

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KHVH 704
             +EKL++Y+FVPN SL         +    L W VR  I  G+ RG+ Y+H+    K +H
Sbjct: 406  GEEKLLVYEFVPNKSLDYFLFDP--NKRNQLDWTVRRNIIGGITRGILYLHQDSRLKIIH 463

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             +LK SNILLDADM PK+ DFG+ R+                 FG  ++ A+        
Sbjct: 464  RDLKASNILLDADMNPKIADFGMARI-----------------FGVDQTVAN-------- 498

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMVPG 344
                     +   +G   Y++PE +   + + K DV+SFGV++LE+++GK   S   + G
Sbjct: 499  ---------TARVVGTFGYMSPEYVTHGQFSMKSDVYSFGVLILEIISGKKNSSFYQMDG 549

Query: 343  ------PPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKE 182
                    V  + E   +  + D  I+ D                 C+   P  RPTM  
Sbjct: 550  LVNNLVTYVWKLWENKTMHELIDPFIKEDCKSDEVIRYVHIGLL--CVQENPADRPTMST 607

Query: 181  VVQAL 167
            + Q L
Sbjct: 608  IHQVL 612



>pir|T14354|T14354 probable somatic embryogenesis receptor-like kinase
            - carrot>gb:A67797_1450276 Sequence 2 from Patent
            WO9743427.>gb:DCU93048_1675787 Daucus carota somatic
            embryogenesis receptor-like kinase mRNA, complete cds.
          Length = 553

 Score =  134 bits (336), Expect = 5e-30
 Identities = 101/309 (32%), Positives = 154/309 (49%), Gaps = 11/309 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIRGFY 881
            ILG  G   +YK  L DG+ +AV+R+ E        +F+ ++ +IS  VH NL+R+RGF 
Sbjct: 235  ILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFC 294

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KH 710
                E+L++Y ++ NGS+A+ C R+   S   L W  R +IA G ARGLSY+H+    K 
Sbjct: 295  MTPTERLLVYPYMANGSVAS-CLRERQPSEPPLDWPTRKRIALGSARGLSYLHDHCDPKI 353

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLD + E  VGDFGL RL+                         +D+   
Sbjct: 354  IHRDVKAANILLDEEFEAVVGDFGLARLM-----------------------DYKDTHVT 390

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG-------KI 371
            +AV G          LG   YIAPE L + K + K DVF +G++LLEL+TG       ++
Sbjct: 391  TAVRG---------TLG---YIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARL 438

Query: 370  IVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
               D+++    V  + ++ K+  + D  +  +                 C    P +RP 
Sbjct: 439  ANDDDVMLLDWVKSLLKEKKLEMLVDPDLENNYIDTEVEQLIQVALL--CTQGSPMERPK 496

Query: 190  MKEVVQALD 164
            M EVV+ L+
Sbjct: 497  MSEVVRMLE 505



>gb:BT015370_1642198 Arabidopsis thaliana At5g01560 gene, complete
            cds.
          Length = 691

 Score =  133 bits (335), Expect = 6e-30
 Identities = 90/303 (29%), Positives = 146/303 (48%), Gaps = 5/303 (1%)
 Frame = -2

Query: 1057 ILGASGSSIMYK-TVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFY 881
            ++G  G  I+Y+  +      +AV+++  + +   REF  +I  + +L H NLV ++G+ 
Sbjct: 368  VVGTGGFGIVYRGNIRSSSDQIAVKKITPNSMQGVREFVAEIESLGRLRHKNLVNLQGWC 427

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH--- 710
               ++ L+IYD++PNGSL +  + K   S   L W  R +IA+G+A GL Y+HE+     
Sbjct: 428  KHRNDLLLIYDYIPNGSLDSLLYSKPRRSGAVLSWNARFQIAKGIASGLLYLHEEWEQIV 487

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++KPSN+L+D+DM P++GDFGL RL   G +S   V                     
Sbjct: 488  IHRDVKPSNVLIDSDMNPRLGDFGLARLYERGSQSCTTV--------------------- 526

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG-KIIVSDEM 353
                           +G   Y+APE  R+   +   DVF+FGV+LLE+++G K   S   
Sbjct: 527  --------------VVGTIGYMAPELARNGNSSSASDVFAFGVLLLEIVSGRKPTDSGTF 572

Query: 352  VPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVVQ 173
                 VM ++   ++L   D   R                G  C    P+ RP M+ V++
Sbjct: 573  FIADWVMELQASGEILSAIDP--RLGSGYDEGEARLALAVGLLCCHHKPESRPLMRMVLR 630

Query: 172  ALD 164
             L+
Sbjct: 631  YLN 633



>gb:AY188755_1588361 Zea mays atypical receptor-like kinase MARK (ark)
            mRNA, complete cds.
          Length = 694

 Score =  133 bits (335), Expect = 6e-30
 Identities = 98/311 (31%), Positives = 141/311 (45%), Gaps = 7/311 (2%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            ASA +LG       YK VL+ G  +AV+R+ +  L    EF  +I  I +L H  +V +R
Sbjct: 395  ASAEVLGKGAFGTTYKAVLESGATVAVKRLKDVTLSE-AEFRERISEIGELQHEFIVPLR 453

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH 710
             +Y+  DEKL++YDF+P GSL+   H    S    L W++R  IA   ARG+ YIH    
Sbjct: 454  AYYYSKDEKLLVYDFMPMGSLSAVLHGNVSSGRTPLNWDLRSSIALAAARGVEYIHSTTS 513

Query: 709  V--HGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSF 536
               HGN+K SN+LL    + +V + GL  LV                             
Sbjct: 514  TASHGNIKSSNVLLGKSYQARVSENGLTTLV----------------------------- 544

Query: 535  PDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK----II 368
                        PS S+   + Y APE + S + + K DV+SFGV+LLEL+TGK      
Sbjct: 545  -----------GPSSSSSRTTGYRAPEVIDSRRVSQKADVYSFGVLLLELVTGKAPSQAA 593

Query: 367  VSDEMVPGPP-VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
            ++DE V  P  V  V        + D+ +                   +C + VP+ RP+
Sbjct: 594  LNDEGVDLPRWVQSVNRSEWGSLVFDMELMRHQ-TGEEPMAQLVLLAMDCTAQVPEARPS 652

Query: 190  MKEVVQALDNI 158
            M  VV  ++ I
Sbjct: 653  MAHVVMRIEEI 663



>pir|T48177|T48177 receptor like protein kinase - Arabidopsis
            thaliana>gb:ATF7A7_1550908 Arabidopsis thaliana DNA
            chromosome 5, BAC clone F7A7 (ESSA project).
          Length = 685

 Score =  133 bits (335), Expect = 6e-30
 Identities = 90/303 (29%), Positives = 146/303 (48%), Gaps = 5/303 (1%)
 Frame = -2

Query: 1057 ILGASGSSIMYK-TVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFY 881
            ++G  G  I+Y+  +      +AV+++  + +   REF  +I  + +L H NLV ++G+ 
Sbjct: 362  VVGTGGFGIVYRGNIRSSSDQIAVKKITPNSMQGVREFVAEIESLGRLRHKNLVNLQGWC 421

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH--- 710
               ++ L+IYD++PNGSL +  + K   S   L W  R +IA+G+A GL Y+HE+     
Sbjct: 422  KHRNDLLLIYDYIPNGSLDSLLYSKPRRSGAVLSWNARFQIAKGIASGLLYLHEEWEQIV 481

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++KPSN+L+D+DM P++GDFGL RL   G +S   V                     
Sbjct: 482  IHRDVKPSNVLIDSDMNPRLGDFGLARLYERGSQSCTTV--------------------- 520

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG-KIIVSDEM 353
                           +G   Y+APE  R+   +   DVF+FGV+LLE+++G K   S   
Sbjct: 521  --------------VVGTIGYMAPELARNGNSSSASDVFAFGVLLLEIVSGRKPTDSGTF 566

Query: 352  VPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVVQ 173
                 VM ++   ++L   D   R                G  C    P+ RP M+ V++
Sbjct: 567  FIADWVMELQASGEILSAIDP--RLGSGYDEGEARLALAVGLLCCHHKPESRPLMRMVLR 624

Query: 172  ALD 164
             L+
Sbjct: 625  YLN 627



>pir|T05606|T05606 protein kinase homolog F9D16.210 - Arabidopsis
            thaliana>gb:ATCHRIV60_1546257 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 60.>gb:ATF9D16_1551298
            Arabidopsis thaliana DNA chromosome 4, BAC clone F9D16
            (ESSAII project).>gb:BT008579_1639796 Arabidopsis
            thaliana clone U50753 putative leucine-rich repeat
            transmembrane protein kinase (At4g23740) mRNA, complete
            cds.>gb:AK118364_1816347 Arabidopsis thaliana At4g23740
            mRNA for putative receptor kinase, complete cds, clone:
            RAFL19-63-C12.
          Length = 638

 Score =  133 bits (335), Expect = 6e-30
 Identities = 96/312 (30%), Positives = 148/312 (47%), Gaps = 8/312 (2%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            ASA +LG       YK VL+D T++AV+R+ +    + R+FE Q+ +I  + H N+V ++
Sbjct: 338  ASAEVLGKGTFGTTYKAVLEDATSVAVKRLKDVAAGK-RDFEQQMEIIGGIKHENVVELK 396

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK-- 716
             +Y+  DEKL++YD+   GS+A+  H   G +   L WE R+KIA G A+G++ IH++  
Sbjct: 397  AYYYSKDEKLMVYDYFSRGSVASLLHGNRGENRIPLDWETRMKIAIGAAKGIARIHKENN 456

Query: 715  -KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDS 539
             K VHGN+K SNI L+++    V D GL                                
Sbjct: 457  GKLVHGNIKSSNIFLNSESNGCVSDLGL-------------------------------- 484

Query: 538  FPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK----I 371
               +AV     P  S  A     Y APE   + K +   DV+SFGVVLLELLTGK     
Sbjct: 485  ---TAVMSPLAPPISRQA----GYRAPEVTDTRKSSQLSDVYSFGVVLLELLTGKSPIHT 537

Query: 370  IVSDEMVPGPP-VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRP 194
               DE++     V  V  +     + D+ +                   +C+     +RP
Sbjct: 538  TAGDEIIHLVRWVHSVVREEWTAEVFDIEL-LRYTNIEEEMVEMLQIAMSCVVKAADQRP 596

Query: 193  TMKEVVQALDNI 158
             M ++V+ ++N+
Sbjct: 597  KMSDLVRLIENV 608



>gb:AP005742_1856983 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, PAC clone:P0489D11.
          Length = 804

 Score =  133 bits (334), Expect = 8e-30
 Identities = 100/311 (32%), Positives = 146/311 (46%), Gaps = 8/311 (2%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            + AY +G  G   +YK +L  G  +A++R+  +     +EF N++ +I+KL H NLVRI 
Sbjct: 487  SEAYKIGQGGFGKVYKGMLG-GQEVAIKRLSRNSQQGTKEFRNEVILIAKLQHRNLVRIL 545

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH 710
            GF    DEKL+IY+++PN SL        GS    L W  R  I +GVARGL Y+H+   
Sbjct: 546  GFCVEGDEKLLIYEYLPNKSLDATLFN--GSRKLLLDWTTRFNIIKGVARGLLYLHQDSR 603

Query: 709  ---VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDS 539
               +H +LK  NILLDA+M+PK+ DFG+ R+                 FG  +  A+   
Sbjct: 604  LTIIHRDLKAGNILLDAEMKPKIADFGMARI-----------------FGDNQQNAN--- 643

Query: 538  FPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSD 359
                          +   +G   Y+APE       + K DV+SFGV+LLE++TG    S 
Sbjct: 644  --------------TQRVVGTYGYMAPEYAMEGIFSTKSDVYSFGVLLLEVITGMRRNSV 689

Query: 358  EMVPGPP-----VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRP 194
              + G P        + ++ K   +AD +I                    C+   P  RP
Sbjct: 690  SNIMGFPNLIVYAWNMWKEGKTEDLADSSIMDSCLQDEVLLCIHLALL--CVQENPDDRP 747

Query: 193  TMKEVVQALDN 161
             M  VV  L+N
Sbjct: 748  LMPFVVFILEN 758



>gb:BT008409_1639626 Arabidopsis thaliana At3g24600 gene, complete
            cds.>gb:AF370509_1792294 Arabidopsis thaliana protein
            kinase-like protein (MOB24.13) mRNA, complete cds.
          Length = 652

 Score =  133 bits (334), Expect = 8e-30
 Identities = 96/314 (30%), Positives = 150/314 (47%), Gaps = 12/314 (3%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            + A +LG  G   ++K +L  G  +AV+++        REF+ ++ +IS++ H +LV + 
Sbjct: 281  SEANLLGQGGFGYVHKGILPSGKEVAVKQLKAGSGQGEREFQAEVEIISRVHHRHLVSLI 340

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE--- 719
            G+     ++L++Y+FVPN +L    H KG  +   + W  RLKIA G A+GLSY+HE   
Sbjct: 341  GYCMAGVQRLLVYEFVPNNNLEFHLHGKGRPT---MEWSTRLKIALGSAKGLSYLHEDCN 397

Query: 718  KKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDS 539
             K +H ++K SNIL+D   E KV DFGL ++      S    + S+R             
Sbjct: 398  PKIIHRDIKASNILIDFKFEAKVADFGLAKIA-----SDTNTHVSTR------------- 439

Query: 538  FPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK----- 374
                              +G   Y+APE   S K   K DVFSFGVVLLEL+TG+     
Sbjct: 440  -----------------VMGTFGYLAPEYAASGKLTEKSDVFSFGVVLLELITGRRPVDA 482

Query: 373  --IIVSDEMV--PGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVP 206
              + V D +V    P +    E+     +AD  +  +                 C+    
Sbjct: 483  NNVYVDDSLVDWARPLLNRASEEGDFEGLADSKMGNEYDREEMARMVACAAA--CVRHSA 540

Query: 205  QKRPTMKEVVQALD 164
            ++RP M ++V+AL+
Sbjct: 541  RRRPRMSQIVRALE 554



>gb:AB092811_1525116 Glycine max NTS1 gene for LRR receptor-like
            kinase, partial cds.
          Length = 1001

 Score =  133 bits (334), Expect = 8e-30
 Identities = 96/313 (30%), Positives = 153/313 (48%), Gaps = 12/313 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFRE-FENQIRVISKLVHPNLVRIRGFY 881
            I+G  G+ I+Y+  + +GT +A++R+  +G  R    F+ +I  + K+ H N++R+ G+ 
Sbjct: 715  IIGKGGAGIVYRGSMPNGTDVAIKRLVGAGSGRNDYGFKAEIETLGKIRHRNIMRLLGYV 774

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH--- 710
               +  L++Y+++PNGSL    H   G+   HL WE+R KIA   A+GL Y+H       
Sbjct: 775  SNKETNLLLYEYMPNGSLGEWLH---GAKGGHLKWEMRYKIAVEAAKGLCYLHHDCSPLI 831

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLD D+E  V DFGL + +   G S                         
Sbjct: 832  IHRDVKSNNILLDGDLEAHVADFGLAKFLYDPGASQSM---------------------- 869

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMV 350
            S+++G +             YIAPE   +LK + K DV+SFGVVLLEL+ G+  V  E  
Sbjct: 870  SSIAGSY------------GYIAPEYAYTLKVDEKSDVYSFGVVLLELIIGRKPVG-EFG 916

Query: 349  PGPPVMGVEEKSK--VLRMADVAIRADMXXXXXXXXXXXXXGY------NCISPVPQKRP 194
             G  ++G   K++  + + +D A+   +              Y       C+  +   RP
Sbjct: 917  DGVDIVGWVNKTRLELAQPSDAALVLAVVDPRLSGYPLTSVIYMFNIAMMCVKEMGPARP 976

Query: 193  TMKEVVQALDNIP 155
            TM+EVV  L   P
Sbjct: 977  TMREVVHMLSEPP 989



>gb:AB020746_1514623 Arabidopsis thaliana genomic DNA, chromosome 3,
            P1 clone: MOB24.>gb:AY056788_1563837 Arabidopsis thaliana
            AT3g24550/MOB24_8 mRNA, complete cds.>gb:AY059901_1564745
            Arabidopsis thaliana protein kinase-like protein
            (MOB24.13) mRNA, complete cds.>gb:AY093065_1575019
            Arabidopsis thaliana unknown protein (At3g24550) mRNA,
            complete cds.>gb:AY128792_1580872 Arabidopsis thaliana
            protein kinase-like protein mRNA, complete
            cds.>gb:BT008400_1639617 Arabidopsis thaliana At3g24550
            gene, complete cds.
          Length = 652

 Score =  133 bits (334), Expect = 8e-30
 Identities = 96/314 (30%), Positives = 150/314 (47%), Gaps = 12/314 (3%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            + A +LG  G   ++K +L  G  +AV+++        REF+ ++ +IS++ H +LV + 
Sbjct: 281  SEANLLGQGGFGYVHKGILPSGKEVAVKQLKAGSGQGEREFQAEVEIISRVHHRHLVSLI 340

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE--- 719
            G+     ++L++Y+FVPN +L    H KG  +   + W  RLKIA G A+GLSY+HE   
Sbjct: 341  GYCMAGVQRLLVYEFVPNNNLEFHLHGKGRPT---MEWSTRLKIALGSAKGLSYLHEDCN 397

Query: 718  KKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDS 539
             K +H ++K SNIL+D   E KV DFGL ++      S    + S+R             
Sbjct: 398  PKIIHRDIKASNILIDFKFEAKVADFGLAKIA-----SDTNTHVSTR------------- 439

Query: 538  FPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK----- 374
                              +G   Y+APE   S K   K DVFSFGVVLLEL+TG+     
Sbjct: 440  -----------------VMGTFGYLAPEYAASGKLTEKSDVFSFGVVLLELITGRRPVDA 482

Query: 373  --IIVSDEMV--PGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVP 206
              + V D +V    P +    E+     +AD  +  +                 C+    
Sbjct: 483  NNVYVDDSLVDWARPLLNRASEEGDFEGLADSKMGNEYDREEMARMVACAAA--CVRHSA 540

Query: 205  QKRPTMKEVVQALD 164
            ++RP M ++V+AL+
Sbjct: 541  RRRPRMSQIVRALE 554



>gb:AE016959_1020675 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC078891_1541546 Oryza sativa
            chromosome 10 clone OSJNBa0092N12, complete
            sequence.>gb:AC098694_1736838 Oryza sativa (japonica
            cultivar-group) chromosome 10 clone OJ1014H12, complete
            sequence.>gb:AE017050_1750494 Oryza sativa (japonica
            cultivar-group) chromosome 10, section 4 of 77 of the
            complete sequence.
          Length = 1110

 Score =  133 bits (334), Expect = 8e-30
 Identities = 97/312 (31%), Positives = 147/312 (47%), Gaps = 11/312 (3%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            ++A ++G+ G   ++K  L DG+ +A++++        REF  ++  + K+ H NLV + 
Sbjct: 825  STASLIGSGGFGEVFKATLKDGSCVAIKKLIHLSYQGDREFMAEMETLGKIKHKNLVPLL 884

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGG-SSHRHLPWEVRLKIARGVARGLSYIHEK- 716
            G+    +E+L++Y+F+ +GSL +  H  GG S+   + WE R K+ARG ARGL ++H   
Sbjct: 885  GYCKIGEERLLVYEFMSHGSLEDTLHGDGGRSASPAMSWEQRKKVARGAARGLCFLHYNC 944

Query: 715  --KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRD 542
                +H ++K SN+LLD DME +V DFG+ RL+                           
Sbjct: 945  IPHIIHRDMKSSNVLLDGDMEARVADFGMARLI--------------------------- 977

Query: 541  SFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG----- 377
                   S   T     +  G   Y+ PE  +S +   K DV+SFGVVLLELLTG     
Sbjct: 978  -------SALDTHLSVSTLAGTPGYVPPEYYQSFRCTVKGDVYSFGVVLLELLTGRRPTD 1030

Query: 376  KIIVSDEMVPGPPVMGVEEKS--KVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQ 203
            K    D  + G   M V + +  +VL    V   AD                 C+   P 
Sbjct: 1031 KDDFGDTNLVGWVKMKVGDGAGKEVLDPELVVEGAD----ADEMARFMDMALQCVDDFPS 1086

Query: 202  KRPTMKEVVQAL 167
            KRP M +VV  L
Sbjct: 1087 KRPNMLQVVAML 1098



>pir|T50850|T50850 receptor protein kinase homolog [imported] -
            soybean>gb:AY166655_1586208 Glycine max nodule
            autoregulation receptor-like protein kinase precursor
            (NARK) gene, complete cds.>gb:AF197947_1776385 Glycine
            max receptor protein kinase-like protein (CLV1B) mRNA,
            complete cds.
          Length = 987

 Score =  133 bits (334), Expect = 8e-30
 Identities = 96/313 (30%), Positives = 153/313 (48%), Gaps = 12/313 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFRE-FENQIRVISKLVHPNLVRIRGFY 881
            I+G  G+ I+Y+  + +GT +A++R+  +G  R    F+ +I  + K+ H N++R+ G+ 
Sbjct: 701  IIGKGGAGIVYRGSMPNGTDVAIKRLVGAGSGRNDYGFKAEIETLGKIRHRNIMRLLGYV 760

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH--- 710
               +  L++Y+++PNGSL    H   G+   HL WE+R KIA   A+GL Y+H       
Sbjct: 761  SNKETNLLLYEYMPNGSLGEWLH---GAKGGHLKWEMRYKIAVEAAKGLCYLHHDCSPLI 817

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLD D+E  V DFGL + +   G S                         
Sbjct: 818  IHRDVKSNNILLDGDLEAHVADFGLAKFLYDPGASQSM---------------------- 855

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMV 350
            S+++G +             YIAPE   +LK + K DV+SFGVVLLEL+ G+  V  E  
Sbjct: 856  SSIAGSY------------GYIAPEYAYTLKVDEKSDVYSFGVVLLELIIGRKPVG-EFG 902

Query: 349  PGPPVMGVEEKSK--VLRMADVAIRADMXXXXXXXXXXXXXGY------NCISPVPQKRP 194
             G  ++G   K++  + + +D A+   +              Y       C+  +   RP
Sbjct: 903  DGVDIVGWVNKTRLELAQPSDAALVLAVVDPRLSGYPLTSVIYMFNIAMMCVKEMGPARP 962

Query: 193  TMKEVVQALDNIP 155
            TM+EVV  L   P
Sbjct: 963  TMREVVHMLSEPP 975



>pir|T50851|T50851 receptor protein kinase homolog [imported] -
            soybean>gb:AF197946_1776384 Glycine max receptor protein
            kinase-like protein (CLV1A) mRNA, complete cds.
          Length = 981

 Score =  133 bits (334), Expect = 8e-30
 Identities = 98/313 (31%), Positives = 156/313 (49%), Gaps = 12/313 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFRE-FENQIRVISKLVHPNLVRIRGFY 881
            I+G  G+ I+Y+  + +G+ +A++R+  +G  R    F+ +I  + K+ H N++R+ G+ 
Sbjct: 695  IIGKGGAGIVYRGSMRNGSDVAIKRLVGAGSGRNDYGFKAEIETVGKIRHRNIMRLLGYV 754

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH--- 710
               +  L++Y+++PNGSL    H   G+   HL WE+R KIA   A+GL Y+H       
Sbjct: 755  SNKETNLLLYEYMPNGSLGEWLH---GAKGGHLKWEMRYKIAVEAAKGLCYLHHDCSPLI 811

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLDA  E  V DFGL + +               + GS +S         
Sbjct: 812  IHRDVKSNNILLDAHFEAHVADFGLAKFLY--------------DLGSSQSM-------- 849

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMV 350
            S+++G +             YIAPE   +LK + K DV+SFGVVLLEL+ G+  V  E  
Sbjct: 850  SSIAGSY------------GYIAPEYAYTLKVDEKSDVYSFGVVLLELIIGRKPVG-EFG 896

Query: 349  PGPPVMGVEEKSK--VLRMADVAIRADMXXXXXXXXXXXXXGY------NCISPVPQKRP 194
             G  ++G   K++  + + +D A+   +              Y       C+  V   RP
Sbjct: 897  DGVDIVGWVNKTRLELSQPSDAAVVLAVVDPRLSGYPLISVIYMFNIAMMCVKEVGPTRP 956

Query: 193  TMKEVVQALDNIP 155
            TM+EVV  L N P
Sbjct: 957  TMREVVHMLSNPP 969



>gb:AC145120_1744276 Solanum demissum chromosome 5 BAC PGEC446O19
            genomic sequence, complete sequence.
          Length = 420

 Score =  132 bits (333), Expect = 1e-29
 Identities = 93/320 (29%), Positives = 147/320 (45%), Gaps = 20/320 (6%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLD----------DGTALAVRRVGESGLDRFREFENQIRVISKLVHP 908
            +LG  G   ++K  +D           G  +AV+++   G    +E+  ++  + +L HP
Sbjct: 90   LLGEGGFGCVFKGWIDAQTLTASKPGSGIVIAVKKLKPEGFQGHKEWLTEVNYLGQLRHP 149

Query: 907  NLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSY 728
            NLV++ G+    D  L++Y+F+P GSL N   R+G    + L W  R+K+A G ARGL++
Sbjct: 150  NLVKLIGYCIDGDNHLLVYEFMPKGSLENHLFRRG---PQPLNWATRIKVAIGAARGLAF 206

Query: 727  IHEKKH--VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRST 554
            +H+ K   ++ + K SNILLDA+   K+ DFGL +                         
Sbjct: 207  LHDAKEQVIYRDFKASNILLDAEFNSKLSDFGLAK------------------------- 241

Query: 553  ASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                     A   G     S   +G   Y APE + + +   K DV+SFGVVLLELL+G+
Sbjct: 242  ---------AGPTGDRTHVSTQVMGTQGYAAPEYVATGRLTAKSDVYSFGVVLLELLSGR 292

Query: 373  IIVSDEMVP--------GPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCI 218
              V +  V           P +G  +K K+ R+ D  +                  + C+
Sbjct: 293  RAVDNAKVGIEQNLVDWAKPYLG--DKRKLFRIMDTKLEGQ--YPQKGAYTAANLAWQCL 348

Query: 217  SPVPQKRPTMKEVVQALDNI 158
            S  P+ RP M EV+ AL+ +
Sbjct: 349  SNEPKLRPKMSEVLTALEEL 368



>gb:AC135288_1742197 Solanum demissum chromosome 5 BAC PGEC219 genomic
            sequence, complete sequence.
          Length = 420

 Score =  132 bits (333), Expect = 1e-29
 Identities = 93/320 (29%), Positives = 147/320 (45%), Gaps = 20/320 (6%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLD----------DGTALAVRRVGESGLDRFREFENQIRVISKLVHP 908
            +LG  G   ++K  +D           G  +AV+++   G    +E+  ++  + +L HP
Sbjct: 90   LLGEGGFGCVFKGWIDAQTLTASKPGSGIVIAVKKLKPEGFQGHKEWLTEVNYLGQLRHP 149

Query: 907  NLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSY 728
            NLV++ G+    D  L++Y+F+P GSL N   R+G    + L W  R+K+A G ARGL++
Sbjct: 150  NLVKLIGYCIDGDNHLLVYEFMPKGSLENHLFRRG---PQPLNWATRIKVAIGAARGLAF 206

Query: 727  IHEKKH--VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRST 554
            +H+ K   ++ + K SNILLDA+   K+ DFGL +                         
Sbjct: 207  LHDAKEQVIYRDFKASNILLDAEFNSKLSDFGLAK------------------------- 241

Query: 553  ASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                     A   G     S   +G   Y APE + + +   K DV+SFGVVLLELL+G+
Sbjct: 242  ---------AGPTGDRTHVSTQVMGTQGYAAPEYVATGRLTAKSDVYSFGVVLLELLSGR 292

Query: 373  IIVSDEMVP--------GPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCI 218
              V +  V           P +G  +K K+ R+ D  +                  + C+
Sbjct: 293  RAVDNTKVGIEQNLVDWAKPYLG--DKRKLFRIMDTKLEGQ--YPQKGAYTAANLAWQCL 348

Query: 217  SPVPQKRPTMKEVVQALDNI 158
            S  P+ RP M EV+ AL+ +
Sbjct: 349  SNEPKLRPKMSEVLTALEEL 368



>gb:AY730335_1625407 Solanum tuberosum strain P6/210 clone BAC
            BA151m8, complete sequence.
          Length = 603

 Score =  132 bits (333), Expect = 1e-29
 Identities = 95/333 (28%), Positives = 152/333 (45%), Gaps = 21/333 (6%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDD----------GTALAVRRVGESGLDRFREFENQIRVISKLVHP 908
            +LG  G   ++K  +++          G  +AV+ +   GL     ++ ++  +  LVHP
Sbjct: 251  LLGEGGFGCVFKGWIEENGTAPVKPGTGLTVAVKTLNHDGLQVLSIWQAEVNFLGDLVHP 310

Query: 907  NLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSY 728
            NLV++ G+    D++L++Y+F+P GSL N   R+       LPW +R+KIA G A+GL++
Sbjct: 311  NLVKLIGYCIEDDQRLLVYEFMPRGSLENHLFRRS----MPLPWSIRMKIALGAAKGLAF 366

Query: 727  IHEKKH---VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRS 557
            +HE+     ++ + K SNILLDAD   K+ DFGL +     G    K + S+R       
Sbjct: 367  LHEEAERPVIYRDFKTSNILLDADYNAKLSDFGLAK----DGPEGDKTHVSTR------- 415

Query: 556  TASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG 377
                                    +G   Y APE + +     K DV+SFGVVLLE++TG
Sbjct: 416  -----------------------VMGTYGYAAPEYVMTGHLTSKSDVYSFGVVLLEMITG 452

Query: 376  KIIVSDEMVPGP--------PVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNC 221
            +  +      G         P +G  E+ +  R+ D  +                    C
Sbjct: 453  RRSMDKNRPNGEHNLVEWARPHLG--ERRRFYRLVDPRLEGHFSIKGAQKAAQLAA--RC 508

Query: 220  ISPVPQKRPTMKEVVQALDNIPTXXXXXXSYFY 122
            +S  P+ RP M +VV+AL  +P       S +Y
Sbjct: 509  LSRDPKARPMMSDVVEALKPLPNLKDMASSSYY 541



>gb:AC144737_1744149 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OSJNBa0018K15, complete sequence.
          Length = 638

 Score =  132 bits (332), Expect = 1e-29
 Identities = 97/316 (30%), Positives = 153/316 (48%), Gaps = 12/316 (3%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKL-VHPNLVRI 893
            ASA +LG       YK VL+DGT + V+R+ E    + REFE Q+ +I ++  H N V++
Sbjct: 344  ASAEVLGKGSYGTTYKAVLEDGTTVVVKRLKEVVAGK-REFEQQMEIIGRVGQHQNAVQL 402

Query: 892  RGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK- 716
            R +Y+  DEKL++YD++  GSL  A H    +    L W  R+KI+   ARG++++H + 
Sbjct: 403  RAYYYSKDEKLLVYDYMTPGSLCAALHGNRTAGRTTLDWATRVKISLEAARGIAHLHAEG 462

Query: 715  --KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRD 542
              K +HGN+K SNILL   +   + +FGL +L+                           
Sbjct: 463  GGKFIHGNIKSSNILLSQGLSACISEFGLAQLMAI------------------------- 497

Query: 541  SFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIV- 365
                      H P+       +  Y APE L + +   K DV+S+GV+LLE+LTGK  + 
Sbjct: 498  ---------PHIPA------RLIGYRAPEVLETKRQTQKSDVYSYGVLLLEMLTGKAPLR 542

Query: 364  ---SDEMVPGPP--VMGV--EEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVP 206
                ++ +   P  V  V  EE +  +  AD+    +                 C++ VP
Sbjct: 543  SPGREDSIEHLPRWVQSVVREEWTSEVFDADLLRHPNSEDEMVQMLQLAMA---CVAIVP 599

Query: 205  QKRPTMKEVVQALDNI 158
             +RP M+EVV+ ++ I
Sbjct: 600  DQRPRMEEVVRRIEEI 615



>gb:AC099732_1737183 Oryza sativa (japonica cultivar-group) chromosome
            3 clone OJ1203D03, complete sequence.
          Length = 1001

 Score =  132 bits (332), Expect = 1e-29
 Identities = 98/314 (31%), Positives = 152/314 (48%), Gaps = 13/314 (4%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRV---GESGL--DRFREFENQIRVISKLVHPNLVRI 893
            ++G  GS I+YK  +  G  +AV+R+   G SG   D +  F  +I+ + ++ H ++VR+
Sbjct: 685  VIGKGGSGIVYKGAMPGGAVVAVKRLPAMGRSGAAHDDYG-FSAEIQTLGRIRHRHIVRL 743

Query: 892  RGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKK 713
             GF    +  L++Y+++PNGSL    H K G    HL W  R KIA   A+GL Y+H   
Sbjct: 744  LGFAANRETNLLVYEYMPNGSLGEVLHGKKGG---HLQWATRYKIAVEAAKGLCYLHHDC 800

Query: 712  H---VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRD 542
                +H ++K +NILLDA+ E  V DFGL + +      S  +                 
Sbjct: 801  SPPILHRDVKSNNILLDAEFEAHVADFGLAKFLRGNAGGSECM----------------- 843

Query: 541  SFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVS 362
                SA++G +             YIAPE   +LK + K DV+SFGVVLLEL+ G+  V 
Sbjct: 844  ----SAIAGSY------------GYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVG 887

Query: 361  D-----EMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKR 197
            +     ++V    ++    K  V ++AD  +                    C++    +R
Sbjct: 888  EFGDGVDIVHWVRMVTGSSKEGVTKIADPRL---STVPLHELTHVFYVAMLCVAEQSVER 944

Query: 196  PTMKEVVQALDNIP 155
            PTM+EVVQ L ++P
Sbjct: 945  PTMREVVQILTDLP 958



>gb:OSJN00075_1694384 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0036B21, complete sequence.
          Length = 628

 Score =  132 bits (332), Expect = 1e-29
 Identities = 99/309 (32%), Positives = 155/309 (50%), Gaps = 11/309 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIRGFY 881
            ILG  G   +YK  L DG+ +AV+R+ E        +F+ ++ +IS  VH NL+R+RGF 
Sbjct: 311  ILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFC 370

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KH 710
                E+L++Y ++ NGS+A+   R+   +   L W+ R +IA G ARGLSY+H+    K 
Sbjct: 371  MTPTERLLVYPYMANGSVASRL-RERQPNDPPLEWQTRTRIALGSARGLSYLHDHCDPKI 429

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLD D E  VGDFGL +L+                         +D+   
Sbjct: 430  IHRDVKAANILLDEDFEAVVGDFGLAKLM-----------------------DYKDTHVT 466

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG-------KI 371
            +AV G          +G   +IAPE L + K + K DVF +G++LLEL+TG       ++
Sbjct: 467  TAVRG---------TIG---HIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARL 514

Query: 370  IVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
               D+++    V G+ ++ KV  + D  +++                  C    P  RP 
Sbjct: 515  ANDDDVMLLDWVKGLLKEKKVEMLVDPDLQSGFVEHEVESLIQVALL--CTQGSPMDRPK 572

Query: 190  MKEVVQALD 164
            M EVV+ L+
Sbjct: 573  MSEVVRMLE 581



>gb:AY652735_1620180 Oryza sativa (japonica cultivar-group) somatic
            embryogenesis protein kinase 1 mRNA, complete cds.
          Length = 628

 Score =  132 bits (332), Expect = 1e-29
 Identities = 99/309 (32%), Positives = 155/309 (50%), Gaps = 11/309 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIRGFY 881
            ILG  G   +YK  L DG+ +AV+R+ E        +F+ ++ +IS  VH NL+R+RGF 
Sbjct: 311  ILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFC 370

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KH 710
                E+L++Y ++ NGS+A+   R+   +   L W+ R +IA G ARGLSY+H+    K 
Sbjct: 371  MTPTERLLVYPYMANGSVASRL-RERQPNDPPLEWQTRTRIALGSARGLSYLHDHCDPKI 429

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLD D E  VGDFGL +L+                         +D+   
Sbjct: 430  IHRDVKAANILLDEDFEAVVGDFGLAKLM-----------------------DYKDTHVT 466

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG-------KI 371
            +AV G          +G   +IAPE L + K + K DVF +G++LLEL+TG       ++
Sbjct: 467  TAVRG---------TIG---HIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARL 514

Query: 370  IVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
               D+++    V G+ ++ KV  + D  +++                  C    P  RP 
Sbjct: 515  ANDDDVMLLDWVKGLLKEKKVEMLVDPDLQSGFVEHEVESLIQVALL--CTQGSPMDRPK 572

Query: 190  MKEVVQALD 164
            M EVV+ L+
Sbjct: 573  MSEVVRMLE 581



>gb:AE016959_1020855 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC074283_1541320 Oryza sativa
            chromosome 10 clone OSJNBa0087H07, complete
            sequence.>gb:AE017054_1750674 Oryza sativa (japonica
            cultivar-group) chromosome 10, section 8 of 77 of the
            complete sequence.
          Length = 640

 Score =  132 bits (332), Expect = 1e-29
 Identities = 81/230 (35%), Positives = 123/230 (53%), Gaps = 3/230 (1%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            LG  G   +YK +  +G  +AV+R+       F EF+N++++I+KL H NLVR+ G    
Sbjct: 352  LGEGGFGPVYKGLFSEGLEIAVKRLASHSGQGFLEFKNEVQLIAKLQHRNLVRLLGCCSQ 411

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---VH 704
             +EK+++Y+++PN SL      +       L W  RL I  G+A+GL Y+H+      +H
Sbjct: 412  GEEKILVYEYLPNKSLDFYIFDE--RKKDLLDWNKRLVIIEGIAQGLLYLHKHSRLRVIH 469

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             +LKPSNILLD++M PK+ DFGL            K++GS+ N G+ R            
Sbjct: 470  RDLKPSNILLDSEMNPKISDFGL-----------AKIFGSNSNEGTTR------------ 506

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                         +G   Y+APE       +PK DVFSFGV++LE+++GK
Sbjct: 507  -----------RVVGTYGYMAPEYSSEGLFSPKSDVFSFGVIILEIISGK 545



>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS
            precursor (EC 2.7.1.37) (Extra sporogenous cells protein)
            (EXCESS MICROSPOROCYTES1 protein).>pir|T48499|T48499
            receptor-like protein kinase-like protein - Arabidopsis
            thaliana>gb:ATH488154_1552685 Arabidopsis thaliana mRNA
            for receptor-like protein kinase-like protein (ems1
            gene).>gb:ATT28J14_1555609 Arabidopsis thaliana DNA
            chromosome 5, BAC clone T28J14 (ESSA project).
          Length = 1192

 Score =  132 bits (332), Expect = 1e-29
 Identities = 100/326 (30%), Positives = 147/326 (45%), Gaps = 26/326 (7%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYW 878
            I+G  G   +YK  L     +AV+++ E+     REF  ++  + K+ HPNLV + G+  
Sbjct: 922  IIGDGGFGTVYKACLPGEKTVAVKKLSEAKTQGNREFMAEMETLGKVKHPNLVSLLGYCS 981

Query: 877  GADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE---KKHV 707
             ++EKL++Y+++ NGSL +    + G     L W  RLKIA G ARGL+++H       +
Sbjct: 982  FSEEKLLVYEYMVNGSLDHWLRNQTGMLEV-LDWSKRLKIAVGAARGLAFLHHGFIPHII 1040

Query: 706  HGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDS 527
            H ++K SNILLD D EPKV DFGL RL+ A       V   +  FG              
Sbjct: 1041 HRDIKASNILLDGDFEPKVADFGLARLISACESHVSTVIAGT--FG-------------- 1084

Query: 526  AVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEM-- 353
                               YI PE  +S +   K DV+SFGV+LLEL+TGK     +   
Sbjct: 1085 -------------------YIPPEYGQSARATTKGDVYSFGVILLELVTGKEPTGPDFKE 1125

Query: 352  ---------------------VPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXX 236
                                 V  P ++ V  K+  LR+  +A+                
Sbjct: 1126 SEGGNLVGWAIQKINQGKAVDVIDPLLVSVALKNSQLRLLQIAML--------------- 1170

Query: 235  XGYNCISPVPQKRPTMKEVVQALDNI 158
                C++  P KRP M +V++AL  I
Sbjct: 1171 ----CLAETPAKRPNMLDVLKALKEI 1192



>gb:AP003434_1829307 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0452F10.
          Length = 597

 Score =  132 bits (331), Expect = 2e-29
 Identities = 94/314 (29%), Positives = 152/314 (48%), Gaps = 12/314 (3%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            + A +LG  G   ++K VL +GT +AV+++ +      REF+ ++ +IS++ H +LV + 
Sbjct: 224  SDANLLGQGGFGYVHKGVLPNGTEVAVKQLRDGSGQGEREFQAEVEIISRVHHKHLVTLV 283

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH 710
            G+     ++L++Y++VPN +L    H +G  +   + W  RL+IA G A+GL+Y+HE  H
Sbjct: 284  GYCISGGKRLLVYEYVPNNTLELHLHGRGRPT---MEWPTRLRIALGAAKGLAYLHEDCH 340

Query: 709  ---VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDS 539
               +H ++K +NILLDA  E KV DFGL +L      S    + S+R             
Sbjct: 341  PKIIHRDIKSANILLDARFEAKVADFGLAKLT-----SDNNTHVSTR------------- 382

Query: 538  FPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIV-- 365
                              +G   Y+APE   S +   K DVFSFGV+LLEL+TG+  V  
Sbjct: 383  -----------------VMGTFGYLAPEYASSGQLTEKSDVFSFGVMLLELITGRRPVRS 425

Query: 364  -----SDEMV--PGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVP 206
                  D +V    P +M   +      + D  +  +                 C+    
Sbjct: 426  NQSQMDDSLVDWARPLMMRASDDGNYDALVDPRLGQEYNGNEMARMIACAAA--CVRHSA 483

Query: 205  QKRPTMKEVVQALD 164
            ++RP M +VV+AL+
Sbjct: 484  RRRPRMSQVVRALE 497



>gb:AC093018_1735842 Oryza sativa chromosome 3 BAC OSJNBb0081B07
            genomic sequence, complete sequence.
          Length = 416

 Score =  132 bits (331), Expect = 2e-29
 Identities = 93/318 (29%), Positives = 149/318 (46%), Gaps = 18/318 (5%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGT----------ALAVRRVGESGLDRFREFENQIRVISKLVHP 908
            +LG  G   +YK  +D+ T          A+AV+R+ +  L   RE+  ++  + +  HP
Sbjct: 83   VLGEGGFGSVYKGWIDENTLSACKPGTGIAVAVKRLNQESLQGHREWLAEVNYLGQFCHP 142

Query: 907  NLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSY 728
            NLV++ G+    + +L++Y+F+P GSL N   R+ GS  + L W +R+K+A G A+GL+Y
Sbjct: 143  NLVKLFGYCLEDEHRLLVYEFMPRGSLENHLFRR-GSHFQPLSWNLRMKVALGAAKGLAY 201

Query: 727  IH--EKKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRST 554
            +H  E K ++ + K SNILLD D   K+ DFGL +     G    K + S+R        
Sbjct: 202  LHSSEAKVIYRDFKTSNILLDTDYSAKLSDFGLAK----DGPVGEKSHVSTR-------- 249

Query: 553  ASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                                   +G   Y APE L +     K DV+SFGVVLLE+++G+
Sbjct: 250  ----------------------VMGTYGYAAPEYLSTGHLTAKSDVYSFGVVLLEMMSGR 287

Query: 373  IIVSDEMVPGPPVM------GVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISP 212
              +      G   +       +  K K+ R+ D   R +                 C+S 
Sbjct: 288  RAIDKNRPQGEHNLVEWARPYLTHKRKIFRVLDT--RLEGQYSHVGAQTVATLALECLSY 345

Query: 211  VPQKRPTMKEVVQALDNI 158
              + RP+M+ VV  L+ +
Sbjct: 346  EAKMRPSMEAVVTILEEL 363



>gb:ZMA277703_1731488 Zea mays mRNA for SERK2 protein.
          Length = 626

 Score =  132 bits (331), Expect = 2e-29
 Identities = 101/309 (32%), Positives = 154/309 (49%), Gaps = 11/309 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIRGFY 881
            ILG  G   +YK  L DG+ +AV+R+ E        +F+ ++ +IS  VH NL+R+RGF 
Sbjct: 309  ILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHKNLLRLRGFC 368

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KH 710
                E+L++Y ++ NGS+A+   R+   S   L WE R +IA G ARGLSY+H+    K 
Sbjct: 369  MTPTERLLVYPYMANGSVASRL-RERQPSEPPLSWEPRRRIALGSARGLSYLHDHCDPKI 427

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLD D E  VGDFGL +L+                         +D+   
Sbjct: 428  IHRDVKAANILLDEDFEAVVGDFGLAKLM-----------------------DYKDTHVT 464

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG-------KI 371
            +AV G          +G   +IAPE L + K + K DVF +G++LLEL+TG       ++
Sbjct: 465  TAVRG---------TIG---HIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARL 512

Query: 370  IVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
               D+++    V G+ ++ KV  + D  ++                   C    P  RP 
Sbjct: 513  ANDDDVMLLDWVKGLLKEKKVEMLVDPDLQ--KAYEEVEVESLIQVALLCTQGSPLDRPK 570

Query: 190  MKEVVQALD 164
            M EVV+ L+
Sbjct: 571  MSEVVRMLE 579



>gb:OSJN00019_1693374 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0043L09, complete sequence.
          Length = 814

 Score =  132 bits (331), Expect = 2e-29
 Identities = 94/306 (30%), Positives = 143/306 (46%), Gaps = 7/306 (2%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYW 878
            +LG  G   +YK  L  G  +AV+R+          F N++ +I+KL H NLVR+ G   
Sbjct: 504  MLGEGGFGKVYKGKLGGGKEIAVKRLSTGSTQGLEHFTNEVVLIAKLQHKNLVRLLGCCI 563

Query: 877  GADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---V 707
              DEKL+IY+++PN SL +       +S   L W  R KI +GVARGL Y+H+      +
Sbjct: 564  HGDEKLLIYEYLPNKSLDHFLFDP--ASKFILDWPTRFKIIKGVARGLLYLHQDSRLTII 621

Query: 706  HGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDS 527
            H +LK SNILLDADM PK+ DFG+ R+                 FG  +  A+ +     
Sbjct: 622  HRDLKTSNILLDADMSPKISDFGMARI-----------------FGGNQQEANTNR---- 660

Query: 526  AVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMVP 347
                          +G   Y++PE       + K D++SFGV+LLE+++G  I   +++ 
Sbjct: 661  -------------VVGTYGYMSPEYAMDGVFSVKSDIYSFGVILLEIVSGLKISLPQLMD 707

Query: 346  GPPVMG----VEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEV 179
             P ++     + +  K + + D +I                    C+   P  RP M  V
Sbjct: 708  FPNLLAYAWRLWKDDKTMDLVDSSIAESCSKNEVLLCIHIGLL--CVQDNPNSRPLMSSV 765

Query: 178  VQALDN 161
            V  L+N
Sbjct: 766  VFMLEN 771



>gb:AB115767_1527521 Citrus unshiu SERK mRNA for somatic embryogenesis
            receptor kinase 1, complete cds.
          Length = 621

 Score =  132 bits (331), Expect = 2e-29
 Identities = 99/309 (32%), Positives = 155/309 (50%), Gaps = 11/309 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIRGFY 881
            ILG  G   +YK  L DG+ +AV+R+ E        +F+ ++ +IS  VH NL+R+RGF 
Sbjct: 303  ILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFC 362

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KH 710
                E+L++Y ++ NGS+A+ C R+   S   L W  R +IA G ARGLSY+H+    K 
Sbjct: 363  MTPTERLLVYPYMANGSVAS-CLRERPPSQLPLDWPTRKRIALGSARGLSYLHDHCDPKI 421

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLD + E  VGDFGL +L+                         +D+   
Sbjct: 422  IHRDVKAANILLDEEFEAVVGDFGLAKLM-----------------------DYKDTHVT 458

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG-------KI 371
            +AV G          +G   +IAPE L + K + K DVF +G++LLEL+TG       ++
Sbjct: 459  TAVRG---------TIG---HIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARL 506

Query: 370  IVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
               D+++    V G+ ++ K+  + D  ++ +                 C    P  RP 
Sbjct: 507  ANDDDVMLLDWVKGLLKEKKLEMLVDPDLQNNYVEAEVEQLIQVALL--CTQGSPMDRPK 564

Query: 190  MKEVVQALD 164
            M EVV+ L+
Sbjct: 565  MSEVVRMLE 573



>gb:AB054061_1521307 Brassica rapa SRK22 mRNA for S locus receptor
            kinase, partial cds.
          Length = 827

 Score =  132 bits (331), Expect = 2e-29
 Identities = 87/230 (37%), Positives = 126/230 (54%), Gaps = 3/230 (1%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            LG SG  I+YK +LD G  +AV+R+ ++ L    EF N++R+I++L H NLVRI G    
Sbjct: 505  LGRSGFGIVYKGMLD-GQEVAVKRLSKTSLQGIDEFMNEVRLIARLQHINLVRILGCCIE 563

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---VH 704
            ADEK++IY+++ N SL      K  SS+  L W+ R  I  GVARGL Y+H+      +H
Sbjct: 564  ADEKILIYEYLENSSLDYFLFGKKRSSN--LNWKDRFAITNGVARGLLYLHQDSRFRIIH 621

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             +LKP NILLD  M PK+ DFG+ R+                         +RD      
Sbjct: 622  RDLKPGNILLDKYMIPKISDFGMARIF------------------------ARDE----- 652

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                 T + + +A+G   Y++PE       + K DVFSFGV++LE+++GK
Sbjct: 653  -----TQARTDNAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSGK 697



>gb:AB008270_1510484 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MTG13.>gb:BT011691_1641213 Arabidopsis thaliana
            At5g16590 gene, complete cds.>gb:BT012270_1641476
            Arabidopsis thaliana At5g16590 gene, complete cds.
          Length = 625

 Score =  132 bits (331), Expect = 2e-29
 Identities = 94/311 (30%), Positives = 141/311 (45%), Gaps = 7/311 (2%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            ASA +LG       YK   D G  +AV+R+ +  +   +EF  +++V+  + H NLV + 
Sbjct: 344  ASAEVLGKGTFGSSYKASFDHGLVVAVKRLRDVVVPE-KEFREKLQVLGSISHANLVTLI 402

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH 710
             +Y+  DEKLV+++++  GSL+   H   GS    L WE R  IA G AR +SY+H +  
Sbjct: 403  AYYFSRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLNWETRANIALGAARAISYLHSRDA 462

Query: 709  V--HGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSF 536
               HGN+K SNILL    E KV D+ L  ++                             
Sbjct: 463  TTSHGNIKSSNILLSESFEAKVSDYCLAPMI----------------------------- 493

Query: 535  PDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKI----I 368
                       SP+ +   I  Y APE   + K + K DV+SFGV++LELLTGK      
Sbjct: 494  -----------SPTSTPNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQ 542

Query: 367  VSDEMVPGPP-VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
            + +E V  P  V  + E+     + D  +                 G +C +  P  RPT
Sbjct: 543  LHEEGVDLPRWVSSITEQQSPSDVFDPELTRYQSDSNENMIRLLNIGISCTTQYPDSRPT 602

Query: 190  MKEVVQALDNI 158
            M EV + ++ +
Sbjct: 603  MPEVTRLIEEV 613



>gb:AP005905_1859878 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, BAC clone:B1080A02.
          Length = 652

 Score =  131 bits (330), Expect = 2e-29
 Identities = 95/310 (30%), Positives = 145/310 (46%), Gaps = 12/310 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLD-DGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFY 881
            ++G+ G   +YK V    G   AV+R  +S  D + EF  ++ +I+ L HPNLV ++G+ 
Sbjct: 332  VVGSGGFGTVYKAVCPCSGVTYAVKRSKQSR-DSYNEFNAELTIIADLKHPNLVHLQGWC 390

Query: 880  WGADEKLVIYDFVPNGSLANACHR-KGGSSHRHLPWEVRLKIARGVARGLSYIHE---KK 713
               DE L++Y+F+ NGSL  A H       H  L W  R  +A G+A  ++Y+HE   K+
Sbjct: 391  AEKDELLLVYEFMSNGSLDMALHPCSEAECHVPLSWAQRYNVAVGIACAVAYLHEEHDKQ 450

Query: 712  HVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFP 533
             +H ++K SNILLD+   P++GDFGL RL                               
Sbjct: 451  VIHRDIKCSNILLDSHFNPRLGDFGLARL------------------------------- 479

Query: 532  DSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEM 353
                   +T   S  A G   Y+APE L+  K   K DV+S+GVVLLE+ TG+  +    
Sbjct: 480  ----KDPNTSPRSTLAAGTVGYLAPEYLQMGKATEKSDVYSYGVVLLEICTGRRPIESAA 535

Query: 352  VPGPPVMGV-------EEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRP 194
                 ++ V         K KVL   D  +  +              G +C++P  ++RP
Sbjct: 536  PDSMNMVNVVDWVWNLHSKGKVLDAVDPTLNGE--YDAGQMMRFLLVGLSCVNPFSEERP 593

Query: 193  TMKEVVQALD 164
             M+ V+  L+
Sbjct: 594  VMRTVLDMLE 603



>gb:AP004858_1846106 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC
            clone:OJ1725_H08.>gb:AP005055_1847351 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, PAC
            clone:P0684A08.
          Length = 454

 Score =  131 bits (330), Expect = 2e-29
 Identities = 95/320 (29%), Positives = 150/320 (46%), Gaps = 20/320 (6%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDD----------GTALAVRRVGESGLDRFREFENQIRVISKLVHP 908
            +LG  G   ++K  +D+          G A+AV+++    L   +E+++++  + +L HP
Sbjct: 115  VLGEGGFGRVHKGWVDERTMSPARSGSGMAVAVKKLDPESLQGVQEWQSEVNFLGRLSHP 174

Query: 907  NLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSS--HRHLPWEVRLKIARGVARGL 734
            NLVR+ G+ W   E L++Y+++  GSL N   RKGGS+   + L W +RL+IA G ARGL
Sbjct: 175  NLVRLLGYCWEDKELLLVYEYMAQGSLENHLFRKGGSASPQQPLSWSLRLRIAIGAARGL 234

Query: 733  SYIH--EKKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKR 560
            +++H  EK  ++ + K SNILLD     K+ DFGL +   AGG S               
Sbjct: 235  AFLHSSEKHVIYRDFKASNILLDTQFHAKLSDFGLAKDGPAGGSS--------------- 279

Query: 559  STASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLT 380
                                 +   +G   Y APE + +     K DV+ FGVVLLELLT
Sbjct: 280  -------------------HVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLELLT 320

Query: 379  GKIIVSDEMVPGPPVM------GVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCI 218
            G   +      G   +       + ++ K+ R+ D   R +                 C+
Sbjct: 321  GLRALDAGRPSGQHHLVDWAKPFLSDRRKLARLMDP--RLEGQYSSRGAQRAAQLTLRCL 378

Query: 217  SPVPQKRPTMKEVVQALDNI 158
            +   + RP+M+EVV  L+ I
Sbjct: 379  AADHKNRPSMREVVAVLEEI 398



>gb:AY182166_1587874 Elaeis guineensis clone Rlk-OPmf receptor-like
            protein kinase mRNA, partial cds.
          Length = 719

 Score =  131 bits (330), Expect = 2e-29
 Identities = 93/301 (30%), Positives = 138/301 (45%), Gaps = 3/301 (0%)
 Frame = -2

Query: 1060 YILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFY 881
            YI+G   SS +YK VL +   +A++R+         EFE ++  I  + H NLV + G+ 
Sbjct: 401  YIIGYGASSTVYKCVLKNSKPIAIKRLYSQYPHNLHEFETELETIGSIRHRNLVSLHGYS 460

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIH---EKKH 710
                  L+ YD++ NGSL +  H  G S    L W+ RLKIA G A+GL+Y+H     + 
Sbjct: 461  LSPHGNLLFYDYMENGSLWDLLH--GPSKKVKLDWDTRLKIAVGAAQGLAYLHHDCNPRI 518

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K SNILLD + E  + DFG+ + + A      K + S+                 
Sbjct: 519  IHRDVKSSNILLDENFEAHLSDFGIAKCIPAA-----KTHAST----------------- 556

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMV 350
                           LG   YI PE  R+ + N K DV+SFG+VLLELLTGK  V ++  
Sbjct: 557  -------------YVLGTIGYIDPEYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNDSN 603

Query: 349  PGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVVQA 170
                ++   + + V+   D  +R+                   I      RPTM EV + 
Sbjct: 604  LHQLILSKADDNTVMEAVDFEVRSPAWIWGCQKAFQL-----AICAQRSDRPTMHEVARV 658

Query: 169  L 167
            L
Sbjct: 659  L 659



>gb:AB005231_1509264 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MBB18.>gb:AY075681_1567820 Arabidopsis thaliana
            AT5g38560/MBB18_10 mRNA, complete
            cds.>gb:AY113039_1578199 Arabidopsis thaliana
            AT5g38560/MBB18_10 mRNA, complete
            cds.>gb:AF424623_1798961 Arabidopsis thaliana
            AT5g38560/MBB18_10 mRNA, complete cds.
          Length = 681

 Score =  131 bits (330), Expect = 2e-29
 Identities = 97/317 (30%), Positives = 150/317 (47%), Gaps = 17/317 (5%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYW 878
            +LG  G   +YK VL DG  +AV+++   G    REF+ ++ +IS++ H +LV + G+  
Sbjct: 344  LLGEGGFGCVYKGVLSDGREVAVKQLKIGGSQGEREFKAEVEIISRVHHRHLVTLVGYCI 403

Query: 877  GADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---V 707
                +L++YD+VPN +L    H  G      + WE R+++A G ARG++Y+HE  H   +
Sbjct: 404  SEQHRLLVYDYVPNNTLHYHLHAPG---RPVMTWETRVRVAAGAARGIAYLHEDCHPRII 460

Query: 706  HGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDS 527
            H ++K SNILLD   E  V DFGL ++     E     + S+R                 
Sbjct: 461  HRDIKSSNILLDNSFEALVADFGLAKI---AQELDLNTHVSTR----------------- 500

Query: 526  AVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMVP 347
                          +G   Y+APE   S K + K DV+S+GV+LLEL+TG+  V      
Sbjct: 501  -------------VMGTFGYMAPEYATSGKLSEKADVYSYGVILLELITGRKPVDTSQPL 547

Query: 346  GP--------PVMGV----EEKSKVL--RMADVAIRADMXXXXXXXXXXXXXGYNCISPV 209
            G         P++G     EE  +++  R+    I  +M                C+   
Sbjct: 548  GDESLVEWARPLLGQAIENEEFDELVDPRLGKNFIPGEMFRMVEAAAA-------CVRHS 600

Query: 208  PQKRPTMKEVVQALDNI 158
              KRP M +VV+ALD +
Sbjct: 601  AAKRPKMSQVVRALDTL 617



>pir|T48176|T48176 receptor like protein kinase - Arabidopsis
            thaliana>gb:ATF7A7_1550907 Arabidopsis thaliana DNA
            chromosome 5, BAC clone F7A7 (ESSA project).
          Length = 688

 Score =  131 bits (330), Expect = 2e-29
 Identities = 92/310 (29%), Positives = 151/310 (48%), Gaps = 9/310 (2%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTA--LAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGF 884
            I+G  G   +++  L   ++  +AV+++  + +   REF  +I  + +L H NLV ++G+
Sbjct: 366  IVGTGGFGTVFRGNLSSPSSDQIAVKKITPNSMQGVREFIAEIESLGRLRHKNLVNLQGW 425

Query: 883  YWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIH---EKK 713
                ++ L+IYD++PNGSL +  + +   S   L W  R KIA+G+A GL Y+H   EK 
Sbjct: 426  CKQKNDLLLIYDYIPNGSLDSLLYSRPRQSGVVLSWNARFKIAKGIASGLLYLHEEWEKV 485

Query: 712  HVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFP 533
             +H ++KPSN+L++ DM P++GDFGL RL   G +S+  V                    
Sbjct: 486  VIHRDIKPSNVLIEDDMNPRLGDFGLARLYERGSQSNTTV-------------------- 525

Query: 532  DSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIV-SDE 356
                            +G   Y+APE  R+ K +   DVF+FGV+LLE+++G+    S  
Sbjct: 526  ---------------VVGTIGYMAPELARNGKSSSASDVFAFGVLLLEIVSGRRPTDSGT 570

Query: 355  MVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVV 176
                  VM +  + ++L   D   R                G  C    P  RP+M+ V+
Sbjct: 571  FFLADWVMELHARGEILHAVDP--RLGFGYDGVEARLALVVGLLCCHQRPTSRPSMRTVL 628

Query: 175  QAL---DNIP 155
            + L   D++P
Sbjct: 629  RYLNGDDDVP 638



>gb:AP003863_1834478 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OJ1058_A12.>gb:AP005810_1858249 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, PAC
            clone:P0696F12.
          Length = 624

 Score =  131 bits (329), Expect = 3e-29
 Identities = 86/230 (37%), Positives = 118/230 (51%), Gaps = 3/230 (1%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            LG  G   +YK  L DG  +AV+R+ +S      E +N++ +++KL H NLVR+ G    
Sbjct: 313  LGEGGFGAVYKGTLPDGDEIAVKRLSKSSAQGVGELKNELALVAKLQHKNLVRLVGVCLE 372

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KHVH 704
             +E+L++Y+FVPN SL            + L W  R KI  G+ARGL Y+HE    K VH
Sbjct: 373  QEERLLVYEFVPNRSLDQILF--DADKRQQLDWGKRYKIINGIARGLQYLHEDSQLKVVH 430

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             +LK SNILLD +M PK+ DFGL RL                 FG       RD      
Sbjct: 431  RDLKASNILLDMNMNPKISDFGLARL-----------------FG-------RDQ----- 461

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                 T   +   +G   Y++PE       + K DVFSFGV++LE++TGK
Sbjct: 462  -----TQGVTNLVIGTYGYMSPEYAMRGNYSLKSDVFSFGVMVLEIVTGK 506



>gb:AC137001_1743353 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OSJNBb0012L23, complete sequence.
          Length = 471

 Score =  131 bits (329), Expect = 3e-29
 Identities = 95/314 (30%), Positives = 147/314 (46%), Gaps = 12/314 (3%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            + A +LG  G   +++ VL  G  +AV+++        REF+ ++ +IS++ H +LV + 
Sbjct: 98   SDANLLGQGGFGYVHRGVLPTGKEIAVKQLKVGSGQGEREFQAEVEIISRVHHKHLVSLV 157

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH 710
            G+     ++L++Y+FVPN +L    H KG  +   + W  RLKIA G A+GL+Y+HE  H
Sbjct: 158  GYCISGGKRLLVYEFVPNNTLEFHLHGKGRPT---MEWPTRLKIALGAAKGLAYLHEDCH 214

Query: 709  ---VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDS 539
               +H ++K SNILLD   E KV DFGL +       S    + S+R             
Sbjct: 215  PKIIHRDIKASNILLDFKFESKVADFGLAKFT-----SDNNTHVSTR------------- 256

Query: 538  FPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK----- 374
                              +G   Y+APE   S K   K DVFS+GV+LLEL+TG+     
Sbjct: 257  -----------------VMGTFGYLAPEYASSGKLTEKSDVFSYGVMLLELITGRRPVDT 299

Query: 373  --IIVSDEMV--PGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVP 206
                + D +V    P +M   E      + D  +  D                 C+    
Sbjct: 300  SQTYMDDSLVDWARPLLMQALENGNYEELVDPRLGKDFNPNEMARMIACAAA--CVRHSA 357

Query: 205  QKRPTMKEVVQALD 164
            ++RP M +VV+AL+
Sbjct: 358  RRRPRMSQVVRALE 371



>gb:AC091532_1734806 Oryza sativa chromosome 3 BAC OSJNBa0078A17
            genomic sequence, complete sequence.
          Length = 962

 Score =  131 bits (329), Expect = 3e-29
 Identities = 82/233 (35%), Positives = 123/233 (52%), Gaps = 5/233 (2%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRV--GESGLDRFREFENQIRVISKLVHPNLVRIRGF 884
            +LG  G   +YK  L DGT +AV+R+  G  G     EF+++I V++K+ H NLV + G+
Sbjct: 612  VLGRGGFGTVYKGELHDGTKIAVKRMEAGVMGNKGLNEFKSEIAVLTKVRHRNLVSLLGY 671

Query: 883  YWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIH---EKK 713
                +E++++Y+++P G+L+         + R L W+ RL IA  VARG+ Y+H   ++ 
Sbjct: 672  CLDGNERILVYEYMPQGTLSQHLFEWKEHNLRPLEWKKRLSIALDVARGVEYLHSLAQQT 731

Query: 712  HVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFP 533
             +H +LKPSNILL  DM+ KV DFGL RL  A G+        +  FG            
Sbjct: 732  FIHRDLKPSNILLGDDMKAKVADFGLVRLAPADGKCVSVETRLAGTFG------------ 779

Query: 532  DSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                                 Y+APE   + +   K DVFSFGV+L+EL+TG+
Sbjct: 780  ---------------------YLAPEYAVTGRVTTKADVFSFGVILMELITGR 811



>gb:AY244745_1592516 Arabidopsis thaliana ERECTA-like kinase 1 (ERL1)
            mRNA, ERL1-erl1 allele, complete cds.
          Length = 966

 Score =  131 bits (329), Expect = 3e-29
 Identities = 91/301 (30%), Positives = 136/301 (45%), Gaps = 3/301 (0%)
 Frame = -2

Query: 1060 YILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFY 881
            +I+G   SS +YK  L     +A++R+        REFE ++  I  + H N+V + G+ 
Sbjct: 652  FIIGYGASSTVYKCALKSSRPIAIKRLYNQYPHNLREFETELETIGSIRHRNIVSLHGYA 711

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE---KKH 710
                  L+ YD++ NGSL +  H  G      L WE RLKIA G A+GL+Y+H     + 
Sbjct: 712  LSPTGNLLFYDYMENGSLWDLLH--GSLKKVKLGWETRLKIAVGAAQGLAYLHHDCTPRI 769

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K SNILLD + E  + DFG+ + + A      K + S+                 
Sbjct: 770  IHRDIKSSNILLDENFEAHLSDFGIAKSIPAS-----KTHAST----------------- 807

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMV 350
                           LG   YI PE  R+ + N K D++SFG+VLLELLTGK  V +E  
Sbjct: 808  -------------YVLGTIGYIDPEYARTSRINEKSDIYSFGIVLLELLTGKKAVDNEAN 854

Query: 349  PGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVVQA 170
                ++   + + V+   D  +                    C    P +RPTM EV + 
Sbjct: 855  LHQLILSKADDNTVMEAVDPEVTVTCMDLGHIRKTFQLALL-CTKRNPLERPTMLEVSRV 913

Query: 169  L 167
            L
Sbjct: 914  L 914



>gb:AY224526_1590723 Oryza sativa (japonica cultivar-group) isolate
            20960 putative receptor protein kinase mRNA, partial cds.
          Length = 394

 Score =  131 bits (329), Expect = 3e-29
 Identities = 95/314 (30%), Positives = 147/314 (46%), Gaps = 12/314 (3%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            + A +LG  G   +++ VL  G  +AV+++        REF+ ++ +IS++ H +LV + 
Sbjct: 21   SDANLLGQGGFGYVHRGVLPTGKEIAVKQLKVGSGQGEREFQAEVEIISRVHHKHLVSLV 80

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH 710
            G+     ++L++Y+FVPN +L    H KG  +   + W  RLKIA G A+GL+Y+HE  H
Sbjct: 81   GYCISGGKRLLVYEFVPNNTLEFHLHGKGRPT---MEWPTRLKIALGAAKGLAYLHEDCH 137

Query: 709  ---VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDS 539
               +H ++K SNILLD   E KV DFGL +       S    + S+R             
Sbjct: 138  PKIIHRDIKASNILLDFKFESKVADFGLAKFT-----SDNNTHVSTR------------- 179

Query: 538  FPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK----- 374
                              +G   Y+APE   S K   K DVFS+GV+LLEL+TG+     
Sbjct: 180  -----------------VMGTFGYLAPEYASSGKLTEKSDVFSYGVMLLELITGRRPVDT 222

Query: 373  --IIVSDEMV--PGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVP 206
                + D +V    P +M   E      + D  +  D                 C+    
Sbjct: 223  SQTYMDDSLVDWARPLLMQALENGNYEELVDPRLGKDFNPNEMARMIACAAA--CVRHSA 280

Query: 205  QKRPTMKEVVQALD 164
            ++RP M +VV+AL+
Sbjct: 281  RRRPRMSQVVRALE 294



>gb:AY080606_1568350 Arabidopsis thaliana putative receptor protein
            kinase (At4g36180) mRNA, partial cds.
          Length = 407

 Score =  131 bits (329), Expect = 3e-29
 Identities = 71/229 (31%), Positives = 118/229 (51%), Gaps = 1/229 (0%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYW 878
            +L  +   +++K   +DG  L++RR+    L     F+ +  V+ K+ H N+  +RG+Y 
Sbjct: 117  VLSRTRYGLLFKANYNDGMVLSIRRLPNGSLLNENLFKKEAEVLGKVKHRNITVLRGYYA 176

Query: 877  GA-DEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKHVHG 701
            G  D +L++YD++PNG+L+             L W +R  IA G+ARGL ++H+   VHG
Sbjct: 177  GPPDLRLLVYDYMPNGNLSTLLQEASHQDGHVLNWPMRHLIALGIARGLGFLHQSNMVHG 236

Query: 700  NLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSAV 521
            ++KP N+L DAD E  + DFGL+RL +     S                           
Sbjct: 237  DIKPQNVLFDADFEAHISDFGLDRLTIRSPSRS--------------------------- 269

Query: 520  SGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                  + + + +G   Y++PE+  S +   + D++SFG+VLLE+LTGK
Sbjct: 270  ------AVTANTIGTLGYVSPEATLSGEITRESDIYSFGIVLLEILTGK 312



>gb:AX088876_1461047 Sequence 1 from Patent
            WO0114563.>gb:AX825703_1475974 Sequence 1 from Patent
            WO03072763.>gb:AY028699_1559159 Brassica napus receptor
            protein kinase PERK1 mRNA, complete cds.
          Length = 647

 Score =  131 bits (329), Expect = 3e-29
 Identities = 96/314 (30%), Positives = 149/314 (47%), Gaps = 12/314 (3%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            + A +LG  G   ++K VL  G  +AV+++        REF+ ++ +IS++ H +LV + 
Sbjct: 276  SEANLLGQGGFGYVHKGVLPSGKEVAVKQLKVGSGQGEREFQAEVEIISRVHHRHLVSLV 335

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE--- 719
            G+     ++L++Y+FVPN +L    H +G  +   + W  RLKIA G A+GLSY+HE   
Sbjct: 336  GYCIAGAKRLLVYEFVPNNNLELHLHGEGRPT---MEWSTRLKIALGSAKGLSYLHEDCN 392

Query: 718  KKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDS 539
             K +H ++K SNIL+D   E KV DFGL ++      S    + S+R             
Sbjct: 393  PKIIHRDIKASNILIDFKFEAKVADFGLAKIA-----SDTNTHVSTR------------- 434

Query: 538  FPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK----- 374
                              +G   Y+APE   S K   K DVFSFGVVLLEL+TG+     
Sbjct: 435  -----------------VMGTFGYLAPEYAASGKLTEKSDVFSFGVVLLELITGRRPVDA 477

Query: 373  --IIVSDEMV--PGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVP 206
              + V D +V    P +    E+     +AD  +                    C+    
Sbjct: 478  NNVYVDDSLVDWARPLLNRASEQGDFEGLADAKMNNGYDREEMARMVACAAA--CVRHSA 535

Query: 205  QKRPTMKEVVQALD 164
            ++RP M ++V+AL+
Sbjct: 536  RRRPRMSQIVRALE 549



>pir|T48175|T48175 receptor like protein kinase - Arabidopsis
            thaliana>gb:ATF7A7_1550906 Arabidopsis thaliana DNA
            chromosome 5, BAC clone F7A7 (ESSA
            project).>gb:BT000489_1634767 Arabidopsis thaliana
            receptor like protein kinase (At5g01540/F7A7_60) mRNA,
            complete cds.>gb:AF361597_1791343 Arabidopsis thaliana
            AT5g01540/F7A7_60 mRNA, complete cds.
          Length = 682

 Score =  131 bits (329), Expect = 3e-29
 Identities = 95/308 (30%), Positives = 146/308 (47%), Gaps = 7/308 (2%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYW 878
            I+G  G   ++K  L +   +AV+++  S     REF  +I  + KL H NLV ++G+  
Sbjct: 372  IIGTGGFGTVFKGKLPNSDPIAVKKIIPSSRQGVREFVAEIESLGKLRHKNLVNLQGWCK 431

Query: 877  GADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIH---EKKHV 707
              ++ L+IYD++PNGSL +  +     S   L W  R +IA+G+A GL Y+H   EK  +
Sbjct: 432  HKNDLLLIYDYIPNGSLDSLLYTVPRRSGAVLSWNARFQIAKGIASGLLYLHEEWEKIVI 491

Query: 706  HGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDS 527
            H ++KPSN+L+D+ M P++GDFGL RL   G                             
Sbjct: 492  HRDVKPSNVLIDSKMNPRLGDFGLARLYERG----------------------------- 522

Query: 526  AVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG-KIIVSDEMV 350
                  T S + + +G   Y+APE  R+  P+   DVF+FGV+LLE++ G K   S    
Sbjct: 523  ------TLSETTALVGTIGYMAPELSRNGNPSSASDVFAFGVLLLEIVCGRKPTDSGTFF 576

Query: 349  PGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVVQA 170
                VM +    ++L   D   R                G  C    P  RP+M+ V++ 
Sbjct: 577  LVDWVMELHANGEILSAIDP--RLGSGYDGGEARLALAVGLLCCHQKPASRPSMRIVLRY 634

Query: 169  L---DNIP 155
            L   +N+P
Sbjct: 635  LNGEENVP 642



>pir|T04587|T04587 hypothetical protein F23E13.70 - Arabidopsis
            thaliana>gb:ATCHRIV84_1547578 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 84.>gb:ATF23E13_1549746
            Arabidopsis thaliana DNA chromosome 4, BAC clone F23E13
            (ESSAII project).
          Length = 1134

 Score =  131 bits (329), Expect = 3e-29
 Identities = 71/229 (31%), Positives = 118/229 (51%), Gaps = 1/229 (0%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYW 878
            +L  +   +++K   +DG  L++RR+    L     F+ +  V+ K+ H N+  +RG+Y 
Sbjct: 844  VLSRTRYGLLFKANYNDGMVLSIRRLPNGSLLNENLFKKEAEVLGKVKHRNITVLRGYYA 903

Query: 877  GA-DEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKHVHG 701
            G  D +L++YD++PNG+L+             L W +R  IA G+ARGL ++H+   VHG
Sbjct: 904  GPPDLRLLVYDYMPNGNLSTLLQEASHQDGHVLNWPMRHLIALGIARGLGFLHQSNMVHG 963

Query: 700  NLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSAV 521
            ++KP N+L DAD E  + DFGL+RL +     S                           
Sbjct: 964  DIKPQNVLFDADFEAHISDFGLDRLTIRSPSRS--------------------------- 996

Query: 520  SGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                  + + + +G   Y++PE+  S +   + D++SFG+VLLE+LTGK
Sbjct: 997  ------AVTANTIGTLGYVSPEATLSGEITRESDIYSFGIVLLEILTGK 1039



>pir|T04124|T04124 receptor-like protein kinase (EC 2.7.1.-) -
            rice>gb:OSTMK_1698389 O.sativa mRNA for leucine rich
            repeat receptor-like kinase.
          Length = 962

 Score =  131 bits (329), Expect = 3e-29
 Identities = 82/233 (35%), Positives = 123/233 (52%), Gaps = 5/233 (2%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRV--GESGLDRFREFENQIRVISKLVHPNLVRIRGF 884
            +LG  G   +YK  L DGT +AV+R+  G  G     EF+++I V++K+ H NLV + G+
Sbjct: 612  VLGRGGFGTVYKGELHDGTKIAVKRMEAGVMGNKGLNEFKSEIAVLTKVRHRNLVSLLGY 671

Query: 883  YWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIH---EKK 713
                +E++++Y+++P G+L+         + R L W+ RL IA  VARG+ Y+H   ++ 
Sbjct: 672  CLDGNERILVYEYMPQGTLSQHLFEWKEHNLRPLEWKKRLSIALDVARGVEYLHSLAQQT 731

Query: 712  HVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFP 533
             +H +LKPSNILL  DM+ KV DFGL RL  A G+        +  FG            
Sbjct: 732  FIHRDLKPSNILLGDDMKAKVADFGLVRLAPADGKCVSVETRLAGTFG------------ 779

Query: 532  DSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                                 Y+APE   + +   K DVFSFGV+L+EL+TG+
Sbjct: 780  ---------------------YLAPEYAVTGRVTTKADVFSFGVILMELITGR 811



>gb:AP005679_1855870 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, BAC
            clone:OJ1210_A07.>gb:AP005742_1856970 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 9, PAC
            clone:P0489D11.
          Length = 854

 Score =  130 bits (328), Expect = 4e-29
 Identities = 101/310 (32%), Positives = 148/310 (47%), Gaps = 8/310 (2%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            + A ++G  G   +YK VLD G  +AV+R+         EF N++ +I+KL H NLVR+ 
Sbjct: 536  SEASLIGKGGFGKVYKGVLD-GREVAVKRLSSWSEQGIVEFRNEVVLIAKLQHRNLVRLV 594

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH 710
            G     DEKL+IY+++PN SL  +  +  G     L W  R KI +GVARGL Y+H+   
Sbjct: 595  GCSIEGDEKLLIYEYMPNKSLDASLFK--GKRKSVLDWSTRFKIVKGVARGLLYLHQDSR 652

Query: 709  ---VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDS 539
               +H +LK SNILLDA+M PK+ DFG+ R+   G    ++V        +KR       
Sbjct: 653  LTIIHRDLKASNILLDAEMNPKISDFGMARIF--GNNQQKEV--------TKR------- 695

Query: 538  FPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSD 359
                              +G   Y+APE       + K DV+SFGV+LLE+++G  I S 
Sbjct: 696  -----------------VVGTYGYMAPEYAMGGIFSMKSDVYSFGVLLLEIVSGSKISSI 738

Query: 358  EMVPGPPVMGVE-----EKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRP 194
            +++   P + V       + K   M D  I A+                 C+      RP
Sbjct: 739  DLIEDSPNLPVYAWNLWNEGKADIMIDSTITANCLLDEVILCIHVALL--CVQENLNDRP 796

Query: 193  TMKEVVQALD 164
             M +VV  L+
Sbjct: 797  LMSDVVLILE 806



>gb:AP003736_1832655 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OJ1008_E09.>gb:AP005786_1857853 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, PAC
            clone:P0458H05.
          Length = 702

 Score =  130 bits (328), Expect = 4e-29
 Identities = 83/235 (35%), Positives = 121/235 (51%), Gaps = 3/235 (1%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            A   ++G  G  ++YK VL DG  +AV+R+ +S      E ++++ +++KL H NLVR+ 
Sbjct: 371  ADTKMIGQGGFGMVYKGVLPDGQEIAVKRLCQSSRQGIGELKSELILVAKLYHKNLVRLI 430

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK-- 716
            G      EK+++Y+++PNGSL           +R L W  R KI  G+ARGL Y+HE   
Sbjct: 431  GVCLEQQEKILVYEYMPNGSLDIVLFDT--DKNRELDWGKRFKIINGIARGLQYLHEDSQ 488

Query: 715  -KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDS 539
             K VH +LK SNILLD D  PK+ DFGL ++   GG+ S  V                  
Sbjct: 489  LKIVHRDLKASNILLDFDYSPKISDFGLAKIF--GGDQSEDV------------------ 528

Query: 538  FPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                          +    G   Y+APE       + K DVFSFGV++LE++TG+
Sbjct: 529  --------------TNRIAGTYGYMAPEYAMRGNYSIKSDVFSFGVLVLEIITGR 569



>gb:AY463361_1607685 Oryza sativa (indica cultivar-group)
            benzothiadiazole-induced somatic embryogenesis receptor
            kinase 1 (BISERK1) mRNA, complete cds.
          Length = 624

 Score =  130 bits (328), Expect = 4e-29
 Identities = 98/309 (31%), Positives = 156/309 (50%), Gaps = 11/309 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIRGFY 881
            ILG  G   +YK  L DG+ +AV+R+ E        +F+ ++ +IS  VH NL+R+RGF 
Sbjct: 306  ILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFC 365

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KH 710
                E+L++Y ++ NGS+A+   R+   S   L W  R +IA G ARGLSY+H+    K 
Sbjct: 366  MTPTERLLVYPYMANGSVASRL-RERPPSEPPLDWRTRRRIALGSARGLSYLHDHCDPKI 424

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLD D E  VGDFGL +L+                         +D+   
Sbjct: 425  IHRDVKAANILLDEDFEAVVGDFGLAKLM-----------------------DYKDTHVT 461

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG-------KI 371
            +AV G          +G   +IAPE L + K + K DVF +G++LLEL+TG       ++
Sbjct: 462  TAVRG---------TIG---HIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARL 509

Query: 370  IVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
               D+++    V G+ ++ ++  + D  ++++                 C    P +RP 
Sbjct: 510  ANDDDVMLLDWVKGLLKEKRLEMLVDPDLQSNYIDVEVESLIQVALL--CTQGSPTERPK 567

Query: 190  MKEVVQALD 164
            M EVV+ L+
Sbjct: 568  MAEVVRMLE 576



>gb:AY162176_1585779 Medicago truncatula somatic embryogenesis
            receptor kinase 1 (SERK1) mRNA, complete
            cds.>gb:AY162177_1585780 Medicago truncatula somatic
            embryogenesis receptor kinase 1 (SERK1) gene, complete
            cds.
          Length = 627

 Score =  130 bits (328), Expect = 4e-29
 Identities = 97/309 (31%), Positives = 154/309 (49%), Gaps = 11/309 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIRGFY 881
            ILG  G   +YK  L DG+ +AV+R+ E        +F+ ++ +IS  VH NL+R+RGF 
Sbjct: 309  ILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFC 368

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KH 710
                E+L++Y ++ NGS+A+ C R+       L W  R +IA G ARGLSY+H+    K 
Sbjct: 369  MTPTERLLVYPYMANGSVAS-CLRERPPHQEPLDWPTRKRIALGSARGLSYLHDHCDPKI 427

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLD + E  VGDFGL +L+                         +D+   
Sbjct: 428  IHRDVKAANILLDEEFEAVVGDFGLAKLM-----------------------DYKDTHVT 464

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG-------KI 371
            +AV G          +G   +IAPE L + K + K DVF +G++LLEL+TG       ++
Sbjct: 465  TAVRG---------TIG---HIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARL 512

Query: 370  IVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
               D+++    V G+ ++ K+  + D  ++ +                 C    P  RP 
Sbjct: 513  ANDDDVMLLDWVKGLLKEKKLEMLVDPDLKTNYIEAEVEQLIQVALL--CTQGSPMDRPK 570

Query: 190  MKEVVQALD 164
            M +VV+ L+
Sbjct: 571  MSDVVRMLE 579



>gb:AY059897_1564741 Arabidopsis thaliana receptor protein kinase-like
            protein (At5g67200; K21H1.16) mRNA, complete
            cds.>gb:BT003370_1636793 Arabidopsis thaliana receptor
            protein kinase-like protein (At5g67200) mRNA, complete
            cds.
          Length = 669

 Score =  130 bits (328), Expect = 4e-29
 Identities = 105/319 (32%), Positives = 149/319 (46%), Gaps = 15/319 (4%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRV--GESGLDRFREFENQIRVISKLVHPNLVR 896
            ASA +LG     I YK VLD+   + V+R+   ++ +     FEN + ++  L H NLV 
Sbjct: 394  ASAELLGRGSVGITYKAVLDNQLIVTVKRLDAAKTAVTSEEAFENHMEIVGGLRHTNLVP 453

Query: 895  IRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK 716
            IR ++    E+L+IYD+ PNGSL N  H    S  + L W   LKIA  VA+GL YIH+ 
Sbjct: 454  IRSYFQSNGERLIIYDYHPNGSLFNLIHGSRSSRAKPLHWTSCLKIAEDVAQGLYYIHQT 513

Query: 715  KH--VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRD 542
                VHGNLK +NILL  D E  + D+ L  L                   +  S+AS D
Sbjct: 514  SSALVHGNLKSTNILLGQDFEACLTDYCLSVL-------------------TDSSSASPD 554

Query: 541  SFPDSAVSGGHTPSPSPSALGISPYIAPESLR-SLKPNPKWDVFSFGVVLLELLTGK--- 374
              PDS                 S Y APE  + S +P  K DV+SFGV++ ELLTGK   
Sbjct: 555  D-PDS-----------------SSYKAPEIRKSSRRPTSKCDVYSFGVLIFELLTGKNAS 596

Query: 373  ---IIVSDEMVPGPPVMGVEEK----SKVLRMADVAIRADMXXXXXXXXXXXXXGYNCIS 215
                +   +M+     M  EE+    +++  M + A                     C  
Sbjct: 597  RHPFMAPHDMLDWVRAMREEEEGTEDNRLGMMTETACL-------------------CRV 637

Query: 214  PVPQKRPTMKEVVQALDNI 158
              P++RPTM++V++ +  I
Sbjct: 638  TSPEQRPTMRQVIKMIQEI 656



>gb:AB188247_1529358 Oryza sativa (japonica cultivar-group) OsSERK1
            mRNA for SERK-family receptor-like protein kinase,
            complete cds.>gb:AP005164_1848543 Oryza sativa (japonica
            cultivar-group) genomic DNA, chromosome 8, BAC
            clone:OSJNBa0054L03.
          Length = 624

 Score =  130 bits (328), Expect = 4e-29
 Identities = 98/309 (31%), Positives = 156/309 (50%), Gaps = 11/309 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIRGFY 881
            ILG  G   +YK  L DG+ +AV+R+ E        +F+ ++ +IS  VH NL+R+RGF 
Sbjct: 306  ILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFC 365

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KH 710
                E+L++Y ++ NGS+A+   R+   S   L W  R +IA G ARGLSY+H+    K 
Sbjct: 366  MTPTERLLVYPYMANGSVASRL-RERPPSEPPLDWRTRRRIALGSARGLSYLHDHCDPKI 424

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLD D E  VGDFGL +L+                         +D+   
Sbjct: 425  IHRDVKAANILLDEDFEAVVGDFGLAKLM-----------------------DYKDTHVT 461

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG-------KI 371
            +AV G          +G   +IAPE L + K + K DVF +G++LLEL+TG       ++
Sbjct: 462  TAVRG---------TIG---HIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARL 509

Query: 370  IVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
               D+++    V G+ ++ ++  + D  ++++                 C    P +RP 
Sbjct: 510  ANDDDVMLLDWVKGLLKEKRLEMLVDPDLQSNYIDVEVESLIQVALL--CTQGSPTERPK 567

Query: 190  MKEVVQALD 164
            M EVV+ L+
Sbjct: 568  MAEVVRMLE 576



>gb:AB020742_1514573 Arabidopsis thaliana genomic DNA, chromosome 5,
            TAC clone:K21H1.
          Length = 651

 Score =  130 bits (328), Expect = 4e-29
 Identities = 105/319 (32%), Positives = 149/319 (46%), Gaps = 15/319 (4%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRV--GESGLDRFREFENQIRVISKLVHPNLVR 896
            ASA +LG     I YK VLD+   + V+R+   ++ +     FEN + ++  L H NLV 
Sbjct: 376  ASAELLGRGSVGITYKAVLDNQLIVTVKRLDAAKTAVTSEEAFENHMEIVGGLRHTNLVP 435

Query: 895  IRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK 716
            IR ++    E+L+IYD+ PNGSL N  H    S  + L W   LKIA  VA+GL YIH+ 
Sbjct: 436  IRSYFQSNGERLIIYDYHPNGSLFNLIHGSRSSRAKPLHWTSCLKIAEDVAQGLYYIHQT 495

Query: 715  KH--VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRD 542
                VHGNLK +NILL  D E  + D+ L  L                   +  S+AS D
Sbjct: 496  SSALVHGNLKSTNILLGQDFEACLTDYCLSVL-------------------TDSSSASPD 536

Query: 541  SFPDSAVSGGHTPSPSPSALGISPYIAPESLR-SLKPNPKWDVFSFGVVLLELLTGK--- 374
              PDS                 S Y APE  + S +P  K DV+SFGV++ ELLTGK   
Sbjct: 537  D-PDS-----------------SSYKAPEIRKSSRRPTSKCDVYSFGVLIFELLTGKNAS 578

Query: 373  ---IIVSDEMVPGPPVMGVEEK----SKVLRMADVAIRADMXXXXXXXXXXXXXGYNCIS 215
                +   +M+     M  EE+    +++  M + A                     C  
Sbjct: 579  RHPFMAPHDMLDWVRAMREEEEGTEDNRLGMMTETACL-------------------CRV 619

Query: 214  PVPQKRPTMKEVVQALDNI 158
              P++RPTM++V++ +  I
Sbjct: 620  TSPEQRPTMRQVIKMIQEI 638



>pir|F85057|F85057 receptor-like protein kinase [imported] -
            Arabidopsis thaliana>gb:ATCHRIV13_1544301 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            13.>gb:AY127017_1580471 Arabidopsis thaliana
            AT4g04570/F4H6_9 mRNA, complete cds.>gb:AF074021_1765944
            Arabidopsis thaliana BAC F4H6, chromosome IV, complete
            sequence.
          Length = 654

 Score =  130 bits (328), Expect = 4e-29
 Identities = 82/235 (34%), Positives = 122/235 (51%), Gaps = 3/235 (1%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            +S   LG  G   +YK    +G  +AV+R+ +       EF+N++ ++++L H NLV++ 
Sbjct: 349  SSENTLGQGGFGTVYKGTFPNGQEVAVKRLTKGSGQGDMEFKNEVSLLTRLQHKNLVKLL 408

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK-- 716
            GF    DE++++Y+FVPN SL +    +   S   L WEVR +I  G+ARGL Y+HE   
Sbjct: 409  GFCNEGDEEILVYEFVPNSSLDHFIFDEDKRSL--LTWEVRFRIIEGIARGLLYLHEDSQ 466

Query: 715  -KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDS 539
             K +H +LK SNILLDA+M PKV DFG  RL                             
Sbjct: 467  LKIIHRDLKASNILLDAEMNPKVADFGTARLF---------------------------- 498

Query: 538  FPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                      T + +    G   Y+APE L   + + K DV+SFGV+LLE+++G+
Sbjct: 499  ------DSDETRAETKRIAGTRGYMAPEYLNHGQISAKSDVYSFGVMLLEMISGE 547



>pir|G85056|G85056 probable receptor-like protein kinase [imported] -
            Arabidopsis thaliana>gb:ATCHRIV12_1544294 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            12.>gb:AF076243_1766167 Arabidopsis thaliana BAC T26N6
            from chromosome IV at 19.3 cM, complete sequence.
          Length = 646

 Score =  130 bits (328), Expect = 4e-29
 Identities = 83/230 (36%), Positives = 121/230 (52%), Gaps = 3/230 (1%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            LG  G   +YK +L  G  +AV+R+ +       EF+N++ ++++L H NLV++ GF   
Sbjct: 351  LGQGGFGSVYKGILPSGQEIAVKRLRKGSGQGGMEFKNEVLLLTRLQHRNLVKLLGFCNE 410

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---VH 704
             DE++++Y+FVPN SL +    +     R L W+VR  I  GVARGL Y+HE      +H
Sbjct: 411  KDEEILVYEFVPNSSLDHFIFDE--EKRRVLTWDVRYTIIEGVARGLLYLHEDSQLRIIH 468

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             +LK SNILLDA+M PKV DFG+ RL                +    R   SR       
Sbjct: 469  RDLKASNILLDAEMNPKVADFGMARLF---------------DMDETRGQTSR------- 506

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                         +G   Y+APE     + + K DV+SFGV+LLE+++GK
Sbjct: 507  ------------VVGTYGYMAPEYATYGQFSTKSDVYSFGVMLLEMISGK 544



>pir|S31429|S31429 S-receptor kinase (EC 2.7.1.-) precursor - wild
            cabbage>gb:BOSRKL_1633897 B.oleracea gene for S-receptor
            kinase-like protein.
          Length = 857

 Score =  130 bits (328), Expect = 4e-29
 Identities = 86/230 (37%), Positives = 126/230 (54%), Gaps = 3/230 (1%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            LG  G  I+YK +LD G  +AV+R+ ++ L    EF N++R+I++L H NLVRI G    
Sbjct: 535  LGQGGFGIVYKGMLD-GQEVAVKRLSKTSLQGIDEFMNEVRLIARLQHINLVRILGCCIE 593

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---VH 704
            ADEK++IY+++ N SL      K  SS+  L W+ R  I  GVARGL Y+H+      +H
Sbjct: 594  ADEKILIYEYLENSSLDYFLFGKKRSSN--LNWKDRFAIINGVARGLLYLHQDSRFRIIH 651

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             ++KPSNILLD  M PK+ DFG+ R+                         +RD      
Sbjct: 652  RDMKPSNILLDKYMIPKISDFGMARIF------------------------ARDE----- 682

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                 T + + +A+G   Y++PE       + K DVFSFGV++LE+++GK
Sbjct: 683  -----TEANTENAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSGK 727



>gb:AP004326_1840210 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, BAC clone:OJ1294_F06.
          Length = 1013

 Score =  130 bits (327), Expect = 5e-29
 Identities = 96/311 (30%), Positives = 148/311 (47%), Gaps = 12/311 (3%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFRE-FENQIRVISKLVHPNLVRIRGFYW 878
            +G      +Y+  + +G  +A++++  + +   R+ F+ ++R++ K  HPNL+ ++G+YW
Sbjct: 726  IGRGVFGTVYRASVGEGRVVAIKKLATASIVESRDDFDREVRILGKARHPNLLPLKGYYW 785

Query: 877  GADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KHV 707
                +L+I D+ P+GSL    H  G  +   L W  R +I  G ARGL+++H+      +
Sbjct: 786  TPQLQLLITDYAPHGSLEARLHGNGDGAFPPLTWAERFRIVAGTARGLAHLHQSFRPPMI 845

Query: 706  HGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDS 527
            H N+KPSNILLD    P VGDFGL RL+        K   SSR  G              
Sbjct: 846  HYNVKPSNILLDEQCNPMVGDFGLARLL----PKLDKHVMSSRFQGG------------- 888

Query: 526  AVSGGHTPSPSPSALGISPYIAPE-SLRSLKPNPKWDVFSFGVVLLELLTGKIIV---SD 359
                               Y+APE + +SL+ N K D++ FGV++LEL+TG+  V    D
Sbjct: 889  -----------------MGYVAPELACQSLRINEKCDIYGFGVLILELVTGRRAVEYGDD 931

Query: 358  EMV----PGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
            ++V        ++     S VL   D +I                 G  C S +P  RP+
Sbjct: 932  DVVILIDQVRVLLDHGGGSNVLECVDPSIG---EFPEEEVLPVLKLGMVCTSQIPSNRPS 988

Query: 190  MKEVVQALDNI 158
            M EVVQ L  I
Sbjct: 989  MAEVVQILQVI 999



>gb:AP004084_1837460 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1217_F02.
          Length = 427

 Score =  130 bits (327), Expect = 5e-29
 Identities = 91/318 (28%), Positives = 152/318 (47%), Gaps = 18/318 (5%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDD----------GTALAVRRVGESGLDRFREFENQIRVISKLVHP 908
            +LG  G   +YK  +D+          G  +AV+++    +  + E++++I  + +L HP
Sbjct: 99   VLGEGGFGRVYKGWVDEKTMNPVKGGTGMVVAVKKLNSESMQGYEEWQSEINFLGRLSHP 158

Query: 907  NLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSY 728
            NLV++ G+ +   E L++Y+F+  GSL N   +KG      L WE+RLKIA G ARGL++
Sbjct: 159  NLVKLLGYCFEDKELLLVYEFMAKGSLENHLFKKGCPP---LSWELRLKIAIGAARGLAF 215

Query: 727  IH--EKKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRST 554
            +H  EK+ ++ + K SNILLDA+   K+ DFGL +L   G  S                 
Sbjct: 216  LHASEKQVIYRDFKASNILLDANYNAKLSDFGLAKLGPTGSNS----------------- 258

Query: 553  ASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                               +   +G   Y APE + +     K DV+ FGVV+LE+++G+
Sbjct: 259  -----------------HITTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVMLEMMSGQ 301

Query: 373  IIVSDEMVPGPPVM------GVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISP 212
              +      G   +       + ++ K+ R+ D   R +                NC++ 
Sbjct: 302  RALDPNRPNGQLSLVDWAKPYLADRRKLARLMDP--RFEGQYNSKQAVQAAQLTLNCLAG 359

Query: 211  VPQKRPTMKEVVQALDNI 158
             P+ RP+MKEV++ L+ I
Sbjct: 360  EPRSRPSMKEVLETLERI 377



>gb:AK118052_1816052 Arabidopsis thaliana At5g62230 mRNA for unknown
            protein, complete cds, clone: RAFL19-29-O16.
          Length = 325

 Score =  130 bits (327), Expect = 5e-29
 Identities = 91/301 (30%), Positives = 136/301 (45%), Gaps = 3/301 (0%)
 Frame = -2

Query: 1060 YILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFY 881
            +I+G   SS +YK  L     +A++R+        REFE ++  I  + H N+V + G+ 
Sbjct: 11   FIIGYGASSTVYKCALKSFRPIAIKRLYNQYPHNLREFETELETIGSIRHRNIVSLHGYA 70

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE---KKH 710
                  L+ YD++ NGSL +  H  G      L WE RLKIA G A+GL+Y+H     + 
Sbjct: 71   LSPTGNLLFYDYMENGSLWDLLH--GSLKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRI 128

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K SNILLD + E  + DFG+ + + A      K + S+                 
Sbjct: 129  IHRDIKSSNILLDENFEAHLSDFGIAKSIPAS-----KTHAST----------------- 166

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMV 350
                           LG   YI PE  R+ + N K D++SFG+VLLELLTGK  V +E  
Sbjct: 167  -------------YVLGTIGYIDPEYARTSRINEKSDIYSFGIVLLELLTGKKAVDNEAN 213

Query: 349  PGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVVQA 170
                ++   + + V+   D  +                    C    P +RPTM EV + 
Sbjct: 214  LHQLILSKADDNTVMEAVDPEVTVTCMDLGHIRKTFQLALL-CTKRNPLERPTMLEVSRV 272

Query: 169  L 167
            L
Sbjct: 273  L 273



>gb:BT006440_1639327 Arabidopsis thaliana At1g60630 gene, complete
            cds.
          Length = 652

 Score =  130 bits (327), Expect = 5e-29
 Identities = 94/304 (30%), Positives = 139/304 (45%), Gaps = 5/304 (1%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            ASA  LG       YK V++ G  + V+R+ ++G  R  EF+  I ++ +L HPNLV +R
Sbjct: 351  ASAETLGRGTLGSTYKAVMESGFIITVKRLKDAGFPRMDEFKRHIEILGRLKHPNLVPLR 410

Query: 889  GFYWGADEKLVIYDFVPNGSLANACH-RKGGSSHRHLPWEVRLKIARGVARGLSYIHEKK 713
             ++   +E L++YD+ PNGSL +  H  K   S + L W   LKIA  +A GL YIH+  
Sbjct: 411  AYFQAKEECLLVYDYFPNGSLFSLIHGSKVSGSGKPLHWTSCLKIAEDLAMGLVYIHQNP 470

Query: 712  HV-HGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSF 536
             + HGNLK SN+LL  D E  + D+GL  L                              
Sbjct: 471  GLTHGNLKSSNVLLGPDFESCLTDYGLSDL------------------------------ 500

Query: 535  PDSAVSGGHTP-SPSPSALGISPYIAPE--SLRSLKPNPKWDVFSFGVVLLELLTGKIIV 365
                    H P S   ++     Y APE   LR     P  DV+SFGV+LLELLTG+   
Sbjct: 501  --------HDPYSIEDTSAASLFYKAPECRDLRKASTQPA-DVYSFGVLLLELLTGRTSF 551

Query: 364  SDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMK 185
             D  +       +    + +R  +  +  ++                C++  P+ RP M+
Sbjct: 552  KD--LVHKYGSDISTWVRAVREEETEVSEELNASEEKLQALLTIATACVAVKPENRPAMR 609

Query: 184  EVVQ 173
            EV++
Sbjct: 610  EVLK 613



>gb:AY085517_1570586 Arabidopsis thaliana clone 15535 mRNA, complete
            sequence.
          Length = 484

 Score =  130 bits (327), Expect = 5e-29
 Identities = 90/306 (29%), Positives = 150/306 (49%), Gaps = 7/306 (2%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYW 878
            I+G  G  ++Y+  L +GT +AV+++  +     ++F  ++  I  + H NLVR+ G+  
Sbjct: 171  IIGDGGYGVVYRGNLVNGTPVAVKKLLNNLGQADKDFRVEVEAIGHVRHKNLVRLLGYCM 230

Query: 877  GADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KHV 707
               +++++Y++V NG+L     R    +H +L WE R+KI  G A+ L+Y+HE    K V
Sbjct: 231  EGTQRMLVYEYVNNGNLEQWL-RGDNQNHEYLTWEARVKILIGTAKALAYLHEAIEPKVV 289

Query: 706  HGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDS 527
            H ++K SNIL+D     K+ DFGL +L+           G+ ++F + R           
Sbjct: 290  HRDIKSSNILIDDKFNSKISDFGLAKLL-----------GADKSFITTR----------- 327

Query: 526  AVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMVP 347
                          +G   Y+APE   S   N K DV+SFGVVLLE +TG+  V D   P
Sbjct: 328  -------------VMGTFGYVAPEYANSGLLNEKSDVYSFGVVLLEAITGRYPV-DYARP 373

Query: 346  GPPVMGVEEKSKVL--RMADVAIRADMXX--XXXXXXXXXXXGYNCISPVPQKRPTMKEV 179
             P V  VE    ++  R ++  +  ++                  C+ P+ +KRP M +V
Sbjct: 374  PPEVHLVEWLKMMVQQRRSEEVVDPNLETKPSTSALKRTLLTALRCVDPMSEKRPRMSQV 433

Query: 178  VQALDN 161
             + L++
Sbjct: 434  ARMLES 439



>gb:AB032474_1518697 Brassica oleracea SRK60 mRNA for S60 S-locus
            receptor kinase, complete cds.
          Length = 859

 Score =  130 bits (327), Expect = 5e-29
 Identities = 86/230 (37%), Positives = 125/230 (54%), Gaps = 3/230 (1%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            LG  G  I+YK +LD G  +AV+R+ ++ L    EF N++R+I++L H NLVRI G    
Sbjct: 537  LGQGGFGIVYKGMLD-GQEVAVKRLSKTSLQGIDEFMNEVRLIARLQHINLVRILGCCIE 595

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---VH 704
            ADEK++IY+++ N SL      K  SS+  L W+ R  I  GVARGL Y+H+      +H
Sbjct: 596  ADEKILIYEYLENSSLDYFLFGKKRSSN--LNWKDRFAITNGVARGLLYLHQDSRFRIIH 653

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             +LKP NILLD  M PK+ DFG+ R+                         +RD      
Sbjct: 654  RDLKPGNILLDKYMIPKISDFGMARIF------------------------ARDE----- 684

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                 T + + +A+G   Y++PE       + K DVFSFGV++LE+++GK
Sbjct: 685  -----TQAMTDNAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSGK 729



>gb:AB024421S2_1515950 Brassica oleracea SRK13-b gene, exon 2, 3, 4,
            5, 6, 7 and complete cds.
          Length = 856

 Score =  130 bits (327), Expect = 5e-29
 Identities = 86/230 (37%), Positives = 125/230 (54%), Gaps = 3/230 (1%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            LG  G  I+YK +LD G  +AV+R+ ++ L    EF N++R+I++L H NLVRI G    
Sbjct: 534  LGQGGFGIVYKGMLD-GQEVAVKRLSKTSLQGIDEFMNEVRLIARLQHINLVRILGCCIE 592

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---VH 704
            ADEK++IY+++ N SL      K  SS+  L W+ R  I  GVARGL Y+H+      +H
Sbjct: 593  ADEKILIYEYLENSSLDYFLFGKKRSSN--LNWKDRFAITNGVARGLLYLHQDSRFRIIH 650

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             +LKP NILLD  M PK+ DFG+ R+                         +RD      
Sbjct: 651  RDLKPGNILLDKYMIPKISDFGMARIF------------------------ARDE----- 681

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                 T + + +A+G   Y++PE       + K DVFSFGV++LE+++GK
Sbjct: 682  -----TQARTDNAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSGK 726



>gb:AB024419S2_1515949 Brassica oleracea SRK13 gene, exon 2, 3, 4, 5,
            6, 7 and complete cds.
          Length = 854

 Score =  130 bits (327), Expect = 5e-29
 Identities = 86/230 (37%), Positives = 125/230 (54%), Gaps = 3/230 (1%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            LG  G  I+YK +LD G  +AV+R+ ++ L    EF N++R+I++L H NLVRI G    
Sbjct: 532  LGQGGFGIVYKGMLD-GQEVAVKRLSKTSLQGIDEFMNEVRLIARLQHINLVRILGCCIE 590

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---VH 704
            ADEK++IY+++ N SL      K  SS+  L W+ R  I  GVARGL Y+H+      +H
Sbjct: 591  ADEKILIYEYLENSSLDYFLFGKKRSSN--LNWKDRFAITNGVARGLLYLHQDSRFRIIH 648

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             +LKP NILLD  M PK+ DFG+ R+                         +RD      
Sbjct: 649  RDLKPGNILLDKYMIPKISDFGMARIF------------------------ARDE----- 679

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                 T + + +A+G   Y++PE       + K DVFSFGV++LE+++GK
Sbjct: 680  -----TQAMTDNAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSGK 724



>pir|E96631|E96631 probable receptor kinase F8A5.15 [imported] -
            Arabidopsis thaliana>gb:AE005173_893739 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC002292_1530143 Arabidopsis thaliana BAC
            F8A5, complete sequence.
          Length = 645

 Score =  130 bits (327), Expect = 5e-29
 Identities = 94/304 (30%), Positives = 139/304 (45%), Gaps = 5/304 (1%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            ASA  LG       YK V++ G  + V+R+ ++G  R  EF+  I ++ +L HPNLV +R
Sbjct: 344  ASAETLGRGTLGSTYKAVMESGFIITVKRLKDAGFPRMDEFKRHIEILGRLKHPNLVPLR 403

Query: 889  GFYWGADEKLVIYDFVPNGSLANACH-RKGGSSHRHLPWEVRLKIARGVARGLSYIHEKK 713
             ++   +E L++YD+ PNGSL +  H  K   S + L W   LKIA  +A GL YIH+  
Sbjct: 404  AYFQAKEECLLVYDYFPNGSLFSLIHGSKVSGSGKPLHWTSCLKIAEDLAMGLVYIHQNP 463

Query: 712  HV-HGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSF 536
             + HGNLK SN+LL  D E  + D+GL  L                              
Sbjct: 464  GLTHGNLKSSNVLLGPDFESCLTDYGLSDL------------------------------ 493

Query: 535  PDSAVSGGHTP-SPSPSALGISPYIAPE--SLRSLKPNPKWDVFSFGVVLLELLTGKIIV 365
                    H P S   ++     Y APE   LR     P  DV+SFGV+LLELLTG+   
Sbjct: 494  --------HDPYSIEDTSAASLFYKAPECRDLRKASTQPA-DVYSFGVLLLELLTGRTSF 544

Query: 364  SDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMK 185
             D  +       +    + +R  +  +  ++                C++  P+ RP M+
Sbjct: 545  KD--LVHKYGSDISTWVRAVREEETEVSEELNASEEKLQALLTIATACVAVKPENRPAMR 602

Query: 184  EVVQ 173
            EV++
Sbjct: 603  EVLK 606



>pir|T51453|T51453 serine/threonine specific protein kinase-like -
            Arabidopsis thaliana>gb:ATF2G14_1550456 Arabidopsis
            thaliana DNA chromosome 5, BAC clone F2G14 (ESSA
            project).>gb:AY062520_1565176 Arabidopsis thaliana
            serine/threonine specific protein kinase-like (At5g15080;
            F2G14_200) mRNA, complete cds.>gb:BT002577_1636180
            Arabidopsis thaliana serine/threonine specific protein
            kinase-like (At5g15080) mRNA, complete cds.
          Length = 493

 Score =  130 bits (327), Expect = 5e-29
 Identities = 99/332 (29%), Positives = 153/332 (46%), Gaps = 20/332 (6%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDD----------GTALAVRRVGESGLDRFREFENQIRVISKLVHP 908
            +LG  G   ++K  +++          G  +AV+ +   GL   +E+  +I  +  L+HP
Sbjct: 147  LLGEGGFGCVFKGWIEENGTAPVKPGTGLTVAVKTLNPDGLQGHKEWLAEINFLGNLLHP 206

Query: 907  NLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSY 728
            NLV++ G+    D++L++Y+F+P GSL N   R+       LPW +R+KIA G A+GLS+
Sbjct: 207  NLVKLVGYCIEDDQRLLVYEFMPRGSLENHLFRRS----LPLPWSIRMKIALGAAKGLSF 262

Query: 727  IHE---KKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRS 557
            +HE   K  ++ + K SNILLDAD   K+ DFGL +          K + S+R       
Sbjct: 263  LHEEALKPVIYRDFKTSNILLDADYNAKLSDFGLAK----DAPDEGKTHVSTR------- 311

Query: 556  TASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG 377
                                    +G   Y APE + +     K DV+SFGVVLLE+LTG
Sbjct: 312  -----------------------VMGTYGYAAPEYVMTGHLTSKSDVYSFGVVLLEMLTG 348

Query: 376  KIIVSDEMVPGPPVMGVE-------EKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCI 218
            +  + D+  P      VE       +K +  R+ D  +                    C+
Sbjct: 349  RRSM-DKNRPNGEHNLVEWARPHLLDKRRFYRLLDPRLEGHFSIKGAQKVTQLAA--QCL 405

Query: 217  SPVPQKRPTMKEVVQALDNIPTXXXXXXSYFY 122
            S  P+ RP M +VV+AL  +P       S +Y
Sbjct: 406  SRDPKIRPKMSDVVEALKPLPHLKDMASSSYY 437



>sp|P17801|KPRO_MAIZE Putative receptor protein kinase ZmPK1 precursor
            (EC 2.7.1.37).>pir|S10930|S10930 S-receptor kinase (EC
            2.7.1.-) homolog PK1 precursor - maize>gb:ZMPK1_1731984
            Maize mRNA for putative protein kinase.>gb:ZMPK1A_1731985
            Z.mays PK1 gene for receptor-like protein kinase.
          Length = 817

 Score =  130 bits (327), Expect = 5e-29
 Identities = 103/313 (32%), Positives = 147/313 (46%), Gaps = 17/313 (5%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            LG   S  +YK VL+D   +AV+++ E+       F+ ++ VI ++ H NLVRI GF   
Sbjct: 540  LGRGESGTVYKGVLEDDRHVAVKKL-ENVRQGKEVFQAELSVIGRINHMNLVRIWGFCSE 598

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE---KKHVH 704
               +L++ ++V NGSLAN    +GG+    L WE R  IA GVA+GL+Y+H    +  +H
Sbjct: 599  GSHRLLVSEYVENGSLANILFSEGGNI--LLDWEGRFNIALGVAKGLAYLHHECLEWVIH 656

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             ++KP NILLD   EPK+ DFGL +L+  G        GS++N    R T          
Sbjct: 657  CDVKPENILLDQAFEPKITDFGLVKLLNRG--------GSTQNVSHVRGTLG-------- 700

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMVPG 344
                              YIAPE + SL    K DV+S+GVVLLELLTG  +   E+V G
Sbjct: 701  ------------------YIAPEWVSSLPITAKVDVYSYGVVLLELLTGTRV--SELVGG 740

Query: 343  PPVMGVEEKSKVLRMADVAIRADMXX--------------XXXXXXXXXXXGYNCISPVP 206
               +      K++RM    +  +                              +C+    
Sbjct: 741  TDEVH-SMLRKLVRMLSAKLEGEEQSWIDGYLDSKLNRPVNYVQARTLIKLAVSCLEEDR 799

Query: 205  QKRPTMKEVVQAL 167
             KRPTM+  VQ L
Sbjct: 800  SKRPTMEHAVQTL 812



>gb:AJ841697_1814400 Poa pratensis serk2 gene for somatic
            embryogenesis receptor-like kinase 2, exons 1-11, allele
            1.
          Length = 629

 Score =  130 bits (326), Expect = 7e-29
 Identities = 98/313 (31%), Positives = 157/313 (50%), Gaps = 11/313 (3%)
 Frame = -2

Query: 1066 SAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRG 887
            S  ILG  G  ++Y+  L +GT +AV+R+ +  +    +F+ ++ +I   VH NL+R+ G
Sbjct: 309  SKNILGQGGFGVVYRGCLRNGTLVAVKRLKDPDVTGEVQFQTEVELIGLAVHRNLLRLYG 368

Query: 886  FYWGADEKLVIYDFVPNGSLANAC--HRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK- 716
            F   + E+L++Y ++PNGS+A+    +R G  S   L W  R++IA G ARGL Y+HE+ 
Sbjct: 369  FCMTSKERLLVYPYMPNGSVADRLREYRHGKPS---LDWSKRMRIAIGAARGLLYLHEQC 425

Query: 715  --KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRD 542
              K +H ++K +NILLD   E  VGDFGL +L+                         +D
Sbjct: 426  NPKIIHRDVKAANILLDESFEAVVGDFGLAKLL-----------------------DRQD 462

Query: 541  SFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVS 362
            S   +AV G          +G   +IAPE L + + + K DV+ FG++LLEL+TG   +S
Sbjct: 463  SHVTTAVRG---------TIG---HIAPEYLSTGQSSEKTDVYGFGILLLELITGPKTLS 510

Query: 361  DEMVPGPP------VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQK 200
            +             V  ++E+ K+ ++ D  ++                   C    P  
Sbjct: 511  NGHGQSQKGMILDWVRELKEEKKLDKLVDRDLKD--LFDIAELECSVDVIIQCTLTNPIL 568

Query: 199  RPTMKEVVQALDN 161
            RP M EV+QAL++
Sbjct: 569  RPKMSEVLQALES 581



>gb:AC129720_1740666 Oryza sativa (japonica cultivar-group) chromosome
            5 clone P0683F12, complete sequence.>gb:AC134931_1741949
            Oryza sativa (japonica cultivar-group) chromosome 5 clone
            OSJNBb0079L11, complete sequence.
          Length = 440

 Score =  130 bits (326), Expect = 7e-29
 Identities = 93/306 (30%), Positives = 148/306 (48%), Gaps = 9/306 (2%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYW 878
            +LG  G   +YK  L++G  +AV+R+  SG    +EF  ++ ++S L HPNLV + G+  
Sbjct: 91   LLGEGGFGRVYKGQLENGQLVAVKRLDLSGFQGNKEFLVEVMMLSLLNHPNLVSLVGYCS 150

Query: 877  GADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---V 707
              D++L++Y+++ +GSLA+    +       L W +R+KIA G A+GL Y+HEK +   +
Sbjct: 151  DGDQRLLVYEYMAHGSLADHL-LENTPDQVPLSWHIRMKIAHGTAKGLEYLHEKANPPVI 209

Query: 706  HGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDS 527
            + +LK  NILLD +  PK+ DFGL +L   GG    K + S+R                 
Sbjct: 210  YRDLKSPNILLDNEYNPKLSDFGLAKLGPVGG----KAHISTR----------------- 248

Query: 526  AVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVS----- 362
                          +G   Y APE +++ +   K DV+SFGV LLEL+TG+  V      
Sbjct: 249  -------------VMGTYGYCAPEYIKTRQLTTKTDVYSFGVFLLELITGRRAVDSSRPE 295

Query: 361  -DEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMK 185
             D+++       ++  S+   + D  +R D                 C+      RP M 
Sbjct: 296  CDQILVKWAKPMLKNPSRHHELVDPLLRGDYPRGDLNQAVAVAAM--CLQEEASVRPYMS 353

Query: 184  EVVQAL 167
            + V AL
Sbjct: 354  DTVVAL 359



>gb:ZMA277702_1731487 Zea mays mRNA for SERK1
            protein.>gb:ZMA400868_1731516 Zea mays serk1 gene for
            somatic embryogenesis receptor-like kinase 1, exons 1-11.
          Length = 622

 Score =  130 bits (326), Expect = 7e-29
 Identities = 96/309 (31%), Positives = 154/309 (49%), Gaps = 11/309 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIRGFY 881
            +LG  G   +YK  L DG+ +AV+R+ E        +F+ ++ +IS  VH NL+R+RGF 
Sbjct: 305  VLGRGGFGKVYKGRLTDGSLVAVKRLKEERTPGGELQFQTEVELISMAVHRNLLRLRGFC 364

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KH 710
                E+L++Y ++ NGS+A+   R+   +   L WE R +IA G ARGLSY+H+    K 
Sbjct: 365  MTPTERLLVYPYMANGSVASRL-RERAPNEPPLEWETRARIALGSARGLSYLHDHCDPKI 423

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLD D E  VGDFGL +L+                         +D+   
Sbjct: 424  IHRDVKAANILLDEDFEAVVGDFGLAKLM-----------------------DYKDTHVT 460

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG-------KI 371
            +AV G          +G   +IAPE L + K + K DVF +G++LLEL+TG       ++
Sbjct: 461  TAVRG---------TIG---HIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARL 508

Query: 370  IVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
               D+++    V  + ++ K+ ++ D  ++                   C    P +RP 
Sbjct: 509  ANDDDVMLLDWVKALLKEKKLEQLVDPDLQGRYVDQEVESLIQVALL--CTQGSPMERPK 566

Query: 190  MKEVVQALD 164
            M EV + L+
Sbjct: 567  MSEVARMLE 575



>gb:AX138085_1462208 Sequence 31 from Patent EP1094113.
          Length = 597

 Score =  130 bits (326), Expect = 7e-29
 Identities = 88/237 (37%), Positives = 127/237 (53%), Gaps = 6/237 (2%)
 Frame = -2

Query: 1066 SAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIR 890
            S  ILG  G  I+YK  L+DGT +AV+R+ +  +     +F+ ++  IS  +H NL+R+R
Sbjct: 268  SKNILGRGGYGIVYKGHLNDGTLVAVKRLKDCNIAGGEVQFQTEVETISLALHRNLLRLR 327

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK-- 716
            GF     E++++Y ++PNGS+A+   +        L W  R KIA G ARGL Y+HE+  
Sbjct: 328  GFCSSNQERILVYPYMPNGSVASRL-KDNIRGEPALDWSRRKKIAVGTARGLVYLHEQCD 386

Query: 715  -KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDS 539
             K +H ++K +NILLD D E  VGDFGL +L+                         RDS
Sbjct: 387  PKIIHRDVKAANILLDEDFEAVVGDFGLAKLL-----------------------DHRDS 423

Query: 538  FPDSAVSG--GHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
               +AV G  GH              IAPE L + + + K DVF FG++LLEL+TG+
Sbjct: 424  HVTTAVRGTVGH--------------IAPEYLSTGQSSEKTDVFGFGILLLELITGQ 466



>gb:CQ768545_1451790 Sequence 40 from Patent
            WO2004007712.>gb:AY056294_1563607 Arabidopsis thaliana
            putative receptor kinase (At1g60800) mRNA, complete
            cds.>gb:AY150495_1585060 Arabidopsis thaliana putative
            receptor kinase (At1g60800) mRNA, complete cds.
          Length = 632

 Score =  130 bits (326), Expect = 7e-29
 Identities = 88/237 (37%), Positives = 127/237 (53%), Gaps = 6/237 (2%)
 Frame = -2

Query: 1066 SAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIR 890
            S  ILG  G  I+YK  L+DGT +AV+R+ +  +     +F+ ++  IS  +H NL+R+R
Sbjct: 303  SKNILGRGGYGIVYKGHLNDGTLVAVKRLKDCNIAGGEVQFQTEVETISLALHRNLLRLR 362

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK-- 716
            GF     E++++Y ++PNGS+A+   +        L W  R KIA G ARGL Y+HE+  
Sbjct: 363  GFCSSNQERILVYPYMPNGSVASRL-KDNIRGEPALDWSRRKKIAVGTARGLVYLHEQCD 421

Query: 715  -KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDS 539
             K +H ++K +NILLD D E  VGDFGL +L+                         RDS
Sbjct: 422  PKIIHRDVKAANILLDEDFEAVVGDFGLAKLL-----------------------DHRDS 458

Query: 538  FPDSAVSG--GHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
               +AV G  GH              IAPE L + + + K DVF FG++LLEL+TG+
Sbjct: 459  HVTTAVRGTVGH--------------IAPEYLSTGQSSEKTDVFGFGILLLELITGQ 501



>pir|T10569|T10569 probable serine/threonine-specific protein kinase
            (EC 2.7.1.-) F25E4.110 - Arabidopsis
            thaliana>gb:ATCHRIV32_1544914 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 32.>gb:ATF25E4_1549986
            Arabidopsis thaliana DNA chromosome 4, BAC clone F25E4
            (ESSA project).
          Length = 636

 Score =  130 bits (326), Expect = 7e-29
 Identities = 82/231 (35%), Positives = 122/231 (52%), Gaps = 3/231 (1%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYW 878
            +LG  G   ++K VL DG+ +AV+R+ +      +EF+N+  +++KL H NLV + GF  
Sbjct: 326  MLGQGGFGEVFKGVLQDGSEIAVKRLSKESAQGVQEFQNETSLVAKLQHRNLVGVLGFCM 385

Query: 877  GADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KHV 707
              +EK+++Y+FVPN SL         +    L W  R KI  G ARG+ Y+H     K +
Sbjct: 386  EGEEKILVYEFVPNKSLDQFLFEP--TKKGQLDWAKRYKIIVGTARGILYLHHDSPLKII 443

Query: 706  HGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDS 527
            H +LK SNILLDA+MEPKV DFG+ R+                     R   SR      
Sbjct: 444  HRDLKASNILLDAEMEPKVADFGMARIF--------------------RVDQSR------ 477

Query: 526  AVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                    + +   +G   YI+PE L   + + K DV+SFGV++LE+++GK
Sbjct: 478  --------ADTRRVVGTHGYISPEYLMHGQFSVKSDVYSFGVLVLEIISGK 520



>pir|E96633|E96633 probable Serine/Threonine protein kinase F8A5.31
            [imported] - Arabidopsis thaliana>gb:AE005173_893755
            Arabidopsis thaliana chromosome 1, bottom arm complete
            sequence.>gb:AX120051_1461705 Sequence 34 from Patent
            WO0129240.>gb:AC002292_1530159 Arabidopsis thaliana BAC
            F8A5, complete sequence.
          Length = 588

 Score =  130 bits (326), Expect = 7e-29
 Identities = 88/237 (37%), Positives = 127/237 (53%), Gaps = 6/237 (2%)
 Frame = -2

Query: 1066 SAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIR 890
            S  ILG  G  I+YK  L+DGT +AV+R+ +  +     +F+ ++  IS  +H NL+R+R
Sbjct: 259  SKNILGRGGYGIVYKGHLNDGTLVAVKRLKDCNIAGGEVQFQTEVETISLALHRNLLRLR 318

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK-- 716
            GF     E++++Y ++PNGS+A+   +        L W  R KIA G ARGL Y+HE+  
Sbjct: 319  GFCSSNQERILVYPYMPNGSVASRL-KDNIRGEPALDWSRRKKIAVGTARGLVYLHEQCD 377

Query: 715  -KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDS 539
             K +H ++K +NILLD D E  VGDFGL +L+                         RDS
Sbjct: 378  PKIIHRDVKAANILLDEDFEAVVGDFGLAKLL-----------------------DHRDS 414

Query: 538  FPDSAVSG--GHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
               +AV G  GH              IAPE L + + + K DVF FG++LLEL+TG+
Sbjct: 415  HVTTAVRGTVGH--------------IAPEYLSTGQSSEKTDVFGFGILLLELITGQ 457



>pir|T00574|T00574 probable protein kinase [imported] - Arabidopsis
            thaliana>gb:AC003674_1531173 Arabidopsis thaliana
            chromosome 2 clone F17A14 map CIC10A06, complete
            sequence.>gb:AC004218_1531549 Arabidopsis thaliana
            chromosome 2 clone F12L6 map CIC10A06, complete
            sequence.>gb:AY062493_1565149 Arabidopsis thaliana
            putative protein kinase (At2g39660; F17A14.3) mRNA,
            complete cds.>gb:AY065029_1566188 Arabidopsis thaliana
            At2g39660/F12L6.32 mRNA, complete
            cds.>gb:AY093278_1575232 Arabidopsis thaliana putative
            protein kinase (At2g39660) mRNA, complete
            cds.>gb:AY093997_1575503 Arabidopsis thaliana
            At2g39660/F12L6.32 mRNA, complete
            cds.>gb:AF325086_1786540 Arabidopsis thaliana putative
            protein kinase (At2g39660) mRNA, complete cds.
          Length = 395

 Score =  130 bits (326), Expect = 7e-29
 Identities = 97/319 (30%), Positives = 151/319 (47%), Gaps = 19/319 (5%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGT----------ALAVRRVGESGLDRFREFENQIRVISKLVHP 908
            ++G  G   ++K  LD+ T           +AV+++ + G    RE+  +I  + +L HP
Sbjct: 72   VIGEGGFGCVFKGWLDESTLTPTKPGTGLVIAVKKLNQEGFQGHREWLTEINYLGQLSHP 131

Query: 907  NLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSY 728
            NLV++ G+    + +L++Y+F+  GSL N   R+ G+  + LPW +R+ +A   A+GL++
Sbjct: 132  NLVKLIGYCLEDEHRLLVYEFMQKGSLENHLFRR-GAYFKPLPWFLRVNVALDAAKGLAF 190

Query: 727  IHEK--KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRST 554
            +H    K ++ ++K SNILLDAD   K+ DFGL R     G      Y S+R        
Sbjct: 191  LHSDPVKVIYRDIKASNILLDADYNAKLSDFGLAR----DGPMGDLSYVSTR-------- 238

Query: 553  ASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                                   +G   Y APE + S   N + DV+SFGV+LLE+L+GK
Sbjct: 239  ----------------------VMGTYGYAAPEYMSSGHLNARSDVYSFGVLLLEILSGK 276

Query: 373  IIVSDEMVPGPPVMGVE-------EKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCIS 215
              + D   P      V+        K KVL + D   R D                 C+S
Sbjct: 277  RAL-DHNRPAKEENLVDWARPYLTSKRKVLLIVD--NRLDTQYLPEEAVRMASVAVQCLS 333

Query: 214  PVPQKRPTMKEVVQALDNI 158
              P+ RPTM +VV+AL  +
Sbjct: 334  FEPKSRPTMDQVVRALQQL 352



>gb:AC098693_1736830 Oryza sativa (japonica cultivar-group) chromosome
            3 clone OJ1004C08, complete sequence.
          Length = 390

 Score =  123 bits (308), Expect(2) = 8e-29
 Identities = 95/319 (29%), Positives = 143/319 (44%), Gaps = 19/319 (5%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDD----------GTALAVRRVGESGLDRFREFENQIRVISKLVHP 908
            +LG  G   +YK   D+          G  +AV+++    +    E+++++  + +LVHP
Sbjct: 76   VLGEGGFGTVYKGWADERTLNPAKSSAGVVVAVKKLNPESVQGLHEWQSEVNFLGRLVHP 135

Query: 907  NLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSY 728
            NLV++ G+     E L++Y+F+P GSL N   R+G  +   L W +RLKIA G ARGL++
Sbjct: 136  NLVKLLGYCKEERELLLVYEFMPKGSLENHLFRRG--AFDPLSWSLRLKIAIGAARGLAF 193

Query: 727  IH--EKKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRST 554
            +H  E++ ++ + K SNILLD D  PK+ DFGL +     G S                 
Sbjct: 194  LHSSERQIIYRDFKASNILLDVDYTPKLSDFGLAKNGPVAGRS----------------- 236

Query: 553  ASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                               +   +G   Y APE + +     K DV+ FGVVLLELLTG 
Sbjct: 237  -----------------HVTTRIIGTYGYAAPEYVATGHLYVKSDVYCFGVVLLELLTG- 278

Query: 373  IIVSDEMVPGPPVMGVE-------EKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCIS 215
            +   D   P      VE          K+  + D  +  D                 C+ 
Sbjct: 279  LRAHDLNRPSHQQNLVEWARPYIAGGKKLAGLMDPRLAGDYPAKAAARAAKLAD--KCLC 336

Query: 214  PVPQKRPTMKEVVQALDNI 158
              P+ RP+M +VV AL  I
Sbjct: 337  GDPKSRPSMDDVVVALQEI 355



 Score = 27.7 bits (60), Expect(2) = 8e-29
 Identities = 16/39 (41%), Positives = 21/39 (53%)
 Frame = -1

Query: 1163 AGEESPTSGAENRGVGDGGRRERAGVRDSAESVGVYSGR 1047
            A +E P + A + G G GGR E      +AES G  +GR
Sbjct: 11   ADDEKPAAAAVSGGGGGGGREEYRRWPIAAESGGGETGR 49



>gb:AP003411_1829038 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, BAC clone:B1148D12.
          Length = 1083

 Score =  129 bits (325), Expect = 9e-29
 Identities = 77/230 (33%), Positives = 122/230 (53%), Gaps = 3/230 (1%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            +G+ G   +YK +L +G   A++R  +  +    EF+N+I ++S++ H NLV + GF + 
Sbjct: 610  IGSGGYGKVYKGMLANGQMAAIKRAQQGSMQGAAEFKNEIELLSRVHHKNLVSLVGFCYE 669

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---VH 704
              E++++Y+++PNG+L      KGG    HL W+ RL+IA G A+GL+Y+HE      +H
Sbjct: 670  QGEQMLVYEYIPNGTLRENLKGKGG---MHLDWKKRLQIAVGSAKGLAYLHELADPPIIH 726

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             ++K +NILLD  +  KV DFGL +LV                               S 
Sbjct: 727  RDIKSTNILLDESLNAKVADFGLSKLV-------------------------------SD 755

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
               GH  +     LG   Y+ PE   + + + K DV+SFGVV+LEL+T +
Sbjct: 756  TKKGHVSTQVKGTLG---YLDPEYYMTQQLSEKSDVYSFGVVMLELITSR 802



 Score = 35.8 bits (81), Expect = 1.7
 Identities = 18/38 (47%), Positives = 26/38 (68%), Gaps = 3/38 (7%)
 Frame = -2

Query: 727  IHEKKH---VHGNLKPSNILLDADMEPKVGDFGLERLV 623
            IHE  +   +H + K +NILLD +++ KV DFGL +LV
Sbjct: 971  IHELTNLPIIHRDAKSTNILLDDNLKAKVADFGLSKLV 1008



>gb:AC133333_1741337 Oryza sativa chromosome 3 BAC OJ1785_A05 genomic
            sequence, complete sequence.
          Length = 520

 Score =  129 bits (325), Expect = 9e-29
 Identities = 86/258 (33%), Positives = 126/258 (48%), Gaps = 7/258 (2%)
 Frame = -2

Query: 1117 VTVDGXXXXXXXXXXKASAY----ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFRE 950
            +++DG              +    ++G  G   +Y+  L DGT +A++++        RE
Sbjct: 184  ISIDGGSLSYDQLAAATGGFSPDNVIGQGGFGCVYRGRLQDGTEVAIKKLKTESKQGDRE 243

Query: 949  FENQIRVISKLVHPNLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEV 770
            F  +  +I+++ H NLV + G+    +++L++Y+FVPN +L    H   G     L W+ 
Sbjct: 244  FRAEADIITRVHHRNLVSLVGYCISGNDRLLVYEFVPNKTLDTHLH---GDKWPPLDWQQ 300

Query: 769  RLKIARGVARGLSYIHE---KKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSR 599
            R KIA G ARGL+Y+H+    K +H ++K SNILLD   EPKV DFGL +          
Sbjct: 301  RWKIAVGSARGLAYLHDDCSPKIIHRDVKASNILLDHGFEPKVADFGLAKY--------- 351

Query: 598  KVYGSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWD 419
                                       G HT   S   +G   YIAPE L S K   K D
Sbjct: 352  -------------------------QPGNHT-HVSTRIMGTFGYIAPEFLSSGKLTDKAD 385

Query: 418  VFSFGVVLLELLTGKIIV 365
            VF+FGVVLLEL+TG++ V
Sbjct: 386  VFAFGVVLLELITGRLPV 403



>gb:AC119292_1739707 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OSJNBb0088F07, complete sequence.
          Length = 538

 Score =  129 bits (325), Expect = 9e-29
 Identities = 90/309 (29%), Positives = 144/309 (46%), Gaps = 7/309 (2%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            A  +++G  G  I+Y+ VL DG  +AV+ +  +     REF+ ++  I ++ H NLVR+ 
Sbjct: 205  APEHVVGEGGYGIVYRGVLADGCEVAVKNLLNNRGQAEREFKVEVEAIGRVRHKNLVRLL 264

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIH---E 719
            G+      ++++Y++V NG+L    H   G     L W++R+ I  G A+G++Y+H   E
Sbjct: 265  GYCAEGAHRILVYEYVDNGNLEQWLHGDVGPV-SPLSWDIRMNIVLGTAKGITYLHEGLE 323

Query: 718  KKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDS 539
             K VH ++K SNILLD    PKV DFGL +L+           GS  N+ + R       
Sbjct: 324  PKVVHRDIKSSNILLDKRWNPKVSDFGLAKLL-----------GSDNNYVTTR------- 365

Query: 538  FPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSD 359
                              +G   Y+APE   +   N + DV+SFG++++E+++G+  V  
Sbjct: 366  -----------------VMGTFGYVAPEYASTGMLNERSDVYSFGILIMEIISGRSPVDY 408

Query: 358  EMVPGPPVMGVEEKSKVLRMADVAIRADMXX----XXXXXXXXXXXGYNCISPVPQKRPT 191
               PG  V  VE    ++   D     D                     C+ P  QKRP 
Sbjct: 409  ARAPG-EVNLVEWLKNMVSNRDYEAVLDPKLPEKPTSKALKKALLVALRCVDPDSQKRPK 467

Query: 190  MKEVVQALD 164
            M  V+  L+
Sbjct: 468  MGHVIHMLE 476



>gb:BT020268_1642663 Arabidopsis thaliana At1g26970 mRNA, complete
            cds.>gb:BT020441_1642836 Arabidopsis thaliana At1g26970
            mRNA, complete cds.
          Length = 412

 Score =  129 bits (325), Expect = 9e-29
 Identities = 88/319 (27%), Positives = 148/319 (46%), Gaps = 19/319 (5%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDD----------GTALAVRRVGESGLDRFREFENQIRVISKLVHP 908
            ++G  G   +YK  +D+          G  +AV+++ E G    R++  ++  + +L H 
Sbjct: 88   VIGEGGFGYVYKGWIDERTLSPSKPGSGMVVAVKKLKEEGFQGHRQWLAEVDCLGRLHHM 147

Query: 907  NLVRIRGFYWGADE-KLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLS 731
            NLV++ G+    D  +L++Y+++P GSL N   R+G      +PW  R+K+A G ARGL+
Sbjct: 148  NLVKLIGYCSKGDHIRLLVYEYMPKGSLENHLFRRGAEP---IPWRTRIKVAIGAARGLA 204

Query: 730  YIHEKKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTA 551
            ++HE + ++ + K SNILLD++   K+ DFGL ++   G  +                  
Sbjct: 205  FLHEAQVIYRDFKASNILLDSEFNAKLSDFGLAKVGPTGDRT------------------ 246

Query: 550  SRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKI 371
                              S   +G   Y APE + + +   K DV+SFGVVLLELL+G++
Sbjct: 247  ----------------HVSTQVMGTQGYAAPEYVATGRITAKSDVYSFGVVLLELLSGRL 290

Query: 370  IVSDEMVP--------GPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCIS 215
             V    V           P +G  +K KV R+ D  +                    C++
Sbjct: 291  TVDKTKVGVERNLVDWAIPYLG--DKRKVFRIMDTKLGGQ--YPHKGACLTANTALQCLN 346

Query: 214  PVPQKRPTMKEVVQALDNI 158
              P+ RP M +V+  L+ +
Sbjct: 347  QEPKLRPKMSDVLSTLEEL 365



>gb:AY090250_1574003 Arabidopsis thaliana AT4g23250/F21P8_140 mRNA,
            complete cds.>gb:BT001060_1635315 Arabidopsis thaliana
            At4g23250/F21P8_140 mRNA, complete cds.
          Length = 579

 Score =  129 bits (325), Expect = 9e-29
 Identities = 95/307 (30%), Positives = 146/307 (47%), Gaps = 9/307 (2%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            LG  G   +YK +L +GT +AV+R+ ++      EF+N++ V++KL H NLVR+ GF   
Sbjct: 265  LGKGGFGEVYKGMLMNGTEIAVKRLSKTSGQGEVEFKNEVVVVAKLQHINLVRLLGFSLQ 324

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KHVH 704
             +EKL++Y+FV N SL         +    L W +R  I  G+ RG+ Y+H+    K +H
Sbjct: 325  GEEKLLVYEFVSNKSLDYFLFDP--TKRNQLDWTMRRNIIGGITRGILYLHQDSRLKIIH 382

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             +LK SNILLDADM PK+ DFG+ R+                 FG  ++ A+        
Sbjct: 383  RDLKASNILLDADMNPKIADFGMARI-----------------FGVDQTVAN-------- 417

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMVPG 344
                     +   +G   Y++PE +   + + K DV+SFGV++LE+++GK   S   + G
Sbjct: 418  ---------TGRVVGTFGYMSPEYVTHGQFSMKSDVYSFGVLILEIISGKKNSSFYQMDG 468

Query: 343  ------PPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKE 182
                    V  + E   +  + D  I  D                 C+   P  RPTM  
Sbjct: 469  LVNNLVTYVWKLWENKSLHELLDPFINQDFTSEEVIRYIHIGLL--CVQENPADRPTMST 526

Query: 181  VVQALDN 161
            + Q L N
Sbjct: 527  IHQMLTN 533



>sp|Q9FE20|PBS1_ARATH Serine/threonine-protein kinase PBS1 (EC
            2.7.1.37) (AvrPphB susceptible protein
            1).>gb:ATT19L5_1554847 Arabidopsis thaliana DNA
            chromosome 5, BAC clone T19L5 (ESSA
            project).>gb:AY078037_1568006 Arabidopsis thaliana
            AT5g13160/T19L5_120 mRNA, complete
            cds.>gb:AF314176_1785302 Arabidopsis thaliana protein
            serine/threonine kinase PBS1 (PBS1) mRNA, complete
            cds.>gb:AF372927_1792642 Arabidopsis thaliana
            AT5g13160/T19L5_120 mRNA, complete cds.
          Length = 456

 Score =  129 bits (325), Expect = 9e-29
 Identities = 94/306 (30%), Positives = 145/306 (47%), Gaps = 10/306 (3%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDD-GTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYW 878
            LG  G   +YK  LD  G  +AV+++  +GL   REF  ++ ++S L HPNLV + G+  
Sbjct: 92   LGEGGFGRVYKGRLDSTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCA 151

Query: 877  GADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---V 707
              D++L++Y+F+P GSL +  H         L W +R+KIA G A+GL ++H+K +   +
Sbjct: 152  DGDQRLLVYEFMPLGSLEDHLHDLPPDKEA-LDWNMRMKIAAGAAKGLEFLHDKANPPVI 210

Query: 706  HGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDS 527
            + + K SNILLD    PK+ DFGL +L    G +  K + S+R                 
Sbjct: 211  YRDFKSSNILLDEGFHPKLSDFGLAKL----GPTGDKSHVSTR----------------- 249

Query: 526  AVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMVP 347
                          +G   Y APE   + +   K DV+SFGVV LEL+TG+  +  EM  
Sbjct: 250  -------------VMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSEMPH 296

Query: 346  GPPVMGV------EEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMK 185
            G   +         ++ K +++AD  ++                   CI      RP + 
Sbjct: 297  GEQNLVAWARPLFNDRRKFIKLADPRLKGRFPTRALYQALAVASM--CIQEQAATRPLIA 354

Query: 184  EVVQAL 167
            +VV AL
Sbjct: 355  DVVTAL 360



>gb:AP003615_1831433 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC clone:P0486H12.
          Length = 813

 Score =  129 bits (324), Expect = 1e-28
 Identities = 101/316 (31%), Positives = 149/316 (47%), Gaps = 20/316 (6%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            LG   S ++YK +L D  A+AV+++ +       EF++++ VISK+ H NLVR+ G+   
Sbjct: 524  LGRGASGVVYKGILKDERAVAVKKLADISQCE-EEFQHELSVISKIYHMNLVRVWGYCSD 582

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---VH 704
               ++++ ++V NGSL         +S   L W+ R KIA GVA+GL+Y+H +     +H
Sbjct: 583  GPHRMLVSEYVENGSLDKKLFGSE-ASQTLLEWKQRFKIALGVAKGLAYLHHECLEWVIH 641

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             ++KP NILLD ++EPK+ DFGL +L+  GG        S++N                 
Sbjct: 642  CDVKPENILLDDNLEPKITDFGLAKLLNRGG--------SNKN----------------- 676

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG----------- 377
            VS  H         G   YIAPE + SL    K DV+SFGVVLLELL G           
Sbjct: 677  VSRIH---------GTRGYIAPEWVSSLPITAKVDVYSFGVVLLELLKGSRVSEWAKTED 727

Query: 376  ------KIIVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCIS 215
                  K++  D  +    V   E+  +      +  R +                +CI 
Sbjct: 728  EDDEVEKVLRRDVRMLAENVKLQEDSERSWITNFIDSRLNGQFNYLQARTMIKLAVSCIE 787

Query: 214  PVPQKRPTMKEVVQAL 167
                KRPTM+ V Q L
Sbjct: 788  EDRSKRPTMENVAQML 803



>gb:AC108875_1738611 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OJ1123_C08, complete
            sequence.>gb:AC130607_1740855 Oryza sativa (japonica
            cultivar-group) chromosome 5 clone P0017D10, complete
            sequence.
          Length = 607

 Score =  129 bits (324), Expect = 1e-28
 Identities = 96/305 (31%), Positives = 148/305 (48%), Gaps = 8/305 (2%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYW 878
            I+G   +  MY+ VL DG+ LAV+R+ +S      +F ++++ + ++ H NLV + GF  
Sbjct: 302  IIGTGRTGTMYRAVLPDGSFLAVKRLQDSQHSE-TQFTSEMKTLGQVRHRNLVPLLGFCI 360

Query: 877  GADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KHV 707
               E+L++Y  +P GSL +  +++ G   + + W +RL+I  G A+GL+Y+H     + +
Sbjct: 361  AKRERLLVYKHMPKGSLYDQLNQEEGKDCK-MDWTLRLRIGIGAAKGLAYLHHTCNPRVL 419

Query: 706  HGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDS 527
            H N+    ILLD D EPK+ DFGL RL+                  +  ST     F D 
Sbjct: 420  HRNISSKCILLDEDYEPKISDFGLARLM--------------NPIDTHLSTFVNGEFGD- 464

Query: 526  AVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK----IIVSD 359
                          LG   Y+APE  R+L   PK DV+SFGVVLLEL+TG+    +  + 
Sbjct: 465  --------------LG---YVAPEYARTLVATPKGDVYSFGVVLLELITGERPTHVSTAP 507

Query: 358  EMVPGPPVMGVEEKSKVLRMADVAIRADM-XXXXXXXXXXXXXGYNCISPVPQKRPTMKE 182
            E   G  V  +   S    + D   ++ +                +C    P++RPTM E
Sbjct: 508  ENFRGSLVEWINYLSNNALLQDAVDKSLIGKGSDGELMQFLKVACSCTISTPKERPTMFE 567

Query: 181  VVQAL 167
            V Q L
Sbjct: 568  VYQLL 572



>gb:ZMA400869_1731517 Zea mays serk2 gene for somatic embryogenesis
            receptor-like kinase 2, exons 1-11.
          Length = 626

 Score =  129 bits (324), Expect = 1e-28
 Identities = 100/309 (32%), Positives = 152/309 (49%), Gaps = 11/309 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIRGFY 881
            ILG  G   +YK  L DG+ +AV+R+ E        +F+ ++ +IS  VH NL+R+RGF 
Sbjct: 309  ILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHKNLLRLRGFC 368

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KH 710
                E+L++Y +  NGS+A+   R+   S   L WE R +IA G ARG SY+H+    K 
Sbjct: 369  MTPTERLLVYPYXANGSVASRL-RERQPSEPPLSWEPRRRIALGSARGXSYLHDHCDPKI 427

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLD D E  VGDFGL +L+                         +D+   
Sbjct: 428  IHRDVKAANILLDEDFEAVVGDFGLAKLM-----------------------DYKDTHVT 464

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG-------KI 371
            +AV G          +G   +IAPE L + K + K DVF +G++LLEL+TG       ++
Sbjct: 465  TAVRG---------TIG---HIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARL 512

Query: 370  IVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
               D+++    V G+ ++ KV  + D  ++                   C    P  RP 
Sbjct: 513  ANDDDVMLLDWVKGLLKEKKVEMLVDPDLQ--KAYEEVEVESLIQVALLCTQGSPLDRPK 570

Query: 190  MKEVVQALD 164
            M EVV+ L+
Sbjct: 571  MSEVVRMLE 579



>gb:AB012245_1511781 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MRA19.
          Length = 570

 Score =  129 bits (324), Expect = 1e-28
 Identities = 94/309 (30%), Positives = 152/309 (49%), Gaps = 9/309 (2%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYW 878
            ILG  G  ++YK  L +GT +AV+R+ +       +F+ ++ +I   VH NL+R+ GF  
Sbjct: 261  ILGQGGFGMVYKGYLPNGTVVAVKRLKDPIYTGEVQFQTEVEMIGLAVHRNLLRLFGFCM 320

Query: 877  GADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KHV 707
              +E++++Y ++PNGS+A+      G     L W  R+ IA G ARGL Y+HE+   K +
Sbjct: 321  TPEERMLVYPYMPNGSVADRLRDNYGEK-PSLDWNRRISIALGAARGLVYLHEQCNPKII 379

Query: 706  HGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDS 527
            H ++K +NILLD   E  VGDFGL +L+                         RDS   +
Sbjct: 380  HRDVKAANILLDESFEAIVGDFGLAKLL-----------------------DQRDSHVTT 416

Query: 526  AVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIV---SDE 356
            AV G          +G   +IAPE L + + + K DVF FGV++LEL+TG  ++   + +
Sbjct: 417  AVRG---------TIG---HIAPEYLSTGQSSEKTDVFGFGVLILELITGHKMIDQGNGQ 464

Query: 355  MVPG---PPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMK 185
            +  G     V  ++ + +   M D  ++ +                 C  P P  RP M 
Sbjct: 465  VRKGMILSWVRTLKAEKRFAEMVDRDLKGEFDDLVLEEVVELALL--CTQPHPNLRPRMS 522

Query: 184  EVVQALDNI 158
            +V++ L+ +
Sbjct: 523  QVLKVLEGL 531



>pir|C85057|C85057 probable receptor-like protein kinase [imported] -
            Arabidopsis thaliana>gb:ATCHRIV12_1544298 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            12.>gb:AF076243_1766171 Arabidopsis thaliana BAC T26N6
            from chromosome IV at 19.3 cM, complete sequence.
          Length = 659

 Score =  129 bits (324), Expect = 1e-28
 Identities = 94/318 (29%), Positives = 148/318 (46%), Gaps = 20/318 (6%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            +S   LG  G   +YK  L +G  +AV+R+ +       EF+N++ ++++L H NLV++ 
Sbjct: 354  SSENTLGQGGFGTVYKGTLLNGQEVAVKRLTKGSGQGDIEFKNEVSLLTRLQHRNLVKLL 413

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK-- 716
            GF    DE++++Y+FVPN SL +            L WE+R +I  G+ARGL Y+HE   
Sbjct: 414  GFCNEGDEQILVYEFVPNSSLDHFIF--DDEKRSLLTWEMRYRIIEGIARGLLYLHEDSQ 471

Query: 715  -KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDS 539
             K +H +LK SNILLDA+M PKV DFG  RL                             
Sbjct: 472  LKIIHRDLKASNILLDAEMNPKVADFGTARLF---------------------------- 503

Query: 538  FPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSD 359
                      T + +    G   Y+APE L   + + K DV+SFGV+LLE+++G+   S 
Sbjct: 504  ------DSDETRAETKRIAGTRGYMAPEYLNHGQISAKSDVYSFGVMLLEMISGERNNSF 557

Query: 358  E-----------MVPGPPVMGVE------EKSKVLRMADVAIRADMXXXXXXXXXXXXXG 230
            E            V G P + ++       +++++++  + +                  
Sbjct: 558  EGEGLAAFAWKRWVEGKPEIIIDPFLIEKPRNEIIKLIQIGLL----------------- 600

Query: 229  YNCISPVPQKRPTMKEVV 176
              C+   P KRPTM  V+
Sbjct: 601  --CVQENPTKRPTMSSVI 616



>pir|T52400|T52400 receptor-like protein kinase [imported] -
            Arabidopsis thaliana>gb:AP000417_1820121 Arabidopsis
            thaliana genomic DNA, chromosome 3, P1 clone: MMB12.
          Length = 991

 Score =  129 bits (324), Expect = 1e-28
 Identities = 101/331 (30%), Positives = 150/331 (45%), Gaps = 28/331 (8%)
 Frame = -2

Query: 1066 SAYILGASGSSIMYKTVLDDGTALAVRRVG--ESGLDRFR----------------EFEN 941
            S  I+G  G   +YK  L  G  LAV+ +   ES  + FR                EFE 
Sbjct: 673  SENIIGRGGQGNVYKVSLRSGETLAVKHIWCPESSHESFRSSTAMLSDGNNRSNNGEFEA 732

Query: 940  QIRVISKLVHPNLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLK 761
            ++  +S + H N+V++       D KL++Y+++PNGSL    H + G   + + W VR  
Sbjct: 733  EVATLSNIKHINVVKLFCSITCEDSKLLVYEYMPNGSLWEQLHERRG--EQEIGWRVRQA 790

Query: 760  IARGVARGLSYIH---EKKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVY 590
            +A G A+GL Y+H   ++  +H ++K SNILLD +  P++ DFGL +++ A         
Sbjct: 791  LALGAAKGLEYLHHGLDRPVIHRDVKSSNILLDEEWRPRIADFGLAKIIQA--------- 841

Query: 589  GSSRNFGSKRSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFS 410
                       +  RD               +P   G   YIAPE   + K N K DV+S
Sbjct: 842  ----------DSVQRD-------------FSAPLVKGTLGYIAPEYAYTTKVNEKSDVYS 878

Query: 409  FGVVLLELLTG-KIIVSDEMVPGPPVMGVEEKSK------VLRMADVAIRADMXXXXXXX 251
            FGVVL+EL+TG K + +D       VM V   SK      ++++ D +I  +        
Sbjct: 879  FGVVLMELVTGKKPLETDFGENNDIVMWVWSVSKETNREMMMKLIDTSIEDEYKEDALKV 938

Query: 250  XXXXXXGYNCISPVPQKRPTMKEVVQALDNI 158
                     C    PQ RP MK VV  L+ I
Sbjct: 939  LTIALL---CTDKSPQARPFMKSVVSMLEKI 966



>pir|C96641|C96641 hypothetical protein T25B24.6 [imported] -
            Arabidopsis thaliana>gb:AE005173_893829 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC005850_1533094 Arabidopsis thaliana
            chromosome I BAC T25B24 genomic sequence, complete
            sequence.>gb:AY064142_1566023 Arabidopsis thaliana
            At1g61590/T25B24_6 mRNA, complete
            cds.>gb:AY097413_1576408 Arabidopsis thaliana
            At1g61590/T25B24_6 mRNA, complete cds.
          Length = 424

 Score =  129 bits (324), Expect = 1e-28
 Identities = 99/316 (31%), Positives = 150/316 (47%), Gaps = 15/316 (4%)
 Frame = -2

Query: 1060 YILGASGSSIMYKTVLDD-------GTALAVRRVGESGLDRFREFENQIRVISKLVHPNL 902
            Y+LG  G   +YK  +DD          +AV+ +   GL   RE+ +++  + +L HPNL
Sbjct: 103  YLLGEGGFGKVYKGYVDDYLRQSLKAQPVAVKLLDIEGLQGHREWLSEVIFLGQLKHPNL 162

Query: 901  VRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIH 722
            V++ G+    +E+++IY+F+P GSL N   R+   S   LPW  RLKIA   A+GL+++H
Sbjct: 163  VKLIGYCCEEEERVLIYEFMPRGSLENHLFRRISLS---LPWATRLKIAVAAAKGLAFLH 219

Query: 721  --EKKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTAS 548
              E   ++ + K SNILLD+D   K+ DFGL ++   G E            GSK    +
Sbjct: 220  DLESPIIYRDFKTSNILLDSDFTAKLSDFGLAKM---GPE------------GSKSHVTT 264

Query: 547  RDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKII 368
            R                    +G   Y APE + +     K DV+S+GVVLLELLTG+  
Sbjct: 265  R-------------------VMGTYGYAAPEYVSTGHLTTKSDVYSYGVVLLELLTGR-- 303

Query: 367  VSDEMVPGPPVMGVEEKSKVLRMADVAIRADM------XXXXXXXXXXXXXGYNCISPVP 206
             + E         + + SK    +   +R  M                      C+SP P
Sbjct: 304  RATEKSRPKNQQNIIDWSKPYLTSSRRLRCVMDPRLAGQYSVKAAKDTALLALQCVSPNP 363

Query: 205  QKRPTMKEVVQALDNI 158
            + RP M  VV+AL+++
Sbjct: 364  KDRPKMLAVVEALESL 379



>gb:AF436829_1799881 Arabidopsis thaliana AT4g26540/M3E9_30 mRNA,
            complete cds.
          Length = 1096

 Score =  129 bits (323), Expect = 2e-28
 Identities = 86/311 (27%), Positives = 143/311 (45%), Gaps = 8/311 (2%)
 Frame = -2

Query: 1066 SAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRG 887
            SA ++G   S ++Y+  +  G +LAV+++     +    F ++I+ +  + H N+VR+ G
Sbjct: 762  SANVIGTGSSGVVYRITIPSGESLAVKKMWSK--EESGAFNSEIKTLGSIRHRNIVRLLG 819

Query: 886  FYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE---K 716
            +    + KL+ YD++PNGSL++  H  G      + WE R  +  GVA  L+Y+H     
Sbjct: 820  WCSNRNLKLLFYDYLPNGSLSSRLH--GAGKGGCVDWEARYDVVLGVAHALAYLHHDCLP 877

Query: 715  KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSF 536
              +HG++K  N+LL    EP + DFGL R +                            +
Sbjct: 878  TIIHGDVKAMNVLLGPHFEPYLADFGLARTI--------------------------SGY 911

Query: 535  PDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDE 356
            P++ +     P+  P   G   Y+APE     +   K DV+S+GVVLLE+LTGK  +  +
Sbjct: 912  PNTGIDLA-KPTNRPPMAGSYGYMAPEHASMQRITEKSDVYSYGVVLLEVLTGKHPLDPD 970

Query: 355  MVPGPPVM-----GVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
            +  G  ++      + EK    R+ D  +                  + C+S    +RP 
Sbjct: 971  LPGGAHLVKWVRDHLAEKKDPSRLLDPRLDGRTDSIMHEMLQTLAVAFLCVSNKANERPL 1030

Query: 190  MKEVVQALDNI 158
            MK+VV  L  I
Sbjct: 1031 MKDVVAMLTEI 1041



>gb:AB052755_1521237 Arabidopsis lyrata mRNA for SRKa, partial cds.
          Length = 847

 Score =  129 bits (323), Expect = 2e-28
 Identities = 82/231 (35%), Positives = 124/231 (53%), Gaps = 3/231 (1%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYW 878
            ILG  G  ++Y   L DG  +AV+R+    L    EF+N++++I++L H NLVR+     
Sbjct: 526  ILGQGGFGVVYMGRLPDGQEIAVKRLSMVSLQGVNEFKNEVKLIARLQHINLVRLFSCCI 585

Query: 877  GADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KHV 707
             ADEK++IY+++ NGSL +   +K  SS   L W+ R  I  G+ARGL Y+H+    K +
Sbjct: 586  YADEKILIYEYLENGSLDSHLFKKVQSSK--LNWQKRFNIINGIARGLLYLHQDSRFKII 643

Query: 706  HGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDS 527
            H +LK SN+LLD DM PK+ DFG+ R+                 F  + + AS       
Sbjct: 644  HRDLKASNVLLDKDMTPKISDFGMARI-----------------FEREETEAS------- 679

Query: 526  AVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                      +   +G   Y++PE       + K DVFSFGV++LE+++GK
Sbjct: 680  ----------TKKVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIVSGK 720



>gb:AF485384_1804095 Helianthus annuus SERK1 mRNA, partial cds.
          Length = 228

 Score =  128 bits (322), Expect = 2e-28
 Identities = 84/236 (35%), Positives = 131/236 (55%), Gaps = 4/236 (1%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRI 893
            ++ +ILG  G   +YK  L DGT +AV+R+ E        +F+ ++ +IS  VH NL+R+
Sbjct: 21   SNRHILGRGGFGKVYKGRLADGTLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRL 80

Query: 892  RGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK- 716
            +GF     E+L++Y ++ NGS+A+ C R+   +   L W +R +IA G ARGL+Y+H+  
Sbjct: 81   KGFCMTPTERLLVYPYMANGSVAS-CLRERPETQEPLDWPIRKRIALGSARGLAYLHDHC 139

Query: 715  --KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRD 542
              K +H ++K +NILLD + E  VGDFGL +L+                         +D
Sbjct: 140  DPKIIHRDVKAANILLDEEFEAVVGDFGLAKLM-----------------------DYKD 176

Query: 541  SFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
            +   +AV G          +G   +IAPE L + K + K DVF +GV+LLEL+TG+
Sbjct: 177  THVTTAVRG---------TIG---HIAPEYLSTGKSSEKTDVFGYGVMLLELITGQ 220



>gb:AF083790_1767020 Arabidopsis thaliana clone sps866 unknown mRNA.
          Length = 658

 Score =  128 bits (322), Expect = 2e-28
 Identities = 95/307 (30%), Positives = 145/307 (47%), Gaps = 11/307 (3%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            +G  G   +YK  L DGT +AV+R+ +S      EF+N++ +++KL H NLVR+ GF   
Sbjct: 343  IGQGGFGEVYKGTLSDGTEVAVKRLSKSSGQGEVEFKNEVVLVAKLQHRNLVRLLGFCLD 402

Query: 874  ADEKLVIYDFVPNGSLANACH---RKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH-- 710
             +E++++Y++VPN SL        +KG      L W  R KI  GVARG+ Y+H+     
Sbjct: 403  GEERVLVYEYVPNKSLDYFLFDPAKKG-----QLDWTRRYKIIGGVARGILYLHQDSRLT 457

Query: 709  -VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFP 533
             +H +LK SNILLDADM PK+ DFG+ R+                 FG  +         
Sbjct: 458  IIHRDLKASNILLDADMNPKIADFGMARI-----------------FGLDQ--------- 491

Query: 532  DSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEM 353
                    T   +   +G   Y++PE     + + K DV+SFGV++LE+++GK   S   
Sbjct: 492  --------TEENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGVLVLEIISGKKNSSFYQ 543

Query: 352  VPGPP-----VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTM 188
              G         G+    + L + D AI  +                 C+   P +RPT+
Sbjct: 544  TDGAHDLVSYAWGLWSNGRPLELVDPAIVENCQRNEVVRCVHIGLL--CVQEDPAERPTL 601

Query: 187  KEVVQAL 167
              +V  L
Sbjct: 602  STIVLML 608



>gb:AF078082_1766256 Phaseolus vulgaris receptor-like protein kinase
            homolog RK20-1 mRNA, complete cds.
          Length = 666

 Score =  128 bits (322), Expect = 2e-28
 Identities = 81/230 (35%), Positives = 120/230 (52%), Gaps = 3/230 (1%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            LG  G   +Y+  L +G  +AV+R+         EF+N++ +++KL H NLVR+ GF   
Sbjct: 345  LGQGGFGAVYRGRLPNGQMIAVKRLSSGSSQGDTEFKNEVLLMAKLQHRNLVRLLGFCLE 404

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KHVH 704
              E+L+IY+FVPN SL              L WE+R KI RG+ARGL Y+HE    + +H
Sbjct: 405  GRERLLIYEFVPNKSLDYFIF--DPVKKAQLDWEMRYKIIRGIARGLLYLHEDSLLRIIH 462

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             +LK SNILLD +M PK+ DFG+ RLV+                                
Sbjct: 463  RDLKASNILLDEEMNPKIADFGMARLVLL------------------------------- 491

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                 T + +   +G   Y+APE +   + + K D+FSFGV+LLE+++G+
Sbjct: 492  ---DETHANTNRVVGTYGYMAPEYIMQGQFSVKSDIFSFGVLLLEIVSGQ 538



>gb:OSJN00019_1693373 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0043L09, complete sequence.
          Length = 838

 Score =  128 bits (322), Expect = 2e-28
 Identities = 91/306 (29%), Positives = 142/306 (46%), Gaps = 7/306 (2%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYW 878
            +LG  G   +YK +L D   +A++R+ +       EF N++ +I+KL H NLV++ G   
Sbjct: 528  MLGQGGFGKVYKGMLGDNKEVAIKRLSKGSGQGVEEFRNEVVLIAKLQHRNLVKLLGCCI 587

Query: 877  GADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---V 707
              DEKL+IY+++PN SL         +S   L W  R KI +GVARGL Y+H+      +
Sbjct: 588  HGDEKLLIYEYLPNKSLEAFIFDP--ASKYALDWPTRFKIIKGVARGLLYLHQDSRLTII 645

Query: 706  HGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDS 527
            H +LK SNILLD DM PK+ DFG+ R+                 FG  +  A+ +     
Sbjct: 646  HRDLKSSNILLDVDMSPKISDFGMARI-----------------FGGNQQEANTNR---- 684

Query: 526  AVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMVP 347
                          +G   Y++PE       + K D +S+GV+LLE+++G  I    ++ 
Sbjct: 685  -------------VVGTYGYMSPEYAMDGAFSVKSDTYSYGVILLEIVSGLKISLPRLMD 731

Query: 346  GPPVM----GVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEV 179
             P ++     + +  K + + D +I                    C+   P  RP M  V
Sbjct: 732  FPNLLAYAWSLWKDDKAMDLVDSSIAESCSKMEVLLCIHIGLL--CVQDNPNNRPPMSSV 789

Query: 178  VQALDN 161
            V  L+N
Sbjct: 790  VFMLEN 795



>gb:BT005954_1638876 Arabidopsis thaliana At4g23180 gene, complete
            cds.>gb:AK117765_1815781 Arabidopsis thaliana At4g23180
            mRNA for putative receptor-like protein kinase 4 (RLK4),
            complete cds, clone: RAFL17-45-D12.
          Length = 669

 Score =  128 bits (322), Expect = 2e-28
 Identities = 95/307 (30%), Positives = 145/307 (47%), Gaps = 11/307 (3%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            +G  G   +YK  L DGT +AV+R+ +S      EF+N++ +++KL H NLVR+ GF   
Sbjct: 354  IGQGGFGEVYKGTLSDGTEVAVKRLSKSSGQGEVEFKNEVVLVAKLQHRNLVRLLGFCLD 413

Query: 874  ADEKLVIYDFVPNGSLANACH---RKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH-- 710
             +E++++Y++VPN SL        +KG      L W  R KI  GVARG+ Y+H+     
Sbjct: 414  GEERVLVYEYVPNKSLDYFLFDPAKKG-----QLDWTRRYKIIGGVARGILYLHQDSRLT 468

Query: 709  -VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFP 533
             +H +LK SNILLDADM PK+ DFG+ R+                 FG  +         
Sbjct: 469  IIHRDLKASNILLDADMNPKIADFGMARI-----------------FGLDQ--------- 502

Query: 532  DSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEM 353
                    T   +   +G   Y++PE     + + K DV+SFGV++LE+++GK   S   
Sbjct: 503  --------TEENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGVLVLEIISGKKNSSFYQ 554

Query: 352  VPGPP-----VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTM 188
              G         G+    + L + D AI  +                 C+   P +RPT+
Sbjct: 555  TDGAHDLVSYAWGLWSNGRPLELVDPAIVENCQRNEVVRCVHIGLL--CVQEDPAERPTL 612

Query: 187  KEVVQAL 167
              +V  L
Sbjct: 613  STIVLML 619



>gb:BOLRPKB_1633858 Brassica campestris mRNA for receptor protein
            kinase SRK12, complete cds.
          Length = 856

 Score =  128 bits (322), Expect = 2e-28
 Identities = 84/230 (36%), Positives = 122/230 (53%), Gaps = 3/230 (1%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            LG  G  I+YK +LD G  +AV+R+ ++ L    EF N++R+I++L H NLVRI G    
Sbjct: 534  LGQGGFGIVYKGMLD-GQEVAVKRLSKTSLQGIDEFMNEVRLIARLQHINLVRILGCCIE 592

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---VH 704
            ADEK++IY+++ N SL      K  SS+  L W+ R  I  GVARGL Y+H+      +H
Sbjct: 593  ADEKILIYEYLENSSLDYFLFGKKRSSN--LNWKDRFAITNGVARGLLYLHQDSRFRIIH 650

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             +LKP NILLD  M PK+ DFG+ R+       +R                         
Sbjct: 651  RDLKPGNILLDKYMIPKISDFGMARIFARDEIQAR------------------------- 685

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                     + +A+G   Y++PE       + K DVFSFGV++LE+++GK
Sbjct: 686  ---------TDNAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSGK 726



>gb:AC000103_1530024 Genomic sequence for Arabidopsis thaliana BAC
            F21J9 from chromosome I, complete sequence.
          Length = 886

 Score =  128 bits (322), Expect = 2e-28
 Identities = 89/237 (37%), Positives = 124/237 (52%), Gaps = 9/237 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGES-----GLDRFREFENQIRVISKLVHPNLVRI 893
            ILG  G  I+YK  L DGT +AV+R+  S     GLD   EF+++I V++++ H NLV +
Sbjct: 552  ILGRGGFGIVYKGELHDGTKIAVKRMESSIISGKGLD---EFKSEIAVLTRVRHRNLVVL 608

Query: 892  RGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKK 713
             G+    +E+L++Y ++P G+L+           R L W  RL IA  VARG+ Y+H   
Sbjct: 609  HGYCLEGNERLLVYQYMPQGTLSRHIFYWKEEGLRPLEWTRRLIIALDVARGVEYLHTLA 668

Query: 712  H---VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGES-SRKVYGSSRNFGSKRSTASR 545
            H   +H +LKPSNILL  DM  KV DFGL RL   G +S   K+ G+   FG        
Sbjct: 669  HQSFIHRDLKPSNILLGDDMHAKVADFGLVRLAPEGTQSIETKIAGT---FG-------- 717

Query: 544  DSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                                     Y+APE   + +   K DV+SFGV+L+ELLTG+
Sbjct: 718  -------------------------YLAPEYAVTGRVTTKVDVYSFGVILMELLTGR 749



>gb:AB125890_1528232 Ipomoea batatas SRF6 mRNA for leucine-rich repeat
            receptor-like kinase, complete cds.
          Length = 627

 Score =  128 bits (322), Expect = 2e-28
 Identities = 103/317 (32%), Positives = 155/317 (48%), Gaps = 16/317 (5%)
 Frame = -2

Query: 1066 SAYILGASGSSIMYKTVLDDGTALAVRRVGE-SGLDRFREFENQIRVISKLVHPNLVRIR 890
            S  ILG  G  I+YK  L+DGT +AV+R+ + +      +F+ ++ +IS  VH NL+R+ 
Sbjct: 306  SKNILGRGGFGIVYKGSLNDGTIVAVKRLKDYNAAGGEIQFQTEVEMISLAVHRNLLRLW 365

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRH----LPWEVRLKIARGVARGLSYIH 722
            GF    +E+L++Y ++PNGS+A+         H H    L W  R +IA G ARGL Y+H
Sbjct: 366  GFCSTENERLLVYPYMPNGSVASRL-----KDHVHGRPVLDWSRRKRIALGTARGLVYLH 420

Query: 721  EK---KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTA 551
            E+   K +H ++K +NILLD D E  VGDFGL +L+                        
Sbjct: 421  EQCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLL-----------------------D 457

Query: 550  SRDSFPDSAVSG--GHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG 377
             R+S   +AV G  GH              IAPE L + + + K DVF FG++LLEL+TG
Sbjct: 458  HRESHVSTAVRGTVGH--------------IAPEYLSTGQSSEKTDVFGFGILLLELITG 503

Query: 376  KIIV------SDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCIS 215
            +  V      + + V    V  + ++ K+  M D  ++ +                 C  
Sbjct: 504  QKAVDFGRGANQKGVILDWVKTLHQEGKLNLMVDKDLKNNFDRVELEEMVQVALL--CTQ 561

Query: 214  PVPQKRPTMKEVVQALD 164
              P  RP M EV++ L+
Sbjct: 562  FNPSHRPKMSEVLRMLE 578



>gb:AE005172_891418 Arabidopsis thaliana chromosome 1, top arm
            complete sequence.>gb:AC004133_1531423 Genomic sequence
            for Arabidopsis thaliana BAC F5A9 from chromosome I,
            complete sequence.
          Length = 924

 Score =  128 bits (322), Expect = 2e-28
 Identities = 89/237 (37%), Positives = 124/237 (52%), Gaps = 9/237 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGES-----GLDRFREFENQIRVISKLVHPNLVRI 893
            ILG  G  I+YK  L DGT +AV+R+  S     GLD   EF+++I V++++ H NLV +
Sbjct: 552  ILGRGGFGIVYKGELHDGTKIAVKRMESSIISGKGLD---EFKSEIAVLTRVRHRNLVVL 608

Query: 892  RGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKK 713
             G+    +E+L++Y ++P G+L+           R L W  RL IA  VARG+ Y+H   
Sbjct: 609  HGYCLEGNERLLVYQYMPQGTLSRHIFYWKEEGLRPLEWTRRLIIALDVARGVEYLHTLA 668

Query: 712  H---VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGES-SRKVYGSSRNFGSKRSTASR 545
            H   +H +LKPSNILL  DM  KV DFGL RL   G +S   K+ G+   FG        
Sbjct: 669  HQSFIHRDLKPSNILLGDDMHAKVADFGLVRLAPEGTQSIETKIAGT---FG-------- 717

Query: 544  DSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                                     Y+APE   + +   K DV+SFGV+L+ELLTG+
Sbjct: 718  -------------------------YLAPEYAVTGRVTTKVDVYSFGVILMELLTGR 749



>pir|T04835|T04835 probable serine/threonine-specific protein kinase
            (EC 2.7.1.-) F21P8.70 - Arabidopsis
            thaliana>gb:ATCHRIV58_1546155 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 58.>gb:ATF21P8_1549620
            Arabidopsis thaliana DNA chromosome 4, BAC clone F21P8
            (ESSA project).
          Length = 633

 Score =  128 bits (322), Expect = 2e-28
 Identities = 95/307 (30%), Positives = 145/307 (47%), Gaps = 11/307 (3%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            +G  G   +YK  L DGT +AV+R+ +S      EF+N++ +++KL H NLVR+ GF   
Sbjct: 318  IGQGGFGEVYKGTLSDGTEVAVKRLSKSSGQGEVEFKNEVVLVAKLQHRNLVRLLGFCLD 377

Query: 874  ADEKLVIYDFVPNGSLANACH---RKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH-- 710
             +E++++Y++VPN SL        +KG      L W  R KI  GVARG+ Y+H+     
Sbjct: 378  GEERVLVYEYVPNKSLDYFLFDPAKKG-----QLDWTRRYKIIGGVARGILYLHQDSRLT 432

Query: 709  -VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFP 533
             +H +LK SNILLDADM PK+ DFG+ R+                 FG  +         
Sbjct: 433  IIHRDLKASNILLDADMNPKIADFGMARI-----------------FGLDQ--------- 466

Query: 532  DSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEM 353
                    T   +   +G   Y++PE     + + K DV+SFGV++LE+++GK   S   
Sbjct: 467  --------TEENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGVLVLEIISGKKNSSFYQ 518

Query: 352  VPGPP-----VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTM 188
              G         G+    + L + D AI  +                 C+   P +RPT+
Sbjct: 519  TDGAHDLVSYAWGLWSNGRPLELVDPAIVENCQRNEVVRCVHIGLL--CVQEDPAERPTL 576

Query: 187  KEVVQAL 167
              +V  L
Sbjct: 577  STIVLML 583



>pir|T14375|T14375 S-receptor kinase (EC 2.7.1.-) 1 -
            turnip>gb:AB000970_1508445 Brassica campestris gene for
            receptor kinase 1, complete cds.
          Length = 847

 Score =  128 bits (322), Expect = 2e-28
 Identities = 83/233 (35%), Positives = 124/233 (53%), Gaps = 3/233 (1%)
 Frame = -2

Query: 1063 AYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGF 884
            A +LG  G  I+YK +L DG  +AV+R+ +  L    EF+N++R+I++L H NLVR+ G 
Sbjct: 526  ANMLGQGGFGIVYKGMLPDGKEIAVKRLSKMSLQGTDEFKNEVRLIARLQHINLVRLLGC 585

Query: 883  YWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH-- 710
                 EK++IY+++ N SL +    K   S+  L W  R  I  G+ARGL Y+H+     
Sbjct: 586  CVDKGEKMLIYEYLENLSLDSHLFDKIRRSN--LSWPKRFDITNGIARGLLYLHQDSRFR 643

Query: 709  -VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFP 533
             +H +LK SN+LLD +M PK+ DFG+ R+                 FG + + A+     
Sbjct: 644  IIHRDLKASNVLLDKNMTPKISDFGMARI-----------------FGREETEAN----- 681

Query: 532  DSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                        +   +G   Y+APE       + K DVFSFGV+LLE++TGK
Sbjct: 682  ------------TRKVVGTYGYMAPEYAMDGIFSMKSDVFSFGVLLLEIITGK 722



>gb:AP005786_1857838 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC clone:P0458H05.
          Length = 696

 Score =  128 bits (321), Expect = 3e-28
 Identities = 83/230 (36%), Positives = 119/230 (51%), Gaps = 3/230 (1%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            LG  G  ++YK  L  G  +AV+R+ +S +    E +N++ +++KL H NLVR+ G    
Sbjct: 370  LGEGGFGVVYKGSLPHGEEIAVKRLSQSSVQGMGELKNELVLVAKLQHKNLVRLVGVCLE 429

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KHVH 704
              E++++Y+++PN SL         SS   L W  RLKI  GVARG+ Y+HE    K VH
Sbjct: 430  EHERMLVYEYMPNRSLDTILFDAEKSSL--LDWGRRLKIINGVARGMQYLHEDSQLKIVH 487

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             +LK SN+LLD+D  PK+ DFGL RL                 FG               
Sbjct: 488  RDLKASNVLLDSDYNPKISDFGLARL-----------------FG--------------- 515

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
              G  T   +   +G   Y+APE       + K DVFSFGV++LE++TG+
Sbjct: 516  --GDQTQDVTNRVVGTYGYMAPEYAMRGHYSVKSDVFSFGVLVLEIVTGR 563



>gb:AP003991_1836031 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1077_A12.
          Length = 620

 Score =  128 bits (321), Expect = 3e-28
 Identities = 95/310 (30%), Positives = 152/310 (49%), Gaps = 9/310 (2%)
 Frame = -2

Query: 1066 SAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRG 887
            S  ILG  G  ++YK  L +G  +AV+R+ +  +    +F+ ++ +I   VH NL+R+ G
Sbjct: 300  SKNILGQGGFGVVYKGCLRNGALVAVKRLKDPDITGEVQFQTEVELIGLAVHRNLLRLYG 359

Query: 886  FYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK--- 716
            F   + E+L++Y ++PNGS+A+   R        L W  R++IA G ARGL Y+HE+   
Sbjct: 360  FCMTSKERLLVYPYMPNGSVADRL-RDYHHGKPSLDWSKRMRIAVGAARGLLYLHEQCNP 418

Query: 715  KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSF 536
            K +H ++K +NILLD   E  VGDFGL +L+                         ++S 
Sbjct: 419  KIIHRDVKAANILLDESFEAIVGDFGLAKLL-----------------------DRQESH 455

Query: 535  PDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDE 356
              +AV G          +G   +IAPE L + + + K DV+ FG++LLEL+TG   +S+ 
Sbjct: 456  VTTAVRG---------TIG---HIAPEYLSTGQSSEKTDVYGFGILLLELITGPKTLSNG 503

Query: 355  MVPGPP------VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRP 194
                        V  V+E++K+ ++ D  ++                   C    P  RP
Sbjct: 504  HAQSQKGMILDWVREVKEENKLDKLVDRDLK--YSFDFAELECSVDVILQCTQTNPILRP 561

Query: 193  TMKEVVQALD 164
             M EV+ AL+
Sbjct: 562  KMSEVLNALE 571



>gb:AP003863_1834484 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OJ1058_A12.>gb:AP005810_1858255 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, PAC
            clone:P0696F12.
          Length = 699

 Score =  128 bits (321), Expect = 3e-28
 Identities = 83/230 (36%), Positives = 118/230 (51%), Gaps = 3/230 (1%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            LG  G   +YK VL DG  +AV+R+ +S     +E +N++ +++KL H NLV   G    
Sbjct: 398  LGEGGFGAVYKGVLPDGNEIAVKRLSKSSTQGVQELKNELALVAKLRHKNLVSFVGVCLD 457

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KHVH 704
              E+L++Y+FVPN SL              L WE R +I  GVARGL Y+HE    K VH
Sbjct: 458  QHERLLVYEFVPNRSLDLILFDT--EKREKLDWEKRYRIINGVARGLQYLHEDSQLKVVH 515

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             +LK SNILLDA+M PK+ +FGL R+                 FG  ++ A  +   D+ 
Sbjct: 516  RDLKASNILLDANMNPKISNFGLARI-----------------FGQDQTQAVTNRVVDTY 558

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                              Y+APE +     + K D FSFGV++LE++TG+
Sbjct: 559  -----------------GYMAPEYMMRGNYSVKSDAFSFGVMVLEIVTGR 591



>gb:AP002536_1822468 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, BAC clone:OSJNBa0015I14.
          Length = 613

 Score =  128 bits (321), Expect = 3e-28
 Identities = 101/315 (32%), Positives = 147/315 (46%), Gaps = 19/315 (6%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            LG+ GS  +YK +LDD   +AV+++ +  +   +EF +++ +I ++ H NLVRI GF   
Sbjct: 334  LGSGGSGAVYKGILDDNRKVAVKKLNDV-IHGEQEFRSELSIIGRVYHMNLVRIWGFCAE 392

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRH----LPWEVRLKIARGVARGLSYIHEKKH- 710
               KL++ +FV NGSL         S+H+     LPW  R  IA GVA+GL+Y+H +   
Sbjct: 393  KTHKLLVSEFVENGSLDRVL-----SNHQSVFPVLPWSQRYNIALGVAKGLAYLHHECLE 447

Query: 709  --VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSF 536
              VH ++KP NILLD D EPK+ DFGL +L+               N G   +  SR   
Sbjct: 448  WIVHCDVKPENILLDKDFEPKIADFGLVKLL---------------NRGPSTNILSR--- 489

Query: 535  PDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK-----I 371
                              G   YIAPE   +L    K DV+S+GVVLLEL+ G      +
Sbjct: 490  ----------------VHGTRGYIAPEWALNLPITGKADVYSYGVVLLELVKGNRVSRWV 533

Query: 370  IVSDEMVPGPPVMGVEEKSKVLRMAD-------VAIRADMXXXXXXXXXXXXXGYNCISP 212
            +  +E V       V+   + L   D       V  R +                +C+  
Sbjct: 534  VDGEEEVELAVKRTVDILKEKLASGDQSWLLDFVDCRLNGEFNYSQAALVLNTAVSCLDE 593

Query: 211  VPQKRPTMKEVVQAL 167
              +KRP+M  VV+ L
Sbjct: 594  DRRKRPSMNSVVEIL 608



>gb:AK117952_1815959 Arabidopsis thaliana At5g01020 mRNA for putative
            protein kinase, complete cds, clone: RAFL19-14-C10.
          Length = 410

 Score =  128 bits (321), Expect = 3e-28
 Identities = 96/315 (30%), Positives = 148/315 (46%), Gaps = 16/315 (5%)
 Frame = -2

Query: 1060 YILGASGSSIMYKTVLDDGTAL-------AVRRVGESGLDRFREFENQIRVISKLVHPNL 902
            YILG  G   +YK  +DD   +       AV+ + + GL   RE+  ++  + +L HPNL
Sbjct: 73   YILGEGGFGTVYKGYIDDNLRVGLKSLPVAVKVLNKEGLQGHREWLTEVNFLGQLRHPNL 132

Query: 901  VRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIH 722
            V++ G+    D +L++Y+F+  GSL N   RK   +   L W  R+ IA G A+GL+++H
Sbjct: 133  VKLIGYCCEDDHRLLVYEFMLRGSLENHLFRK---TTAPLSWSRRMMIALGAAKGLAFLH 189

Query: 721  --EKKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTAS 548
              E+  ++ + K SNILLD+D   K+ DFGL +    G E+                   
Sbjct: 190  NAERPVIYRDFKTSNILLDSDYTAKLSDFGLAKAGPQGDET------------------- 230

Query: 547  RDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKII 368
                             S   +G   Y APE + +     + DV+SFGVVLLE+LTG+  
Sbjct: 231  ---------------HVSTRVMGTYGYAAPEYVMTGHLTARSDVYSFGVVLLEMLTGRKS 275

Query: 367  VSDEMVPGPPVMGVE-------EKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPV 209
            V D+  P      V+       +K K+L++ D   R +               Y C+S  
Sbjct: 276  V-DKTRPSKEQNLVDWARPKLNDKRKLLQIIDP--RLENQYSVRAAQKACSLAYYCLSQN 332

Query: 208  PQKRPTMKEVVQALD 164
            P+ RP M +VV+ L+
Sbjct: 333  PKARPLMSDVVETLE 347



>gb:AF084035_1767052 Arabidopsis thaliana receptor-like protein kinase
            (RKS1) gene, complete cds.
          Length = 829

 Score =  128 bits (321), Expect = 3e-28
 Identities = 79/230 (34%), Positives = 121/230 (52%), Gaps = 3/230 (1%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            LGA G   +YK VL +   +AV+R+  +      EF+N++++ISKL H NLVRI G    
Sbjct: 517  LGAGGFGPVYKGVLQNRMEIAVKRLSRNSGQGMEEFKNEVKLISKLQHRNLVRILGCCVE 576

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---VH 704
             +EK+++Y+++PN SL      +       L W  R++I RG+ARG+ Y+H+      +H
Sbjct: 577  LEEKMLVYEYLPNKSLDYFIFHE--EQRAELDWPKRMEIVRGIARGILYLHQDSRLRIIH 634

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             +LK SNILLD++M PK+ DFG+ R+                 FG               
Sbjct: 635  RDLKASNILLDSEMIPKISDFGMARI-----------------FG--------------- 662

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
              G      +   +G   Y+APE     + + K DV+SFGV++LE++TGK
Sbjct: 663  --GNQMEGCTSRVVGTFGYMAPEYAMEGQFSIKSDVYSFGVLMLEIITGK 710



>pir|D85065|D85065 receptor protein kinase-like protein [imported] -
            Arabidopsis thaliana>gb:ATCHRIV15_1544364 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No. 15.
          Length = 675

 Score =  128 bits (321), Expect = 3e-28
 Identities = 79/230 (34%), Positives = 119/230 (51%), Gaps = 3/230 (1%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            LG  G   +YK  L  G  +A++R+ +       EF+N++ V++KL H NL ++ G+   
Sbjct: 353  LGHGGFGEVYKGQLITGETVAIKRLSQGSTQGAEEFKNEVDVVAKLQHRNLAKLLGYCLD 412

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---VH 704
             +EK+++Y+FVPN SL            R L W+ R KI  G+ARG+ Y+H       +H
Sbjct: 413  GEEKILVYEFVPNKSLDYFLF--DNEKRRVLDWQRRYKIIEGIARGILYLHRDSRLTIIH 470

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             +LK SNILLDADM PK+ DFG+ R+                 FG  ++ A+        
Sbjct: 471  RDLKASNILLDADMHPKISDFGMARI-----------------FGVDQTQAN-------- 505

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                     +   +G   Y++PE     K + K DV+SFGV++LEL+TGK
Sbjct: 506  ---------TKRIVGTYGYMSPEYAIHGKYSVKSDVYSFGVLVLELITGK 546



>pir|T45878|T45878 receptor lectin kinase-like protein - Arabidopsis
            thaliana>gb:ATF4P12_1550723 Arabidopsis thaliana DNA
            chromosome 3, BAC clone F4P12.
          Length = 715

 Score =  128 bits (321), Expect = 3e-28
 Identities = 97/312 (31%), Positives = 146/312 (46%), Gaps = 15/312 (4%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDD-GTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFY 881
            I+G     ++Y+ +L + G  +AV+R   S  D+  EF +++ +I  L H NLVR++G+ 
Sbjct: 381  IIGHGAFGVVYRGILPETGDIVAVKRCSHSSQDKKNEFLSELSIIGSLRHRNLVRLQGWC 440

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIH---EKKH 710
                E L++YD +PNGSL  A       S   LPW+ R KI  GVA  L+Y+H   E + 
Sbjct: 441  HEKGEILLVYDLMPNGSLDKALF----ESRFTLPWDHRKKILLGVASALAYLHRECENQV 496

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K SNI+LD     K+GDFGL R +                          D  P+
Sbjct: 497  IHRDVKSSNIMLDESFNAKLGDFGLARQI------------------------EHDKSPE 532

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEM- 353
            + V           A G   Y+APE L + + + K DVFS+G V+LE+++G+  +  ++ 
Sbjct: 533  ATV-----------AAGTMGYLAPEYLLTGRASEKTDVFSYGAVVLEVVSGRRPIEKDLN 581

Query: 352  -----VPGPP-----VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQ 203
                 V   P     V G+ ++ KV   AD  +                    C  P P 
Sbjct: 582  VQRHNVGVNPNLVEWVWGLYKEGKVSAAADSRLEGKFDEGEMWRVLVVGLA--CSHPDPA 639

Query: 202  KRPTMKEVVQAL 167
             RPTM+ VVQ L
Sbjct: 640  FRPTMRSVVQML 651



>gb:AP004685_1843366 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC clone:P0017G10.
          Length = 414

 Score =  127 bits (320), Expect = 3e-28
 Identities = 93/320 (29%), Positives = 155/320 (48%), Gaps = 20/320 (6%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDD----------GTALAVRRVGESGLDRFREFENQIRVISKLVHP 908
            +LG  G   +YK  +D+          G  +AV+++    +    ++E+++  + ++ HP
Sbjct: 98   VLGEGGFGKVYKGWVDERTMNPSKSSTGVVVAVKKLNPESVQGTEQWESEVNFLGRISHP 157

Query: 907  NLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSY 728
            NLV++ G+    DE L++Y+F+  GSL N   R+ G+ +  LPW +RLKI  G ARGL++
Sbjct: 158  NLVKLLGYCKDNDELLLVYEFMAKGSLENHLFRR-GAVYEPLPWSLRLKILIGAARGLAF 216

Query: 727  IH--EKKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRST 554
            +H  E++ ++ + K SNILLD++   K+ DFGL +            +G           
Sbjct: 217  LHSSERQIIYRDFKASNILLDSNFNAKLSDFGLAK------------HG----------- 253

Query: 553  ASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                  PD  +S   T       +G   Y APE + +     K DV+ FGVVLLE+L+G 
Sbjct: 254  ------PDGGLSHVTT-----RVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEMLSGL 302

Query: 373  IIVSDEMVPG--------PPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCI 218
              +      G         P++   ++ K+ ++ D   R +                 C+
Sbjct: 303  RALDPSRPSGKLNLVDWAKPLLA--DRRKLSQLMD--SRLEGQYHSRGALQAAQLTLKCL 358

Query: 217  SPVPQKRPTMKEVVQALDNI 158
            S  P+ RP+MKEVV+AL+ I
Sbjct: 359  SGDPKSRPSMKEVVEALEKI 378



>gb:AF024648_1762136 Arabidopsis thaliana receptor-like
            serine/threonine kinase (RKF1) mRNA, complete cds.
          Length = 1020

 Score =  127 bits (320), Expect = 3e-28
 Identities = 96/310 (30%), Positives = 147/310 (47%), Gaps = 11/310 (3%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            +G  G   ++K VL DG  +AV+++        REF N+I  IS L HPNLV++ GF   
Sbjct: 686  IGEGGFGAVFKGVLADGRVVAVKQLSSKSRQGNREFLNEIGAISCLQHPNLVKLHGFCVE 745

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLP--WEVRLKIARGVARGLSYIHEK---KH 710
              + L+ Y+++ N SL++A        H+ +P  W  R KI  G+A+GL+++HE+   K 
Sbjct: 746  RAQLLLAYEYMENNSLSSALF---SPKHKQIPMDWPTRFKICCGIAKGLAFLHEESPLKF 802

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            VH ++K +NILLD D+ PK+ DFGL RL     +   K + S++                
Sbjct: 803  VHRDIKATNILLDKDLTPKISDFGLARL-----DEEEKTHISTK---------------- 841

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMV 350
                            G   Y+APE         K DV+SFGV++LE++ G I  S+ M 
Sbjct: 842  --------------VAGTIGYMAPEYALWGYLTFKADVYSFGVLVLEIVAG-ITNSNFMG 886

Query: 349  PGPPVMGVE------EKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTM 188
             G  V  +E      E   ++++ D  +R ++                C S  P  RP M
Sbjct: 887  AGDSVCLLEFANECVESGHLMQVVDERLRPEVDRKEAEAGIKVALV--CSSASPTDRPLM 944

Query: 187  KEVVQALDNI 158
             EVV  L+ +
Sbjct: 945  SEVVAMLEGL 954



>gb:AC079288_1732513 Arabidopsis thaliana chromosome 1 BAC T3M22
            genomic sequence, complete sequence.
          Length = 901

 Score =  127 bits (320), Expect = 3e-28
 Identities = 96/310 (30%), Positives = 147/310 (47%), Gaps = 11/310 (3%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            +G  G   ++K VL DG  +AV+++        REF N+I  IS L HPNLV++ GF   
Sbjct: 567  IGEGGFGAVFKGVLADGRVVAVKQLSSKSRQGNREFLNEIGAISCLQHPNLVKLHGFCVE 626

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLP--WEVRLKIARGVARGLSYIHEK---KH 710
              + L+ Y+++ N SL++A        H+ +P  W  R KI  G+A+GL+++HE+   K 
Sbjct: 627  RAQLLLAYEYMENNSLSSALF---SPKHKQIPMDWPTRFKICCGIAKGLAFLHEESPLKF 683

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            VH ++K +NILLD D+ PK+ DFGL RL     +   K + S++                
Sbjct: 684  VHRDIKATNILLDKDLTPKISDFGLARL-----DEEEKTHISTK---------------- 722

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMV 350
                            G   Y+APE         K DV+SFGV++LE++ G I  S+ M 
Sbjct: 723  --------------VAGTIGYMAPEYALWGYLTFKADVYSFGVLVLEIVAG-ITNSNFMG 767

Query: 349  PGPPVMGVE------EKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTM 188
             G  V  +E      E   ++++ D  +R ++                C S  P  RP M
Sbjct: 768  AGDSVCLLEFANECVESGHLMQVVDERLRPEVDRKEAEAVIKVALV--CSSASPTDRPLM 825

Query: 187  KEVVQALDNI 158
             EVV  L+ +
Sbjct: 826  SEVVAMLEGL 835



>gb:AY091006_1574238 Arabidopsis thaliana putative receptor
            serine/threonine kinase (At1g29750) mRNA, complete
            cds.>gb:AY142598_1583014 Arabidopsis thaliana putative
            receptor serine/threonine kinase (At1g29750) mRNA,
            complete cds.
          Length = 1006

 Score =  127 bits (320), Expect = 3e-28
 Identities = 96/310 (30%), Positives = 147/310 (47%), Gaps = 11/310 (3%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            +G  G   ++K VL DG  +AV+++        REF N+I  IS L HPNLV++ GF   
Sbjct: 672  IGEGGFGAVFKGVLADGRVVAVKQLSSKSRQGNREFLNEIGAISCLQHPNLVKLHGFCVE 731

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLP--WEVRLKIARGVARGLSYIHEK---KH 710
              + L+ Y+++ N SL++A        H+ +P  W  R KI  G+A+GL+++HE+   K 
Sbjct: 732  RAQLLLAYEYMENNSLSSALF---SPKHKQIPMDWPTRFKICCGIAKGLAFLHEESPLKF 788

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            VH ++K +NILLD D+ PK+ DFGL RL     +   K + S++                
Sbjct: 789  VHRDIKATNILLDKDLTPKISDFGLARL-----DEEEKTHISTK---------------- 827

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMV 350
                            G   Y+APE         K DV+SFGV++LE++ G I  S+ M 
Sbjct: 828  --------------VAGTIGYMAPEYALWGYLTFKADVYSFGVLVLEIVAG-ITNSNFMG 872

Query: 349  PGPPVMGVE------EKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTM 188
             G  V  +E      E   ++++ D  +R ++                C S  P  RP M
Sbjct: 873  AGDSVCLLEFANECVESGHLMQVVDERLRPEVDRKEAEAVIKVALV--CSSASPTDRPLM 930

Query: 187  KEVVQALDNI 158
             EVV  L+ +
Sbjct: 931  SEVVAMLEGL 940



>gb:ATCHRIV12_1544293 Arabidopsis thaliana DNA chromosome 4, contig
            fragment No. 12.>gb:AF076243_1766166 Arabidopsis thaliana
            BAC T26N6 from chromosome IV at 19.3 cM, complete
            sequence.
          Length = 658

 Score =  127 bits (320), Expect = 3e-28
 Identities = 81/230 (35%), Positives = 121/230 (52%), Gaps = 3/230 (1%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            LG  G   +YK +L  G  +AV+R+         EF+N++ ++++L H NLV++ GF   
Sbjct: 346  LGQGGFGSVYKGILPSGQEIAVKRLAGGSGQGELEFKNEVLLLTRLQHRNLVKLLGFCNE 405

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---VH 704
             +E++++Y+ VPN SL +    +       L W+VR +I  GVARGL Y+HE      +H
Sbjct: 406  GNEEILVYEHVPNSSLDHFIFDE--DKRWLLTWDVRYRIIEGVARGLLYLHEDSQLRIIH 463

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             +LK SNILLDA+M PKV DFG+ RL                N    R   SR       
Sbjct: 464  RDLKASNILLDAEMNPKVADFGMARLF---------------NMDETRGETSR------- 501

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                         +G   Y+APE +R  + + K DV+SFGV+LLE+++G+
Sbjct: 502  ------------VVGTYGYMAPEYVRHGQFSAKSDVYSFGVMLLEMISGE 539



>gb:AB019235_1514215 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MMI9.
          Length = 938

 Score =  127 bits (320), Expect = 3e-28
 Identities = 91/301 (30%), Positives = 136/301 (45%), Gaps = 3/301 (0%)
 Frame = -2

Query: 1060 YILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFY 881
            +I+G   SS +YK  L     +A++R+        REFE ++  I  + H N+V + G+ 
Sbjct: 628  FIIGYGASSTVYKCALKSSRPIAIKRLYNQYPHNLREFETELETIGSIRHRNIVSLHGYA 687

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE---KKH 710
                  L+ YD++ NGSL +  H  G      L WE RLKIA G A+GL+Y+H     + 
Sbjct: 688  LSPTGNLLFYDYMENGSLWDLLH--GSLKKVKLDWETRLKIAVGAAQGLAYLHHDCTPRI 745

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K SNILLD + E  + DFG+ + + A      K + S+                 
Sbjct: 746  IHRDIKSSNILLDENFEAHLSDFGIAKSIPAS-----KTHAST----------------- 783

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMV 350
                           LG   YI PE  R+ + N K D++SFG+VLLELLTGK  V +E  
Sbjct: 784  -------------YVLGTIGYIDPEYARTSRINEKSDIYSFGIVLLELLTGKKAVDNE-- 828

Query: 349  PGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVVQA 170
                +  + + + V+   D  +                    C    P +RPTM EV + 
Sbjct: 829  --ANLHQLADDNTVMEAVDPEVTVTCMDLGHIRKTFQLALL-CTKRNPLERPTMLEVSRV 885

Query: 169  L 167
            L
Sbjct: 886  L 886



>pir|A86421|A86421 Receptor-like serine/threonine kinase (RFK1)
            [imported] - Arabidopsis thaliana>gb:AE005172_891825
            Arabidopsis thaliana chromosome 1, top arm complete
            sequence.>gb:AC008030_1536479 Arabidopsis thaliana
            chromosome I BAC F1N18 genomic sequence, complete
            sequence.
          Length = 1021

 Score =  127 bits (320), Expect = 3e-28
 Identities = 96/310 (30%), Positives = 147/310 (47%), Gaps = 11/310 (3%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            +G  G   ++K VL DG  +AV+++        REF N+I  IS L HPNLV++ GF   
Sbjct: 687  IGEGGFGAVFKGVLADGRVVAVKQLSSKSRQGNREFLNEIGAISCLQHPNLVKLHGFCVE 746

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLP--WEVRLKIARGVARGLSYIHEK---KH 710
              + L+ Y+++ N SL++A        H+ +P  W  R KI  G+A+GL+++HE+   K 
Sbjct: 747  RAQLLLAYEYMENNSLSSALF---SPKHKQIPMDWPTRFKICCGIAKGLAFLHEESPLKF 803

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            VH ++K +NILLD D+ PK+ DFGL RL     +   K + S++                
Sbjct: 804  VHRDIKATNILLDKDLTPKISDFGLARL-----DEEEKTHISTK---------------- 842

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMV 350
                            G   Y+APE         K DV+SFGV++LE++ G I  S+ M 
Sbjct: 843  --------------VAGTIGYMAPEYALWGYLTFKADVYSFGVLVLEIVAG-ITNSNFMG 887

Query: 349  PGPPVMGVE------EKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTM 188
             G  V  +E      E   ++++ D  +R ++                C S  P  RP M
Sbjct: 888  AGDSVCLLEFANECVESGHLMQVVDERLRPEVDRKEAEAVIKVALV--CSSASPTDRPLM 945

Query: 187  KEVVQALDNI 158
             EVV  L+ +
Sbjct: 946  SEVVAMLEGL 955



>pir|T14377|T14377 S-receptor kinase (EC 2.7.1.-) SRK29 -
            turnip>gb:AB008191_1510363 Brassica rapa mRNA for SRK29,
            complete cds.
          Length = 854

 Score =  127 bits (320), Expect = 3e-28
 Identities = 83/230 (36%), Positives = 122/230 (53%), Gaps = 3/230 (1%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            +G  G  ++YK  L DG  +AV+R+ E       EF N++R+I+KL H NLVR+ G    
Sbjct: 539  VGKGGFGVVYKGRLVDGQEIAVKRLSEMSAQGTDEFMNEVRLIAKLQHNNLVRLLGCCVY 598

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---VH 704
              EK++IY+++ N SL +  H   GS    L W++R  I  G+ARGL Y+H+      +H
Sbjct: 599  EGEKILIYEYLENLSLDS--HLFDGSRSCKLNWQMRFDIINGIARGLLYLHQDSRFRIIH 656

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             +LK SN+LLD DM PK+ DFG+ R+                 FG       RD      
Sbjct: 657  RDLKASNVLLDKDMTPKISDFGMARI-----------------FG-------RDE----- 687

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                 T + +   +G   Y++PE   +   + K DVFSFGV+LLE+++GK
Sbjct: 688  -----TEADTRKVVGTYGYMSPEYAMNGTFSMKSDVFSFGVLLLEIISGK 732



>pir|JC2482|JC2482 S-receptor kinase (EC 2.7.1.-) 12 precursor - field
            mustard  (fragment)
          Length = 856

 Score =  127 bits (320), Expect = 3e-28
 Identities = 83/230 (36%), Positives = 122/230 (53%), Gaps = 3/230 (1%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            LG  G  I+YK +LD G  +AV+R+ ++ L    EF N++R+I++L H NLVRI G    
Sbjct: 534  LGQGGFGIVYKGMLD-GQEVAVKRLSKTSLQGIDEFMNEVRLIARLQHINLVRILGCCIE 592

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---VH 704
            ADEK++IY+++ N SL      K  SS  +L W+ R  I  GVARGL Y+H+      +H
Sbjct: 593  ADEKILIYEYLENSSLDYFLFGKKRSS--NLNWKDRFAITNGVARGLLYLHQDSRFRIIH 650

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             +LKP NILLD  M PK+ DFG+ R+ +                                
Sbjct: 651  RDLKPGNILLDKYMIPKISDFGMARIFIR------------------------------- 679

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                 T   + +A+G   Y++P+       + K DVFSFGV++LE+++GK
Sbjct: 680  ---AETQVRTDNAVGTYGYMSPDYAMYGVISEKTDVFSFGVIVLEIVSGK 726



>gb:AK117901_1815909 Arabidopsis thaliana At5g49660 mRNA for putative
            receptor protein kinase, complete cds, clone:
            RAFL19-08-G15.
          Length = 966

 Score =  127 bits (319), Expect = 4e-28
 Identities = 91/318 (28%), Positives = 146/318 (45%), Gaps = 21/318 (6%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRV---------GESGLDRFREFENQIRVISKLVHPN 905
            I+G  GS  +Y+  L  G  +AV+++          E  +   +E + ++  +  + H N
Sbjct: 661  IVGHGGSGTVYRVELKSGEVVAVKKLWSQSNKDSASEDKMHLNKELKTEVETLGSIRHKN 720

Query: 904  LVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYI 725
            +V++  ++   D  L++Y+++PNG+L +A H+       HL W  R +IA GVA+GL+Y+
Sbjct: 721  IVKLFSYFSSLDCSLLVYEYMPNGNLWDALHK----GFVHLEWRTRHQIAVGVAQGLAYL 776

Query: 724  HEKKH---VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRST 554
            H       +H ++K +NILLD + +PKV DFG+ +++ A G+                  
Sbjct: 777  HHDLSPPIIHRDIKSTNILLDVNYQPKVADFGIAKVLQARGKD----------------- 819

Query: 553  ASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                             S +    G   Y+APE   S K   K DV+SFGVVL+EL+TGK
Sbjct: 820  -----------------STTTVMAGTYGYLAPEYAYSSKATIKCDVYSFGVVLMELITGK 862

Query: 373  IIVSDEMVPGPPVMG-----VEEKSKVLRMADVAI----RADMXXXXXXXXXXXXXGYNC 221
              V         ++      ++ K  ++   D  +    +ADM                C
Sbjct: 863  KPVDSCFGENKNIVNWVSTKIDTKEGLIETLDKRLSESSKADM-------INALRVAIRC 915

Query: 220  ISPVPQKRPTMKEVVQAL 167
             S  P  RPTM EVVQ L
Sbjct: 916  TSRTPTIRPTMNEVVQLL 933



>gb:OSJN00055_1693993 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0017B10, complete sequence.
          Length = 475

 Score =  127 bits (319), Expect = 4e-28
 Identities = 97/319 (30%), Positives = 150/319 (47%), Gaps = 19/319 (5%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDD----------GTALAVRRVGESGLDRFREFENQIRVISKLVHP 908
            +LG  G   +YK  +D+          G  +AV+++    +   +E++++I  + +L HP
Sbjct: 140  VLGEGGFGRVYKGWVDERTMSPARSGTGMVIAVKKLNPESVQGLQEWQSEINFLGRLSHP 199

Query: 907  NLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSY 728
            NLVR+ G+     E L++Y+F+  GSL N   RK GS+++ + W + L+IA G ARGL++
Sbjct: 200  NLVRLIGYCVEDRELLLVYEFMAKGSLENHLFRK-GSAYQPISWNLCLRIAIGAARGLAF 258

Query: 727  IH--EKKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRST 554
            +H  E++ ++ + K SNILLD     K+ DFGL +     GES                 
Sbjct: 259  LHSSERQIIYRDFKASNILLDTHYNAKLSDFGLAKNGPTAGES----------------- 301

Query: 553  ASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                               +   +G   Y APE + +     K DV+ FGVVLLE+LTG 
Sbjct: 302  -----------------HVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEMLTG- 343

Query: 373  IIVSDEMVPGPPVMGVE-------EKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCIS 215
            +   D   P P    VE       ++ K+ R+ D   R +                 C+S
Sbjct: 344  MRALDTGRPAPQHSLVEWAKPYLADRRKLARLVDP--RLEGQYPSRAAQQAAQLTLRCLS 401

Query: 214  PVPQKRPTMKEVVQALDNI 158
              P+ RP+M EVVQAL  I
Sbjct: 402  GDPRSRPSMAEVVQALVEI 420



>pir|H85056|H85056 probable receptor-like protein kinase [imported] -
            Arabidopsis thaliana>gb:ATCHRIV12_1544295 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            12.>gb:AF076243_1766168 Arabidopsis thaliana BAC T26N6
            from chromosome IV at 19.3 cM, complete sequence.
          Length = 648

 Score =  127 bits (319), Expect = 4e-28
 Identities = 81/230 (35%), Positives = 119/230 (51%), Gaps = 3/230 (1%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            +G  G   +YK  L  G  +AV+R+         EF N++ ++++L H NLV++ GF   
Sbjct: 345  IGQGGFGSVYKGKLPGGEEIAVKRLTRGSGQGEIEFRNEVLLLTRLQHRNLVKLLGFCNE 404

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---VH 704
             DE++++Y+FVPN SL +    +       L W++R +I  GVARGL Y+HE      +H
Sbjct: 405  GDEEILVYEFVPNSSLDHFIFDE--EKRLLLTWDMRARIIEGVARGLVYLHEDSQLRIIH 462

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             +LK SNILLDA M PKV DFG+ RL                N    R+   +       
Sbjct: 463  RDLKASNILLDAYMNPKVADFGMARLF---------------NMDQTRAVTRK------- 500

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                         +G   Y+APE +R+   + K DV+SFGVVLLE++TG+
Sbjct: 501  ------------VVGTFGYMAPEYVRNRTFSVKTDVYSFGVVLLEMITGR 538



>gb:AP005156_1848353 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OJ1729_E01.
          Length = 609

 Score =  127 bits (318), Expect = 6e-28
 Identities = 81/230 (35%), Positives = 121/230 (52%), Gaps = 3/230 (1%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            +G  G   +YK +L  G  +AV+R+ +       E +N++ +++KL H NLVR+ GF   
Sbjct: 308  IGEGGFGAVYKGILH-GQEVAVKRMAKGSNQGLEELKNELVLVAKLHHRNLVRLVGFCLD 366

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE---KKHVH 704
              E+L+IY+++ N SL            R L W VR KI  G+ARGL Y+H+   KK VH
Sbjct: 367  EGERLLIYEYMSNKSLDTFLF--DAEQKRKLDWAVRFKIIEGIARGLQYLHQDSQKKIVH 424

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             ++K SNILLDADM PK+GDFGL RL   G + +R+V                       
Sbjct: 425  RDMKASNILLDADMNPKIGDFGLARLF--GQDQTREV----------------------- 459

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                     +    G   Y+ PE +   + + K DVFSFG++++E++TG+
Sbjct: 460  ---------TSRIAGTFGYMPPEYVLRGQYSTKSDVFSFGILVIEIVTGR 500



>gb:AP004584_1841867 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, PAC clone:P0007D08.
          Length = 836

 Score =  127 bits (318), Expect = 6e-28
 Identities = 99/320 (30%), Positives = 148/320 (46%), Gaps = 23/320 (7%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRV----GESG--------LDRFREFENQIRVISKLVH 911
            +G+     +Y+  L DG  +A++R       SG         D  R F  ++R++S++ H
Sbjct: 486  IGSGSFGSVYRAKLPDGREVAIKRAERPRAASGGGRRRRRRYDAERAFRAELRLLSRVNH 545

Query: 910  PNLVRIRGFYWGADEKLVIYDFVPNGSLANACH-RKGGSSHRHLPWEVRLKIARGVARGL 734
             NLV++ GF     E++++++F+P+G+L +  H R  G S     WE RL++A   ARG+
Sbjct: 546  RNLVQLLGFCEERGERILVFEFMPHGALHDHLHGRVDGHSPLFASWEARLRVALDAARGV 605

Query: 733  SYIH---EKKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSK 563
             Y+H       +H ++KPSNILLD +   KV DFGL                      + 
Sbjct: 606  EYLHCYAVPPIIHRDIKPSNILLDGEWTAKVSDFGLSL--------------------AS 645

Query: 562  RSTASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELL 383
             S++S  + P +A S       + S  G   YI PE  R  +   + DV+SFGVVLLEL+
Sbjct: 646  SSSSSATATPPAACS-------TSSTAGTVGYIDPEYYRLQELTQRSDVYSFGVVLLELV 698

Query: 382  TG-KIIVSDEMVPGPPVMGVE------EKSKVLRMADVAIRADMXXXXXXXXXXXXXGYN 224
            TG K I   E   G P   +E      E   V R+ D  + A                  
Sbjct: 699  TGRKAIHRQEGGSGSPRNVIEFAVPAVEAGGVGRIMDGRVPAPRGNEAEAVSRVARIASE 758

Query: 223  CISPVPQKRPTMKEVVQALD 164
            C+ P  + RP M EVV  L+
Sbjct: 759  CVRPRGRARPVMSEVVAELE 778



>gb:BT003347_1636770 Arabidopsis thaliana serine/threonine-specific
            protein kinase -like (At3g55450) mRNA, complete cds.
          Length = 389

 Score =  127 bits (318), Expect = 6e-28
 Identities = 93/316 (29%), Positives = 147/316 (46%), Gaps = 19/316 (6%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDD----------GTALAVRRVGESGLDRFREFENQIRVISKLVHP 908
            ++G  G   +++  LD+          G  +AV+R+   G    RE+  +I  + +L HP
Sbjct: 66   VVGEGGFGCVFRGWLDETTLTPTKSSSGLVIAVKRLNPDGFQGHREWLTEINYLGQLSHP 125

Query: 907  NLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSY 728
            NLV++ G+    +++L++Y+F+  GSL N     G    + L W +R+K+A   A+GL++
Sbjct: 126  NLVKLIGYCLEDEQRLLVYEFMHKGSLENHLFANGNKDFKPLSWILRIKVALDAAKGLAF 185

Query: 727  IHEK--KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRST 554
            +H    K ++ ++K SNILLD+D   K+ DFGL R     G    + Y S+R        
Sbjct: 186  LHSDPVKVIYRDIKASNILLDSDFNAKLSDFGLAR----DGPMGEQSYVSTR-------- 233

Query: 553  ASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                                   +G   Y APE + +   N + DV+SFGVVLLELL G+
Sbjct: 234  ----------------------VMGTFGYAAPEYVSTGHLNARSDVYSFGVVLLELLCGR 271

Query: 373  IIVSDEMVPGPPVMGVE-------EKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCIS 215
              + D   P      V+        + KVL + D   R +                 C+S
Sbjct: 272  QAL-DHNRPAKEQNLVDWARPYLTSRRKVLLIVDT--RLNSQYKPEGAVRLASIAVQCLS 328

Query: 214  PVPQKRPTMKEVVQAL 167
              P+ RPTM +VV+AL
Sbjct: 329  FEPKSRPTMDQVVRAL 344



>gb:BT000431_1634709 Arabidopsis thaliana serine/threonine-specific
            protein kinase -like (At3g55450) mRNA, complete cds.
          Length = 389

 Score =  127 bits (318), Expect = 6e-28
 Identities = 93/316 (29%), Positives = 147/316 (46%), Gaps = 19/316 (6%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDD----------GTALAVRRVGESGLDRFREFENQIRVISKLVHP 908
            ++G  G   +++  LD+          G  +AV+R+   G    RE+  +I  + +L HP
Sbjct: 66   VVGEGGFGCVFRGWLDETTLTPTKSSSGLVIAVKRLNPDGFQGHREWLTEINYLGQLSHP 125

Query: 907  NLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSY 728
            NLV++ G+    +++L++Y+F+  GSL N     G    + L W +R+K+A   A+GL++
Sbjct: 126  NLVKLIGYCLEDEQRLLVYEFMHKGSLENHLFANGNKDFKPLSWILRIKVALDAAKGLAF 185

Query: 727  IHEK--KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRST 554
            +H    K ++ ++K SNILLD+D   K+ DFGL R     G    + Y S+R        
Sbjct: 186  LHSDPVKVIYRDIKASNILLDSDFNAKLSDFGLAR----DGPMGEQSYVSTR-------- 233

Query: 553  ASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                                   +G   Y APE + +   N + DV+SFGVVLLELL G+
Sbjct: 234  ----------------------VMGTFGYAAPEYVSTGHLNARSDVYSFGVVLLELLCGR 271

Query: 373  IIVSDEMVPGPPVMGVE-------EKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCIS 215
              + D   P      V+        + KVL + D   R +                 C+S
Sbjct: 272  QAL-DHNRPAKEQNLVDWARPYLTSRRKVLLIVDT--RLNSQYKPEGAVRLASIAVQCLS 328

Query: 214  PVPQKRPTMKEVVQAL 167
              P+ RPTM +VV+AL
Sbjct: 329  FEPKSRPTMDQVVRAL 344



>pir|E96787|E96787 protein T4O12.5 [imported] - Arabidopsis
            thaliana>gb:AE005173_895118 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:AC007396_1535823 Genomic sequence for
            Arabidopsis thaliana BAC T4O12 from chromosome I,
            complete sequence.
          Length = 978

 Score =  127 bits (318), Expect = 6e-28
 Identities = 94/312 (30%), Positives = 147/312 (47%), Gaps = 11/312 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFRE-FENQIRVISKLVHPNLVRIRGFY 881
            I+G  G+ I+Y+  + +   +A++R+   G  R    F  +I+ + ++ H ++VR+ G+ 
Sbjct: 695  IIGKGGAGIVYRGSMPNNVDVAIKRLVGRGTGRSDHGFTAEIQTLGRIRHRHIVRLLGYV 754

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH--- 710
               D  L++Y+++PNGSL    H   GS   HL WE R ++A   A+GL Y+H       
Sbjct: 755  ANKDTNLLLYEYMPNGSLGELLH---GSKGGHLQWETRHRVAVEAAKGLCYLHHDCSPLI 811

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLD+D E  V DFGL + +V G  S                         
Sbjct: 812  LHRDVKSNNILLDSDFEAHVADFGLAKFLVDGAASECM---------------------- 849

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMV 350
            S+++G +             YIAPE   +LK + K DV+SFGVVLLEL+ GK  V +   
Sbjct: 850  SSIAGSY------------GYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGKKPVGEFGE 897

Query: 349  PGPPVMGVEE-KSKVLRMADVAIRADMXXXXXXXXXXXXXGY------NCISPVPQKRPT 191
                V  V   + ++ + +D AI   +              +       C+      RPT
Sbjct: 898  GVDIVRWVRNTEEEITQPSDAAIVVAIVDPRLTGYPLTSVIHVFKIAMMCVEEEAAARPT 957

Query: 190  MKEVVQALDNIP 155
            M+EVV  L N P
Sbjct: 958  MREVVHMLTNPP 969



>pir|T47684|T47684 serine/threonine-specific protein kinase-like -
            Arabidopsis thaliana>gb:ATT22E16_1555249 Arabidopsis
            thaliana DNA chromosome 3, BAC clone T22E16.
          Length = 392

 Score =  127 bits (318), Expect = 6e-28
 Identities = 93/316 (29%), Positives = 147/316 (46%), Gaps = 19/316 (6%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDD----------GTALAVRRVGESGLDRFREFENQIRVISKLVHP 908
            ++G  G   +++  LD+          G  +AV+R+   G    RE+  +I  + +L HP
Sbjct: 69   VVGEGGFGCVFRGWLDETTLTPTKSSSGLVIAVKRLNPDGFQGHREWLTEINYLGQLSHP 128

Query: 907  NLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSY 728
            NLV++ G+    +++L++Y+F+  GSL N     G    + L W +R+K+A   A+GL++
Sbjct: 129  NLVKLIGYCLEDEQRLLVYEFMHKGSLENHLFANGNKDFKPLSWILRIKVALDAAKGLAF 188

Query: 727  IHEK--KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRST 554
            +H    K ++ ++K SNILLD+D   K+ DFGL R     G    + Y S+R        
Sbjct: 189  LHSDPVKVIYRDIKASNILLDSDFNAKLSDFGLAR----DGPMGEQSYVSTR-------- 236

Query: 553  ASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                                   +G   Y APE + +   N + DV+SFGVVLLELL G+
Sbjct: 237  ----------------------VMGTFGYAAPEYVSTGHLNARSDVYSFGVVLLELLCGR 274

Query: 373  IIVSDEMVPGPPVMGVE-------EKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCIS 215
              + D   P      V+        + KVL + D   R +                 C+S
Sbjct: 275  QAL-DHNRPAKEQNLVDWARPYLTSRRKVLLIVDT--RLNSQYKPEGAVRLASIAVQCLS 331

Query: 214  PVPQKRPTMKEVVQAL 167
              P+ RPTM +VV+AL
Sbjct: 332  FEPKSRPTMDQVVRAL 347



>sp|Q9SYQ8|CLV1_ARATH Receptor protein kinase CLAVATA1 precursor (EC
            2.7.1.-).>gb:ATU96879_1557418 Arabidopsis thaliana CLV1
            receptor kinase (CLAVATA1) gene, complete cds.
          Length = 980

 Score =  127 bits (318), Expect = 6e-28
 Identities = 94/312 (30%), Positives = 147/312 (47%), Gaps = 11/312 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFRE-FENQIRVISKLVHPNLVRIRGFY 881
            I+G  G+ I+Y+  + +   +A++R+   G  R    F  +I+ + ++ H ++VR+ G+ 
Sbjct: 697  IIGKGGAGIVYRGSMPNNVDVAIKRLVGRGTGRSDHGFTAEIQTLGRIRHRHIVRLLGYV 756

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH--- 710
               D  L++Y+++PNGSL    H   GS   HL WE R ++A   A+GL Y+H       
Sbjct: 757  ANKDTNLLLYEYMPNGSLGELLH---GSKGGHLQWETRHRVAVEAAKGLCYLHHDCSPLI 813

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLD+D E  V DFGL + +V G  S                         
Sbjct: 814  LHRDVKSNNILLDSDFEAHVADFGLAKFLVDGAASECM---------------------- 851

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMV 350
            S+++G +             YIAPE   +LK + K DV+SFGVVLLEL+ GK  V +   
Sbjct: 852  SSIAGSY------------GYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGKKPVGEFGE 899

Query: 349  PGPPVMGVEE-KSKVLRMADVAIRADMXXXXXXXXXXXXXGY------NCISPVPQKRPT 191
                V  V   + ++ + +D AI   +              +       C+      RPT
Sbjct: 900  GVDIVRWVRNTEEEITQPSDAAIVVAIVDPRLTGYPLTSVIHVFKIAMMCVEEEAAARPT 959

Query: 190  MKEVVQALDNIP 155
            M+EVV  L N P
Sbjct: 960  MREVVHMLTNPP 971



>gb:AP004570_1841747 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC clone:P0625E02.
          Length = 479

 Score =  126 bits (317), Expect = 8e-28
 Identities = 90/306 (29%), Positives = 145/306 (47%), Gaps = 9/306 (2%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYW 878
            +LG  G   +YK  +++G  +AV+++  +GL   REF  ++ ++S L HPNLVR+ G+  
Sbjct: 84   LLGEGGFGRVYKGQMENGQVIAVKQLDRNGLQGNREFLVEVLMLSLLHHPNLVRLIGYCA 143

Query: 877  GADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---V 707
              D++L++Y+++  GSL N  H +     + L W  R+KIA G A+GL Y+H+K +   +
Sbjct: 144  DGDQRLLVYEYMLLGSLENHLHDR-PPGKKPLDWNARMKIAVGAAKGLEYLHDKANPPVI 202

Query: 706  HGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDS 527
            + + K SNILL  D  PK+ DFGL +L    G    K + S+R                 
Sbjct: 203  YRDFKSSNILLGEDYYPKLSDFGLAKL----GPVGDKTHVSTR----------------- 241

Query: 526  AVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMVP 347
                          +G   Y APE   + +   K DV+SFGVV LEL+TG+  +      
Sbjct: 242  -------------VMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDHTQPA 288

Query: 346  GPPVMGV------EEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMK 185
            G   +         ++ K  +MAD +++                   C+      RP + 
Sbjct: 289  GEQNLVAWARPLFRDRRKFCQMADPSLQGCYPKRGLYQALAVASM--CLQENATSRPLIA 346

Query: 184  EVVQAL 167
            ++V AL
Sbjct: 347  DIVTAL 352



>gb:AP003277_1827082 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC
            clone:P0518C01.>gb:AP003298_1827601 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 1, PAC
            clone:P0698H10.
          Length = 408

 Score =  126 bits (317), Expect = 8e-28
 Identities = 86/318 (27%), Positives = 153/318 (48%), Gaps = 18/318 (5%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTAL----------AVRRVGESGLDRFREFENQIRVISKLVHP 908
            +LG  G   ++K  +D+ T L          AV+++ + G    RE+  ++  + +L HP
Sbjct: 80   VLGEGGFGSVFKGWVDENTFLPSRPGTGMVIAVKKLNQDGFQGHREWLAEVNYLGQLSHP 139

Query: 907  NLVRIRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSY 728
            NLV++ G+    +++L++Y+F+P GSL N   R+ GS  + L W +R+K+A G A+GL++
Sbjct: 140  NLVKLVGYCLQDEQRLLVYEFMPRGSLENHLFRR-GSHFQPLSWNLRMKVALGAAKGLAF 198

Query: 727  IH--EKKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRST 554
            +H  + K ++ + K SN+LLD++   K+ DFGL +     G +  K + S+R        
Sbjct: 199  LHSDKAKVIYRDFKTSNVLLDSNYNAKLSDFGLAK----DGPTGDKSHVSTR-------- 246

Query: 553  ASRDSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK 374
                                   +G   Y APE L +   + K DV+SFGVV++E+L+G+
Sbjct: 247  ----------------------VMGTYGYAAPEYLATGHLSAKSDVYSFGVVMVEMLSGR 284

Query: 373  IIVSDEMVPGPPVM------GVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISP 212
              +      G   +       +  + ++ R+ D  +                    C+S 
Sbjct: 285  RALDKNRPAGEHNLVEWARPYLSSRRRIFRILDARLAGQ--YSLAGAHKAAALALQCLSA 342

Query: 211  VPQKRPTMKEVVQALDNI 158
              + RPTM +VV AL+ +
Sbjct: 343  DAKNRPTMHQVVAALEQL 360



>gb:AJ841698_1814401 Poa pratensis serk1 gene for somatic
            embryogenesis receptor-like kinase 1, exons 1-11, allele
            1.
          Length = 629

 Score =  126 bits (317), Expect = 8e-28
 Identities = 95/311 (30%), Positives = 154/311 (49%), Gaps = 9/311 (2%)
 Frame = -2

Query: 1066 SAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRG 887
            S  ILG  G  ++Y+  L +GT +AV+R+ +  +    +F+ ++ +I   VH NL+ + G
Sbjct: 309  SKNILGQGGFGVVYRGCLRNGTLVAVKRLKDPDVTGEVQFQTEVELIGLAVHRNLLPLYG 368

Query: 886  FYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK--- 716
            F   + E+L++Y ++PNGS+A+   R+       L W  R++IA G ARGL Y+HE+   
Sbjct: 369  FCMTSKERLLVYPYMPNGSVADRL-REYHHGKPSLDWSKRMRIAIGAARGLLYLHEQCNP 427

Query: 715  KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSF 536
            K +H ++K +NILLD   E  VGDFGL +L+                         +DS 
Sbjct: 428  KIIHRDVKAANILLDEGFEAVVGDFGLAKLL-----------------------DRQDSH 464

Query: 535  PDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDE 356
              +AV G          +G   +IAPE L + + + K DV+ FG++LLEL+TG   +S+ 
Sbjct: 465  VTTAVRG---------TIG---HIAPEYLSTGQSSEKTDVYGFGILLLELITGPKTLSNG 512

Query: 355  MVPGPP------VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRP 194
                        V  ++E+ K+ ++ D  ++                   C    P  RP
Sbjct: 513  HGQSQKGMILDWVRELKEEKKLDKLVDRDLKD--LFDIAELECSVDVIIQCTLTSPILRP 570

Query: 193  TMKEVVQALDN 161
             M EV+QAL++
Sbjct: 571  KMSEVLQALES 581



>gb:OSJN00033_1693630 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0042L16, complete sequence.
          Length = 526

 Score =  126 bits (317), Expect = 8e-28
 Identities = 88/308 (28%), Positives = 148/308 (48%), Gaps = 6/308 (1%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            A   ++G  G  I+Y  VL+DGT +AV+ +  +     REF+ ++  I ++ H NLVR+ 
Sbjct: 196  ADEKVIGEGGYGIVYHGVLEDGTQVAVKNLLNNRGQAEREFKVEVEAIGRVRHKNLVRLL 255

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE--- 719
            G+    ++++++Y++V NG+L    H   G     L W++R+KI  G A+GL Y+HE   
Sbjct: 256  GYCAEGNQRMLVYEYVNNGNLEQWLHGDVGPVSP-LTWDMRMKIILGTAKGLMYLHEGLE 314

Query: 718  KKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDS 539
             K VH ++K SNILLD     K+ DFGL +L+           GS R++ + R       
Sbjct: 315  PKVVHRDVKSSNILLDKTWNAKLSDFGLAKLL-----------GSERSYVTTR------- 356

Query: 538  FPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSD 359
                              +G   Y+APE   +   N   DV+SFG++++E+++G++ V  
Sbjct: 357  -----------------VMGTFGYVAPEYAGTGMLNETSDVYSFGILIMEIISGRVPVDY 399

Query: 358  EMVPGPPVMGVEEKSKVL-RMADVAIRADMXX--XXXXXXXXXXXGYNCISPVPQKRPTM 188
               PG   +    K+ V  R ++  +   M                  C+ P  +KRP +
Sbjct: 400  NRPPGEVNLVEWLKTMVSNRNSEGVLDPKMTEKPTSRALKKALLVALRCVDPEARKRPKI 459

Query: 187  KEVVQALD 164
              V+  L+
Sbjct: 460  GHVIHMLE 467



>gb:BT006486_1639373 Arabidopsis thaliana At5g49760 gene, complete
            cds.>gb:AK117123_1815170 Arabidopsis thaliana At5g49760
            mRNA for putative receptor protein kinase, complete cds,
            clone: RAFL16-66-A16.
          Length = 953

 Score =  126 bits (317), Expect = 8e-28
 Identities = 91/306 (29%), Positives = 144/306 (47%), Gaps = 7/306 (2%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            +G  G   +Y+ +L +G  +A++R  +  L    EF+ +I ++S++ H N+VR+ GF + 
Sbjct: 637  VGGGGYGKVYRGILPNGQLIAIKRAQQGSLQGGLEFKTEIELLSRVHHKNVVRLLGFCFD 696

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---VH 704
             +E++++Y+++ NGSL ++   K G     L W  RLKIA G  +GL+Y+HE      +H
Sbjct: 697  RNEQMLVYEYISNGSLKDSLSGKSGI---RLDWTRRLKIALGSGKGLAYLHELADPPIIH 753

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             ++K +NILLD ++  KV DFGL +LV                 G    T          
Sbjct: 754  RDIKSNNILLDENLTAKVADFGLSKLV-----------------GDPEKT---------- 786

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMVPG 344
                H  +     +G   Y+ PE   + +   K DV+ FGVVLLELLTG+  +       
Sbjct: 787  ----HVTTQVKGTMG---YLDPEYYMTNQLTEKSDVYGFGVVLLELLTGRSPIERGKYVV 839

Query: 343  PPVMGVEEKSKVL----RMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVV 176
              V     KS+ L     + D  I A                  C+      RP+M EVV
Sbjct: 840  REVKTKMNKSRSLYDLQELLDTTIIAS-SGNLKGFEKYVDLALRCVEEEGVNRPSMGEVV 898

Query: 175  QALDNI 158
            + ++NI
Sbjct: 899  KEIENI 904



>gb:AY056243_1563564 Arabidopsis thaliana unknown protein (At2g13780)
            mRNA, complete cds.
          Length = 620

 Score =  126 bits (317), Expect = 8e-28
 Identities = 98/309 (31%), Positives = 152/309 (49%), Gaps = 11/309 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIRGFY 881
            +LG  G   +YK  L DG  +AV+R+ E        +F+ ++ +IS  VH NL+R+RGF 
Sbjct: 299  VLGRGGFGKVYKGRLADGNLVAVKRLKEERTKGGELQFQTEVEMISMAVHRNLLRLRGFC 358

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE---KKH 710
                E+L++Y ++ NGS+A+ C R+    +  L W  R  IA G ARGL+Y+H+   +K 
Sbjct: 359  MTPTERLLVYPYMANGSVAS-CLRERPEGNPALDWPKRKHIALGSARGLAYLHDHCDQKI 417

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLD + E  VGDFGL +L+               N+         DS   
Sbjct: 418  IHRDVKAANILLDEEFEAVVGDFGLAKLM---------------NYN--------DSHVT 454

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG-------KI 371
            +AV G          +G   +IAPE L + K + K DVF +GV+LLEL+TG       ++
Sbjct: 455  TAVRG---------TIG---HIAPEYLSTGKSSEKTDVFGYGVMLLELITGQKAFDLARL 502

Query: 370  IVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
               D+++    V  V ++ K+  + D  +                    C      +RP 
Sbjct: 503  ANDDDIMLLDWVKEVLKEKKLESLVDAELEGKYVETEVEQLIQMALL--CTQSSAMERPK 560

Query: 190  MKEVVQALD 164
            M EVV+ L+
Sbjct: 561  MSEVVRMLE 569



>gb:ATAC018363_1543678 Arabidopsis thaliana chromosome III BAC F13E7
            genomic sequence, complete sequence.>gb:BT006352_1639239
            Arabidopsis thaliana At3g02880/F13E7_17 gene, complete
            cds.>gb:AF372969_1792681 Arabidopsis thaliana
            AT3g02880/F13E7_17 mRNA, complete cds.
          Length = 627

 Score =  126 bits (317), Expect = 8e-28
 Identities = 91/311 (29%), Positives = 141/311 (45%), Gaps = 7/311 (2%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            ASA +LG       YK   + G  +AV+R+ +  +   +EF  ++ V+  + H NLV + 
Sbjct: 346  ASAEVLGKGTVGSSYKASFEHGLVVAVKRLRDVVVPE-KEFRERLHVLGSMSHANLVTLI 404

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH 710
             +Y+  DEKL++++++  GSL+   H   G+    L WE R  IA G AR +SY+H +  
Sbjct: 405  AYYFSRDEKLLVFEYMSKGSLSAILHGNKGNGRTPLNWETRAGIALGAARAISYLHSRDG 464

Query: 709  V--HGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSF 536
               HGN+K SNILL    E KV D+GL  ++ +    +R                     
Sbjct: 465  TTSHGNIKSSNILLSDSYEAKVSDYGLAPIISSTSAPNR--------------------- 503

Query: 535  PDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKI----I 368
                               I  Y APE   + K + K DV+SFGV++LELLTGK      
Sbjct: 504  -------------------IDGYRAPEITDARKISQKADVYSFGVLILELLTGKSPTHQQ 544

Query: 367  VSDEMVPGPP-VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
            +++E V  P  V  V E+     + D  +                 G +C +  P  RP+
Sbjct: 545  LNEEGVDLPRWVQSVTEQQTPSDVLDPELTRYQPEGNENIIRLLKIGMSCTAQFPDSRPS 604

Query: 190  MKEVVQALDNI 158
            M EV + ++ +
Sbjct: 605  MAEVTRLIEEV 615



>gb:AB025613_1516372 Arabidopsis thaliana genomic DNA, chromosome 5,
            TAC clone:K2I5.
          Length = 941

 Score =  126 bits (317), Expect = 8e-28
 Identities = 91/306 (29%), Positives = 144/306 (47%), Gaps = 7/306 (2%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            +G  G   +Y+ +L +G  +A++R  +  L    EF+ +I ++S++ H N+VR+ GF + 
Sbjct: 612  VGGGGYGKVYRGILPNGQLIAIKRAQQGSLQGGLEFKTEIELLSRVHHKNVVRLLGFCFD 671

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEKKH---VH 704
             +E++++Y+++ NGSL ++   K G     L W  RLKIA G  +GL+Y+HE      +H
Sbjct: 672  RNEQMLVYEYISNGSLKDSLSGKSGI---RLDWTRRLKIALGSGKGLAYLHELADPPIIH 728

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             ++K +NILLD ++  KV DFGL +LV                 G    T          
Sbjct: 729  RDIKSNNILLDENLTAKVADFGLSKLV-----------------GDPEKT---------- 761

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSDEMVPG 344
                H  +     +G   Y+ PE   + +   K DV+ FGVVLLELLTG+  +       
Sbjct: 762  ----HVTTQVKGTMG---YLDPEYYMTNQLTEKSDVYGFGVVLLELLTGRSPIERGKYVV 814

Query: 343  PPVMGVEEKSKVL----RMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMKEVV 176
              V     KS+ L     + D  I A                  C+      RP+M EVV
Sbjct: 815  REVKTKMNKSRSLYDLQELLDTTIIAS-SGNLKGFEKYVDLALRCVEEEGVNRPSMGEVV 873

Query: 175  QALDNI 158
            + ++NI
Sbjct: 874  KEIENI 879



>gb:AX120071_1461715 Sequence 54 from Patent WO0129240.
          Length = 596

 Score =  126 bits (317), Expect = 8e-28
 Identities = 98/309 (31%), Positives = 152/309 (49%), Gaps = 11/309 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIRGFY 881
            +LG  G   +YK  L DG  +AV+R+ E        +F+ ++ +IS  VH NL+R+RGF 
Sbjct: 275  VLGRGGFGKVYKGRLADGNLVAVKRLKEERTKGGELQFQTEVEMISMAVHRNLLRLRGFC 334

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE---KKH 710
                E+L++Y ++ NGS+A+ C R+    +  L W  R  IA G ARGL+Y+H+   +K 
Sbjct: 335  MTPTERLLVYPYMANGSVAS-CLRERPEGNPALDWPKRKHIALGSARGLAYLHDHCDQKI 393

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLD + E  VGDFGL +L+               N+         DS   
Sbjct: 394  IHRDVKAANILLDEEFEAVVGDFGLAKLM---------------NYN--------DSHVT 430

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG-------KI 371
            +AV G          +G   +IAPE L + K + K DVF +GV+LLEL+TG       ++
Sbjct: 431  TAVRG---------TIG---HIAPEYLSTGKSSEKTDVFGYGVMLLELITGQKAFDLARL 478

Query: 370  IVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
               D+++    V  V ++ K+  + D  +                    C      +RP 
Sbjct: 479  ANDDDIMLLDWVKEVLKEKKLESLVDAELEGKYVETEVEQLIQMALL--CTQSSAMERPK 536

Query: 190  MKEVVQALD 164
            M EVV+ L+
Sbjct: 537  MSEVVRMLE 545



>gb:CQ768567_1451801 Sequence 62 from Patent WO2004007712.
          Length = 615

 Score =  126 bits (317), Expect = 8e-28
 Identities = 98/309 (31%), Positives = 152/309 (49%), Gaps = 11/309 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIRGFY 881
            +LG  G   +YK  L DG  +AV+R+ E        +F+ ++ +IS  VH NL+R+RGF 
Sbjct: 294  VLGRGGFGKVYKGRLADGNLVAVKRLKEERTKGGELQFQTEVEMISMAVHRNLLRLRGFC 353

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE---KKH 710
                E+L++Y ++ NGS+A+ C R+    +  L W  R  IA G ARGL+Y+H+   +K 
Sbjct: 354  MTPTERLLVYPYMANGSVAS-CLRERPEGNPALDWPKRKHIALGSARGLAYLHDHCDQKI 412

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLD + E  VGDFGL +L+               N+         DS   
Sbjct: 413  IHRDVKAANILLDEEFEAVVGDFGLAKLM---------------NYN--------DSHVT 449

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG-------KI 371
            +AV G          +G   +IAPE L + K + K DVF +GV+LLEL+TG       ++
Sbjct: 450  TAVRG---------TIG---HIAPEYLSTGKSSEKTDVFGYGVMLLELITGQKAFDLARL 497

Query: 370  IVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
               D+++    V  V ++ K+  + D  +                    C      +RP 
Sbjct: 498  ANDDDIMLLDWVKEVLKEKKLESLVDAELEGKYVETEVEQLIQMALL--CTQSSAMERPK 555

Query: 190  MKEVVQALD 164
            M EVV+ L+
Sbjct: 556  MSEVVRMLE 564



>pir|T01086|T01086 probable serine/threonine-specific protein kinase
            (EC 2.7.1.-) T10P11.10 - Arabidopsis
            thaliana>gb:AC002330_1530281 Arabidopsis thaliana BAC
            T10P11 from chromosome IV, near 15 cM, complete
            sequence.>gb:ATCHRIV6_1546251 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 6.>gb:BT004208_1637304
            Arabidopsis thaliana clone RAFL15-29-F09 (R50149)
            putative serine/threonine protein kinase (At4g02630)
            mRNA, complete cds.>gb:BT005583_1638523 Arabidopsis
            thaliana clone U50149 putative serine/threonine protein
            kinase (At4g02630) mRNA, complete cds.
          Length = 492

 Score =  126 bits (317), Expect = 8e-28
 Identities = 87/309 (28%), Positives = 143/309 (46%), Gaps = 7/309 (2%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIR 890
            A   ++G  G  I+Y+ VL+D + +A++ +  +     +EF+ ++  I ++ H NLVR+ 
Sbjct: 163  ADENVIGQGGYGIVYRGVLEDKSMVAIKNLLNNRGQAEKEFKVEVEAIGRVRHKNLVRLL 222

Query: 889  GFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE--- 719
            G+      ++++Y++V NG+L    H  G      L WE+R+ I  G A+GL Y+HE   
Sbjct: 223  GYCVEGAHRMLVYEYVDNGNLEQWIHGGGLGFKSPLTWEIRMNIVLGTAKGLMYLHEGLE 282

Query: 718  KKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDS 539
             K VH ++K SNILLD     KV DFGL +L+           GS  ++ + R       
Sbjct: 283  PKVVHRDIKSSNILLDKQWNSKVSDFGLAKLL-----------GSEMSYVTTR------- 324

Query: 538  FPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVSD 359
                              +G   Y+APE   +   N + DV+SFGV+++E+++G+  V  
Sbjct: 325  -----------------VMGTFGYVAPEYASTGMLNERSDVYSFGVLVMEIISGRSPVDY 367

Query: 358  EMVPGPPVMGVEEKSKVLRMADVAIRADMXX----XXXXXXXXXXXGYNCISPVPQKRPT 191
               PG  V  VE   +++   D     D                     C+ P  QKRP 
Sbjct: 368  SRAPG-EVNLVEWLKRLVTNRDAEGVLDPRMVDKPSLRSLKRTLLVALRCVDPNAQKRPK 426

Query: 190  MKEVVQALD 164
            M  ++  L+
Sbjct: 427  MGHIIHMLE 435



>pir|G84510|G84510 probable receptor-like protein kinase [imported] -
            Arabidopsis thaliana>gb:AC006436_1534245 Arabidopsis
            thaliana chromosome 2 clone F13J11 map mi398, complete
            sequence.
          Length = 520

 Score =  126 bits (317), Expect = 8e-28
 Identities = 98/309 (31%), Positives = 152/309 (49%), Gaps = 11/309 (3%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRIRGFY 881
            +LG  G   +YK  L DG  +AV+R+ E        +F+ ++ +IS  VH NL+R+RGF 
Sbjct: 199  VLGRGGFGKVYKGRLADGNLVAVKRLKEERTKGGELQFQTEVEMISMAVHRNLLRLRGFC 258

Query: 880  WGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE---KKH 710
                E+L++Y ++ NGS+A+ C R+    +  L W  R  IA G ARGL+Y+H+   +K 
Sbjct: 259  MTPTERLLVYPYMANGSVAS-CLRERPEGNPALDWPKRKHIALGSARGLAYLHDHCDQKI 317

Query: 709  VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPD 530
            +H ++K +NILLD + E  VGDFGL +L+               N+         DS   
Sbjct: 318  IHRDVKAANILLDEEFEAVVGDFGLAKLM---------------NYN--------DSHVT 354

Query: 529  SAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG-------KI 371
            +AV G          +G   +IAPE L + K + K DVF +GV+LLEL+TG       ++
Sbjct: 355  TAVRG---------TIG---HIAPEYLSTGKSSEKTDVFGYGVMLLELITGQKAFDLARL 402

Query: 370  IVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPT 191
               D+++    V  V ++ K+  + D  +                    C      +RP 
Sbjct: 403  ANDDDIMLLDWVKEVLKEKKLESLVDAELEGKYVETEVEQLIQMALL--CTQSSAMERPK 460

Query: 190  MKEVVQALD 164
            M EVV+ L+
Sbjct: 461  MSEVVRMLE 469



>gb:AP003736_1832662 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OJ1008_E09.>gb:AP005156_1848347 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OJ1729_E01.
          Length = 657

 Score =  126 bits (316), Expect = 1e-27
 Identities = 93/311 (29%), Positives = 152/311 (48%), Gaps = 10/311 (3%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            LG  G   +YK +L  G  +AV+R+ +       E +N++ +++KL H NLVR+ GF   
Sbjct: 357  LGEGGFGAVYKGLLF-GQEVAVKRLAKGSNQGLEELKNELVLVAKLHHKNLVRLVGFCLE 415

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE---KKHVH 704
              E+L++Y ++PN SL         S  R L W  R KI  G+ARGL Y+H+   KK +H
Sbjct: 416  EGERLLVYKYIPNKSLDIFLFDSEQS--RQLDWATRFKIIEGIARGLQYLHQDSQKKIIH 473

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             ++K SN+LLDADM PK+GDFGL RL   G + +R V                       
Sbjct: 474  RDMKASNVLLDADMNPKIGDFGLARLF--GQDQTRDV----------------------- 508

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK-------IIV 365
                     +   +G   Y++PE +   + + K DVFSFG++++E++TG+       +  
Sbjct: 509  ---------TNRIVGTFGYMSPEYVIRGQYSTKSDVFSFGILVIEIVTGRRNSGPHFLEQ 559

Query: 364  SDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKRPTMK 185
            +++++    V    E+  ++ M D ++  +                 C+   P  RPTM 
Sbjct: 560  NEDLI--SIVRRHWEEGNIVEMTDHSLGRNYPEAELLKCVSIGLL--CVQQNPVDRPTMA 615

Query: 184  EVVQALDNIPT 152
            +V+  L++  T
Sbjct: 616  DVMVLLNSDAT 626



>gb:ZMA400870_1731518 Zea mays partial mRNA for somatic embryogenesis
            receptor-like kinase 3, (serk3 gene).
          Length = 541

 Score =  126 bits (316), Expect = 1e-27
 Identities = 90/270 (33%), Positives = 144/270 (53%), Gaps = 11/270 (4%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESGLDRFR-EFENQIRVISKLVHPNLVRI 893
            ++ +ILG  G   +YK  L DG+ +AV+R+ E        +F+ ++ +IS   H NL+R+
Sbjct: 281  SNKHILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAAHRNLLRL 340

Query: 892  RGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK- 716
            RGF     E+L++Y ++ NGS+A+   R+  +S   L WE R +IA G ARGLSY+H+  
Sbjct: 341  RGFCMTPTERLLVYPYMANGSVASRL-RERQASEPPLKWETRRRIALGSARGLSYLHDHC 399

Query: 715  --KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRD 542
              K +H ++K +NILLD + E  VGDFGL +L+                         +D
Sbjct: 400  DPKIIHRDVKAANILLDEEFEAVVGDFGLAKLM-----------------------DYKD 436

Query: 541  SFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTG----- 377
            +   +AV G          +G   +IAPE L + K + K DVF +G++LLEL+TG     
Sbjct: 437  THVTTAVRG---------TIG---HIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFD 484

Query: 376  --KIIVSDEMVPGPPVMGVEEKSKVLRMAD 293
              ++   D+++    V G+ ++ KV  + D
Sbjct: 485  LARLANDDDVMLLDWVKGLLKEKKVEMLVD 514



>gb:PSY250467_1702600 Pinus sylvestris mRNA for receptor protein
            kinase (upk gene).
          Length = 1145

 Score =  126 bits (316), Expect = 1e-27
 Identities = 94/316 (29%), Positives = 147/316 (46%), Gaps = 16/316 (5%)
 Frame = -2

Query: 1057 ILGASGSSIMYKTVLDDGTALAVRRVG---ESGLDRFRE---FENQIRVISKLVHPNLVR 896
            I+G   S ++YK  + +G  +AV+++    ES  ++ RE   F  ++  +  + H N+VR
Sbjct: 802  IIGKGCSGVVYKAEMGNGDVIAVKKLWTGKESECEKVRERDSFSAEVNTLGAIRHRNIVR 861

Query: 895  IRGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK 716
            + G       KL++YD++PNGSL    H K       L WE+R  I  GV RGLSY+H  
Sbjct: 862  LLGCCTNGRSKLLMYDYMPNGSLGGLLHEK----RSMLDWEIRYNIVLGVRRGLSYLHHD 917

Query: 715  KH---VHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASR 545
                 +H ++K +NILL +  EP + DFGL +LV             S +F    +T + 
Sbjct: 918  CRPPILHRDVKANNILLGSQYEPYLADFGLAKLV------------DSADFNRSSTTVA- 964

Query: 544  DSFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIV 365
                                 G   YIAPE   ++K   K DV+SFGVVLLE++TGK  +
Sbjct: 965  ---------------------GSYGYIAPEYGYTMKITQKIDVYSFGVVLLEVVTGKQPI 1003

Query: 364  SDEMVPGPPVM----GVEEKSKVLRMADV---AIRADMXXXXXXXXXXXXXGYNCISPVP 206
               +  G  ++       + +K+   A+V    ++                 + C++  P
Sbjct: 1004 DPTIPEGVHLVEWARDAVQSNKLADSAEVIDPRLQGRPDTQIQEMLQVLGVAFLCVNSNP 1063

Query: 205  QKRPTMKEVVQALDNI 158
             +RPTMK+V   L  I
Sbjct: 1064 DERPTMKDVAALLKEI 1079



>gb:AY088040_1573064 Arabidopsis thaliana clone 40594 mRNA, complete
            sequence.
          Length = 629

 Score =  126 bits (316), Expect = 1e-27
 Identities = 99/314 (31%), Positives = 150/314 (47%), Gaps = 12/314 (3%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRVGESG-LDRFREFENQIRVISKLVHPNLVRI 893
            +S  +LG  G   +YK +L D T +AV+R+ + G L    +F+ ++ +IS  VH NL+R+
Sbjct: 304  SSKNLLGKGGYGNVYKGILGDSTVIAVKRLKDGGALGGEIQFQTEVEMISLAVHRNLLRL 363

Query: 892  RGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK- 716
             GF     EKL++Y ++ NGS+A+    K       L W +R +IA G ARGL Y+HE+ 
Sbjct: 364  YGFCITQTEKLLVYPYMSNGSVASRMKAKPV-----LDWSIRKRIAIGAARGLVYLHEQC 418

Query: 715  --KHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRD 542
              K +H ++K +NILLD   E  VGDFGL +L+                         +D
Sbjct: 419  DPKIIHRDVKAANILLDDYCEAVVGDFGLAKLL-----------------------DHQD 455

Query: 541  SFPDSAVSG--GHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK-- 374
            S   +AV G  GH              IAPE L + + + K DVF FG++LLEL+TG+  
Sbjct: 456  SHVTTAVRGTVGH--------------IAPEYLSTGQSSEKTDVFGFGILLLELVTGQRA 501

Query: 373  ----IIVSDEMVPGPPVMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVP 206
                   + + V    V  + ++ K+  + D  +                    C   +P
Sbjct: 502  FEFGKAANQKGVMLDWVKKIHQEKKLELLVDKELLKKKSYDEIELDEMVRVALLCTQYLP 561

Query: 205  QKRPTMKEVVQALD 164
              RP M EVV+ L+
Sbjct: 562  GHRPKMSEVVRMLE 575



>gb:AB103395_1526454 Oryza sativa (japonica cultivar-group) MSP1 mRNA
            for putative leucin-rich repeat protein kinase, complete
            cds.>gb:AP003451_1829652 Oryza sativa (japonica
            cultivar-group) genomic DNA, chromosome 1, PAC
            clone:P0413C03.
          Length = 1294

 Score =  126 bits (316), Expect = 1e-27
 Identities = 97/310 (31%), Positives = 139/310 (44%), Gaps = 9/310 (2%)
 Frame = -2

Query: 1069 ASAYILGASGSSIMYKTVLDDGTALAVRRV-GESGLDRFREFENQIRVISKLVHPNLVRI 893
            +  +I+G  G   +YK  L +G  +A++R+ G       REF  ++  I K+ HPNLV +
Sbjct: 1003 SKVHIIGDGGFGTVYKAALPEGRRVAIKRLHGGHQFQGDREFLAEMETIGKVKHPNLVPL 1062

Query: 892  RGFYWGADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHE-- 719
             G+    DE+ +IY+++ NGSL     R    +   L W  RLKI  G ARGL+++H   
Sbjct: 1063 LGYCVCGDERFLIYEYMENGSL-EMWLRNRADALEALGWPDRLKICLGSARGLAFLHHGF 1121

Query: 718  -KKHVHGNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRD 542
                +H ++K SNILLD + EP+V DFGL R++ A                         
Sbjct: 1122 VPHIIHRDMKSSNILLDENFEPRVSDFGLARIISA------------------------- 1156

Query: 541  SFPDSAVSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGKIIVS 362
                           S    G   YI PE   ++K   K DV+SFGVV+LELLTG+    
Sbjct: 1157 ----------CETHVSTDIAGTFGYIPPEYGLTMKSTTKGDVYSFGVVMLELLTGRPPTG 1206

Query: 361  DEMVPGPP-----VMGVEEKSKVLRMADVAIRADMXXXXXXXXXXXXXGYNCISPVPQKR 197
             E V G       V  +  + K   + D  +                   +C +  P KR
Sbjct: 1207 QEEVQGGGNLVGWVRWMIARGKQNELFDPCLPVS-SVWREQMARVLAIARDCTADEPFKR 1265

Query: 196  PTMKEVVQAL 167
            PTM EVV+ L
Sbjct: 1266 PTMLEVVKGL 1275



>gb:AE016959_1021800 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC090486_1734344 Genomic
            sequence for Oryza sativa (japonica cultivar-group)
            cultivar Nipponbare clone OSJNBa0093I09, from Chromosome
            10, complete sequence.>gb:AC099774_1737233 Oryza sativa
            chromosome 10 BAC OSJNBa0073L20 genomic sequence,
            complete sequence.>gb:AE017076_1751619 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 30 of 77
            of the complete sequence.
          Length = 680

 Score =  126 bits (316), Expect = 1e-27
 Identities = 94/311 (30%), Positives = 143/311 (45%), Gaps = 10/311 (3%)
 Frame = -2

Query: 1054 LGASGSSIMYKTVLDDGTALAVRRVGESGLDRFREFENQIRVISKLVHPNLVRIRGFYWG 875
            LG  G   +YK  L DG  +AV+R+ ++      +  N++  ++KL H NL ++ G    
Sbjct: 364  LGHGGFGAVYKGFLPDGREIAVKRLDKTSGQGLEQLRNELLFVAKLRHNNLAKLLGVCIK 423

Query: 874  ADEKLVIYDFVPNGSLANACHRKGGSSHRHLPWEVRLKIARGVARGLSYIHEK---KHVH 704
             +EKL+IY+++PN SL              L WE R +I  G+ARGL Y+HE    K +H
Sbjct: 424  GEEKLLIYEYLPNRSLDTFLF--DPEKRGQLNWETRYQIIHGIARGLLYLHEDSQIKIIH 481

Query: 703  GNLKPSNILLDADMEPKVGDFGLERLVVAGGESSRKVYGSSRNFGSKRSTASRDSFPDSA 524
             +LK SN+LLDA+M PK+ DFGL RL                                  
Sbjct: 482  RDLKASNVLLDANMNPKISDFGLARL---------------------------------- 507

Query: 523  VSGGHTPSPSPSALGISPYIAPESLRSLKPNPKWDVFSFGVVLLELLTGK--IIVSDEMV 350
              G  T S +   +G   Y+APE       + K DV+SFG+++LE++TG+    VS E+ 
Sbjct: 508  FDGTKTASITNHVVGTLGYMAPEYAVLGHVSVKLDVYSFGILVLEIVTGRRNTDVSGEVE 567

Query: 349  PGPPVMGVE----EKSKVLRMADVAIRAD-MXXXXXXXXXXXXXGYNCISPVPQKRPTMK 185
                ++        K   L +AD ++  D               G  C+   P  RPTM 
Sbjct: 568  ESNNLLSYVWDHWVKGTPLEIADASLLGDGRSLSDMELLKCVHFGLLCVQENPVDRPTML 627

Query: 184  EVVQALDNIPT 152
            +++  L ++ T
Sbjct: 628  DILVMLHDVDT 638


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,192,570,882
Number of Sequences: 1806583
Number of extensions: 26462871
Number of successful extensions: 118215
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 93098
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 109300
length of database: 581,917,975
effective HSP length: 127
effective length of database: 352,481,934
effective search space used: 94817640246
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)