BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10717
         (995 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY088570_1573587 Arabidopsis thaliana clone 7925 mRNA, comple...   405   e-112   
gb:AB020749_1514655 Arabidopsis thaliana genomic DNA, chromosome...   405   e-112   
gb:AJ583803_1811375 Glycine max cctd gene for cytosolic chaperon...   396   e-109   
gb:GMA012318_1680333 Glycine max cctd gene.                           392   e-108   
gb:AP005865_1859262 Oryza sativa (japonica cultivar-group) genom...   378   e-104   
gb:AE016959_1023422 Oryza sativa (japonica cultivar-group) chrom...   366   e-100   
gb:AF494043_1276771 Physarum polycephalum chaperonin containing ...   308   8e-83   
sp|Q9NB32|TCPD_AEDTR|TCPD_AEDTR T-complex protein 1, delta subunit (TCP-1-d...   303   3e-81   Ochlerotatus triseriatus
gb:BC056719_2551912 Danio rerio chaperonin containing TCP1, subu...   303   5e-81   
gb:BC076940_2559679 Xenopus tropicalis chaperonin containing TCP...   301   2e-80   
gb:BC065324_2553943 Danio rerio chaperonin containing TCP1, subu...   300   4e-80   
gb:BC084314_2563699 Xenopus laevis hypothetical protein LOC39895...   299   5e-80   
gb:BC060448_2552914 Xenopus laevis hypothetical protein LOC39895...   299   5e-80   
gb:BC014676_1974775 Homo sapiens, clone IMAGE:4158571, mRNA, par...   297   2e-79   
gb:AF026291_1877303 Homo sapiens chaperonin containing t-complex...   297   2e-79   
gb:CR860659_1184718 Pongo pygmaeus mRNA; cDNA DKFZp459D1424 (fro...   297   2e-79   
pir|JC4521|JC4521 t-complex polypeptide 1 chaperonin delta chain...   297   2e-79   Takifugu rubripes [tiger puffer]
sp|P53451|TCPD_FUGRU|TCPD_FUGRU T-complex protein 1, delta subunit (TCP-1-d...   297   2e-79   Takifugu rubripes [tiger puffer]
gb:BC073652_2557475 Xenopus laevis MGC82994 protein, mRNA (cDNA ...   297   2e-79   
sp|P80315|TCPD_MOUSE|TCPD_MOUSE T-complex protein 1, delta subunit (TCP-1-d...   296   3e-79   Mus musculus [mouse]
sp|P50991|TCPD_HUMAN|TCPD_HUMAN T-complex protein 1, delta subunit (TCP-1-d...   296   3e-79   Homo sapiens [man]
gb:AB056420_1868409 Macaca fascicularis brain cDNA, clone:QflA-1...   296   4e-79   
gb:AE014134_1128927 Drosophila melanogaster chromosome 2L, compl...   295   7e-79   
gb:GGA251587_2572730 Gallus gallus mRNA for chaperonin T-complex...   295   1e-78   
gb:AY223861_2079906 Rattus norvegicus chaperonin delta subunit (...   294   2e-78   
gb:MUSCHAP_2125473 Mus musculus chaperonin mRNA, complete cds.        293   5e-78   
gb:AE017347_1757761 Cryptococcus neoformans var. neoformans JEC2...   283   5e-75   
sp|P50999|TCPD_SCHPO|TCPD_SCHPO T-complex protein 1, delta subunit (TCP-1-d...   282   8e-75   Schizosaccharomyces pombe
sp|P47208|TCPD_CAEEL|TCPD_CAEEL T-complex protein 1, delta subunit (TCP-1-d...   275   1e-72   Caenorhabditis elegans [roundworm]
gb:AY327033_1319732 Tetrahymena pyriformis CCT delta subunit (CC...   269   7e-71   
gb:AE016817_1747467 Ashbya gossypii (= Eremothecium gossypii) AT...   263   5e-69   
gb:PFMAL13_1191626 Plasmodium falciparum 3D7 chromosome 13, *** ...   262   9e-69   
gb:AY850329_1180299 Magnaporthe grisea T-complex protein-like pr...   262   9e-69   
gb:SCANC2C_1706500 S.cerevisiae (S288C) anc2 gene for cytosolic ...   261   1e-68   
gb:BX842624_1643822 Neurospora crassa DNA linkage group I BAC cl...   261   1e-68   
pir|T49506|T49506 probable chaperonin CCT4 [imported] - Neurospo...   261   1e-68   Neurospora crassa
sp|P39078|TCPD_YEAST|TCPD_YEAST T-complex protein 1, delta subunit (TCP-1-d...   261   1e-68   Saccharomyces cerevisiae [brewer's yeast]
gb:CR380955_1651675 Candida glabrata strain CBS138 chromosome I ...   261   2e-68   
pir|T43649|T43649 chaperonin CCT4 - fission yeast (Schizosacchar...   257   3e-67   Schizosaccharomyces pombe
gb:CR382134_1667094 Debaryomyces hansenii chromosome B of strain...   256   5e-67   
gb:LMFL3856_1388022 Leishmania major Friedlin chromosome 21 cosm...   253   3e-66   
gb:CR382126_1658571 Kluyveromyces lactis strain NRRL Y-1140 chro...   252   9e-66   
gb:AF226717_1252679 Trichomonas vaginalis chaperonin subunit del...   234   2e-60   
gb:AY223304_1176765 Schistosoma japonicum clone ZZD584 mRNA sequ...   227   2e-58   
gb:CR382132_1665795 Yarrowia lipolytica chromosome F of strain C...   221   2e-56   
pir|E90086|E90086 t-complex protein 1, delta SU [imported] - Gui...   181   3e-44   Guillardia theta
sp|P50016|THS_METKA|THS_METKA Thermosome subunit (Chaperonin-like complex)...   178   2e-43   Methanopyrus kandleri
gb:AE013337_291426 Methanosarcina mazei strain Goe1, section 119...   174   2e-42   
gb:AE011161_269691 Methanosarcina acetivorans str. C2A, section ...   172   7e-42   
sp|O28045|THSA_ARCFU|THSA_ARCFU Thermosome alpha subunit (Thermosome subuni...   167   3e-40   Archaeoglobus fulgidus
gb:AE017199_402975 Nanoarchaeum equitans Kin4-M, complete genome.     166   7e-40   
gb:AE013372_291709 Methanosarcina mazei strain Goe1, section 154...   163   6e-39   
sp|O28821|THSB_ARCFU|THSB_ARCFU Thermosome beta subunit (Thermosome subunit...   162   7e-39   Archaeoglobus fulgidus
gb:AE010665_265476 Methanosarcina acetivorans str. C2A, section ...   159   6e-38   
gb:BA000023_691876 Sulfolobus tokodaii str. 7 DNA, complete genome.   159   1e-37   
sp|O24734|THSA_SULTO|THSA_SULTO Thermosome alpha subunit (Thermosome subuni...   159   1e-37   Sulfurisphaera tokodaii
gb:AY254173_602659 Acidianus tengchongenses strain S5 chaperonin...   158   1e-37   
gb:AY596297_634138 Haloarcula marismortui ATCC 43049 chromosome ...   157   3e-37   
sp|O93624|THS_METTL|THS_METTL Thermosome subunit (Chaperonin subunit).>pir...   155   1e-36   Methanothermococcus thermolithotrophicus
gb:AE010290_261541 Pyrococcus furiosus DSM 3638, section 165 of ...   155   2e-36   
gb:AF181261_486189 Sulfolobus solfataricus TF55-alpha protein (T...   153   6e-36   
sp|Q9V2S9|THSA_SULSO|THSA_SULSO Thermosome alpha subunit (Thermosome subuni...   153   6e-36   Saccharolobus solfataricus
pir|S59859|S59859 rosettasome alpha chain - Sulfolobus shibatae       152   1e-35   Saccharolobus shibatae
gb:AJ627421_527945 Uncultured crenarchaeote genomic fragment 68f19.   152   1e-35   
sp|P46219|THSA_SULSH|THSA_SULSH Thermosome alpha subunit (Thermosome subuni...   152   1e-35   Saccharolobus shibatae
sp|O30561|THS1_HALVO|THS1_HALVO Thermosome subunit 1 (Heat shock protein CC...   151   2e-35   Haloferax volcanii
pir|T45135|T45135 chaperone protein thsA [imported] - Pyrodictiu...   151   2e-35   Pyrodictium occultum
sp|Q9V2T5|THSA_SULAC|THSA_SULAC Thermosome alpha subunit (Thermosome subuni...   150   3e-35   Sulfolobus acidocaldarius
gb:AY283768_606340 Thermococcus litoralis thermosome alpha subun...   150   4e-35   
sp|Q58405|THS_METJA|THS_METJA Thermosome subunit (Chaperonin subunit).>pir...   150   4e-35   Methanocaldococcus jannaschii
gb:BA000011_664949 Thermoplasma volcanium GSS1 DNA, complete gen...   150   5e-35   
pir|C84373|C84373 thermosome subunit alpha [imported] - Halobact...   150   5e-35   Halobacterium salinarum
sp|Q9HN70|THSA_HALN1|THSA_HALN1 Thermosome alpha subunit (Thermosome subuni...   150   5e-35   Halobacterium sp.
gb:AE009922_257428 Pyrobaculum aerophilum strain IM2 section 177...   149   6e-35   
gb:AE009858_256582 Pyrobaculum aerophilum strain IM2 section 113...   149   6e-35   
pir|T45139|T45139 chaperone protein thsB [imported] - Pyrodictiu...   149   6e-35   Pyrodictium occultum
sp|P61111|THSA_PYRKO|THSA_PYRKO Thermosome alpha subunit (Thermosome subuni...   149   8e-35   
sp|O57762|THS_PYRHO|THS_PYRHO Thermosome subunit (Chaperonin subunit).>pir...   149   1e-34   Pyrococcus horikoshii
sp|Q9V2Q7|THS_PYRAB|THS_PYRAB Thermosome subunit (Chaperonin subunit).>pir...   149   1e-34   Pyrococcus abyssi
sp|O24730|THSB_THEK1|THSB_THEK1 Thermosome beta subunit (Thermosome subunit...   149   1e-34   Thermococcus sp.
sp|Q52500|THSB_PYRKO|THSB_PYRKO Thermosome beta subunit (Thermosome subunit...   147   2e-34   
pir|C72512|C72512 probable thermosome, subunit APE2072 - Aeropyr...   147   4e-34   Aeropyrum pernix
sp|Q9YA66|THSB_AERPE|THSB_AERPE Thermosome beta subunit (Thermosome subunit...   147   4e-34   Aeropyrum pernix
sp|Q53546|THS_DESSY|THS_DESSY Thermosome subunit (Hyperthermophilic heat s...   145   9e-34   Desulfurococcus sp.
pir|C72686|C72686 probable thermosome subunit APE0907 - Aeropyru...   145   1e-33   Aeropyrum pernix
sp|Q9YDK6|THSA_AERPE|THSA_AERPE Thermosome alpha subunit (Thermosome subuni...   145   1e-33   Aeropyrum pernix
gb:AY596297_634100 Haloarcula marismortui ATCC 43049 chromosome ...   145   2e-33   
pir|H69126|H69126 chaperonin - Methanobacterium thermoautotrophi...   145   2e-33   Methanothermobacter thermautotrophicus str. Delta H
sp|O26320|THSA_METTH|THSA_METTH Thermosome alpha subunit (Thermosome subuni...   145   2e-33   Methanothermobacter thermautotrophicus
gb:AY283769_606341 Thermococcus litoralis thermosome beta subuni...   144   2e-33   
gb:AY099402_588798 Methanococcus maripaludis chaperonin gene, co...   144   2e-33   
sp|O26885|THSB_METTH|THSB_METTH Thermosome beta subunit (Thermosome subunit...   144   4e-33   Methanothermobacter thermautotrophicus
gb:BA000023_691416 Sulfolobus tokodaii str. 7 DNA, complete genome.   143   6e-33   
gb:AE017261_420212 Picrophilus torridus DSM 9790, complete genome.    143   6e-33   
gb:AY714828_1188883 Uncultured archaeon GZfos18H11 clone GZfos18...   142   8e-33   
sp|O24731|THSA_THEK8|THSA_THEK8 Thermosome alpha subunit (Thermosome subuni...   142   1e-32   Thermococcus sp.
pir|A99481|A99481 hypothetical protein thsC [imported] - Sulfolo...   142   1e-32   Saccharolobus solfataricus
sp|Q9V2T7|THSG_SULSO|THSG_SULSO Thermosome gamma subunit (Thermosome subuni...   142   1e-32   Saccharolobus solfataricus
sp|P48425|THSB_THEAC|THSB_THEAC Thermosome beta subunit (Thermosome subunit...   142   1e-32   Thermoplasma acidophilum
gb:HUMKG1DD_2033895 Homo sapiens mRNA for KIAA0098 protein, part...   140   3e-32   
gb:BC009454_1972016 Homo sapiens, clone IMAGE:3534054, mRNA, par...   140   3e-32   
gb:BC002971_1968571 Homo sapiens, clone IMAGE:3543711, mRNA, par...   140   3e-32   
gb:AE010841_267025 Methanosarcina acetivorans str. C2A, section ...   140   3e-32   
sp|P48643|TCPE_HUMAN|TCPE_HUMAN T-complex protein 1, epsilon subunit (TCP-1...   140   3e-32   Homo sapiens [man]
gb:BC044997_2548956 Xenopus laevis chaperonin containing TCP1, s...   140   4e-32   
gb:CEU25632_1368472 Caenorhabditis elegans chaperonin CCT-2 (cct...   140   4e-32   
sp|P47207|TCPB_CAEEL|TCPB_CAEEL T-complex protein 1, beta subunit (TCP-1-be...   140   4e-32   Caenorhabditis elegans [roundworm]
gb:AY534910_626193 Uncultured marine group II euryarchaeote Deep...   140   5e-32   
sp|Q9HH21|THSG_SULSH|THSG_SULSH Thermosome gamma subunit (Thermosome subuni...   140   5e-32   Saccharolobus shibatae
gb:BC075101_2558215 Xenopus tropicalis cDNA clone MGC:79582 IMAG...   139   1e-31   
gb:BC064254_2553807 Xenopus tropicalis hypothetical protein MGC7...   139   1e-31   
gb:CR857360_1181603 Pongo pygmaeus mRNA; cDNA DKFZp469K0732 (fro...   139   1e-31   
gb:CNS07EG9_1372808 chromosome II of strain GB-M1 of Encephalito...   138   2e-31   
sp|O24732|THSB_THEK8|THSB_THEK8 Thermosome beta subunit (Thermosome subunit...   138   2e-31   Thermococcus sp.
gb:AE013227_290402 Methanosarcina mazei strain Goe1, section 9 o...   137   3e-31   
gb:CEC07G2_1360196 Caenorhabditis elegans cosmid C07G2, complete...   137   3e-31   
sp|P47209|TCPE_CAEEL|TCPE_CAEEL T-complex protein 1, epsilon subunit (TCP-1...   137   3e-31   Caenorhabditis elegans [roundworm]
gb:AY398321_2531851 Danio rerio clone RK074A2D01 chaperonin cont...   137   4e-31   
sp|O30560|THS2_HALVO|THS2_HALVO Thermosome subunit 2 (Heat shock protein CC...   137   4e-31   Haloferax volcanii
gb:BA000011_665594 Thermoplasma volcanium GSS1 DNA, complete gen...   136   6e-31   
gb:BC086201_2564781 Xenopus laevis hypothetical LOC495794, mRNA ...   136   7e-31   
gb:AK129056_2069287 Mus musculus mRNA for mKIAA0098 protein.          136   7e-31   
sp|P80316|TCPE_MOUSE|TCPE_MOUSE T-complex protein 1, epsilon subunit (TCP-1...   136   7e-31   Mus musculus [mouse]
gb:BC079441_2107549 Rattus norvegicus chaperonin containing TCP1...   135   1e-30   
gb:AY054210_1563032 Arabidopsis thaliana AT5g20890/F22D1_60 mRNA...   135   1e-30   
gb:AE017341_1753888 Cryptococcus neoformans var. neoformans JEC2...   135   2e-30   
gb:AE017261_419752 Picrophilus torridus DSM 9790, complete genome.    135   2e-30   
gb:TACID4_196739 Thermoplasma acidophilum complete genome; segme...   135   2e-30   
sp|P48424|THSA_THEAC|THSA_THEAC Thermosome alpha subunit (Thermosome subuni...   135   2e-30   Thermoplasma acidophilum
sp|Q9UTM4|TCPE_SCHPO|TCPE_SCHPO T-complex protein 1, epsilon subunit (TCP-1...   134   3e-30   Schizosaccharomyces pombe
gb:AF226724_1252686 Giardia intestinalis chaperonin subunit epsi...   134   4e-30   
sp|P28488|THSB_SULSH|THSB_SULSH Thermosome beta subunit (Thermosome subunit...   133   6e-30   Saccharolobus shibatae
pir|E90170|E90170 hypothetical protein thsB [imported] - Sulfolo...   132   8e-30   Saccharolobus solfataricus
sp|Q9V2T8|THSB_SULSO|THSB_SULSO Thermosome beta subunit (Thermosome subunit...   132   8e-30   Saccharolobus solfataricus
gb:AY223856_598995 Acidianus tengchongenses chaperonin gene, com...   132   1e-29   
gb:AB027708_2461236 Carassius auratus mRNA for CCT (chaperonin c...   132   1e-29   
gb:BA000023_690880 Sulfolobus tokodaii str. 7 DNA, complete genome.   132   1e-29   
sp|O24735|THSB_SULTO|THSB_SULTO Thermosome beta subunit (Thermosome subunit...   132   1e-29   Sulfurisphaera tokodaii
pir|S53816|S53816 thermosome alpha chain - Thermoplasma acidophilum   130   3e-29   Thermoplasma acidophilum
gb:AC107206_1738350 Oryza sativa chromosome 3 BAC OSJNBa0063J18 ...   130   4e-29   
gb:AF442548_1271412 Physarum polycephalum CCT chaperonin theta s...   130   4e-29   
gb:AP003714_1832367 Oryza sativa (japonica cultivar-group) genom...   129   7e-29   
gb:AC104709_1737779 Oryza sativa (japonica cultivar-group) chrom...   129   7e-29   
sp|P54411|TCE2_AVESA|TCE2_AVESA T-complex protein 1, epsilon subunit (TCP-1...   129   7e-29   Avena sativa [cultivated oat]
sp|P40412|TCE1_AVESA|TCE1_AVESA T-complex protein 1, epsilon subunit (TCP-1...   129   7e-29   Avena sativa [cultivated oat]
gb:CR382131_1664353 Yarrowia lipolytica chromosome E of strain C...   128   2e-28   
gb:AF442546_1271410 Physarum polycephalum CCT chaperonin beta su...   127   3e-28   
gb:AC024827_1204872 Caenorhabditis elegans cosmid Y55F3AR, compl...   127   3e-28   
gb:AE014298_1124891 Drosophila melanogaster chromosome X, comple...   127   3e-28   
gb:AE014298_1124890 Drosophila melanogaster chromosome X, comple...   127   3e-28   
gb:PFMAL3P7_1394576 Plasmodium falciparum MAL3P7, complete seque...   127   3e-28   
sp|O04450|TCPE_ARATH|TCPE_ARATH T-complex protein 1, epsilon subunit (TCP-1...   127   3e-28   Arabidopsis thaliana [mouse-ear cress]
gb:CR380952_1650247 Candida glabrata strain CBS138 chromosome F ...   127   4e-28   
sp|Q9V2T3|THSB_DESMO|THSB_DESMO Thermosome beta subunit (Thermosome subunit...   127   4e-28   
gb:AE013599_1131383 Drosophila melanogaster chromosome 2R, compl...   126   6e-28   
gb:AE013599_1131382 Drosophila melanogaster chromosome 2R, compl...   126   6e-28   
pir|S57083|S57083 t-complex-type molecular chaperone CCT5 - yeas...   126   6e-28   Saccharomyces cerevisiae [brewer's yeast]
sp|P40413|TCPE_YEAST|TCPE_YEAST T-complex protein 1, epsilon subunit (TCP-1...   126   6e-28   Saccharomyces cerevisiae [brewer's yeast]
gb:AE016819_1749253 Ashbya gossypii (= Eremothecium gossypii) AT...   125   1e-27   
gb:PFMAL3P2_1394444 Plasmodium falciparum MAL3P2, complete seque...   125   1e-27   
gb:AE017343_1755602 Cryptococcus neoformans var. neoformans JEC2...   125   1e-27   
pir|T24508|T24508 hypothetical protein T05C12.7 - Caenorhabditis...   125   1e-27   Caenorhabditis elegans [roundworm]
gb:AF275798_1894344 Homo sapiens PNAS-102 mRNA, complete cds.         125   2e-27   
gb:YSCTCEP_1730754 Saccharomyces cerevisiae (clone p701-6) Tcp1 ...   124   3e-27   
sp|P41988|TCPA_CAEEL|TCPA_CAEEL T-complex protein 1, alpha subunit (TCP-1-a...   124   4e-27   Caenorhabditis elegans [roundworm]
gb:AF149920_483532 Sulfolobus solfataricus chaperonin beta subun...   123   5e-27   
pir|D84359|D84359 thermosome subunit beta [imported] - Halobacte...   123   5e-27   Halobacterium salinarum
sp|Q9HNI0|THSB_HALN1|THSB_HALN1 Thermosome beta subunit (Thermosome subunit...   123   5e-27   Halobacterium sp.
gb:BC083650_2108726 Rattus norvegicus chaperonin containing TCP1...   123   6e-27   
gb:CR382137_1670387 Debaryomyces hansenii chromosome E of strain...   123   6e-27   
pir|S43059|S43059 CCT (chaperonin containing TCP-1) beta chain -...   122   8e-27   Mus musculus [mouse]
sp|P80314|TCPB_MOUSE|TCPB_MOUSE T-complex protein 1, beta subunit (TCP-1-be...   122   8e-27   Mus musculus [mouse]
gb:AY389968_2531458 Xenopus laevis chaperonin subunit 8 theta mR...   122   1e-26   
gb:AF097668_1767894 Mesembryanthemum crystallinum T-complex prot...   122   1e-26   
gb:AF303531_1260548 Tetrahymena pyriformis CCTepsilon subunit ge...   122   1e-26   
gb:BC042347_2548155 Xenopus laevis chaperonin subunit 2 (beta), ...   122   1e-26   
gb:CR548612_1375445 Paramecium tetraurelia macronuclear largest ...   121   2e-26   
gb:DDU43896_1377343 Dictyostelium discoideum molecular chaperone...   121   2e-26   
gb:BT019965_2151624 Synthetic construct Homo sapiens chaperonin ...   120   3e-26   
sp|P78371|TCPB_HUMAN|TCPB_HUMAN T-complex protein 1, beta subunit (TCP-1-be...   120   3e-26   Homo sapiens [man]
gb:BC084429_2563805 Xenopus laevis hypothetical LOC495278, mRNA ...   120   4e-26   
gb:BC042312_2548124 Xenopus laevis hypothetical LOC495278, mRNA ...   120   4e-26   
gb:AP003935_1835491 Oryza sativa (japonica cultivar-group) genom...   120   4e-26   
gb:AF188130_1249196 Oxytricha nova clone 11 chaperonin beta subu...   120   4e-26   
gb:BC075536_2558636 Xenopus tropicalis chaperonin containing TCP...   120   5e-26   
gb:CR382122_1655411 Kluyveromyces lactis strain NRRL Y-1140 chro...   120   5e-26   
gb:OSJN00060_1694108 Oryza sativa genomic DNA, chromosome 4, BAC...   119   7e-26   
gb:CR382138_1671760 Debaryomyces hansenii chromosome F of strain...   119   9e-26   
gb:CR382126_1659302 Kluyveromyces lactis strain NRRL Y-1140 chro...   119   9e-26   
gb:BC059558_2552535 Danio rerio chaperonin containing TCP1, subu...   119   1e-25   
gb:AY389916_2531411 Protopterus dolloi chaperonin subunit 8 thet...   119   1e-25   
gb:CR457071_1993278 Homo sapiens full open reading frame cDNA cl...   119   1e-25   
gb:AF494044_1276772 Physarum polycephalum chaperonin containing ...   119   1e-25   
gb:BC068214_2555000 Xenopus tropicalis hypothetical protein LOC4...   118   2e-25   
gb:CR380953_1650802 Candida glabrata strain CBS138 chromosome G ...   118   2e-25   
sp|P42943|TCPH_YEAST|TCPH_YEAST T-complex protein 1, eta subunit (TCP-1-eta...   118   2e-25   Saccharomyces cerevisiae [brewer's yeast]
gb:AJ720426_2502613 Gallus gallus mRNA for hypothetical protein,...   118   2e-25   
gb:AE017341_1754249 Cryptococcus neoformans var. neoformans JEC2...   118   2e-25   
gb:AE014186_938294 Plasmodium falciparum 3D7 chromosome 11 compl...   118   2e-25   
gb:D89272_1675389 Schizosaccharomyces pombe mRNA, partial cds, c...   117   3e-25   
gb:LMFL2719_1387894 Leishmania major Friedlin chromosome 23 cosm...   117   3e-25   
pir|T43202|T43202 probable chaperonin, t-complex-type - fission ...   117   3e-25   Schizosaccharomyces pombe
sp|P78921|TCPQ_SCHPO|TCPQ_SCHPO Probable T-complex protein 1, theta subunit...   117   3e-25   Schizosaccharomyces pombe
sp|P87153|TCPH_SCHPO|TCPH_SCHPO Probable T-complex protein 1, eta subunit (...   117   3e-25   Schizosaccharomyces pombe
gb:A45921_1449230 Sequence 60 from Patent WO9520654.                  117   4e-25   
gb:AK077781_1172056 Mus musculus adult male thymus cDNA, RIKEN f...   117   4e-25   
sp|P80313|TCPH_MOUSE|TCPH_MOUSE T-complex protein 1, eta subunit (TCP-1-eta...   117   4e-25   Mus musculus [mouse]
gb:BC068901_2555397 Xenopus laevis t-complex polypeptide 1, mRNA...   117   5e-25   
gb:BC080140_2561571 Xenopus tropicalis cct8-prov protein, mRNA (...   116   6e-25   
gb:AK172867_2069801 Mus musculus mRNA for mKIAA0002 protein.          116   6e-25   
gb:AB022161_2044206 Mus musculus Cctq gene for chaperonin contai...   116   6e-25   
gb:AK075880_1171074 Mus musculus adult male tongue cDNA, RIKEN f...   116   6e-25   
gb:AK014005_1157744 Mus musculus 13 days embryo head cDNA, RIKEN...   116   6e-25   
sp|P42932|TCPQ_MOUSE|TCPQ_MOUSE T-complex protein 1, theta subunit (TCP-1-t...   116   6e-25   Mus musculus [mouse]
gb:BC077927_2560573 Xenopus laevis chaperonin containing TCP1, s...   116   8e-25   
gb:BC045074_2549026 Xenopus laevis chaperonin containing TCP1, s...   116   8e-25   
gb:CR382129_1662145 Yarrowia lipolytica chromosome C of strain C...   116   8e-25   
gb:AF494046_1276774 Physarum polycephalum chaperonin containing ...   116   8e-25   
gb:AF442545_1271409 Physarum polycephalum CCT chaperonin alpha s...   116   8e-25   
gb:CR456719_1992926 Homo sapiens full open reading frame cDNA cl...   115   1e-24   
gb:CR860934_1184977 Pongo pygmaeus mRNA; cDNA DKFZp469M1631 (fro...   115   1e-24   
sp|Q99832|TCPH_HUMAN|TCPH_HUMAN T-complex protein 1, eta subunit (TCP-1-eta...   115   1e-24   Homo sapiens [man]
sp|O15891|TCPA_TETPY|TCPA_TETPY T-complex protein 1, alpha subunit (TCP-1-a...   115   1e-24   Tetrahymena pyriformis
sp|Q9W790|TCPA_PALPA|TCPA_PALPA T-complex protein 1, alpha subunit (TCP-1-a...   115   1e-24   Paleosuchus palpebrosus
gb:AF143494_2477000 Xenopus laevis t-complex polypeptide 1 (TCP1...   115   2e-24   
gb:HUMKIAA000_2033901 Homo sapiens cosmid Q7A10 (D21S246) insert...   115   2e-24   
gb:BC012584_1973688 Homo sapiens chaperonin containing TCP1, sub...   115   2e-24   
gb:ATAC016795_1543596 Arabidopsis thaliana chromosome III BAC F2...   115   2e-24   
gb:AY251815_1313170 Bigelowiella natans chaperonin-containing TC...   115   2e-24   
sp|P50990|TCPQ_HUMAN|TCPQ_HUMAN T-complex protein 1, theta subunit (TCP-1-t...   115   2e-24   Homo sapiens [man]
gb:BC045040_2548995 Xenopus laevis chaperonin containing TCP1, s...   114   2e-24   
gb:NCB23G1_1689750 Neurospora crassa DNA linkage group II BAC co...   114   2e-24   
gb:AF506229_2498563 Danio rerio chaperonin-containing T-complex ...   114   3e-24   
gb:AC116979_1207127 Dictyostelium discoideum chromosome 2 map 64...   114   3e-24   
gb:HUMRSC548_2036442 Homo sapiens KIAA0002 mRNA, partial cds.         114   4e-24   
gb:AE014297_1138542 Drosophila melanogaster chromosome 3R, compl...   114   4e-24   
sp|Q9V2T4|THSB_SULAC|THSB_SULAC Thermosome beta subunit (Thermosome subunit...   114   4e-24   Sulfolobus acidocaldarius
gb:AJ719415_2501602 Gallus gallus mRNA for hypothetical protein,...   113   5e-24   
gb:AE017351_1759459 Cryptococcus neoformans var. neoformans JEC2...   113   5e-24   
gb:AE016819_1748902 Ashbya gossypii (= Eremothecium gossypii) AT...   113   5e-24   
gb:AB073552_1523189 Bruguiera sexangula bstcp-1 mRNA for t-compl...   113   5e-24   
gb:AY507656_1430669 Oryctolagus cuniculus chaperonin-containing ...   113   5e-24   
gb:AY393846_2531631 Gallus gallus chaperonin subunit 8 theta mRN...   113   7e-24   
gb:CR382130_1662768 Yarrowia lipolytica chromosome D of strain C...   113   7e-24   
sp|O00782|TCPG_OXYGR|TCPG_OXYGR T-complex protein 1, gamma subunit (TCP-1-g...   113   7e-24   Oxytricha granulifera
gb:BC044397_2548706 Danio rerio t-complex polypeptide 1, mRNA (c...   112   9e-24   
gb:AF164030_2477874 Danio rerio clone T-3-7 t-complex polypeptid...   112   9e-24   
gb:AF164029_2477873 Danio rerio clone T-3-5 t-complex polypeptid...   112   9e-24   
gb:AF164028_2477872 Danio rerio clone TA2 t-complex polypeptide ...   112   9e-24   
gb:AF143493_2476999 Danio rerio t-complex polypeptide 1 (TCP1) m...   112   9e-24   
gb:AF322044_1262506 Malawimonas jakobiformis chaperonin subunit ...   112   9e-24   
gb:AF226715_1252677 Trichomonas vaginalis chaperonin subunit alp...   112   9e-24   
gb:AY389915_2531410 Latimeria chalumnae chaperonin subunit 8 the...   112   1e-23   
gb:AE016820_1750268 Ashbya gossypii (= Eremothecium gossypii) AT...   112   1e-23   
gb:CR382126_1659353 Kluyveromyces lactis strain NRRL Y-1140 chro...   112   1e-23   
gb:BC044673_2548870 Xenopus laevis similar to t-complex polypept...   112   1e-23   
gb:AE017341_1754106 Cryptococcus neoformans var. neoformans JEC2...   112   1e-23   
gb:CR382132_1665419 Yarrowia lipolytica chromosome F of strain C...   112   1e-23   
gb:MKCLIC_144250 M.kandleri gene for chaperonin-like complex (Cl...   112   1e-23   
pir|S54118|S54118 chaperonin-like complex (CliC) - Methanopyrus ...   112   1e-23   Methanopyrus kandleri
gb:AC135563_1742579 Oryza sativa chromosome 3 BAC OSJNBb0015I02 ...   111   2e-23   
gb:CNS07EGI_1374436 chromosome IX of strain GB-M1 of Encephalito...   111   2e-23   
sp|Q10147|TCPB_SCHPO|TCPB_SCHPO Probable T-complex protein 1, beta subunit ...   111   2e-23   Schizosaccharomyces pombe
gb:CR380958_1653432 Candida glabrata strain CBS138 chromosome L ...   111   3e-23   
pir|T43895|T43895 t-complex-type molecular chaperone TCP1 homolo...   111   3e-23   Dictyostelium discoideum
gb:BC050492_2550376 Danio rerio chaperonin containing TCP1, subu...   110   4e-23   
gb:AY391413_2531549 Danio rerio chaperonin containing TCP1, subu...   110   4e-23   
gb:BT007686_2150618 Synthetic construct Homo sapiens t-complex 1...   110   4e-23   
gb:HSTCP1_2020737 Homo sapiens mRNA for t-complex polypeptide 1 ...   110   4e-23   
gb:AE016818_1748558 Ashbya gossypii (= Eremothecium gossypii) AT...   110   4e-23   
gb:AF427597_1270023 Artemia franciscana chaperonin subunit 1 (CH...   110   4e-23   
sp|P39076|TCPB_YEAST|TCPB_YEAST T-complex protein 1, beta subunit (TCP-1-be...   110   4e-23   Saccharomyces cerevisiae [brewer's yeast]
sp|P17987|TCPA_HUMAN|TCPA_HUMAN T-complex protein 1, alpha subunit (TCP-1-a...   110   4e-23   Homo sapiens [man]
gb:CR382133_1666763 Debaryomyces hansenii chromosome A of strain...   109   7e-23   
gb:CR382123_1655974 Kluyveromyces lactis strain NRRL Y-1140 chro...   109   7e-23   
gb:NFU43123_1390817 Naegleria fowleri T-complex polypeptide homo...   109   7e-23   
gb:AF067947_1238195 Caenorhabditis elegans cosmid T10B5, complet...   109   7e-23   
sp|Q9XT06|TCPA_MONDO|TCPA_MONDO T-complex protein 1, alpha subunit (TCP-1-a...   109   7e-23   Monodelphis domestica
gb:BT002052_1635655 Arabidopsis thaliana t-complex polypeptide 1...   109   1e-22   
gb:ABE309379_1529751 Atropa belladonna partial mRNA for putative...   109   1e-22   
gb:AY596297_633168 Haloarcula marismortui ATCC 43049 chromosome ...   109   1e-22   
sp|P18279|TCPA_CRIGR|TCPA_CRIGR T-complex protein 1, alpha subunit (TCP-1-a...   109   1e-22   
sp|P28769|TCPA_ARATH|TCPA_ARATH T-complex protein 1, alpha subunit (TCP-1-a...   109   1e-22   
gb:CR382139_1672964 Debaryomyces hansenii chromosome G of strain...   108   1e-22   
gb:AY488148_1330190 Cryptosporidium parvum genotype IIc T-comple...   108   1e-22   
gb:AY488147_1330189 Cryptosporidium parvum genotype IIb T-comple...   108   1e-22   
sp|P28480|TCPA_RAT|TCPA_RAT T-complex protein 1, alpha subunit (TCP-1-alp...   108   1e-22   
gb:BT010388_1640334 Arabidopsis thaliana At3g03960 mRNA, complet...   108   2e-22   
gb:AF226721_1252683 Giardia intestinalis chaperonin subunit beta...   108   2e-22   
sp|O74341|TCPG_SCHPO|TCPG_SCHPO T-complex protein 1, gamma subunit (TCP-1-g...   108   2e-22   
gb:AY190688_2518007 Pagrus major chaperonin subunit 7 mRNA, part...   108   2e-22   
sp|P39077|TCPG_YEAST|TCPG_YEAST T-complex protein 1, gamma subunit (TCP-1-g...   108   2e-22   
gb:ATAC011698_1543372 Arabidopsis thaliana chromosome III BAC T1...   107   3e-22   
gb:AY488149_1330191 Cryptosporidium parvum genotype Ie T-complex...   107   3e-22   
gb:AY488146_1330188 Cryptosporidium parvum genotype IIa T-comple...   107   3e-22   
gb:AF130110_1150172 Homo sapiens clone FLB6303 PRO1633 mRNA, com...   107   3e-22   
sp|P11984|TCP1_MOUSE|TCP1_MOUSE T-complex protein 1, alpha subunit A (TCP-1...   107   3e-22   
gb:AP000383_1819897 Arabidopsis thaliana genomic DNA, chromosome...   107   4e-22   
gb:AE001362_939368 Plasmodium falciparum 3D7 chromosome 2 comple...   107   4e-22   
pir|A71610|A71610 HSP60 fold T-complex protein 1 PFB0635w - mala...   107   4e-22   
sp|Q9HHA2|THS3_HALVO|THS3_HALVO Thermosome subunit 3 (Heat shock protein CC...   107   4e-22   
gb:CR380953_1650914 Candida glabrata strain CBS138 chromosome G ...   107   5e-22   
sp|P54409|TCPH_TETPY|TCPH_TETPY T-complex protein 1, eta subunit (TCP-1-eta...   107   5e-22   
sp|P11983|TCP2_MOUSE|TCP2_MOUSE T-complex protein 1, alpha subunit B (TCP-1...   107   5e-22   
gb:AP004818_1845658 Oryza sativa (japonica cultivar-group) genom...   106   6e-22   
gb:A45915_1449224 Sequence 54 from Patent WO9520654.                  106   6e-22   
gb:AF136446_1244016 Tetrahymena pyriformis chaperonin-containing...   106   6e-22   
gb:BX538353_1359153 Cryptosporidium parvum chromosome 6, complet...   106   8e-22   
gb:AY488152_1330194 Cryptosporidium parvum genotype Ia2 T-comple...   106   8e-22   
gb:AF322046_1262508 Reclinomonas americana strain 50394 chaperon...   106   8e-22   
gb:SCBIN2_1706554 Saccharomyces cerevisiae S288C Bin2p (BIN2) ge...   105   1e-21   
gb:AF252794_1256074 Drosophila simulans strain sim1 t-complex po...   105   1e-21   
sp|P54408|TCPG_TETPY|TCPG_TETPY T-complex protein 1, gamma subunit (TCP-1-g...   105   1e-21   
sp|P12613|TCPA_DROME|TCPA_DROME T-complex protein 1, alpha subunit (TCP-1-a...   105   1e-21   
gb:BC053271_2550662 Danio rerio chaperonin containing TCP1, subu...   105   1e-21   
gb:BC006501_1970335 Homo sapiens cDNA clone IMAGE:2820063, parti...   105   1e-21   
gb:AL589685_1929115 Human DNA sequence from clone RP11-443G18 on...   105   1e-21   
gb:HSM804508_1187230 Homo sapiens mRNA; cDNA DKFZp667A196 (from ...   105   1e-21   
gb:CR926077_1185583 Pongo pygmaeus mRNA; cDNA DKFZp459J0510 (fro...   105   1e-21   
pir|S61529|A38983 TCP1 ring complex protein TRiC5 - human>gb:HSH...   105   1e-21   
sp|P49368|TCPG_HUMAN|TCPG_HUMAN T-complex protein 1, gamma subunit (TCP-1-g...   105   1e-21   
gb:BC063178_2105198 Rattus norvegicus chaperonin containing TCP1...   105   2e-21   
gb:AF322048_1262510 Acrasis rosea chaperonin subunit alpha gene,...   105   2e-21   
gb:AF255324_1256337 Drosophila simulans t-complex polypeptide 1 ...   105   2e-21   
sp|P80318|TCPG_MOUSE|TCPG_MOUSE T-complex protein 1, gamma subunit (TCP-1-g...   105   2e-21   
gb:AF506226_2498560 Danio rerio chaperonin-containing TCP-1 comp...   104   2e-21   
pir|S42723|S42723 matricin - mouse>gb:MUSMATRICI_2128857 Mus mus...   104   2e-21   
gb:AF322047_1262509 Reclinomonas americana strain 50283 chaperon...   103   4e-21   
pir|S54210|S54210 chaperonin containing TCP-1 complex gamma chai...   103   4e-21   
pir|JT0367|JT0367 Tcp-1 protein - fruit fly (Drosophila melanoga...   103   4e-21   
sp|P47828|TCPQ_CANAL|TCPQ_CANAL T-complex protein 1, theta subunit (TCP-1-t...   103   4e-21   
sp|P50143|TCPG_XENLA|TCPG_XENLA T-complex protein 1, gamma subunit (TCP-1-g...   103   4e-21   
gb:AF506209_2498543 Danio rerio chaperonin-containing TCP-1 comp...   103   5e-21   
gb:AB050948_1196230 Babesia microti TCP-1 mRNA for T-complex pro...   103   5e-21   
gb:CR859507_1183621 Pongo pygmaeus mRNA; cDNA DKFZp459K2438 (fro...   103   7e-21   
gb:BX908808_1644519 Neurospora crassa DNA linkage group IV Cosmi...   102   9e-21   
gb:AY714832_1189055 Uncultured archaeon GZfos1C11 clone GZfos1C1...   102   9e-21   
gb:AF136609_1414892 Bos taurus Cctq mRNA, partial cds.                102   1e-20   
gb:AF226718_1252680 Trichomonas vaginalis chaperonin subunit eta...   102   2e-20   
gb:AE013599_1130725 Drosophila melanogaster chromosome 2R, compl...   101   2e-20   
gb:BC064256_2553809 Xenopus tropicalis hypothetical protein MGC7...   101   3e-20   
gb:MUSTCPAA_2130393 Mouse t complex polypeptide 1 (Tcp-1-a) mRNA...   101   3e-20   
gb:CR382128_1660995 Yarrowia lipolytica chromosome B of strain C...   101   3e-20   
gb:BC045933_2549447 Danio rerio chaperonin containing TCP1, subu...   100   3e-20   
gb:YSCTCP1_1730755 Yeast (S.cerevisiae) T complex protein 1 (Tcp...   100   4e-20   
gb:CR382130_1663161 Yarrowia lipolytica chromosome D of strain C...   100   4e-20   
gb:CNS07EGA_1372934 chromosome III of strain GB-M1 of Encephalit...   100   4e-20   
gb:AY596296_631243 Haloarcula marismortui ATCC 43049 plasmid pNG...   100   4e-20   
gb:MUSTCPAB_2130394 Mouse t complex polypeptide 1 (Tcp-1-b) mRNA...   100   6e-20   
gb:CR382133_1666874 Debaryomyces hansenii chromosome A of strain...   100   6e-20   
gb:HSU17104_2022531 Human cytoplasmic chaperonin hTRiC5 mRNA, pa...   100   8e-20   
gb:CR382139_1672634 Debaryomyces hansenii chromosome G of strain...   100   8e-20   
gb:AY507657_1430670 Oryctolagus cuniculus chaperonin-containing ...   100   8e-20   
gb:CR382121_1654446 Kluyveromyces lactis strain NRRL Y-1140 chro...    99   1e-19   
gb:AF442547_1271411 Physarum polycephalum CCT chaperonin gamma s...    99   1e-19   
gb:CR380952_1650561 Candida glabrata strain CBS138 chromosome F ...    99   1e-19   
gb:AF322045_1262507 Malawimonas jakobiformis chaperonin subunit ...    99   1e-19   
gb:AE017343_1755320 Cryptococcus neoformans var. neoformans JEC2...    99   2e-19   
gb:BT002737_1636340 Arabidopsis thaliana clone C105119 putative ...    99   2e-19   
gb:AF322050_1262512 Monocercomonas sp. chaperonin subunit alpha ...    99   2e-19   
pir|T01855|T01855 probable chaperonin-containing TCP-1 complex g...    99   2e-19   
sp|P12612|TCPA_YEAST|TCPA_YEAST T-complex protein 1, alpha subunit (TCP-1-a...    98   2e-19   
gb:AY392162_2531614 Scyliorhinus canicula chaperonin-containing ...    98   3e-19   
gb:AE016820_1749862 Ashbya gossypii (= Eremothecium gossypii) AT...    97   4e-19   
gb:AX705097_1473525 Sequence 18 from Patent WO03014351.                97   4e-19   
gb:CNS07EGD_1373514 chromosome VI of strain GB-M1 of Encephalito...    97   4e-19   
sp|Q94757|TCPA_SCHMA|TCPA_SCHMA T-complex protein 1, alpha subunit (TCP-1-a...    97   4e-19   
gb:AF322049_1262511 Naegleria gruberi chaperonin subunit alpha g...    97   5e-19   
gb:AP005614_1854968 Oryza sativa (japonica cultivar-group) genom...    96   8e-19   
gb:AY050654_1289980 Giardia intestinalis chaperone-t-complex eta...    96   8e-19   
pir|B24059|B24059 t complex polypeptide 1b - mouse                     96   8e-19   
gb:CR382124_1656742 Kluyveromyces lactis strain NRRL Y-1140 chro...    95   2e-18   
gb:AC024136_1204209 Caenorhabditis elegans cosmid F54A3, complet...    94   3e-18   
gb:AF226714_1252676 Trichomonas vaginalis chaperonin subunit alp...    94   4e-18   
gb:AK010882_1156050 Mus musculus 13 days embryo liver cDNA, RIKE...    94   5e-18   
pir|F90124|F90124 t-complex protein1 eta SU [imported] - Guillar...    94   5e-18   
gb:DMU31961_1380645 Drosophila melanogaster bithorax complex (BX...    93   9e-18   
gb:DMCCTGGEN_1378516 D.melanogaster Cctg gene.                         93   9e-18   
gb:AF322043_1262505 Trypanosoma brucei chaperonin subunit alpha ...    93   9e-18   
pir|F90133|F90133 t-complex protein 1 beta SU [imported] - Guill...    93   9e-18   
sp|P48605|TCPG_DROME|TCPG_DROME T-complex protein 1, gamma subunit (TCP-1-g...    93   9e-18   
gb:AF226722_1252684 Giardia intestinalis chaperonin subunit gamm...    92   2e-17   
gb:AC117081_1207905 Dictyostelium discoideum chromosome 2 map 58...    92   2e-17   
pir|S52132|S52132 t-complex-type molecular chaperone TCP-1 - axo...    92   2e-17   
sp|P47079|TCPQ_YEAST|TCPQ_YEAST T-complex protein 1, theta subunit (TCP-1-t...    92   2e-17   
sp|P50157|TCPA_AMBME|TCPA_AMBME T-complex protein 1, alpha subunit (TCP-1-a...    92   2e-17   
gb:AF226720_1252682 Giardia intestinalis chaperonin subunit alph...    91   3e-17   
sp|Q9LKI7|TCPG_THAWE|TCPG_THAWE T-complex protein 1, gamma subunit (TCP-1-g...    91   3e-17   
pir|T33227|T33227 hypothetical protein T10B5.5 - Caenorhabditis ...    91   5e-17   
sp|O94501|TCPA_SCHPO|TCPA_SCHPO T-complex protein 1, alpha subunit (TCP-1-a...    91   5e-17   
gb:AF226723_1252685 Giardia intestinalis chaperonin subunit delt...    90   8e-17   
gb:AE014188_968092 Plasmodium falciparum 3D7 chromosome 12, comp...    90   8e-17   
gb:AF226716_1252678 Trichomonas vaginalis chaperonin subunit gam...    89   1e-16   
gb:CNS07EGG_1374048 chromosome X of strain GB-M1 of Encephalitoz...    88   2e-16   
pir|T18430|T18430 hypothetical protein PFC0350c - malaria parasi...    87   4e-16   
gb:BC079020_2107159 Rattus norvegicus cDNA clone MGC:93945 IMAGE...    87   7e-16   
gb:AE010749_266232 Methanosarcina acetivorans str. C2A, section ...    86   1e-15   
gb:AK076639_1171478 Mus musculus adult male testis cDNA, RIKEN f...    85   2e-15   
gb:MMCCTZ2MR_2114456 M.musculus mRNA for CCT zeta2.                    85   3e-15   
gb:AL645594_2071731 Mouse DNA sequence from clone RP23-316C11 on...    85   3e-15   
gb:CR380950_1649784 Candida glabrata strain CBS138 chromosome D ...    85   3e-15   
sp|Q61390|TCPW_MOUSE|TCPW_MOUSE T-complex protein 1, zeta-2 subunit (TCP-1-...    85   3e-15   
gb:AE011158_269664 Methanosarcina acetivorans str. C2A, section ...    84   4e-15   
gb:AF494045_1276773 Physarum polycephalum chaperonin containing ...    84   6e-15   
pir|E90083|E90083 t-complex protein1, epsilon-SU [imported] - Gu...    83   7e-15   
sp|O77622|TCPZ_RABIT|TCPZ_RABIT T-complex protein 1, zeta subunit (TCP-1-ze...    83   1e-14   
gb:D78333_1994878 Homo sapiens mRNA for testis-specific TCP20, c...    82   1e-14   
gb:AF226725_1252687 Giardia intestinalis chaperonin subunit thet...    82   1e-14   
sp|Q92526|TCPW_HUMAN|TCPW_HUMAN T-complex protein 1, zeta-2 subunit (TCP-1-...    82   1e-14   
gb:AF226726_1252688 Giardia intestinalis chaperonin subunit zeta...    82   2e-14   
gb:CR382130_1663151 Yarrowia lipolytica chromosome D of strain C...    80   5e-14   
gb:BC044393_2548702 Danio rerio chaperonin containing TCP1, subu...    79   1e-13   
gb:AE016816_1746736 Ashbya gossypii (= Eremothecium gossypii) AT...    79   1e-13   
gb:CR548612_1375408 Paramecium tetraurelia macronuclear largest ...    79   1e-13   
gb:AJ720580_2502767 Gallus gallus mRNA for hypothetical protein,...    79   1e-13   
gb:AY251812_1313167 Bigelowiella natans chaperonin-containing TC...    78   3e-13   
gb:AC116305_1206208 Dictyostelium discoideum chromosome 2 map 10...    78   3e-13   
gb:AP003553_1933566 Homo sapiens CESK1 gene for T-complex protei...    77   4e-13   
gb:BC067921_2554907 Xenopus tropicalis hypothetical protein MGC6...    77   5e-13   
gb:BC050797_2100450 Mus musculus gene model 443, (NCBI), mRNA (c...    77   5e-13   
gb:BC018459_2092724 Mus musculus chaperonin subunit 6a (zeta), m...    77   5e-13   
sp|P80317|TCPZ_MOUSE|TCPZ_MOUSE T-complex protein 1, zeta subunit (TCP-1-ze...    77   5e-13   
gb:BC074165_2557682 Xenopus laevis MGC81949 protein, mRNA (cDNA ...    77   7e-13   
gb:CNS07EGG_1374009 chromosome X of strain GB-M1 of Encephalitoz...    77   7e-13   
gb:CR858342_1182523 Pongo pygmaeus mRNA; cDNA DKFZp459C0730 (fro...    77   7e-13   
gb:AC148814_1744834 Oryza sativa (japonica cultivar-group) chrom...    76   9e-13   
gb:AP000365_1933516 Homo sapiens genomic DNA, chromosome 22q11.2...    74   3e-12   
gb:HUMHTR3A_2032276 Human chaperonin-like protein (HTR3) mRNA, c...    74   4e-12   
gb:AC092101_1875522 Homo sapiens BAC clone RP11-745J15 from 7, c...    74   4e-12   
gb:AB063318_1869035 Homo sapiens MoDP-2, MoDP-3 mRNA for acute m...    74   4e-12   
sp|P40227|TCPZ_HUMAN|TCPZ_HUMAN T-complex protein 1, zeta subunit (TCP-1-ze...    74   4e-12   
gb:AF053556_1764456 Mesembryanthemum crystallinum chaperonin hom...    74   6e-12   
pir|T12207|T12207 chaperonin homolog - common ice plant (fragment)     74   6e-12   
pir|H90125|H90125 t-complex protein 1 alpha SU [imported] - Guil...    74   6e-12   
gb:AY128362_1580661 Arabidopsis thaliana TCP-1 chaperonin-like p...    73   8e-12   
gb:AY251814_1313169 Bigelowiella natans chaperonin-containing TC...    73   8e-12   
pir|T51390|T51390 TCP-1 chaperonin-like protein - Arabidopsis th...    73   8e-12   
gb:AE014298_1125799 Drosophila melanogaster chromosome X, comple...    72   1e-11   
pir|B90103|B90103 T-complex protein gamma SU [imported] - Guilla...    72   2e-11   
gb:AB041570_2045439 Mus musculus brain cDNA, clone MNCb-1272, si...    70   5e-11   
gb:AF226719_1252681 Trichomonas vaginalis chaperonin subunit zet...    70   5e-11   
gb:AF387003_1794808 Arabidopsis thaliana putative chaperonin (F1...    70   6e-11   
gb:CR382139_1672584 Debaryomyces hansenii chromosome G of strain...    70   6e-11   
gb:ATAC021640_1543733 Arabidopsis thaliana chromosome III BAC F1...    70   6e-11   
gb:CR382399_1374916 Plasmodium falciparum chromosome 6, complete...    70   6e-11   
gb:AF293981_1259515 Entamoeba histolytica strain HM-1 chaperonin...    70   6e-11   
gb:AY084739_1569824 Arabidopsis thaliana clone 116386 mRNA, comp...    70   8e-11   
gb:DRVI18419_1383154 Drosophila virilis mRNA for t-complex polyp...    69   2e-10   
gb:AY781285_645983 Corynebacterium pseudotuberculosis strain T1 ...    65   2e-09   
sp|P46550|TCPZ_CAEEL|TCPZ_CAEEL T-complex protein 1, zeta subunit (TCP-1-ze...    65   2e-09   
sp|P39079|TCPZ_YEAST|TCPZ_YEAST T-complex protein 1, zeta subunit (TCP-1-ze...    64   4e-09   
sp|O94515|TCPZ_SCHPO|TCPZ_SCHPO T-complex protein 1, zeta subunit (TCP-1-ze...    64   4e-09   
sp|Q8CY27|CH61_COREF|CH61_COREF 60 kDa chaperonin 1 (Protein Cpn60 1) (groE...    64   5e-09   
gb:AE017349_1758746 Cryptococcus neoformans var. neoformans JEC2...    64   6e-09   
gb:AF322112_1262513 Leishmania donovani chaperonin TCP20 (TCP20)...    64   6e-09   
gb:BX248355_761869 Corynebacterium diphtheriae gravis NCTC13129,...    64   6e-09   
gb:CR380953_1650976 Candida glabrata strain CBS138 chromosome G ...    61   3e-08   
gb:SSOTF56A_190730 Sulfolobus shibatae thermophilic factor 56 (t...    60   5e-08   
pir|S59860|S59860 hypothetical protein - Sulfolobus shibatae           60   5e-08   
gb:BX927149_832184 Corynebacterium glutamicum ATCC 13032, IS fin...    60   7e-08   
sp|Q8NSS0|CH61_CORGL|CH61_CORGL 60 kDa chaperonin 1 (Protein Cpn60 1) (groE...    60   7e-08   
gb:AY251811_1313166 Bigelowiella natans chaperonin-containing TC...    59   1e-07   
gb:AF149922_483534 Sulfolobus shibatae putative chaperonin gamma...    59   1e-07   
sp|P60545|CH61_MYCPA|CH61_MYCPA 60 kDa chaperonin 1 (Protein Cpn60 1) (groE...    59   1e-07   
pir|G71219|G71219 hypothetical protein PH0018 - Pyrococcus horik...    57   4e-07   
gb:PFL306236_2577911 Platichthys flesus partial mRNA for T-compl...    56   1e-06   
pir|G90109|G90109 T-complex protein 1, zeta SU [imported] - Guil...    56   1e-06   
gb:AE016820_1749834 Ashbya gossypii (= Eremothecium gossypii) AT...    56   1e-06   
sp|P49464|CH60_ODOSI|CH60_ODOSI 60 kDa chaperonin (Protein Cpn60) (groEL pr...    56   1e-06   
gb:AC116960_1206778 Dictyostelium discoideum chromosome 2 map co...    55   2e-06   
gb:BA000045_741102 Gloeobacter violaceus PCC 7421 DNA, complete ...    55   2e-06   
sp|Q59573|CH61_MYCTU|CH61_MYCTU 60 kDa chaperonin 1 (Protein Cpn60-1) (groE...    55   2e-06   
gb:AY038047_586144 Streptococcus oralis ATCC 35037 GroES (groES)...    55   2e-06   
gb:AP004843_1845835 Oryza sativa (japonica cultivar-group) genom...    55   3e-06   
gb:AB002583_1508793 Cyanidioschyzon merolae chloroplast DNA, com...    55   3e-06   
gb:AY346155_611617 Streptococcus bovis strain ATCC 33317 GroEL (...    55   3e-06   
gb:MTGROEOP_151055 M.tuberculosis groE gene for KCS and 10-kDa p...    55   3e-06   
gb:AF067947_1238196 Caenorhabditis elegans cosmid T10B5, complet...    54   4e-06   
gb:AF417586_509439 Enterococcus hirae ATCC 8043 GroES and GroEL ...    54   5e-06   
pir|B41884|B41884 58K heat shock protein groEL - Bacillus subtil...    54   5e-06   
sp|P28598|CH60_BACSU|CH60_BACSU 60 kDa chaperonin (Protein Cpn60) (groEL pr...    54   5e-06   
gb:CR382124_1657141 Kluyveromyces lactis strain NRRL Y-1140 chro...    54   6e-06   
gb:AE017333_446528 Bacillus licheniformis DSM 13, complete genom...    54   6e-06   
sp|Q8VV84|CH60_BACTR|CH60_BACTR 60 kDa chaperonin (Protein Cpn60) (groEL pr...    54   6e-06   
gb:BA000043_736826 Geobacillus kaustophilus HTA426 DNA, complete...    53   8e-06   
gb:PAC130877_1391530 Plectus acuminatus mRNA for heat shock prot...    53   1e-05   
gb:AY346178_611640 Streptococcus bovis isolate ntuh8995 GroEL (g...    53   1e-05   
gb:AY315820_608527 Enterococcus faecium strain ATCC 35667 GroES ...    53   1e-05   
gb:AP006618_557281 Nocardia farcinica IFM 10152 DNA, complete ge...    53   1e-05   
gb:AF417582_509431 Enterococcus faecium ATCC 19434 GroES and Gro...    53   1e-05   
gb:AY346186_611646 Streptococcus bovis isolate ntuh2639 GroEL (g...    52   1e-05   
gb:AY346182_611644 Streptococcus bovis isolate ntuh195 GroEL (gr...    52   1e-05   
gb:AY346181_611643 Streptococcus bovis isolate ntuh6546 GroEL (g...    52   1e-05   
gb:AY346159_611621 Streptococcus bovis isolate ntuh4936 GroEL (g...    52   1e-05   
pir|S68249|S68249 chaperonin groEL homolog cpn60 - Clostridium t...    52   1e-05   
sp|P37578|CH61_MYCLE|CH61_MYCLE 60 kDa chaperonin 1 (Protein Cpn60 1) (groE...    52   1e-05   
sp|Q8KJ16|CH60_STRSA|CH60_STRSA 60 kDa chaperonin (Protein Cpn60) (groEL pr...    52   1e-05   
sp|P48212|CH60_CLOTM|CH60_CLOTM 60 kDa chaperonin (Protein Cpn60) (groEL pr...    52   1e-05   
gb:AX073958_1460591 Sequence 50 from Patent WO0104344.                 52   2e-05   
gb:DMHSP60_1379630 D.melanogaster mRNA for heat shock protein 60.      52   2e-05   


>gb:AY088570_1573587 Arabidopsis thaliana clone 7925 mRNA, complete
           sequence.
          Length = 536

 Score =  405 bits (1040), Expect = e-112
 Identities = 207/221 (93%), Positives = 215/221 (97%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KIMVIKDVERDEIEF+TKTLNCLPIAN+EHFRAEKLGHADLVEE SLGDG KI+KITG
Sbjct: 317 KAKIMVIKDVERDEIEFVTKTLNCLPIANIEHFRAEKLGHADLVEEASLGDG-KILKITG 375

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
           I+DMGRT SVLVRGSNQLV+DEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA
Sbjct: 376 IKDMGRTTSVLVRGSNQLVLDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 435

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           WAKVL GMEGYCVKSFAE+LEVIPYTLAENAGLNPI IVTELRN+HAQGEINAGINVRKG
Sbjct: 436 WAKVLHGMEGYCVKSFAEALEVIPYTLAENAGLNPIAIVTELRNKHAQGEINAGINVRKG 495

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           QITNILEENVVQPLLVSTSAI+LATECVRMILKIDDIVTVR
Sbjct: 496 QITNILEENVVQPLLVSTSAITLATECVRMILKIDDIVTVR 536



>gb:AB020749_1514655 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MRC8.>gb:AY099877_1576902 Arabidopsis thaliana
           chaperonin subunit, putative (At3g18190) mRNA, complete
           cds.>gb:BT003418_1636841 Arabidopsis thaliana chaperonin
           subunit, putative (At3g18190) mRNA, complete cds.
          Length = 536

 Score =  405 bits (1040), Expect = e-112
 Identities = 207/221 (93%), Positives = 215/221 (97%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KIMVIKDVERDEIEF+TKTLNCLPIAN+EHFRAEKLGHADLVEE SLGDG KI+KITG
Sbjct: 317 KAKIMVIKDVERDEIEFVTKTLNCLPIANIEHFRAEKLGHADLVEEASLGDG-KILKITG 375

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
           I+DMGRT SVLVRGSNQLV+DEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA
Sbjct: 376 IKDMGRTTSVLVRGSNQLVLDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 435

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           WAKVL GMEGYCVKSFAE+LEVIPYTLAENAGLNPI IVTELRN+HAQGEINAGINVRKG
Sbjct: 436 WAKVLHGMEGYCVKSFAEALEVIPYTLAENAGLNPIAIVTELRNKHAQGEINAGINVRKG 495

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           QITNILEENVVQPLLVSTSAI+LATECVRMILKIDDIVTVR
Sbjct: 496 QITNILEENVVQPLLVSTSAITLATECVRMILKIDDIVTVR 536



>gb:AJ583803_1811375 Glycine max cctd gene for cytosolic chaperonin
           delta-subunit, cultivar Cuc Vang.
          Length = 533

 Score =  396 bits (1017), Expect = e-109
 Identities = 202/221 (91%), Positives = 214/221 (96%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KI+VIKDVERDEIEFITKTLNCLPIAN+EHFR EKLG+ADLVEEVSLGDG KIVKITG
Sbjct: 314 KAKILVIKDVERDEIEFITKTLNCLPIANIEHFRTEKLGYADLVEEVSLGDG-KIVKITG 372

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
           I++MG+T +VLVRGSNQLV+DEAERSLHDALCVVRCLV+KRFLIAGGGAPEIELSRQLGA
Sbjct: 373 IKEMGKTTTVLVRGSNQLVLDEAERSLHDALCVVRCLVAKRFLIAGGGAPEIELSRQLGA 432

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           WAKVL GMEGYCV++FAE+LEVIPYTLAENAGLNPI IVTELRNRHAQGEINAGINVRKG
Sbjct: 433 WAKVLHGMEGYCVRAFAEALEVIPYTLAENAGLNPIAIVTELRNRHAQGEINAGINVRKG 492

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           QITNILEENVVQPLLVSTSAI LATECVRMILKIDDIVTVR
Sbjct: 493 QITNILEENVVQPLLVSTSAIMLATECVRMILKIDDIVTVR 533



>gb:GMA012318_1680333 Glycine max cctd gene.
          Length = 533

 Score =  392 bits (1007), Expect = e-108
 Identities = 200/221 (90%), Positives = 213/221 (96%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KI+VIKDVERDEIEFITKTLNCLPIAN+EHFR EKLG+ADLVEE SLGDG KIVKITG
Sbjct: 314 KAKILVIKDVERDEIEFITKTLNCLPIANIEHFRTEKLGYADLVEEFSLGDG-KIVKITG 372

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
           I++MG+T +VLVRGSNQLV+DEAERSLHDALCVVRCLV+KRFLIAGGGAPEIELSRQLGA
Sbjct: 373 IKEMGKTTTVLVRGSNQLVLDEAERSLHDALCVVRCLVAKRFLIAGGGAPEIELSRQLGA 432

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           WAKVL GMEGYCV++FAE+LEVIPYTLAENAGLNPI IVTELRNRHAQGEINAGINVRKG
Sbjct: 433 WAKVLHGMEGYCVRAFAEALEVIPYTLAENAGLNPIAIVTELRNRHAQGEINAGINVRKG 492

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           QITNILEENVVQP LVSTSAI+LATECVRMILKIDDIVTVR
Sbjct: 493 QITNILEENVVQPPLVSTSAITLATECVRMILKIDDIVTVR 533



>gb:AP005865_1859262 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBb0037J12.
          Length = 534

 Score =  378 bits (971), Expect = e-104
 Identities = 192/221 (86%), Positives = 209/221 (94%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KI+V+KDVERDEIEFITKTLNCLPIAN+EHFR +KLG+ADLVEEVS+G+  KIVKI G
Sbjct: 315 KAKILVVKDVERDEIEFITKTLNCLPIANIEHFREDKLGYADLVEEVSVGES-KIVKIMG 373

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
           I+DMGRTA+VLVRGSNQLVIDEAERSLHDALCV+RCLV+KRFLIAGGGAPEIE+S QL A
Sbjct: 374 IKDMGRTATVLVRGSNQLVIDEAERSLHDALCVIRCLVNKRFLIAGGGAPEIEMSMQLAA 433

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           WAK LQGME YC+K FAE+LEVIPYTLAENAGLNPI+IVTELRNRHA+GE NAGINVRKG
Sbjct: 434 WAKELQGMESYCIKEFAEALEVIPYTLAENAGLNPISIVTELRNRHAKGEKNAGINVRKG 493

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           QITNILEENVVQPLLVSTSAI+LA ECVRMILKIDDIVTVR
Sbjct: 494 QITNILEENVVQPLLVSTSAITLACECVRMILKIDDIVTVR 534



>gb:AE016959_1023422 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC068924_1540526
           Oryza sativa chromosome 10 BAC OSJNBa0026L12 genomic
           sequence, complete sequence.>gb:AE017112_1753241 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           66 of 77 of the complete sequence.
          Length = 541

 Score =  366 bits (939), Expect = e-100
 Identities = 183/223 (82%), Positives = 207/223 (92%), Gaps = 2/223 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGG--KIVKI 822
           K KIMV+KDVERDEIEFITKTLNC+PIA++EH R +KLGHA LVEE+S+GDG   KIVKI
Sbjct: 319 KAKIMVVKDVERDEIEFITKTLNCMPIASIEHLREDKLGHAHLVEEISVGDGNNNKIVKI 378

Query: 821 TGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQL 642
           TGI++MGRTA+VLVRGSNQ+VIDEA+RSLHDA CV+RCLV+KRFLIAGGGAPEIE+S QL
Sbjct: 379 TGIKNMGRTATVLVRGSNQMVIDEAQRSLHDAFCVIRCLVNKRFLIAGGGAPEIEMSMQL 438

Query: 641 GAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVR 462
            AWAK L+GME YCV+ FAE+LEVIPYTLAENAGL+PI+ VTELRNRHA+GE NAGINVR
Sbjct: 439 AAWAKELRGMESYCVREFAEALEVIPYTLAENAGLDPISTVTELRNRHAKGEKNAGINVR 498

Query: 461 KGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           KG+ITNILEENVVQPLLVSTSA++LA ECVRMILKIDDIVTVR
Sbjct: 499 KGRITNILEENVVQPLLVSTSAVTLACECVRMILKIDDIVTVR 541



>gb:AF494043_1276771 Physarum polycephalum chaperonin containing
           TCP-1 delta subunit (CCT4) mRNA, complete cds.
          Length = 539

 Score =  308 bits (790), Expect = 8e-83
 Identities = 155/221 (70%), Positives = 189/221 (85%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KI+V+KD+ERDE+EFITKTL C+PIA+++ F  EKLG ADLVEEV   +  K+VKITG
Sbjct: 320 KMKILVVKDIERDEVEFITKTLGCVPIASIDSFVPEKLGKADLVEEVGSNES-KLVKITG 378

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
           I + G+T SV+VRGSN+LV+DEAERSLHDALCV+R LV K+ +IAGGGAPEIE++ QL  
Sbjct: 379 IPNAGKTVSVVVRGSNKLVLDEAERSLHDALCVIRSLVKKKCMIAGGGAPEIEVAMQLTN 438

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           ++K L+G+E YCV+S+AE+ E+IPYTLAENAGL+PI IVTELRNRHAQGE  AGINV+KG
Sbjct: 439 YSKTLKGVESYCVRSYAEAFEIIPYTLAENAGLHPIAIVTELRNRHAQGEKTAGINVKKG 498

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
            ITN+LEENVVQPLLV TSA++LATE V M+LKIDDIV  R
Sbjct: 499 AITNMLEENVVQPLLVDTSAVTLATETVVMLLKIDDIVITR 539



>sp|Q9NB32|TCPD_AEDTR T-complex protein 1, delta subunit
           (TCP-1-delta) (CCT-delta).>gb:AF271209_1257583 Aedes
           triseriatus putative chaperonin containing t-complex
           polypeptide 1 CCT delta subunit mRNA, complete cds.
          Length = 533

 Score =  303 bits (777), Expect = 3e-81
 Identities = 154/218 (70%), Positives = 186/218 (85%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K K+MV+KD+E ++IEF+ KTLNC PIA+++HF  E L +ADLVEEVS G   K VK+TG
Sbjct: 313 KIKVMVVKDIEHEDIEFVCKTLNCRPIASLDHFLPEHLVNADLVEEVSSGSS-KFVKVTG 371

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
           IQ+MG+T S++VRGSN+LV++EAERSLHDALCVVRCLV KR  IAGGGAPEIE++ QL A
Sbjct: 372 IQNMGQTVSIVVRGSNKLVLEEAERSLHDALCVVRCLVKKRAQIAGGGAPEIEMAIQLAA 431

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
            A+ L+G++ YC ++FA +LEVIP TLAENAGLNPI  VTELRNRHAQGE NAGINVRKG
Sbjct: 432 HAQTLEGVDAYCFRAFANALEVIPSTLAENAGLNPIATVTELRNRHAQGEKNAGINVRKG 491

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            IT+IL ENVVQPLLVSTS+I+LA+E VR ILKIDDI+
Sbjct: 492 AITDILAENVVQPLLVSTSSITLASETVRSILKIDDII 529



>gb:BC056719_2551912 Danio rerio chaperonin containing TCP1, subunit
           4 (delta), mRNA (cDNA clone MGC:65789 IMAGE:6790812),
           complete cds.
          Length = 533

 Score =  303 bits (775), Expect = 5e-81
 Identities = 155/221 (70%), Positives = 184/221 (83%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KIMVIKD+ER+EIEFI KT+   PIA+++ F  E LG A+LVEEVSL   GK+VKITG
Sbjct: 313 KMKIMVIKDIEREEIEFICKTIGTKPIAHIDQFTPEMLGSAELVEEVSLDGSGKLVKITG 372

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
               G+T S++VRGSN+LVI+EAERS+HDALCV+RCLV KR LIAGGGAPEIEL+ +L  
Sbjct: 373 CASPGKTVSIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLAE 432

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A+ L GME YCV+++A++LEVIP TLAENAGLNPI+ VTELRNRHAQGE  AGINVRKG
Sbjct: 433 YARSLGGMEAYCVRAYADALEVIPSTLAENAGLNPISTVTELRNRHAQGETTAGINVRKG 492

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
            I+NILEE VVQPLLVS SA++LATE VR ILKIDD+V  R
Sbjct: 493 GISNILEELVVQPLLVSISALTLATETVRSILKIDDLVNTR 533



>gb:BC076940_2559679 Xenopus tropicalis chaperonin containing TCP1,
           subunit 4 (delta), mRNA (cDNA clone MGC:89275
           IMAGE:6977162), complete cds.
          Length = 542

 Score =  301 bits (770), Expect = 2e-80
 Identities = 148/221 (66%), Positives = 185/221 (83%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KIMV+KD+ER++IEFI KT+   P+A+++ F A+ L  A+L EEVSL   GK+VKITG
Sbjct: 322 KMKIMVVKDIEREDIEFICKTIGTKPVAHIDQFTADMLASAELAEEVSLNGSGKLVKITG 381

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
             + G+T +++VRGSN+LVI+EAERS+HDALCV+RCLV KR LIAGGGAPEIELS +L  
Sbjct: 382 CANPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELSLRLNE 441

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A+ L GME YC+++FA++LE+IP+TLAENAGLNPI+ VTELRNRHAQGE  AGINVRKG
Sbjct: 442 YARTLSGMESYCIRAFADALEIIPFTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKG 501

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
            I+NILEE VVQPLLVS S+++LATE VR ILKIDD+V  R
Sbjct: 502 GISNILEELVVQPLLVSISSLTLATETVRSILKIDDVVNTR 542



>gb:BC065324_2553943 Danio rerio chaperonin containing TCP1, subunit
           4 (delta), mRNA (cDNA clone MGC:77192 IMAGE:6961875),
           complete cds.
          Length = 533

 Score =  300 bits (767), Expect = 4e-80
 Identities = 154/221 (69%), Positives = 183/221 (82%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KIMVIKD+ER+EIEFI KT+   PIA+++ F  E LG A+LVEEVSL   GK+VKITG
Sbjct: 313 KMKIMVIKDIEREEIEFICKTIGTKPIAHIDQFTPEMLGSAELVEEVSLDGSGKLVKITG 372

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
               G+T S++VRGSN+LVI+EAERS+ DALCV+RCLV KR LIAGGGAPEIEL+ +L  
Sbjct: 373 CASPGKTVSIVVRGSNKLVIEEAERSIRDALCVIRCLVKKRALIAGGGAPEIELALRLAE 432

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A+ L GME YCV+++A++LEVIP TLAENAGLNPI+ VTELRNRHAQGE  AGINVRKG
Sbjct: 433 YARSLGGMEAYCVRAYADALEVIPSTLAENAGLNPISTVTELRNRHAQGETTAGINVRKG 492

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
            I+NILEE VVQPLLVS SA++LATE VR ILKIDD+V  R
Sbjct: 493 GISNILEELVVQPLLVSISALTLATETVRSILKIDDLVNTR 533



>gb:BC084314_2563699 Xenopus laevis hypothetical protein LOC398959,
           mRNA (cDNA clone MGC:83370 IMAGE:7007752), complete cds.
          Length = 541

 Score =  299 bits (766), Expect = 5e-80
 Identities = 147/221 (66%), Positives = 185/221 (83%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KIMV+K++ER++IEFI KT+   P+A+++ F A+ L  A+L EEVSL   GK+VKITG
Sbjct: 321 KMKIMVVKEIEREDIEFICKTIGTKPVAHIDQFTADMLASAELAEEVSLNGSGKLVKITG 380

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
             + G+T +++VRGSN+LVI+EAERS+HDALCV+RCLV KR LIAGGGAPEIELS +L  
Sbjct: 381 CANPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELSLRLNE 440

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A+ L GME YC+++FA++LE+IP+TLAENAGLNPI+ VTELRNRHAQGE  AGINVRKG
Sbjct: 441 YARALSGMESYCIRAFADALEIIPFTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKG 500

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
            I+NILEE VVQPLLVS S+++LATE VR ILKIDD+V  R
Sbjct: 501 GISNILEELVVQPLLVSISSLTLATETVRSILKIDDVVNTR 541



>gb:BC060448_2552914 Xenopus laevis hypothetical protein LOC398959,
           mRNA (cDNA clone IMAGE:3400035), partial cds.
          Length = 449

 Score =  299 bits (766), Expect = 5e-80
 Identities = 147/221 (66%), Positives = 185/221 (83%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KIMV+K++ER++IEFI KT+   P+A+++ F A+ L  A+L EEVSL   GK+VKITG
Sbjct: 229 KMKIMVVKEIEREDIEFICKTIGTKPVAHIDQFTADMLASAELAEEVSLNGSGKLVKITG 288

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
             + G+T +++VRGSN+LVI+EAERS+HDALCV+RCLV KR LIAGGGAPEIELS +L  
Sbjct: 289 CANPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELSLRLNE 348

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A+ L GME YC+++FA++LE+IP+TLAENAGLNPI+ VTELRNRHAQGE  AGINVRKG
Sbjct: 349 YARALSGMESYCIRAFADALEIIPFTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKG 408

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
            I+NILEE VVQPLLVS S+++LATE VR ILKIDD+V  R
Sbjct: 409 GISNILEELVVQPLLVSISSLTLATETVRSILKIDDVVNTR 449



>gb:BC014676_1974775 Homo sapiens, clone IMAGE:4158571, mRNA,
           partial cds.
          Length = 250

 Score =  297 bits (761), Expect = 2e-79
 Identities = 148/221 (66%), Positives = 184/221 (83%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KIMVIKD+ER++IEFI KT+   P+A+++ F A+ LG A+L EEV+L   GK++KITG
Sbjct: 30  KMKIMVIKDIEREDIEFICKTIGTKPVAHIDQFTADMLGSAELAEEVNLNGSGKLLKITG 89

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
               G+T +++VRGSN+LVI+EAERS+HDALCV+RCLV KR LIAGGGAPEIEL+ +L  
Sbjct: 90  CASPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTE 149

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +++ L GME YCV++FA+++EVIP TLAENAGLNPI+ VTELRNRHAQGE  AGINVRKG
Sbjct: 150 YSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKG 209

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
            I+NILEE VVQPLLVS SA++LATE VR ILKIDD+V  R
Sbjct: 210 GISNILEELVVQPLLVSVSALTLATETVRSILKIDDVVNTR 250



>gb:AF026291_1877303 Homo sapiens chaperonin containing t-complex
           polypeptide 1, delta subunit (Cctd) mRNA, complete cds.
          Length = 539

 Score =  297 bits (761), Expect = 2e-79
 Identities = 148/221 (66%), Positives = 184/221 (83%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KIMVIKD+ER++IEFI KT+   P+A+++ F A+ LG A+L EEV+L   GK++KITG
Sbjct: 319 KMKIMVIKDIEREDIEFICKTIGTKPVAHIDQFTADMLGSAELAEEVNLNGSGKLLKITG 378

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
               G+T +++VRGSN+LVI+EAERS+HDALCV+RCLV KR LIAGGGAPEIEL+ +L  
Sbjct: 379 CASPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTE 438

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +++ L GME YCV++FA+++EVIP TLAENAGLNPI+ VTELRNRHAQGE  AGINVRKG
Sbjct: 439 YSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKG 498

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
            I+NILEE VVQPLLVS SA++LATE VR ILKIDD+V  R
Sbjct: 499 GISNILEELVVQPLLVSVSALTLATETVRSILKIDDVVNTR 539



>gb:CR860659_1184718 Pongo pygmaeus mRNA; cDNA DKFZp459D1424 (from
           clone DKFZp459D1424).
          Length = 539

 Score =  297 bits (761), Expect = 2e-79
 Identities = 148/221 (66%), Positives = 184/221 (83%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KIMVIKD+ER++IEFI KT+   P+A+++ F A+ LG A+L EEV+L   GK++KITG
Sbjct: 319 KMKIMVIKDIEREDIEFICKTIGTKPVAHIDQFTADMLGSAELAEEVNLNGSGKLLKITG 378

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
               G+T +++VRGSN+LVI+EAERS+HDALCV+RCLV KR LIAGGGAPEIEL+ +L  
Sbjct: 379 CASPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTE 438

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +++ L GME YCV++FA+++EVIP TLAENAGLNPI+ VTELRNRHAQGE  AGINVRKG
Sbjct: 439 YSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKG 498

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
            I+NILEE VVQPLLVS SA++LATE VR ILKIDD+V  R
Sbjct: 499 GISNILEELVVQPLLVSVSALTLATETVRSILKIDDVVNTR 539



>pir|JC4521|JC4521 t-complex polypeptide 1 chaperonin delta chain -
           Japanese pufferfish
          Length = 536

 Score =  297 bits (761), Expect = 2e-79
 Identities = 149/221 (67%), Positives = 184/221 (83%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KIMV+KD+ER++IEFI KT+   PIA+++HF  E LG A+L EEVSL   GK+VKITG
Sbjct: 316 KMKIMVVKDIEREDIEFICKTIGTKPIAHIDHFTPEMLGTAELAEEVSLDGSGKLVKITG 375

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
               G+T S++VRGSN+LVI+EAERS+HDALCV+RCLV KR LIAGGGAPEIEL+ +L  
Sbjct: 376 CASPGKTVSIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELAVRLAE 435

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +++ L GME YCV++++++LEVIP TLAENAGLNPI+ VTELRNRHAQG+  AGINVRKG
Sbjct: 436 YSRTLGGMEAYCVRAYSDALEVIPSTLAENAGLNPISTVTELRNRHAQGDKMAGINVRKG 495

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
            I+NI+EE VVQPLLVS SA++LATE VR ILKIDD+V  R
Sbjct: 496 GISNIMEELVVQPLLVSISALTLATETVRSILKIDDVVNAR 536



>sp|P53451|TCPD_FUGRU T-complex protein 1, delta subunit
           (TCP-1-delta) (CCT-delta).>gb:FRBCCT1D1_2572011 Fugu
           rubripes Cctd mRNA for chaperonin containing TCP-1
           delta, complete cds.>gb:FRBCCT2_2572012 Takifugu
           rubripes Cctd gene for chaperonin containing TCP-1
           delta, complete cds.
          Length = 536

 Score =  297 bits (761), Expect = 2e-79
 Identities = 149/221 (67%), Positives = 184/221 (83%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KIMV+KD+ER++IEFI KT+   PIA+++HF  E LG A+L EEVSL   GK+VKITG
Sbjct: 316 KMKIMVVKDIEREDIEFICKTIGTKPIAHIDHFTPEMLGTAELAEEVSLDGSGKLVKITG 375

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
               G+T S++VRGSN+LVI+EAERS+HDALCV+RCLV KR LIAGGGAPEIEL+ +L  
Sbjct: 376 CASPGKTVSIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELAVRLAE 435

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +++ L GME YCV++++++LEVIP TLAENAGLNPI+ VTELRNRHAQG+  AGINVRKG
Sbjct: 436 YSRTLGGMEAYCVRAYSDALEVIPSTLAENAGLNPISTVTELRNRHAQGDKMAGINVRKG 495

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
            I+NI+EE VVQPLLVS SA++LATE VR ILKIDD+V  R
Sbjct: 496 GISNIMEELVVQPLLVSISALTLATETVRSILKIDDVVNAR 536



>gb:BC073652_2557475 Xenopus laevis MGC82994 protein, mRNA (cDNA
           clone MGC:82994 IMAGE:5516202), complete cds.
          Length = 539

 Score =  297 bits (760), Expect = 2e-79
 Identities = 147/221 (66%), Positives = 183/221 (82%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KIMVIKD+ER++IEFI KT+   P+A+++ F A+ L  A+L EEVSL   GK+VKITG
Sbjct: 319 KMKIMVIKDIEREDIEFICKTIGAKPVAHIDQFTADMLASAELAEEVSLNGSGKLVKITG 378

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
             + G+T +++VRGSN+LVI+EAERS+HDALCV+RCLV K+ LIAGGGAPEIELS +L  
Sbjct: 379 CANPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKKALIAGGGAPEIELSLRLNE 438

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +++ L GME YC++ FA++LEVIP+TLAENAGL PI+ VTELRNRHAQGE  AGINVRKG
Sbjct: 439 YSRALSGMESYCIRGFADALEVIPFTLAENAGLKPISTVTELRNRHAQGEKTAGINVRKG 498

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
            I+NILEE VVQPLLVS S+++LATE VR ILKIDD+V  R
Sbjct: 499 GISNILEELVVQPLLVSISSLTLATETVRSILKIDDVVNAR 539



>sp|P80315|TCPD_MOUSE T-complex protein 1, delta subunit
           (TCP-1-delta) (CCT-delta) (A45).>pir|S43060|S43060 CCT
           (chaperonin containing TCP-1) delta chain -
           mouse>gb:AK010634_1155900 Mus musculus ES cells cDNA,
           RIKEN full-length enriched library, clone:2410038N06
           product:chaperonin subunit 4 (delta), full insert
           sequence.>gb:A45918_1449227 Sequence 57 from Patent
           WO9520654.>gb:AB022157_2044202 Mus musculus Cctd gene
           for chaperonin containing TCP-1 delta subunit, complete
           cds.>gb:BC054773_2101813 Mus musculus chaperonin subunit
           4 (delta), mRNA (cDNA clone MGC:65609 IMAGE:6807250),
           complete cds.>gb:BX001008_2111239 Mouse DNA sequence
           from clone RP24-143D17 on chromosome 11 Contains part of
           the 3'UTR of the U2af1-rs1 gene for U2 small nuclear
           ribonucleoprotein auxiliary factor (U2AF) 1 (related
           sequence 1), the 5' end of the Murr1 gene for U2af1-rs1
           region 1, the Cct4 gene for chaperonin subunit 4
           (delta), the 5' end of gene FLJ13305 and three CpG
           islands, complete sequence.>gb:MMCCTDE_2114451
           M.musculus (129/Sv) Cctd mRNA for CCT (chaperonin
           containing TCP-1) delta subunit.>gb:BC083954_2563367
           Xenopus laevis hypothetical LOC494891, mRNA (cDNA clone
           MGC:97965 IMAGE:7197957), complete cds.
          Length = 539

 Score =  296 bits (759), Expect = 3e-79
 Identities = 148/221 (66%), Positives = 182/221 (82%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KIMV+KDVER++IEFI KT+   P+A+++ F A+ LG A+L EEVSL   GK+ KITG
Sbjct: 319 KMKIMVVKDVEREDIEFICKTIGTKPVAHIDQFTADMLGSAELAEEVSLNGSGKLFKITG 378

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
               G+T +++VRGSN+LVI+EAERS+HDALCV+RCLV KR LIAGGGAPEIEL+ +L  
Sbjct: 379 CTSPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTE 438

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +++ L GME YCV++FA+++EVIP TLAENAGLNPI+ VTELRNRHAQGE   GINVRKG
Sbjct: 439 YSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTTGINVRKG 498

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
            I+NILEE VVQPLLVS SA++LATE VR ILKIDD+V  R
Sbjct: 499 GISNILEEMVVQPLLVSVSALTLATETVRSILKIDDVVNTR 539



>sp|P50991|TCPD_HUMAN T-complex protein 1, delta subunit
           (TCP-1-delta) (CCT-delta) (Stimulator of TAR RNA
           binding).>gb:HSU38846_2023978 Human stimulator of TAR
           RNA binding (SRB) mRNA, complete cds.
          Length = 539

 Score =  296 bits (759), Expect = 3e-79
 Identities = 148/221 (66%), Positives = 183/221 (82%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KIMVIKD+ER++IEFI KT+   P+A+++ F A+ LG A+L EEV+L   GK++KITG
Sbjct: 319 KMKIMVIKDIEREDIEFICKTIGTKPVAHIDQFTADMLGSAELAEEVNLNGSGKLLKITG 378

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
               G+T +++VRGSN+LVI+EAERS+HDALCV+RCLV KR LIAGGGAPEIEL+  L  
Sbjct: 379 CASPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALALTE 438

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +++ L GME YCV++FA+++EVIP TLAENAGLNPI+ VTELRNRHAQGE  AGINVRKG
Sbjct: 439 YSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKG 498

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
            I+NILEE VVQPLLVS SA++LATE VR ILKIDD+V  R
Sbjct: 499 GISNILEELVVQPLLVSVSALTLATETVRSILKIDDVVNTR 539



>gb:AB056420_1868409 Macaca fascicularis brain cDNA,
           clone:QflA-14733.
          Length = 483

 Score =  296 bits (758), Expect = 4e-79
 Identities = 147/221 (66%), Positives = 184/221 (83%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KIMVIKD+ER++IEFI KT+   P+A+++ F A+ LG A+L EEVSL   GK++KITG
Sbjct: 263 KMKIMVIKDIEREDIEFICKTIGTKPVAHIDQFTADMLGSAELAEEVSLNGSGKLLKITG 322

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
               G+T +++VRGSN+LVI+EAERS+HDALCV+RCLV +R LIAGGGAPEIEL+ +L  
Sbjct: 323 CASPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKRRALIAGGGAPEIELALRLTE 382

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +++ L GME YCV++FA+++EVIP TLAENAGLNPI+ VTELRNRHAQGE  +GINVRKG
Sbjct: 383 YSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTSGINVRKG 442

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
            I+NILEE VVQPLLVS SA++LATE VR ILKIDD+V  R
Sbjct: 443 GISNILEELVVQPLLVSVSALTLATETVRSILKIDDVVNTR 483



>gb:AE014134_1128927 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003637_1219034 Drosophila melanogaster
           chromosome 2L, section 46 of 83 of the complete
           sequence.>gb:AY128484_1302119 Drosophila melanogaster
           RE61939 full insert cDNA.
          Length = 533

 Score =  295 bits (756), Expect = 7e-79
 Identities = 151/218 (69%), Positives = 181/218 (83%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K K MV+KDVER++IEF+ KTL+C PIA+++HF AE L  ADLVEEV+ G   K VKITG
Sbjct: 313 KIKCMVVKDVEREDIEFVCKTLHCRPIASLDHFTAENLSSADLVEEVASGTN-KFVKITG 371

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
           IQ+MGRT S++ RGSN+LV++EA RSLHDALCVVRCLV  R  I GGGAPEIE++ QL A
Sbjct: 372 IQNMGRTVSIICRGSNKLVLEEAARSLHDALCVVRCLVKLRAQIVGGGAPEIEMALQLAA 431

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
            A+ ++G++ YC ++FA++LEVIP TLAENAGLNPI  VTELRNRHAQGE NAGINVRKG
Sbjct: 432 LAQTVEGVDAYCFRAFADALEVIPSTLAENAGLNPIATVTELRNRHAQGEKNAGINVRKG 491

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            IT+I  ENVVQPLLVS S+I+LATE +R ILKIDDIV
Sbjct: 492 AITDIFAENVVQPLLVSISSITLATETIRSILKIDDIV 529



>gb:GGA251587_2572730 Gallus gallus mRNA for chaperonin T-complex
           protein 1 delta subunit (tcp-1 delta gene).
          Length = 536

 Score =  295 bits (754), Expect = 1e-78
 Identities = 144/221 (65%), Positives = 184/221 (83%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KIMV+KD+ER++IEFI KT+   P+A+++ F  + LG A+L EEV+L   GK++KITG
Sbjct: 316 KMKIMVVKDIEREDIEFICKTIGTKPVAHIDQFTPDMLGSAELAEEVNLNGSGKLIKITG 375

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
             + G+T +++VRGSN+LV++EAERS+HDALCV+RCLV KR LIAGGGAPEIEL+ +L  
Sbjct: 376 CTNPGKTVTIVVRGSNKLVLEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLNE 435

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A+ L+GM+ YCV+++ ++LEVIP TLAENAGLNPI+ VTELRNRHAQGE  AGINVRKG
Sbjct: 436 YARTLRGMDSYCVRAYGDALEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKG 495

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
            I+NILEE VVQPLLVS SA++LATE VR ILKIDD+V  R
Sbjct: 496 GISNILEELVVQPLLVSVSALTLATETVRSILKIDDVVNTR 536



>gb:AY223861_2079906 Rattus norvegicus chaperonin delta subunit
           (Cct4) mRNA, complete cds.>gb:BC079283_2107407 Rattus
           norvegicus chaperonin subunit 4 (delta), mRNA (cDNA
           clone MGC:94410 IMAGE:7134210), complete cds.
          Length = 539

 Score =  294 bits (753), Expect = 2e-78
 Identities = 146/221 (66%), Positives = 181/221 (81%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KIMV+KD+ER++IEFI KT+   P+A+++ F  + LG A+L EEVSL   GK+ KITG
Sbjct: 319 KMKIMVVKDIEREDIEFICKTIGTKPVAHIDQFTPDMLGSAELAEEVSLNGSGKLFKITG 378

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
               G+T +++VRGSN+LVI+EAERS+HDALCV+RCLV KR LIAGGGAPEIEL+ +L  
Sbjct: 379 CTSPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLTE 438

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +++ L GME YCV++FA+++EVIP TLAENAGLNPI+ VTELRNRHAQGE   GINVRKG
Sbjct: 439 YSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTTGINVRKG 498

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
            I+NILEE VVQPLLVS SA++LATE VR ILKIDD+V  R
Sbjct: 499 GISNILEEMVVQPLLVSVSALTLATETVRSILKIDDVVNTR 539



>gb:MUSCHAP_2125473 Mus musculus chaperonin mRNA, complete cds.
          Length = 539

 Score =  293 bits (749), Expect = 5e-78
 Identities = 147/221 (66%), Positives = 180/221 (81%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KIMV+KDVER++IEFI KT+   P+A+++ F A+ LG A+L EEVSL   GK+ KITG
Sbjct: 319 KMKIMVVKDVEREDIEFICKTIGTKPVAHIDQFTADMLGSAELAEEVSLNGSGKLFKITG 378

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
               G+T +++VRGSN+LVI+EAERS+HDALCV+RCLV KR LIAGGGAPEIEL+ +L  
Sbjct: 379 CTSPGKTVTIVVRGSNKLVIEEAERSVHDALCVIRCLVKKRALIAGGGAPEIELALRLTE 438

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +++   GME YCV+ FA+++EVIP TLAENAGLNPI+ VTELRNRHAQGE   GINVRKG
Sbjct: 439 YSRTPSGMESYCVRRFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTTGINVRKG 498

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
            I+NILEE VVQPLLVS SA++LATE VR ILKIDD+V  R
Sbjct: 499 GISNILEEMVVQPLLVSVSALTLATETVRSILKIDDVVNTR 539



>gb:AE017347_1757761 Cryptococcus neoformans var. neoformans JEC21
           chromosome 7, complete sequence.
          Length = 535

 Score =  283 bits (723), Expect = 5e-75
 Identities = 143/217 (65%), Positives = 179/217 (82%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KI+VIKD+ERDEI+FI K+    P+A++E F  +KLG A+LVEE +   G K+VK+TG
Sbjct: 316 KLKILVIKDIERDEIDFIAKSTGAKPVADIEAFTEDKLGSAELVEETNQS-GAKVVKVTG 374

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
           +++ G+T SV+  G+N+LV++E+ERSLHDALCVVRCLV KR LIAGGGAPEI +SR L  
Sbjct: 375 VKNAGKTVSVVCTGANELVLEESERSLHDALCVVRCLVKKRALIAGGGAPEIHVSRLLTD 434

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           ++  L+G E YC ++FAE+LEVIP TLAENAGLNPI IVTELRN+HA G+ NAGINV+KG
Sbjct: 435 YSHTLKGKEAYCFQAFAEALEVIPTTLAENAGLNPIAIVTELRNKHALGDRNAGINVKKG 494

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDI 345
            I+NILEENVVQPLLVSTSA+ LATE V +IL+IDDI
Sbjct: 495 IISNILEENVVQPLLVSTSALELATETVALILRIDDI 531



>sp|P50999|TCPD_SCHPO T-complex protein 1, delta subunit
           (TCP-1-delta) (CCT-delta).>pir|T39263|T39263 chaperonin
           subunit cct4 - fission yeast (Schizosaccharomyces
           pombe)>gb:SPBC106_1718750 S.pombe chromosome II cosmid
           c106.
          Length = 527

 Score =  282 bits (721), Expect = 8e-75
 Identities = 141/221 (63%), Positives = 177/221 (80%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KIMVIKD+ERDE+EFI K+  C PIA++E F  +KLGHADLVEE S   G KIVK +G
Sbjct: 308 KLKIMVIKDIERDEVEFICKSTGCKPIADIESFAEDKLGHADLVEETS-SSGEKIVKFSG 366

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
           +++ G+T S+L RG+N L ++EAERSLHDALCV+RCLV +R LIAGGG+PEIE +++L  
Sbjct: 367 VKNAGKTVSILCRGANLLTLEEAERSLHDALCVIRCLVKQRALIAGGGSPEIEAAQRLLE 426

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
            A+ L+G E  C+++F+E+LE+IP TLAENAGLN I +VTELR+RHA GE  AGINVRKG
Sbjct: 427 HARQLEGREAICIRAFSEALEIIPVTLAENAGLNAIQVVTELRSRHANGEKTAGINVRKG 486

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
            +TNILEENV+QPLLV+ SAI LA E  +MI+KIDDI   R
Sbjct: 487 IVTNILEENVLQPLLVNISAIQLAAETTKMIMKIDDITLAR 527



>sp|P47208|TCPD_CAEEL T-complex protein 1, delta subunit
           (TCP-1-delta) (CCT-delta).>pir|T23173|T23173
           hypothetical protein K01C8.10 - Caenorhabditis
           elegans>gb:CEK01C8_1365158 Caenorhabditis elegans cosmid
           K01C8, complete sequence.>gb:CEU25697_1368473
           Caenorhabditis elegans CCT chaperonin subunit 4 (cct-4)
           mRNA, complete cds.
          Length = 540

 Score =  275 bits (703), Expect = 1e-72
 Identities = 130/218 (59%), Positives = 176/218 (80%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KIM IKD+ER++IEF ++ L C P+A+V+HF A+ LG+ADLVEE+  G  GK++K+TG
Sbjct: 319 KMKIMCIKDIEREDIEFYSRILGCRPVASVDHFNADALGYADLVEEIPTGGDGKVIKVTG 378

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
           +Q+ G   S+L+RGSN+LV++EA+RS+HDALCV+RCLV K+ L+ GGGAPE+E++ +L  
Sbjct: 379 VQNPGHAVSILLRGSNKLVLEEADRSIHDALCVIRCLVKKKALLPGGGAPEMEIAVKLRN 438

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
            A+   G   YC ++FA++LE+IPYTLAENAGL+PI  VTELRN HA G  + G+NVRKG
Sbjct: 439 LAQTQHGATQYCWRAFADALELIPYTLAENAGLSPIHTVTELRNNHANGNSSYGVNVRKG 498

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            +T+++EE+VVQPLLV+ SAI  A+ECVR ILKIDDIV
Sbjct: 499 YVTDMVEEDVVQPLLVTASAIKQASECVRSILKIDDIV 536



>gb:AY327033_1319732 Tetrahymena pyriformis CCT delta subunit (CCTd)
           gene, complete cds.
          Length = 540

 Score =  269 bits (687), Expect = 7e-71
 Identities = 132/219 (60%), Positives = 174/219 (79%), Gaps = 1/219 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  IMV+KD+ER+++EFITKT+  +P+A+++H   EKLG A+L E+V L D  +I+KITG
Sbjct: 318 KKGIMVVKDIEREDVEFITKTIGAIPVAHIDHLTPEKLGKAELCEDVKLSDDSRILKITG 377

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
           +Q   +T ++L RGSN LVIDEAERSLHDALCVVR LV  R L+ GGG PE+E+S+QL  
Sbjct: 378 VQSKAKTVTILCRGSNSLVIDEAERSLHDALCVVRSLVKNRGLVPGGGVPEVEISQQLSK 437

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
            ++ ++G+    V++FA++LEVIPYTLAENAGLNPI IVT+LRNRHA G   AGI++RKG
Sbjct: 438 LSREMKGVNSLIVRAFADALEVIPYTLAENAGLNPINIVTDLRNRHALGHKYAGISIRKG 497

Query: 455 QIT-NILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            I  +I  E+V+QP LV+ SA++LATECVRMILKIDD+V
Sbjct: 498 TINDDITTESVLQPALVTQSALTLATECVRMILKIDDLV 536



>gb:AE016817_1747467 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 529

 Score =  263 bits (671), Expect = 5e-69
 Identities = 137/223 (61%), Positives = 175/223 (78%), Gaps = 2/223 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+VIKDVERDEIEF++K+L C PI++VE F  ++LG ADLVEE+   DG KIVKITG
Sbjct: 308 KLNIVVIKDVERDEIEFLSKSLGCKPISDVELFTEDRLGSADLVEEID-SDGTKIVKITG 366

Query: 815 IQ--DMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQL 642
           I+  +   T S +VRG+N +V+DE ERSLHDALCV+RCLV +R LIAGGGAPEIE+SR +
Sbjct: 367 IKTGNAKPTVSCIVRGANNVVLDETERSLHDALCVIRCLVKERALIAGGGAPEIEVSRTI 426

Query: 641 GAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVR 462
              ++ +QG+E +  + FAE+LEVIP TLAENAGLN I +VTELR+RH  GE NAGI+VR
Sbjct: 427 MRESRAMQGVEAFVWQEFAEALEVIPTTLAENAGLNSIKVVTELRSRHESGETNAGISVR 486

Query: 461 KGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           +   TN  +E+++QP+LVSTSAI+LA ECV+ IL+IDDI   R
Sbjct: 487 RSGTTNTYDEHILQPVLVSTSAITLAAECVKSILRIDDITFSR 529



>gb:PFMAL13_1191626 Plasmodium falciparum 3D7 chromosome 13, ***
           SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 528

 Score =  262 bits (669), Expect = 9e-69
 Identities = 130/221 (58%), Positives = 180/221 (81%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KIMVIKD++R++IEFI+KT NC+P+A++++F ++KLG+A+ V   S+G G +IVKITG
Sbjct: 310 KAKIMVIKDIDREDIEFISKTCNCIPVASLDYFTSDKLGYAENVTTESVGYG-EIVKITG 368

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
           ++    T SVL+R SN L++DEAERSLHDALCVVR L+ ++ ++ GG APE+ELS++L  
Sbjct: 369 VESKN-TISVLLRASNNLMLDEAERSLHDALCVVRSLIKEKAVLPGGAAPEMELSQKLYQ 427

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           WA  L+G +  CVK+F+++LE+IPYTLAENAGL+P+ IVTELRN+HA+G    GIN+R G
Sbjct: 428 WANTLKGSKQICVKAFSDALELIPYTLAENAGLSPLHIVTELRNKHAEGHKYHGINIRTG 487

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
            I+N+++ENV+QPLLV+++AI LATE V MILKIDD V  R
Sbjct: 488 TISNMIDENVIQPLLVTSTAIKLATETVMMILKIDDTVICR 528



>gb:AY850329_1180299 Magnaporthe grisea T-complex protein-like
           protein mRNA, complete cds.
          Length = 533

 Score =  262 bits (669), Expect = 9e-69
 Identities = 133/222 (59%), Positives = 171/222 (77%), Gaps = 1/222 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ IKD+ERDE+EFI K+  C PIA+++ F  +KLG ADL+EE     G ++VKITG
Sbjct: 313 KLNILAIKDIERDEVEFICKSTGCKPIADIDSFTEDKLGTADLIEETQ-SSGSRLVKITG 371

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            +  G+T SV+VRG+N L++DEAERSLHDALCVVRCLV K+ LIAGGGA EIE++ QL  
Sbjct: 372 TKSTGKTISVVVRGANSLILDEAERSLHDALCVVRCLVKKKALIAGGGAAEIEIAAQLSR 431

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
            A+ L G E  C K+FA++LEV+P TLAENAGLN I +VT+LR+RH  GE NAG++++ G
Sbjct: 432 RARELTGTEAICWKAFADALEVVPTTLAENAGLNSIKVVTDLRHRHEMGEKNAGVSIKSG 491

Query: 455 QI-TNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
            + +NI +ENV+QPLLVSTSAI LA E V+MIL+IDDI   R
Sbjct: 492 GVNSNIAKENVLQPLLVSTSAIELAAETVKMILRIDDIALSR 533



>gb:SCANC2C_1706500 S.cerevisiae (S288C) anc2 gene for cytosolic
           chaperonin.
          Length = 528

 Score =  261 bits (668), Expect = 1e-68
 Identities = 131/223 (58%), Positives = 176/223 (78%), Gaps = 2/223 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  IMV+KD+ER+EIEF++K L C PIA++E F  ++LG ADLVEE+   DG KIV++TG
Sbjct: 307 KLNIMVVKDIEREEIEFLSKGLGCKPIADIELFTEDRLGSADLVEEID-SDGSKIVRVTG 365

Query: 815 IQDMGR--TASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQL 642
           I++     T SV++RG+N ++IDE ERSLHDALCV+RCLV +R LIAGGGAPEIE+SR+L
Sbjct: 366 IRNNNARPTVSVVIRGANNMIIDETERSLHDALCVIRCLVKERGLIAGGGAPEIEISRRL 425

Query: 641 GAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVR 462
              A+ ++G++ +  + FA +LEVIP TLAENAGLN I +VTELR++H  GE+N GI+VR
Sbjct: 426 SKEARSMEGVQAFIWQEFASALEVIPTTLAENAGLNSIKVVTELRSKHENGELNDGISVR 485

Query: 461 KGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           +   TN  EE+++QP+LVSTSAI+LA+ECV+ IL+IDDI   R
Sbjct: 486 RSGTTNTYEEHILQPVLVSTSAITLASECVKSILRIDDIAFSR 528



>gb:BX842624_1643822 Neurospora crassa DNA linkage group I BAC clone
           B10D6.
          Length = 533

 Score =  261 bits (668), Expect = 1e-68
 Identities = 130/219 (59%), Positives = 171/219 (78%), Gaps = 1/219 (0%)
 Frame = -1

Query: 986 IMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQD 807
           I+ +KD+ERDE+EFI K+  C PIA+++ F  +KLG ADLVEEV+   G ++VK+TG + 
Sbjct: 316 ILAVKDIERDEVEFICKSTGCKPIADIDSFTEDKLGSADLVEEVN-SSGSRMVKVTGTKS 374

Query: 806 MGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAK 627
            G+T SV+VRG+N L++DEAERSLHDALCV+RCLV K+ LIAGGGA EIE++ QL   ++
Sbjct: 375 AGKTVSVVVRGANSLILDEAERSLHDALCVIRCLVKKKALIAGGGAAEIEIASQLAKQSR 434

Query: 626 VLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQIT 447
            L G E  C K+FA+++EVIP TLAENAGLN I +VT+LR+RH  GE NAG++++ G + 
Sbjct: 435 ALSGTEAICWKAFADAMEVIPTTLAENAGLNSIKVVTDLRHRHENGEKNAGVSIKSGGVN 494

Query: 446 -NILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
            NI +ENV+QPLLVSTSAI LA E V+MIL+IDDI   R
Sbjct: 495 PNIAKENVLQPLLVSTSAIELAAETVKMILRIDDIALSR 533



>pir|T49506|T49506 probable chaperonin CCT4 [imported] - Neurospora
           crassa
          Length = 534

 Score =  261 bits (668), Expect = 1e-68
 Identities = 130/219 (59%), Positives = 171/219 (78%), Gaps = 1/219 (0%)
 Frame = -1

Query: 986 IMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQD 807
           I+ +KD+ERDE+EFI K+  C PIA+++ F  +KLG ADLVEEV+   G ++VK+TG + 
Sbjct: 317 ILAVKDIERDEVEFICKSTGCKPIADIDSFTEDKLGSADLVEEVN-SSGSRMVKVTGTKS 375

Query: 806 MGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAK 627
            G+T SV+VRG+N L++DEAERSLHDALCV+RCLV K+ LIAGGGA EIE++ QL   ++
Sbjct: 376 AGKTVSVVVRGANSLILDEAERSLHDALCVIRCLVKKKALIAGGGAAEIEIASQLAKQSR 435

Query: 626 VLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQIT 447
            L G E  C K+FA+++EVIP TLAENAGLN I +VT+LR+RH  GE NAG++++ G + 
Sbjct: 436 ALSGTEAICWKAFADAMEVIPTTLAENAGLNSIKVVTDLRHRHENGEKNAGVSIKSGGVN 495

Query: 446 -NILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
            NI +ENV+QPLLVSTSAI LA E V+MIL+IDDI   R
Sbjct: 496 PNIAKENVLQPLLVSTSAIELAAETVKMILRIDDIALSR 534



>sp|P39078|TCPD_YEAST T-complex protein 1, delta subunit
           (TCP-1-delta) (CCT-delta).>pir|S67690|S67690 chaperonin
           CCT4, cytosolic - yeast (Saccharomyces
           cerevisiae)>gb:SCYDL143W_1711716 S.cerevisiae chromosome
           IV reading frame ORF YDL143w.
          Length = 528

 Score =  261 bits (668), Expect = 1e-68
 Identities = 131/223 (58%), Positives = 176/223 (78%), Gaps = 2/223 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  IMV+KD+ER+EIEF++K L C PIA++E F  ++LG ADLVEE+   DG KIV++TG
Sbjct: 307 KLNIMVVKDIEREEIEFLSKGLGCKPIADIELFTEDRLGSADLVEEID-SDGSKIVRVTG 365

Query: 815 IQDMGR--TASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQL 642
           I++     T SV++RG+N ++IDE ERSLHDALCV+RCLV +R LIAGGGAPEIE+SR+L
Sbjct: 366 IRNNNARPTVSVVIRGANNMIIDETERSLHDALCVIRCLVKERGLIAGGGAPEIEISRRL 425

Query: 641 GAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVR 462
              A+ ++G++ +  + FA +LEVIP TLAENAGLN I +VTELR++H  GE+N GI+VR
Sbjct: 426 SKEARSMEGVQAFIWQEFASALEVIPTTLAENAGLNSIKVVTELRSKHENGELNDGISVR 485

Query: 461 KGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           +   TN  EE+++QP+LVSTSAI+LA+ECV+ IL+IDDI   R
Sbjct: 486 RSGTTNTYEEHILQPVLVSTSAITLASECVKSILRIDDIAFSR 528



>gb:CR380955_1651675 Candida glabrata strain CBS138 chromosome I
           complete sequence.
          Length = 529

 Score =  261 bits (666), Expect = 2e-68
 Identities = 130/223 (58%), Positives = 177/223 (79%), Gaps = 2/223 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  IMVIKD+ER+EIEF++K+L C PI++VE F  ++LG ADLVEE+   DG KIVK +G
Sbjct: 308 KLGIMVIKDIEREEIEFLSKSLGCKPISDVELFTEDRLGSADLVEEID-SDGTKIVKFSG 366

Query: 815 IQDMGR--TASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQL 642
           ++ +    T SV++RG+N +++DE ERSLHDALCV+RCLV +R LIAGGGAPEIE+SR+L
Sbjct: 367 VKGVNAKPTVSVIIRGANSMILDETERSLHDALCVIRCLVKERGLIAGGGAPEIEISRRL 426

Query: 641 GAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVR 462
              ++ ++G+E Y  + FA++LEVIP TLAENAGLN I ++TELR+RH  G++N GI+VR
Sbjct: 427 ERESRSMEGVEAYIWQEFAQALEVIPTTLAENAGLNSIKVITELRSRHENGDVNEGISVR 486

Query: 461 KGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           +   TN  EE+++QP+LVSTSAI+LA+ECV+ IL+IDDI   R
Sbjct: 487 RSGTTNTYEEHILQPVLVSTSAITLASECVKSILRIDDITFSR 529



>pir|T43649|T43649 chaperonin CCT4 - fission yeast
           (Schizosaccharomyces pombe)>gb:AF050465_1764162
           Schizosaccharomyces pombe chaperonin subunit Cct4 (CCT4)
           mRNA, complete cds.
          Length = 525

 Score =  257 bits (656), Expect = 3e-67
 Identities = 135/222 (60%), Positives = 171/222 (77%), Gaps = 1/222 (0%)
 Frame = -1

Query: 995 KXKIMVIKDV-ERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKIT 819
           K KIMVIK+V ERDE+EFI K+  C PIA++E F  +KLGHADLVEE S   G KIVK +
Sbjct: 307 KLKIMVIKEVIERDEVEFICKSTGCKPIADIESFAEDKLGHADLVEETS-SSGEKIVKFS 365

Query: 818 GIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLG 639
           G+++ G+T S+L RG+N L ++EAERSLHDALCV+RCLV +R LIAGGG+PEIE +++L 
Sbjct: 366 GVKNAGKTVSILCRGANLLTLEEAERSLHDALCVIRCLVKQRALIAGGGSPEIEAAQRLL 425

Query: 638 AWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRK 459
             A+ L+G E  C+ +F+E+LE+IP TLAENAGLN I IVTELR  + + +   G NVRK
Sbjct: 426 EHARQLEGREAICIGAFSEALEIIPVTLAENAGLNAIRIVTELRKSYLRED--CGYNVRK 483

Query: 458 GQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           G +TNILEENV+QPLLV+ SAI LA E  +MI+KIDDI   R
Sbjct: 484 GIVTNILEENVLQPLLVNISAIQLAAETTKMIMKIDDITLAR 525



>gb:CR382134_1667094 Debaryomyces hansenii chromosome B of strain
           CBS767 of Debaryomyces hansenii.
          Length = 533

 Score =  256 bits (654), Expect = 5e-67
 Identities = 131/223 (58%), Positives = 175/223 (78%), Gaps = 2/223 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  IMVIKD+ERDEIEF++K   C PIA++++F  ++LG AD+VEE+    G +IVKI G
Sbjct: 312 KLNIMVIKDIERDEIEFLSKATGCKPIADIDNFTEDRLGSADVVEEIE-SSGSRIVKIDG 370

Query: 815 I--QDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQL 642
           +  +++  T S++ RG+NQLV+DE ERS+HDALCVVRCLV ++ LIAGGGAPEIE+SR L
Sbjct: 371 VSAKNVKPTVSIVCRGANQLVLDETERSIHDALCVVRCLVKEKALIAGGGAPEIEVSRVL 430

Query: 641 GAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVR 462
            + A  L G+E +  + FA++LEVIP TLAENAGLN I +VT+LRNRHA GE NAGI+VR
Sbjct: 431 MSEANKLSGVEQFVYQEFAQALEVIPTTLAENAGLNSINVVTDLRNRHANGEKNAGISVR 490

Query: 461 KGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           +   +N  +E+V+QP+LVS+SAI+LA+ECV+ IL+IDDI   R
Sbjct: 491 RSGASNTYDEHVLQPVLVSSSAITLASECVKSILRIDDIAFSR 533



>gb:LMFL3856_1388022 Leishmania major Friedlin chromosome 21 cosmid
            L3856.
          Length = 551

 Score =  253 bits (647), Expect = 3e-66
 Identities = 125/232 (53%), Positives = 174/232 (75%), Gaps = 11/232 (4%)
 Frame = -1

Query: 995  KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
            K KIMV+ D+ER++I+FITKTL C+P+AN+E+   +K GHA  V E      GK++KI G
Sbjct: 320  KMKIMVVTDIERNDIDFITKTLGCMPVANLENLTKDKFGHAKTVIEEGT-PSGKVIKIMG 378

Query: 815  IQD----------MGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAP 666
            +Q            G+T    +RGSN L+++EAER+LHD+LCV+R +V KR ++ GG A 
Sbjct: 379  VQPPPPSSLNHELFGKTVCFFLRGSNSLMLEEAERALHDSLCVIRSIVKKRAIMPGGAAG 438

Query: 665  EIELSRQLGAWAKV-LQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQG 489
            EIE+  QLG +A+   +GM+ +C++++A++ E+IPYTLAENAG+ PI+IVTELRN HA G
Sbjct: 439  EIEVCMQLGKYARERAEGMQTFCMRAYADAFEIIPYTLAENAGMQPISIVTELRNAHASG 498

Query: 488  EINAGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
             +N+G+NVRKG +T+++EENVVQPLLVSTSA+ LA+E V MILKIDDI+  R
Sbjct: 499  HVNSGVNVRKGCVTDMVEENVVQPLLVSTSAVRLASEAVMMILKIDDIIMTR 550



>gb:CR382126_1658571 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 530

 Score =  252 bits (643), Expect = 9e-66
 Identities = 127/223 (56%), Positives = 173/223 (77%), Gaps = 2/223 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  IMV++D+ERDE+EF++K+L C PI++VE F  ++LG AD+VEEV   DG  IV ITG
Sbjct: 309 KLGIMVVRDIERDEVEFLSKSLGCKPISDVELFTEDRLGSADVVEEVE-SDGSNIVTITG 367

Query: 815 IQDMGR--TASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQL 642
           ++   +  T SV++RG+N +V+DE ERSLHDALCV+RCLV +R LIAGGGAPEIE+S +L
Sbjct: 368 VKTTNKNPTVSVVIRGANNMVLDETERSLHDALCVIRCLVKERALIAGGGAPEIEVSYRL 427

Query: 641 GAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVR 462
              A+ ++G+E +  + +AE+LEVIP TLAENAGLN + +VTELR RH  GE N+GI+VR
Sbjct: 428 MKEARTMEGVEAFVWQEYAEALEVIPTTLAENAGLNSLNVVTELRLRHENGESNSGISVR 487

Query: 461 KGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           +   +N  E++++QP+LVSTSAI LA+ECV+ IL+IDDI   R
Sbjct: 488 RSGTSNTYEDHILQPVLVSTSAIRLASECVKSILRIDDITFSR 530



>gb:AF226717_1252679 Trichomonas vaginalis chaperonin subunit delta
           CCTdelta (Cctd) gene, complete cds.
          Length = 536

 Score =  234 bits (598), Expect = 2e-60
 Identities = 113/221 (51%), Positives = 169/221 (76%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+V+KD++R+E++F+ +T+ C PIA+VE   A+KLG A+ VEEV+   GG I+KI G
Sbjct: 317 KKGIIVVKDIDREEVDFVCRTIGCQPIASVEGLSADKLGFAETVEEVTTA-GGAIIKIMG 375

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
           ++ + +T +VL+RGSN+L+I EAERSLHDALCV+R LV +R+L+ GGGAPE+EL+ +L  
Sbjct: 376 LKKVSKTVTVLLRGSNELIIGEAERSLHDALCVIRSLVYERYLLPGGGAPEVELAIKLAK 435

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
            A  + G  G+C+++FA+SL+++PYTLAENAGL P+ +VT+LR  H+ G++  G++V   
Sbjct: 436 KADEIGGEIGHCIRAFADSLDIVPYTLAENAGLAPLDVVTQLREAHSSGKMYYGVSVVAC 495

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
              ++ EE V+QP LV+ SA++ A+E VRMILK+DDI+  R
Sbjct: 496 GPADMKEEEVLQPYLVTKSAVTFASETVRMILKVDDILATR 536



>gb:AY223304_1176765 Schistosoma japonicum clone ZZD584 mRNA
           sequence.
          Length = 248

 Score =  227 bits (579), Expect = 2e-58
 Identities = 113/195 (57%), Positives = 152/195 (77%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KIMV+KD+ER E+EFI KTL+C+PIA+++HF  E +G A LVEE         V ITG
Sbjct: 57  KMKIMVVKDIERTEVEFICKTLHCIPIASLDHFNPEYMGSASLVEESEAT--AHCVHITG 114

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
           I++ GRT S+LVRGSN+L++DEAERSLHDALCV+RCLV +R +I+GGGAPEIE++++L A
Sbjct: 115 IENRGRTMSILVRGSNKLMLDEAERSLHDALCVIRCLVKRRAMISGGGAPEIEIAQKLAA 174

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A    G++ YC+++FA++ EVIPYTLAENAGL+PI  VTELR    +G+    INVR G
Sbjct: 175 FANTTPGLDQYCLRAFADAFEVIPYTLAENAGLSPIQTVTELRACTLKGK-KCWINVRTG 233

Query: 455 QITNILEENVVQPLL 411
            + +IL +NV+QP+L
Sbjct: 234 AVVDILAQNVIQPML 248



>gb:CR382132_1665795 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 527

 Score =  221 bits (563), Expect = 2e-56
 Identities = 114/221 (51%), Positives = 160/221 (72%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  IMVIKD+ERD+IEFI+++    P+A++E F  +KLG  DLVEEV    G K V+ + 
Sbjct: 310 KLNIMVIKDIERDDIEFISRSTGAKPVADIEAFTEDKLGSCDLVEEVE-SSGSKTVRFSS 368

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++   T S+LVRG+N LVIDE ERSLHDALCV+R L     L+ GGGA E+++++ +G 
Sbjct: 369 -REGSNTVSILVRGANDLVIDETERSLHDALCVLRSLFRVPALVPGGGACEVQVAQVIGK 427

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
            ++ + G    C + F+ ++ VIP TLAENAGLNP+ +VTELR RH +GE+NAGI+VR+G
Sbjct: 428 ESRAMDGASAICYEEFSNAMLVIPTTLAENAGLNPVNVVTELRVRHEKGEVNAGISVRRG 487

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
             + ++EE+V+QP LV+TSAI+LA EC + +L+IDDI   R
Sbjct: 488 -TSIMVEEHVIQPALVTTSAITLAAECAKGLLRIDDIAFSR 527



>pir|E90086|E90086 t-complex protein 1, delta SU [imported] -
           Guillardia theta nucleomorph>gb:AF165818_1773774
           Guillardia theta nucleomorph chromosome 1, complete
           sequence.
          Length = 519

 Score =  181 bits (458), Expect = 3e-44
 Identities = 96/220 (43%), Positives = 144/220 (65%), Gaps = 2/220 (0%)
 Frame = -1

Query: 989 KIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIV--KITG 816
           KI+VIKDVERDEI +++++L C+PI ++E    +KLG   LVEE    DG  I   KI+ 
Sbjct: 302 KILVIKDVERDEISYLSESLGCIPIVDIESISEKKLGIVRLVEEKFFEDGSLIFFKKISI 361

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
              +  T  +LVR SN +++DEAERSL DAL V+R ++ +R+ I GGG  EIE+S  L  
Sbjct: 362 SYCLRNT--ILVRASNAVLLDEAERSLIDALSVMRSIIRRRYFIPGGGTVEIEISSCLNQ 419

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           + K L G++  CV+SF  ++E IPY L+EN+G+ PI I+++L+  H  G+   GI+ RK 
Sbjct: 420 FQKTLTGIDVMCVESFRRTIETIPYVLSENSGMEPIQIISKLKEFHKNGKKFYGIDARKN 479

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTV 336
           +I N L+  ++ PLLV TS ++L+ E    + KID+ + +
Sbjct: 480 KIVNALDSRIISPLLVFTSMLNLSIEFAIQMFKIDEFLII 519



>sp|P50016|THS_METKA Thermosome subunit (Chaperonin-like complex)
           (CLIC).>pir|S68687|S68687 thermosome - Methanopyrus
           kandleri>gb:MKDNATHS_144252 M.kandleri DNA for ths
           gene.>gb:AE010389_262638 Methanopyrus kandleri AV19
           section 88 of 157 of the complete
           genome.>gb:AE009439_903419 Methanopyrus kandleri AV19,
           complete genome.
          Length = 545

 Score =  178 bits (451), Expect = 2e-43
 Identities = 87/221 (39%), Positives = 148/221 (66%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++ V++ +++ + +      + N++    E LG A++VEE  +  G K++ + G
Sbjct: 309 KKGILAVRRVKKSDMQKLARATGARIVTNIDDLSEEDLGEAEVVEEKKVA-GDKMIFVEG 367

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            +D  +  ++L+RG  + V+DEAER++ DA+ VV   +    ++AGGGAPE+E++RQL  
Sbjct: 368 CKDP-KAVTILIRGGTEHVVDEAERAIEDAIGVVAAALEDGKVVAGGGAPEVEVARQLRD 426

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A  ++G E   V++FA++LE+IP TLAEN+GL+PI ++ +LR +H  G++ AGI+V  G
Sbjct: 427 FADGVEGREQLAVEAFADALEIIPRTLAENSGLDPIDVLVQLRAKHEDGQVTAGIDVYDG 486

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
            + ++LEE VV+PL V T A++ ATE   MIL+IDD++  R
Sbjct: 487 DVKDMLEEGVVEPLRVKTQALASATEAAEMILRIDDVIAAR 527



>gb:AE013337_291426 Methanosarcina mazei strain Goe1, section 119 of
           379 of the complete genome.>gb:AE008384_965535
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 542

 Score =  174 bits (441), Expect = 2e-42
 Identities = 92/218 (42%), Positives = 143/218 (65%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I  ++ V++ +++ +++      I N++      LG+A +VEE  +  G ++  +TG
Sbjct: 305 KAGIFAMRRVKKSDMDKLSRATGGRIITNLDEIDESDLGYAGMVEEKDV-TGSRMTFVTG 363

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            +D  +T S+L+RG  + V+D  ER+L DAL VV   +  + ++ GGG+PEIELS +L  
Sbjct: 364 CKD-SKTTSILLRGGTEHVVDGLERALEDALRVVGVALEDQKIVVGGGSPEIELSLRLKE 422

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A  L+G E   V  FAESLEVIP TLAENAGL+PI ++ E+R++H +G   AG+NV KG
Sbjct: 423 YAATLKGREQLAVTKFAESLEVIPQTLAENAGLDPIDMLVEMRSQHEKGNKRAGLNVYKG 482

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           +I ++ E NVV+PL + T AI+ ATE   M+L+IDD++
Sbjct: 483 KIEDMFENNVVEPLRIKTQAINAATEAAIMVLRIDDVI 520



>gb:AE011161_269691 Methanosarcina acetivorans str. C2A, section 506
           of 534 of the complete genome.>gb:AE010299_910250
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 543

 Score =  172 bits (437), Expect = 7e-42
 Identities = 90/218 (41%), Positives = 142/218 (65%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I  ++ V++ +++ +++      I N++      +G+A LVEE  +  G ++  +TG
Sbjct: 305 KAGIFAMRRVKKSDMDKLSRATGARVITNLDEIEEADIGYAGLVEEKDV-TGSRMTFVTG 363

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            +D  +T S+L+RG  + V+D  ER+L DAL VV   +  + ++ GGG+PE+EL+ +L  
Sbjct: 364 CKD-SKTTSILLRGGTEHVVDGLERALEDALRVVGVALEDQKIVVGGGSPEVELALRLKE 422

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A  L+G E   V  FAESLEVIP TLAENAGL+PI ++ E+R++H +G   AG+NV  G
Sbjct: 423 YAATLKGREQLAVMKFAESLEVIPQTLAENAGLDPIDMLVEMRSQHEKGNKRAGLNVYTG 482

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           +I ++ E NVV+PL + T AI+ ATE   MIL+IDD++
Sbjct: 483 KIEDMFENNVVEPLRIKTQAINAATEAAIMILRIDDVI 520



>sp|O28045|THSA_ARCFU Thermosome alpha subunit (Thermosome subunit
           1) (Chaperonin alpha subunit).>pir|F69529|F69529
           thermosome, subunit alpha (thsA) homolog - Archaeoglobus
           fulgidus>gb:AE000950_29673 Archaeoglobus fulgidus DSM
           4304 section 157 of 172 of the complete
           genome.>gb:AE000782_976114 Archaeoglobus fulgidus DSM
           4304 complete genome.
          Length = 545

 Score =  167 bits (423), Expect = 3e-40
 Identities = 90/221 (40%), Positives = 140/221 (63%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++ V++ +IE I K      I ++    +  LG A+LVEE  +GD  K+V I G
Sbjct: 307 KAGILAVRRVKQSDIEKIAKACGAKIITDLREITSADLGEAELVEERKVGDE-KMVFIEG 365

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  ++L+RG ++ V+DE ERSL DA+ VV+  +    ++AGGGAPEIE++ ++  
Sbjct: 366 CKNP-KAVTILIRGGSEHVVDEVERSLQDAIKVVKTALESGKVVAGGGAPEIEVALKIRD 424

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           WA  L G E    ++FA +LEVIP  LAEN+GL+PI I+ ELR  H +G+   G++V  G
Sbjct: 425 WAPTLGGREQLAAEAFASALEVIPRALAENSGLDPIDILVELRKAHEEGKTTYGVDVFSG 484

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           ++  + E  V++PL V T AI+ ATE   MIL+IDD++  +
Sbjct: 485 EVACMKERGVLEPLKVKTQAITSATEVAIMILRIDDVIAAK 525



>gb:AE017199_402975 Nanoarchaeum equitans Kin4-M, complete genome.
          Length = 540

 Score =  166 bits (420), Expect = 7e-40
 Identities = 89/218 (40%), Positives = 139/218 (63%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I  ++ V++ ++E + K      + NVE    E LG A+LVEE  +  G  +V +TG
Sbjct: 306 KYGIFAVRRVKKSDMEKLAKATGARIVTNVEDLTPEDLGEAELVEERKVA-GESMVFVTG 364

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  R  ++L+RG  + ++DE ER+L DA+  V   +    ++AGGGA E+EL+++L  
Sbjct: 365 CKNP-RAVTILIRGGTEHIVDEIERALTDAMKDVAVALKDGKVVAGGGAVEVELAKRLRE 423

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           WA+ L   E      FA+SLE+IP TLAENAGL+PI I+ ELR+RH +GE  AG++V +G
Sbjct: 424 WAQQLPSKEQLAALKFADSLEIIPQTLAENAGLDPIEIMAELRSRHEKGEKWAGVDVFEG 483

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           ++ ++ E+ V++P  V + AI  ATE   MIL+IDD++
Sbjct: 484 KVADMWEKGVIEPFRVKSQAIKSATEAAIMILRIDDVI 521



>gb:AE013372_291709 Methanosarcina mazei strain Goe1, section 154 of
           379 of the complete genome.>gb:AE008384_965818
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 551

 Score =  163 bits (412), Expect = 6e-39
 Identities = 89/218 (40%), Positives = 139/218 (63%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I  ++ V++ ++E + +      I N++    E LG A LVEE  +G G  +  +TG
Sbjct: 303 KAGIFAVRRVKKSDMEKLARATGGKLITNLDEIVPEDLGFAKLVEEKKVG-GDSMTFVTG 361

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
             D  +  ++L+RG  + V+D  + +L DAL VV   +    L+AGGG+PE+E++ +L  
Sbjct: 362 C-DNPKAVTILLRGGTEHVVDSIDSALEDALRVVGVAIEDEKLVAGGGSPEVEVALRLQE 420

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A  L+G E   VK+++E+LEVIP TLAENAGL+PI ++ ELR++H +G   AG+NV +G
Sbjct: 421 YAATLEGREQLAVKAYSEALEVIPRTLAENAGLDPIDMLMELRSQHEKGMKTAGLNVYEG 480

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           ++ ++ E  VV+PL V T  I+ ATE   MIL+IDDI+
Sbjct: 481 KVVDMWENFVVEPLRVKTQVINAATESAVMILRIDDII 518



>sp|O28821|THSB_ARCFU Thermosome beta subunit (Thermosome subunit 2)
           (Chaperonin beta subunit).>pir|B69431|B69431 thermosome,
           subunit beta (thsB) homolog - Archaeoglobus
           fulgidus>gb:AE001003_30462 Archaeoglobus fulgidus DSM
           4304 section 104 of 172 of the complete
           genome.>gb:AF035826_471436 Archaeoglobus fulgidus
           chaperonin beta subunit gene, complete
           cds.>gb:AE000782_975334 Archaeoglobus fulgidus DSM 4304
           complete genome.
          Length = 545

 Score =  162 bits (411), Expect = 7e-39
 Identities = 87/221 (39%), Positives = 137/221 (61%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  ++ ++ V++ ++E + K      + ++    +E LG A LVEE  +GD  K+V +TG
Sbjct: 307 KAGVLAVRRVKKSDMEKLAKATGAKVLTDLRDISSEDLGEAALVEERKVGDE-KMVFVTG 365

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  ++LVRG  + V++E  R + DA+  V C V    ++ G GAPEIE+S +L  
Sbjct: 366 CKNP-KAVTILVRGGTEHVVEEIARGIEDAVRAVACAVEDGKVVVGAGAPEIEVSLKLRE 424

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           WA  L G E   V++FA +LE+IP TLAENAGL+PI ++ EL+  H +G+  AG++V  G
Sbjct: 425 WAPSLGGREQLAVEAFATALEIIPRTLAENAGLDPIDVLVELKAAHEKGQKYAGVDVDTG 484

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           ++ ++ E  V +PL V T AI  ATE   MIL+IDDI+  +
Sbjct: 485 KVVDMKERGVFEPLRVKTQAIGSATEVAVMILRIDDIIAAK 525



>gb:AE010665_265476 Methanosarcina acetivorans str. C2A, section 10
           of 534 of the complete genome.>gb:AE010299_906035
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 552

 Score =  159 bits (403), Expect = 6e-38
 Identities = 87/218 (39%), Positives = 138/218 (63%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I  I+ V++ ++E + +      I N++    E LG A LVEE  +G G  +  +TG
Sbjct: 303 KAGIFAIRRVKKSDMEKLARATGGKLITNLDEITPEDLGFAKLVEEKKVG-GDSMTFVTG 361

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
             D  +  ++L+RG  + V+D  + +L DAL VV   +    L++GGG+PE+E++ +L  
Sbjct: 362 C-DNPKAVTILLRGGTEHVVDSVDSALEDALRVVGVAIEDEKLVSGGGSPEVEVALRLQE 420

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A  L+G E   VK+++E+LEVIP TLAENAGL+PI ++ ELR++H +G   AG++V +G
Sbjct: 421 YAATLEGREQLAVKAYSEALEVIPRTLAENAGLDPIDMLMELRSQHEKGMKTAGLDVYEG 480

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           ++ ++    VV+PL V T  I+ ATE   MIL+IDDI+
Sbjct: 481 KVVDMWNNFVVEPLRVKTQVINAATESAVMILRIDDII 518



>gb:BA000023_691876 Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 568

 Score =  159 bits (401), Expect = 1e-37
 Identities = 89/219 (40%), Positives = 143/219 (65%), Gaps = 1/219 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++ V+R +IE + K L    I++++    E LG+A+LVEE  +G+  K+V I G
Sbjct: 322 KKGILAVRRVKRSDIEKLEKALGARIISSIKDATPEDLGYAELVEERRVGND-KMVFIEG 380

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  ++L+RGSN + +DEAERS++DAL  +R ++ K  ++AGGGA E EL+ +L  
Sbjct: 381 AKNP-KAVNILLRGSNDMALDEAERSINDALHSLRNVLMKPMIVAGGGAVETELALRLRE 439

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A+ + G E   ++ FAE+LE IP  LAE AG+ PI  + +LR +HA+G INAG++V  G
Sbjct: 440 YARSVGGKEQLAIEKFAEALEEIPMILAETAGMEPIQTLMDLRAKHAKGLINAGVDVMNG 499

Query: 455 QIT-NILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           +I  ++L  NV++P+ V    +  A E    ILKIDD++
Sbjct: 500 KIADDMLALNVLEPVRVKAQVLKSAVEAATAILKIDDLI 538



>sp|O24734|THSA_SULTO Thermosome alpha subunit (Thermosome subunit
           1) (Chaperonin alpha subunit).>pir|JC5616|JC5616 group
           II chaperonin alpha chain - Sulfolobus sp. (strain
           7)>gb:AB001085_271 Sulfolobus sp. DNA for chaperonin
           alpha subunit, complete cds.
          Length = 559

 Score =  159 bits (401), Expect = 1e-37
 Identities = 89/219 (40%), Positives = 143/219 (65%), Gaps = 1/219 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++ V+R +IE + K L    I++++    E LG+A+LVEE  +G+  K+V I G
Sbjct: 313 KKGILAVRRVKRSDIEKLEKALGARIISSIKDATPEDLGYAELVEERRVGND-KMVFIEG 371

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  ++L+RGSN + +DEAERS++DAL  +R ++ K  ++AGGGA E EL+ +L  
Sbjct: 372 AKNP-KAVNILLRGSNDMALDEAERSINDALHSLRNVLMKPMIVAGGGAVETELALRLRE 430

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A+ + G E   ++ FAE+LE IP  LAE AG+ PI  + +LR +HA+G INAG++V  G
Sbjct: 431 YARSVGGKEQLAIEKFAEALEEIPMILAETAGMEPIQTLMDLRAKHAKGLINAGVDVMNG 490

Query: 455 QIT-NILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           +I  ++L  NV++P+ V    +  A E    ILKIDD++
Sbjct: 491 KIADDMLALNVLEPVRVKAQVLKSAVEAATAILKIDDLI 529



>gb:AY254173_602659 Acidianus tengchongenses strain S5 chaperonin
           alpha subunit gene, complete cds.
          Length = 563

 Score =  158 bits (400), Expect = 1e-37
 Identities = 87/219 (39%), Positives = 145/219 (66%), Gaps = 1/219 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++ V+R +IE + K L    I++++    E LG+A+LVEE  +G+  K+V I G
Sbjct: 314 KRGILAVRRVKRSDIEKLEKALGARIISSIKDATPEDLGYAELVEERKVGND-KMVFIEG 372

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  ++L+RGSN + +DEAERS++DAL  +R ++ + +++ GGGA E+ELS +L  
Sbjct: 373 AKNP-KAVNILLRGSNDMALDEAERSINDALYSLRNILMEPYIVPGGGAIELELSARLRE 431

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A+ + G E   ++++A++LE IP  LAE AGL PI+ + +LR RHA+G  N G++V  G
Sbjct: 432 YARSVGGKEQLAIEAYADALEEIPMILAETAGLEPISALMDLRARHAKGLTNCGVDVING 491

Query: 455 Q-ITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           + I +I   NVV+P+ V+   +  ATE    I+KIDD++
Sbjct: 492 KIIDDIYSINVVEPIRVTRQVLKSATEAATSIMKIDDLI 530



>gb:AY596297_634138 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 559

 Score =  157 bits (397), Expect = 3e-37
 Identities = 81/215 (37%), Positives = 131/215 (60%)
 Frame = -1

Query: 986 IMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQD 807
           I+ ++  ++ +IEF+ + L    +++++   AE LGH  +  +    D   +  + G  D
Sbjct: 313 ILAVRRAKKSDIEFLKEVLGARIVSDLDSASAEDLGHGSVTRD----DAEGLFYVEGSGD 368

Query: 806 MGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAK 627
                ++L+RGS   V+DE ER + DAL VV   V+   ++ GGGAPE+E++R+L  +A 
Sbjct: 369 GAHGVTLLLRGSTDHVVDELERGVTDALDVVASTVANGSVLGGGGAPEVEVARRLRDYAD 428

Query: 626 VLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQIT 447
            ++G E   ++SFA++LE+IP TLAENAGL+ I  + +LR  H  G+++AG+NV  G + 
Sbjct: 429 SVEGREQLAIESFADALEIIPRTLAENAGLDSIDTLVDLRAAHEDGDVSAGLNVFSGDVE 488

Query: 446 NILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           N L+  VV+P      AIS A E   ++LKIDDI+
Sbjct: 489 NTLDTGVVEPAHAKRQAISSAAEAANLVLKIDDII 523



>sp|O93624|THS_METTL Thermosome subunit (Chaperonin
           subunit).>pir|T43845|T43845 chaperonin [validated] -
           Methanococcus thermolithotrophicus>gb:AB015435_2548
           Methanococcus thermolithotrophicus gene for chaperonin,
           complete cds.
          Length = 544

 Score =  155 bits (392), Expect = 1e-36
 Identities = 85/220 (38%), Positives = 141/220 (64%), Gaps = 2/220 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++ V++ ++E ++K      + N++  +AE LG A +VEE  +  G  ++ +  
Sbjct: 302 KEGILAVRRVKKSDMEKLSKATGANVVTNIKDLKAEDLGEAGIVEERKIA-GDAMIFVEE 360

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            +   +  ++L+RG+ + VI+E  R++ DA+ VV C +    ++AGGGA EIEL+ +L  
Sbjct: 361 CKHP-KAVTMLIRGTTEHVIEEVARAVDDAIGVVACTIEDGKIVAGGGAAEIELAMKLRD 419

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINA--GINVR 462
           +A+ + G E   V++FA++LEV+P TLAENAGL+ I ++ +LR +HA+G  NA  G+NV 
Sbjct: 420 YAEGVSGREQLAVRAFADALEVVPRTLAENAGLDAIEMLVKLRAKHAEGN-NAYYGLNVF 478

Query: 461 KGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            G + N+ E  VV+PL V T AI  ATE   M+L+IDD++
Sbjct: 479 TGDVENMTENGVVEPLRVKTQAIQSATEATEMLLRIDDVI 518



>gb:AE010290_261541 Pyrococcus furiosus DSM 3638, section 165 of 173
           of the complete genome.>gb:AE009950_902322 Pyrococcus
           furiosus DSM 3638, complete genome.
          Length = 549

 Score =  155 bits (391), Expect = 2e-36
 Identities = 83/218 (38%), Positives = 138/218 (63%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  IM ++ V++ ++E + K      + N+     E LG+A+LVEE  +  G  ++ + G
Sbjct: 307 KYGIMAVRRVKKSDMEKLAKATGAKIVTNIRDLTPEDLGYAELVEERKVA-GESMIFVEG 365

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            Q+  +  ++L+RG  + V+DE ER+L DA+ VV+ ++    ++AGGGAPEIEL+ +L  
Sbjct: 366 CQNP-KAVTILIRGGTEHVVDEVERALEDAIKVVKDILEDGKILAGGGAPEIELAIRLDE 424

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +AK + G E   +++FAE+L+VIP TLAENAGL+PI  + ++   H +     G++V +G
Sbjct: 425 YAKEVGGKEQLAIEAFAEALKVIPRTLAENAGLDPIETLVKVIAAHKEKGPTIGVDVYEG 484

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           +  ++LE  V++PL V   AI  A+E   MIL+IDD++
Sbjct: 485 EPADMLERGVIEPLRVKKQAIKSASEAAIMILRIDDVI 522



>gb:AF181261_486189 Sulfolobus solfataricus TF55-alpha protein
           (TF55-alpha) gene, partial cds.
          Length = 559

 Score =  153 bits (386), Expect = 6e-36
 Identities = 84/219 (38%), Positives = 144/219 (65%), Gaps = 1/219 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++ V+R +IE + K L    I++++    E LG+A+LVEE  +G+  K+V I G
Sbjct: 312 KKGILAVRRVKRSDIEKLEKALGARIISSIKDATPEDLGYAELVEERRVGND-KMVFIEG 370

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            +++ +  ++L+RGSN + +DEAERS++DAL  +R ++ +  ++ GGGA E+EL+ +L  
Sbjct: 371 AKNL-KAVNILLRGSNDMALDEAERSINDALHALRNILLEPVILPGGGAIELELAMKLRE 429

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A+ + G E   +++FA++LE IP  LAE AGL  I+ + +LR RHA+G  N G++V  G
Sbjct: 430 YARSVGGKEQLAIEAFADALEEIPLILAETAGLEAISSLMDLRARHAKGLSNTGVDVIGG 489

Query: 455 QIT-NILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           +I  ++   N+++P+ V +  +  ATE    ILKIDD++
Sbjct: 490 KIVDDVYALNIIEPIRVKSQVLKSATEAATAILKIDDLI 528



>sp|Q9V2S9|THSA_SULSO Thermosome alpha subunit (Thermosome subunit
           1) (Chaperonin alpha subunit) (Thermophilic factor 55
           alpha) (TF55-alpha).>pir|A99237|A99237 hypothetical
           protein thsA [imported] - Sulfolobus
           solfataricus>gb:AE006708_221753 Sulfolobus solfataricus
           P2 section 67 of 272 of the complete
           genome.>gb:AE006641_1107601 Sulfolobus solfataricus P2,
           complete genome.
          Length = 559

 Score =  153 bits (386), Expect = 6e-36
 Identities = 84/219 (38%), Positives = 144/219 (65%), Gaps = 1/219 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++ V+R +IE + K L    I++++    E LG+A+LVEE  +G+  K+V I G
Sbjct: 312 KKGILAVRRVKRSDIEKLEKALGARIISSIKDATPEDLGYAELVEERRVGND-KMVFIEG 370

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            +++ +  ++L+RGSN + +DEAERS++DAL  +R ++ +  ++ GGGA E+EL+ +L  
Sbjct: 371 AKNL-KAVNILLRGSNDMALDEAERSINDALHALRNILLEPVILPGGGAIELELAMKLRE 429

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A+ + G E   +++FA++LE IP  LAE AGL  I+ + +LR RHA+G  N G++V  G
Sbjct: 430 YARSVGGKEQLAIEAFADALEEIPLILAETAGLEAISSLMDLRARHAKGLSNTGVDVIGG 489

Query: 455 QIT-NILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           +I  ++   N+++P+ V +  +  ATE    ILKIDD++
Sbjct: 490 KIVDDVYALNIIEPIRVKSQVLKSATEAATAILKIDDLI 528



>pir|S59859|S59859 rosettasome alpha chain - Sulfolobus shibatae
          Length = 560

 Score =  152 bits (384), Expect = 1e-35
 Identities = 83/219 (37%), Positives = 143/219 (65%), Gaps = 1/219 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++ V+R +IE + K L    I++++    + LG+A+LVEE  +G+  K+V I G
Sbjct: 312 KKGILAVRRVKRSDIEKLEKALGARIISSIKDATPDDLGYAELVEERRVGND-KMVFIEG 370

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            +++ +  ++L+RGSN + +DEAERS++DAL  +R ++ +  ++ GGGA E+EL+ +L  
Sbjct: 371 AKNL-KAVNILLRGSNDMALDEAERSINDALHALRNILLEPVILPGGGAIELELAMKLRE 429

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A+ + G E   +++FA++LE IP  LAE AGL  I+ + +LR RHA+G  N G++V  G
Sbjct: 430 YARSVGGKEQLAIEAFADALEEIPMILAETAGLEAISALMDLRARHAKGLTNTGVDVIGG 489

Query: 455 QIT-NILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           +I  ++   N+++P+ V    +  ATE    ILKIDD++
Sbjct: 490 KIVDDVYALNIIEPIRVKAQVLKSATEAATAILKIDDLI 528



>gb:AJ627421_527945 Uncultured crenarchaeote genomic fragment 68f19.
          Length = 473

 Score =  152 bits (383), Expect = 1e-35
 Identities = 80/218 (36%), Positives = 136/218 (62%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++ V+  ++  ++K      + N++ F  + LG ADLVEE  + +  K V I G
Sbjct: 219 KEGILAVRRVKESDMSKLSKATGARIVNNLDDFTTKDLGSADLVEERKV-ETDKWVFIEG 277

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  ++LVRG +Q V+DEA+RS+HDAL VV+ ++   F +AGGGAPE  ++ +L  
Sbjct: 278 CRNP-KAVTILVRGGSQRVVDEADRSIHDALMVVKDVLENPFAVAGGGAPEAYVANELRQ 336

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           W+  ++G     ++ FA++L+ IP +LA NAG++PI  +T LR + ++G    GI+V   
Sbjct: 337 WSSNMEGRGQLAIQKFADALDTIPLSLAVNAGMDPIDTMTTLRAKQSKGAKWTGIDVLNT 396

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            + ++ ++NV++PL V    I  ATE   MIL+IDD++
Sbjct: 397 VVADMQKQNVIEPLAVKQQIIKSATEAANMILRIDDVI 434



>sp|P46219|THSA_SULSH Thermosome alpha subunit (Thermosome subunit
           1) (Chaperonin alpha subunit) (Thermophilic factor 55
           alpha) (TF55-alpha) (Ring complex alpha subunit)
           (Thermophilic factor 56).>gb:SSOTF56A_190729 Sulfolobus
           shibatae thermophilic factor 56 (tf56) gene, complete
           cds.
          Length = 560

 Score =  152 bits (383), Expect = 1e-35
 Identities = 83/219 (37%), Positives = 143/219 (65%), Gaps = 1/219 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++ V+R +IE + K L    I++++    + LG+A+LVEE  +G+  K+V I G
Sbjct: 312 KKGILAVRRVKRSDIEKLEKALGARIISSIKDATPDDLGYAELVEERRVGND-KMVFIEG 370

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            +++ +  ++L+RGSN + +DEAERS++DAL  +R ++ +  ++ GGGA E+EL+ +L  
Sbjct: 371 AKNL-KAVNILLRGSNDMALDEAERSINDALHALRNILLEPVILPGGGAIELELAMKLRE 429

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A+ + G E   +++FA++LE IP  LAE AGL  I+ + +LR RHA+G  N G++V  G
Sbjct: 430 YARSVGGKEQLAIEAFADALEEIPTILAETAGLEAISALMDLRARHAKGLTNTGVDVIGG 489

Query: 455 QIT-NILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           +I  ++   N+++P+ V    +  ATE    ILKIDD++
Sbjct: 490 KIVDDVYALNIIEPIRVKAQVLKSATEAATAILKIDDLI 528



>sp|O30561|THS1_HALVO Thermosome subunit 1 (Heat shock protein
           CCT1).>pir|T48841|T48841 heat shock protein cct1
           [similarity] - Haloferax volcanii>gb:AF010470_468348
           Haloferax volcanii heat shock protein (cct1) gene,
           complete cds.
          Length = 560

 Score =  151 bits (382), Expect = 2e-35
 Identities = 81/218 (37%), Positives = 138/218 (63%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++  +  +++ + +      +++++   A+ LG A  V +  +G G + + +  
Sbjct: 305 KEGILAVRRAKSSDLKRLARATGGRVVSSLDDIEADDLGFAGSVGQKDVG-GDERIFVED 363

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
           ++D  ++ ++++RG  + V+DE ER++ D+L VVR  +    ++ GGGAPE ELS QL  
Sbjct: 364 VED-AKSVTLILRGGTEHVVDELERAIEDSLGVVRTTLEDGKVLPGGGAPETELSLQLRE 422

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A  + G E   V++FAE+L++IP TLAENAGL+PI  + +LR+RH  GE  AG++   G
Sbjct: 423 FADSVGGREQLAVEAFAEALDIIPRTLAENAGLDPIDSLVDLRSRHDGGEFAAGLDAYTG 482

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           ++ ++ EE VV+PL V T AI  ATE   MIL+IDD++
Sbjct: 483 EVIDMEEEGVVEPLRVKTQAIESATEAAVMILRIDDVI 520



>pir|T45135|T45135 chaperone protein thsA [imported] - Pyrodictium
           occultum>gb:PO6549_159070 Pyrodictium occultum thsA
           gene.
          Length = 557

 Score =  151 bits (381), Expect = 2e-35
 Identities = 84/219 (38%), Positives = 143/219 (65%), Gaps = 1/219 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  IM ++ V+R ++E +        ++++   + E LG A LVEE  +G+  K+V I G
Sbjct: 322 KKGIMAVRRVKRSDLEKLEYATGGRIVSSLRDLKPEDLGFAKLVEERKVGND-KMVFIEG 380

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
             +  +  ++L+RG+N +V+DEAERSL+DAL V+R ++ K  ++ GGGA E+EL+ +L  
Sbjct: 381 CPNP-KAVTILLRGANDMVLDEAERSLNDALHVLRNVLRKPLIVPGGGAVEVELAMRLRK 439

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A+ L G E   V+++A++LE IP  LAE+AG++ +  + +LR  HA+G++ AGI+  +G
Sbjct: 440 YAESLGGKEQLAVEAYADALEEIPMVLAESAGMDALQALMDLRRLHAEGKVFAGIDAVEG 499

Query: 455 QI-TNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           +I  ++ + NV++P+LV    +  ATE    ILKIDD++
Sbjct: 500 KIEEDMTKVNVIEPILVKEQVLKSATEAATAILKIDDVI 538



>sp|Q9V2T5|THSA_SULAC Thermosome alpha subunit (Thermosome subunit
           1) (Chaperonin alpha subunit) (Thermophilic factor 55
           alpha) (TF55-alpha) (Fragment).>gb:AF149923_483535
           Sulfolobus acidocaldarius chaperonin alpha subunit gene,
           partial cds.
          Length = 490

 Score =  150 bits (380), Expect = 3e-35
 Identities = 86/214 (40%), Positives = 138/214 (64%), Gaps = 1/214 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++ V+R +IE + K L    I++++    E LG+A+LVEE  +G+  K+V I G
Sbjct: 279 KKGILAVRRVKRSDIEKLEKALGARIISSIKDATPEDLGYAELVEERRIGND-KMVFIEG 337

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  R  ++L+RGSN + +DEAERSL+DAL  +R ++ K  ++AGGGA E EL+ +L  
Sbjct: 338 AKNP-RAVNILLRGSNDMALDEAERSLNDALHSLRNVLMKPMIVAGGGAVESELALRLRE 396

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A+ + G E   ++ FAE+LE IP  LAE AG+ PI  + +LR RHA+G +N+GI+   G
Sbjct: 397 YARSVGGKEQLAIEKFAEALEEIPMILAETAGMEPIQALMDLRARHAKGLVNSGIDAVNG 456

Query: 455 QITNILEE-NVVQPLLVSTSAISLATECVRMILK 357
           +I + + + NV++P+ V +  +  A E    ILK
Sbjct: 457 KIADDMTKINVIEPVRVKSQVLKSAVEAATAILK 490



>gb:AY283768_606340 Thermococcus litoralis thermosome alpha subunit
           gene, complete cds.
          Length = 544

 Score =  150 bits (379), Expect = 4e-35
 Identities = 80/218 (36%), Positives = 136/218 (62%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++ V++ ++E + K      + NV     + LG+A+LVEE  +  G  +V + G
Sbjct: 307 KAGILAVRRVKKSDMEKLAKATGAKIVTNVRDLTPDDLGYAELVEERKVA-GENMVFVEG 365

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  ++L+RG  + V+DE ER+L DA+ VV+ +V    ++AGGGA EIEL+ +L  
Sbjct: 366 CKNP-KAVTILIRGGTEHVVDEVERALEDAIKVVKDIVEDGKIVAGGGASEIELAIRLDE 424

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +AK + G E   +++FA++L+VIP TLAENAGL+P+ ++ ++   H       G++V  G
Sbjct: 425 YAKEVGGKEQLAIEAFADALKVIPRTLAENAGLDPVDVLVKVTAAHKDKGATIGVDVFAG 484

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           +  ++LE  V++PL V   AI  A+E   MIL+IDD++
Sbjct: 485 EPADMLERGVIEPLRVKKQAIKSASEAAIMILRIDDVI 522



>sp|Q58405|THS_METJA Thermosome subunit (Chaperonin
           subunit).>pir|F64424|F64424 chaperonin - Methanococcus
           jannaschii>gb:U67542_207107 Methanocaldococcus
           jannaschii DSM 2661 section 84 of 150 of the complete
           genome.>gb:L77117_1099865 Methanocaldococcus jannaschii
           DSM 2661, complete genome.
          Length = 542

 Score =  150 bits (379), Expect = 4e-35
 Identities = 83/220 (37%), Positives = 142/220 (64%), Gaps = 2/220 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++ V++ ++E + K      +  ++    E LG A LVEE  +  G  ++ +  
Sbjct: 304 KKGILAVRRVKKSDMEKLAKATGARIVTKIDDLTPEDLGEAGLVEERKVA-GDAMIFVEQ 362

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            +   +  ++L RGS + V++E  R++ DA+ VV+C + +  ++AGGGA EIEL+++L  
Sbjct: 363 CKHP-KAVTILARGSTEHVVEEVARAIDDAIGVVKCALEEGKIVAGGGATEIELAKRLRK 421

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQ--GEINAGINVR 462
           +A+ + G E   VK+FA++LEVIP TLAEN+GL+PI ++ +LR  H +  GE+  G++V 
Sbjct: 422 FAESVAGREQLAVKAFADALEVIPRTLAENSGLDPIDMLVKLRAAHEKEGGEV-YGLDVF 480

Query: 461 KGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           +G++ ++LE+ VV+PL V T AI  ATE   M+L+IDD++
Sbjct: 481 EGEVVDMLEKGVVEPLKVKTQAIDSATEASVMLLRIDDVI 520



>gb:BA000011_664949 Thermoplasma volcanium GSS1 DNA, complete
           genome.
          Length = 544

 Score =  150 bits (378), Expect = 5e-35
 Identities = 80/221 (36%), Positives = 134/221 (60%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I  ++ V++ +++ + K      ++ ++   A  LG AD VE+V +GD   +  +TG
Sbjct: 305 KEGIYAVRRVKKSDMDKLAKATGATVVSTIDEISASDLGSADRVEQVKVGDD-YMTFVTG 363

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  SVLVRG  + V+DE ERS+ D+L VV   +      AGGGA   E++ +L +
Sbjct: 364 CKNP-KAVSVLVRGETEHVVDEMERSITDSLHVVASALEDGAYTAGGGATAAEIAVRLRS 422

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A+ + G +   ++ FA+++E +P  LAENAGL+PI I+ +LR  HA+G   AG+NV  G
Sbjct: 423 YAQKIGGRQQLAIEKFADAIEEVPRALAENAGLDPIDIILKLRAEHAKGNKYAGVNVFSG 482

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           +I +++   V++P+ V   AI  ATE   MIL+IDD++  +
Sbjct: 483 EIEDMVNNGVIEPIRVGKQAIESATEAAIMILRIDDVIATK 523



>pir|C84373|C84373 thermosome subunit alpha [imported] -
           Halobacterium sp. NRC-1>gb:AE005109_63511 Halobacterium
           sp. NRC-1 section 140 of 170 of the complete
           genome.>gb:AE004437_888430 Halobacterium sp. NRC-1
           complete genome.
          Length = 581

 Score =  150 bits (378), Expect = 5e-35
 Identities = 79/218 (36%), Positives = 134/218 (61%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++  + D+   +++     P++NV    A  LG A  V +  +G G + + +  
Sbjct: 323 KEGILAVRRAKSDDFTRLSRATGATPVSNVNDIEAADLGAAGSVAQKDIG-GDERIFVED 381

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
           +++  ++ ++++RG  + V+DE ER++ D+L VVR  +    ++ GGGAPE EL+ QL  
Sbjct: 382 VEE-AKSVTLILRGGTEHVVDEVERAIEDSLGVVRVTLEDGQVMPGGGAPETELAMQLRD 440

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A  + G E   V++FA++LEVIP TLAENAG +PI  + +LR++H  G+  AG++   G
Sbjct: 441 FADSVGGREQLAVEAFADALEVIPRTLAENAGHDPIDSLVDLRSQHDGGDTEAGLDAYNG 500

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            + ++  E +V+PL V T AI  ATE   MIL+IDD++
Sbjct: 501 DVIDMESEGIVEPLRVKTQAIESATEAATMILRIDDVI 538



>sp|Q9HN70|THSA_HALN1 Thermosome alpha subunit (Thermosome subunit
           1) (Chaperonin alpha subunit).
          Length = 562

 Score =  150 bits (378), Expect = 5e-35
 Identities = 79/218 (36%), Positives = 134/218 (61%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++  + D+   +++     P++NV    A  LG A  V +  +G G + + +  
Sbjct: 304 KEGILAVRRAKSDDFTRLSRATGATPVSNVNDIEAADLGAAGSVAQKDIG-GDERIFVED 362

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
           +++  ++ ++++RG  + V+DE ER++ D+L VVR  +    ++ GGGAPE EL+ QL  
Sbjct: 363 VEE-AKSVTLILRGGTEHVVDEVERAIEDSLGVVRVTLEDGQVMPGGGAPETELAMQLRD 421

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A  + G E   V++FA++LEVIP TLAENAG +PI  + +LR++H  G+  AG++   G
Sbjct: 422 FADSVGGREQLAVEAFADALEVIPRTLAENAGHDPIDSLVDLRSQHDGGDTEAGLDAYNG 481

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            + ++  E +V+PL V T AI  ATE   MIL+IDD++
Sbjct: 482 DVIDMESEGIVEPLRVKTQAIESATEAATMILRIDDVI 519



>gb:AE009922_257428 Pyrobaculum aerophilum strain IM2 section 177 of
           201 of the complete genome.>gb:AE009441_900054
           Pyrobaculum aerophilum strain IM2 complete genome.
          Length = 553

 Score =  149 bits (377), Expect = 6e-35
 Identities = 88/218 (40%), Positives = 131/218 (60%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++ V+R +IE + +      I +++  + E LG A LVEE  +G+  K+V +  
Sbjct: 309 KKGILAVRRVKRSDIEKLARATGAKIITSIKDAKPEDLGTAGLVEERKVGEE-KMVFVEE 367

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
           I +  R  ++LVRG +  ++DE ERSL DAL V R L  +  ++ GGGA E+E++R++  
Sbjct: 368 IPNP-RAVTILVRGGSDRILDEVERSLQDALHVSRDLFREPKIVPGGGAFEVEVARRVRE 426

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A+ L G E      FA++LE IP  LA  AGL+P+  + ELR RH  GEI AG++V  G
Sbjct: 427 FARKLPGKEQLAALKFADALEHIPTILALTAGLDPVDAIAELRRRHDNGEITAGVDVHGG 486

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           +I ++   NV  PLLV    I  A E   MIL+IDDI+
Sbjct: 487 KIADMAALNVWDPLLVKKQVIKSAVEAAIMILRIDDII 524



>gb:AE009858_256582 Pyrobaculum aerophilum strain IM2 section 113 of
           201 of the complete genome.>gb:AE009441_899208
           Pyrobaculum aerophilum strain IM2 complete genome.
          Length = 549

 Score =  149 bits (377), Expect = 6e-35
 Identities = 85/219 (38%), Positives = 139/219 (63%), Gaps = 1/219 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++ V+R +IE + +      + ++E      LG A LVEE  +GD  K+V +  
Sbjct: 312 KAGILAVRRVKRSDIEKLVRATGARLVTSIEDLTEADLGFAGLVEERRVGDE-KMVFVEQ 370

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  S+LVRG  + ++DEAER+L DAL VV  +V   +++  GGA EIE ++ + A
Sbjct: 371 CKNP-KAVSILVRGGFERLVDEAERNLDDALSVVSDVVEDPYILPAGGAAEIEAAKAVRA 429

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGE-INAGINVRK 459
           +A  + G E Y V++FA +LEVIP  LAENAGL+PI I+TEL ++H Q +    G++V +
Sbjct: 430 FAPKVGGREQYAVEAFARALEVIPKALAENAGLDPIDILTELTHKHEQTDGWKYGLDVYQ 489

Query: 458 GQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           G++ +++   +V+PL V  +A+ +A E   MIL+ID+I+
Sbjct: 490 GKVVDMVSLGLVEPLTVKINALKVAVEAASMILRIDEII 528



>pir|T45139|T45139 chaperone protein thsB [imported] - Pyrodictium
           occultum>gb:PO6550_159071 Pyrodictium occultum thsB
           gene.
          Length = 572

 Score =  149 bits (377), Expect = 6e-35
 Identities = 86/219 (39%), Positives = 134/219 (61%), Gaps = 1/219 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  IM ++ V+R +IE I+K      ++N+E    E LG A LVEE  +G+  K+V I G
Sbjct: 335 KKGIMAVRRVKRSDIEKISKATGAKIVSNIEDLTPEDLGFAKLVEERKVGEN-KMVFIEG 393

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
             +  +  ++++RG  + ++DEAERS+ DA+  V   +    + AGGGA E+ELS+ L  
Sbjct: 394 CPNP-KAVTIVIRGGLERLVDEAERSIQDAMHAVADAIRDGKIFAGGGAVEVELSKYLRE 452

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEIN-AGINVRK 459
            A  + G E   V++FA +LE +P  LAENAGL+P+ I+ +LR  H++ +    GINV  
Sbjct: 453 IAPKIGGKEQLAVEAFARALEGLPMALAENAGLDPVEIMMKLRAAHSKPDGKWYGINVFN 512

Query: 458 GQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           G + N++E  VV+P+ +  +AI   TE   M+L+IDDI+
Sbjct: 513 GNVENMMELGVVEPVSIKANAIKAGTEAATMVLRIDDII 551



>sp|P61111|THSA_PYRKO Thermosome alpha subunit (Thermosome subunit
           1) (Chaperonin alpha subunit).>sp|P61112|THSA_THEK1
           Thermosome alpha subunit (Thermosome subunit 1)
           (Chaperonin alpha subunit).>pir|T43915|T43915 chaperonin
           alpha chain [imported] - Pyrococcus
           kodakaraensis>gb:AB001080_266 Thermococcus sp. DNA for
           chaperonin alpha subunit, complete cds.>gb:AB018432_3335
           Pyrococcus kodakaraensis gene for chaperonin like
           protein alpha subunit, complete cds.>gb:AP006878_575830
           Thermococcus kodakaraensis strain KOD1 DNA, complete
           genome.
          Length = 548

 Score =  149 bits (376), Expect = 8e-35
 Identities = 78/221 (35%), Positives = 140/221 (63%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  IM ++ V++ ++E + K      + NV+    E LG+A++VEE  L  G  ++ + G
Sbjct: 307 KYGIMAVRRVKKSDMEKLAKATGAKIVTNVKDLTPEDLGYAEVVEERKLA-GENMIFVEG 365

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  ++L+RG  + VIDE ER+L DA+ VV+ ++    ++  GGAPEIEL+ +L  
Sbjct: 366 CKNP-KAVTILIRGGTEHVIDEVERALEDAVKVVKDVMEDGAVLPAGGAPEIELAIRLDE 424

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +AK + G E   +++FA++L++IP TLAENAGL+ + ++ ++ + H    +  GI+V +G
Sbjct: 425 YAKQVGGKEALAIENFADALKIIPKTLAENAGLDTVEMLVKVISEHKNRGLGIGIDVFEG 484

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           +  ++LE+ +++PL V   AI  A+E   MIL+IDD++  +
Sbjct: 485 KPADMLEKGIIEPLRVKKQAIKSASEAAIMILRIDDVIAAK 525



>sp|O57762|THS_PYRHO Thermosome subunit (Chaperonin
           subunit).>pir|F71219|F71219 probable thermophilic factor
           - Pyrococcus horikoshii>gb:BA000001_648647 Pyrococcus
           horikoshii OT3 DNA, complete genome.
          Length = 549

 Score =  149 bits (375), Expect = 1e-34
 Identities = 81/218 (37%), Positives = 136/218 (62%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++ V++ ++E + K      + N+     E LG A+LVEE  +  G  ++ + G
Sbjct: 307 KYGILAVRRVKKSDMEKLAKATGAKIVTNIRDLTPEDLGEAELVEERKVA-GENMIFVEG 365

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  ++L+RG  + V+DE ER+L DA+ VV+ ++    +IAGGGA EIELS +L  
Sbjct: 366 CKNP-KAVTILIRGGTEHVVDEVERALEDAIKVVKDILEDGKIIAGGGASEIELSIKLDE 424

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +AK + G E   +++FAE+L+VIP TLAENAGL+PI  + ++   H +     GI+V +G
Sbjct: 425 YAKEVGGKEQLAIEAFAEALKVIPRTLAENAGLDPIETLVKVIAAHKEKGQTIGIDVYEG 484

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           +  +++E  V++P+ V   AI  A+E   MIL+IDD++
Sbjct: 485 EPADMMERGVIEPVRVKKQAIKSASEAAIMILRIDDVI 522



>sp|Q9V2Q7|THS_PYRAB Thermosome subunit (Chaperonin
           subunit).>pir|F75186|F75186 thermosome, chain alpha
           (thsa) PAB2341 - Pyrococcus abyssi  (strain
           Orsay)>gb:CNSPAX01_848780 Pyrococcus abyssi complete
           genome; segment 1/6.
          Length = 550

 Score =  149 bits (375), Expect = 1e-34
 Identities = 81/221 (36%), Positives = 137/221 (61%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++ V++ ++E + K      + N+     E LG A+LVEE  +  G  ++ + G
Sbjct: 307 KYGILAVRRVKKSDMEKLAKATGAKIVTNIRDLTPEDLGEAELVEERKVA-GENMIFVEG 365

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  ++L+RG  + V+DE ER+L DA+ VV+ ++    +IAGGGA EIELS +L  
Sbjct: 366 CKNP-KAVTILIRGGTEHVVDEVERALEDAVKVVKDILEDGKIIAGGGAAEIELSIKLDE 424

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +AK + G E   +++FAE+L+VIP TLAENAGL+PI  + ++   H +     GI+V +G
Sbjct: 425 YAKEVGGKEQLAIEAFAEALKVIPRTLAENAGLDPIETLVKVIAAHKEKGPTIGIDVYEG 484

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           +  +++E  V++P+ V   AI  A+E   MIL+IDD++  +
Sbjct: 485 EPADMMERGVIEPVRVKKQAIKSASEAAIMILRIDDVIAAQ 525



>sp|O24730|THSB_THEK1 Thermosome beta subunit (Thermosome subunit 2)
           (Chaperonin beta subunit).>gb:AB001081_267 Thermococcus
           sp. DNA for chaperonin beta subunit, complete cds.
          Length = 546

 Score =  149 bits (375), Expect = 1e-34
 Identities = 82/218 (37%), Positives = 135/218 (61%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  IM ++ V++ ++E + K      + NV     E LG A+LVE+  +  G  ++ + G
Sbjct: 307 KYGIMAVRRVKKSDMEKLAKATGAKIVTNVRDLTPEDLGEAELVEQRKVA-GENMIFVEG 365

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  ++L+RG  + V+DE ER+L DA+ VV+ +V    ++A GGAPEIELS +L  
Sbjct: 366 CKNP-KAVTILIRGGTEHVVDEVERALEDAVKVVKDIVEDGKIVAAGGAPEIELSIRLDE 424

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +AK + G E   +++FAE+L+VIP TLAENAGL+PI  + ++   H +     G++V +G
Sbjct: 425 YAKEVGGKEQLAIEAFAEALKVIPRTLAENAGLDPIETLVKVIAAHKEKGPTIGVDVFEG 484

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           +  ++LE  V+ P+ V   AI  A+E   MIL+IDD++
Sbjct: 485 EPADMLERGVIAPVRVPKQAIKSASEAAIMILRIDDVI 522



>sp|Q52500|THSB_PYRKO Thermosome beta subunit (Thermosome subunit 2)
           (Chaperonin beta subunit).>pir|S61294|S61294 heat-shock
           protein - Pyrococcus sp.>gb:PYWHSP_162191 Pyrococcus sp.
           KOD1 gene for heat-shock protein, complete
           cds.>gb:AP006878_577455 Thermococcus kodakaraensis
           strain KOD1 DNA, complete genome.
          Length = 546

 Score =  147 bits (372), Expect = 2e-34
 Identities = 81/218 (37%), Positives = 135/218 (61%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  IM ++ V++ ++E + K      + NV     E LG A+LVE+  +  G  ++ + G
Sbjct: 307 KYGIMAVRRVKKSDMEKLAKATGAKIVTNVRDLTPEDLGEAELVEQRKVA-GENMIFVEG 365

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  ++L+RG  + V+DE ER+L DA+ VV+ +V    ++A GGAPEIEL+ +L  
Sbjct: 366 CKNP-KAVTILIRGGTEHVVDEVERALEDAVKVVKDIVEDGKIVAAGGAPEIELAIRLDE 424

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +AK + G E   +++FAE+L+VIP TLAENAGL+PI  + ++   H +     G++V +G
Sbjct: 425 YAKEVGGKEQLAIEAFAEALKVIPRTLAENAGLDPIETLVKVIAAHKEKGPTIGVDVFEG 484

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           +  ++LE  V+ P+ V   AI  A+E   MIL+IDD++
Sbjct: 485 EPADMLERGVIAPVRVPKQAIKSASEAAIMILRIDDVI 522



>pir|C72512|C72512 probable thermosome, subunit APE2072 - Aeropyrum
           pernix  (strain K1)>gb:BA000002_652827 Aeropyrum pernix
           K1 DNA, complete genome.
          Length = 555

 Score =  147 bits (370), Expect = 4e-34
 Identities = 81/222 (36%), Positives = 138/222 (62%), Gaps = 1/222 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++ V+R +IE I +      + ++E  R E LG+A+LVEE  +G+  K+V I G
Sbjct: 321 KKGILAVRRVKRSDIEKIARATGARIVTDIEDLRPEDLGYAELVEERKVGED-KMVFIEG 379

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  ++ ++L+RG  + ++DEAERSLHDAL VV   +    ++AGGGA E E+++ L  
Sbjct: 380 AKNP-KSVTILLRGGFERLVDEAERSLHDALSVVADAIMDGKIVAGGGAVEAEVAKVLYE 438

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEIN-AGINVRK 459
           +A  L G     V++FA ++E +P  LA NAG +PI ++ +LR+ H + E    G+++  
Sbjct: 439 YASKLPGKTQLAVEAFARAVEALPQALAHNAGHDPIEVLVKLRSAHEKPENKWYGVDLDT 498

Query: 458 GQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           G+I ++    V++P+ V  +A+  ATE   +IL+IDD++  R
Sbjct: 499 GEIVDMWSRGVLEPMRVKLNALKAATEVASLILRIDDVIAAR 540



>sp|Q9YA66|THSB_AERPE Thermosome beta subunit (Thermosome subunit 2)
           (Chaperonin beta subunit).
          Length = 548

 Score =  147 bits (370), Expect = 4e-34
 Identities = 81/222 (36%), Positives = 138/222 (62%), Gaps = 1/222 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++ V+R +IE I +      + ++E  R E LG+A+LVEE  +G+  K+V I G
Sbjct: 314 KKGILAVRRVKRSDIEKIARATGARIVTDIEDLRPEDLGYAELVEERKVGED-KMVFIEG 372

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  ++ ++L+RG  + ++DEAERSLHDAL VV   +    ++AGGGA E E+++ L  
Sbjct: 373 AKNP-KSVTILLRGGFERLVDEAERSLHDALSVVADAIMDGKIVAGGGAVEAEVAKVLYE 431

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEIN-AGINVRK 459
           +A  L G     V++FA ++E +P  LA NAG +PI ++ +LR+ H + E    G+++  
Sbjct: 432 YASKLPGKTQLAVEAFARAVEALPQALAHNAGHDPIEVLVKLRSAHEKPENKWYGVDLDT 491

Query: 458 GQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           G+I ++    V++P+ V  +A+  ATE   +IL+IDD++  R
Sbjct: 492 GEIVDMWSRGVLEPMRVKLNALKAATEVASLILRIDDVIAAR 533



>sp|Q53546|THS_DESSY Thermosome subunit (Hyperthermophilic heat
           shock protein) (HHSP).>pir|JC4270|JC4270
           hyperthermophilic heat shock protein - Desulfurococcus
           mobilis>gb:S79557_169184 hyperthermophilic heat shock
           protein [Desulfurococcus, SY, Genomic, 1959 nt].
          Length = 545

 Score =  145 bits (367), Expect = 9e-34
 Identities = 79/218 (36%), Positives = 135/218 (61%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  IM ++ V++ ++E + K      + NV     E LG A+LVE+  +  G  ++ + G
Sbjct: 307 KYGIMAVRRVKKSDMEKLAKATGAKIVTNVRDLTPEDLGEAELVEQRKVA-GENMIFVEG 365

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  ++L+RG  + V+DE ER+L DA+ VV+ +V    ++  GGAPEIEL+ +L  
Sbjct: 366 CKNP-KAVTILIRGGTEHVVDEVERALEDAVKVVKDIVEDGKILPAGGAPEIELAIKLDE 424

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +AK + G E   +++FAE+L+VIP TLAENAGL+P+  + ++   H +     G++V +G
Sbjct: 425 YAKEVGGKEQLAIEAFAEALKVIPRTLAENAGLDPVETLVKVIAAHKEKGPTIGVDVFEG 484

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           +  +++E+ V+ PL V   AI  A+E   MIL+IDD++
Sbjct: 485 EPADMMEKGVIAPLRVPKQAIKSASEAAIMILRIDDVI 522



>pir|C72686|C72686 probable thermosome subunit APE0907 - Aeropyrum
           pernix  (strain K1)>gb:BA000002_651635 Aeropyrum pernix
           K1 DNA, complete genome.
          Length = 557

 Score =  145 bits (366), Expect = 1e-33
 Identities = 79/219 (36%), Positives = 144/219 (65%), Gaps = 1/219 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++ V+R +IE + K      + ++   + E LG+A+LVEE  +G+  K+V I G
Sbjct: 312 KKGILAVRRVKRSDIEKVAKATGAKIVTSLRDLKPEYLGYAELVEERKVGED-KMVFIEG 370

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  ++ ++L+RG+N +++DEAER++ DAL  +R ++ +  ++ GGGA E+EL+ +L  
Sbjct: 371 AKNP-KSVTILLRGANDMLLDEAERNIKDALHGLRNILREPKIVGGGGAVEVELALKLKE 429

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A+ + G +   ++++AE+LE IP  LAE+AG++ +  + +LR+ H+QG   AG+NV +G
Sbjct: 430 FARTVGGKQQLAIEAYAEALETIPTVLAESAGMDALEALLKLRSLHSQGYKFAGVNVLEG 489

Query: 455 QI-TNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           +I  ++ + NV +P+LV    I  A+E    ILKIDD++
Sbjct: 490 KIEEDMTKINVYEPVLVKKQVIKSASEAAISILKIDDVI 528



>sp|Q9YDK6|THSA_AERPE Thermosome alpha subunit (Thermosome subunit
           1) (Chaperonin alpha subunit).
          Length = 554

 Score =  145 bits (366), Expect = 1e-33
 Identities = 79/219 (36%), Positives = 144/219 (65%), Gaps = 1/219 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++ V+R +IE + K      + ++   + E LG+A+LVEE  +G+  K+V I G
Sbjct: 309 KKGILAVRRVKRSDIEKVAKATGAKIVTSLRDLKPEYLGYAELVEERKVGED-KMVFIEG 367

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  ++ ++L+RG+N +++DEAER++ DAL  +R ++ +  ++ GGGA E+EL+ +L  
Sbjct: 368 AKNP-KSVTILLRGANDMLLDEAERNIKDALHGLRNILREPKIVGGGGAVEVELALKLKE 426

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A+ + G +   ++++AE+LE IP  LAE+AG++ +  + +LR+ H+QG   AG+NV +G
Sbjct: 427 FARTVGGKQQLAIEAYAEALETIPTVLAESAGMDALEALLKLRSLHSQGYKFAGVNVLEG 486

Query: 455 QI-TNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           +I  ++ + NV +P+LV    I  A+E    ILKIDD++
Sbjct: 487 KIEEDMTKINVYEPVLVKKQVIKSASEAAISILKIDDVI 525



>gb:AY596297_634100 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 590

 Score =  145 bits (365), Expect = 2e-33
 Identities = 74/215 (34%), Positives = 135/215 (62%)
 Frame = -1

Query: 986 IMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQD 807
           I+ ++  ++ +IE ++++     I+N++   A+ LG A  V +  +  G + + +  ++D
Sbjct: 334 ILAVRRAKKSDIEALSRSTGARIISNIDDIEADDLGFAGSVAQKDIA-GDERIFVEDVED 392

Query: 806 MGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAK 627
             R  ++++RG  + V+DE ER++ D+L VV   +    ++ GGGAPE +L+  L   A 
Sbjct: 393 -ARAVTMILRGGTEHVVDEVERAIEDSLGVVAATLEDGKVLPGGGAPETQLALGLRDHAD 451

Query: 626 VLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQIT 447
            + G E   V++FA++++VIP TLAENAGL+PI  + +LR++H  G + +G++   G++ 
Sbjct: 452 SVGGREQLAVEAFADAIDVIPRTLAENAGLDPIDSLVDLRSKHDGGAVTSGLDAYTGEVV 511

Query: 446 NILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           ++ E+ VV+PL V T A+  ATE   MIL+IDD++
Sbjct: 512 DMEEDGVVEPLRVKTQAVESATEAAVMILRIDDVI 546



>pir|H69126|H69126 chaperonin - Methanobacterium thermoautotrophicum
           (strain Delta H)>gb:AE000808_27920 Methanobacterium
           thermoautotrophicum from bases 150234 to 161689 (section
           14 of 148) of the complete genome.>gb:AE000666_925002
           Methanobacterium thermoautotrophicum str. Delta H
           complete genome.
          Length = 552

 Score =  145 bits (365), Expect = 2e-33
 Identities = 82/220 (37%), Positives = 131/220 (59%), Gaps = 2/220 (0%)
 Frame = -1

Query: 986 IMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQD 807
           IM +K V++ +I+ I K      + N++   AE LG A ++ E  + D      +T I++
Sbjct: 313 IMALKRVKKSDIKRIEKATGARLVTNIDDLTAEDLGEAGVIYEKKIFDE----VLTFIEE 368

Query: 806 MG--RTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAW 633
               +  S+++RGS + V +E ER+L DA+ VV   +  R ++AGGGAPE+E++R+L  +
Sbjct: 369 CRDPKAISIILRGSTKHVAEEMERALEDAIGVVASTLEDREVVAGGGAPEVEIARKLREY 428

Query: 632 AKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQ 453
           A  + G E   V +FA++LE++P TLAENAGL+ I ++ +LR  H +     GI+V  G 
Sbjct: 429 ADTISGREQLAVSAFADALEIVPKTLAENAGLDSIDVLVDLRAAHEESPY-MGIDVFDGN 487

Query: 452 ITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           I ++ E  V++P  V   AI  A E   MIL+IDD++  R
Sbjct: 488 IVDMKEAGVIEPQRVKKQAIQSAAEAAEMILRIDDMIAAR 527



>sp|O26320|THSA_METTH Thermosome alpha subunit (Thermosome subunit
           1) (Chaperonin alpha subunit).
          Length = 542

 Score =  145 bits (365), Expect = 2e-33
 Identities = 82/220 (37%), Positives = 131/220 (59%), Gaps = 2/220 (0%)
 Frame = -1

Query: 986 IMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQD 807
           IM +K V++ +I+ I K      + N++   AE LG A ++ E  + D      +T I++
Sbjct: 303 IMALKRVKKSDIKRIEKATGARLVTNIDDLTAEDLGEAGVIYEKKIFDE----VLTFIEE 358

Query: 806 MG--RTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAW 633
               +  S+++RGS + V +E ER+L DA+ VV   +  R ++AGGGAPE+E++R+L  +
Sbjct: 359 CRDPKAISIILRGSTKHVAEEMERALEDAIGVVASTLEDREVVAGGGAPEVEIARKLREY 418

Query: 632 AKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQ 453
           A  + G E   V +FA++LE++P TLAENAGL+ I ++ +LR  H +     GI+V  G 
Sbjct: 419 ADTISGREQLAVSAFADALEIVPKTLAENAGLDSIDVLVDLRAAHEESPY-MGIDVFDGN 477

Query: 452 ITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           I ++ E  V++P  V   AI  A E   MIL+IDD++  R
Sbjct: 478 IVDMKEAGVIEPQRVKKQAIQSAAEAAEMILRIDDMIAAR 517



>gb:AY283769_606341 Thermococcus litoralis thermosome beta subunit
           gene, complete cds.
          Length = 548

 Score =  144 bits (364), Expect = 2e-33
 Identities = 79/221 (35%), Positives = 136/221 (61%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++ V++ ++E + K      + NV+   +E LG+A+LVEE  +  G  ++ + G
Sbjct: 307 KHGILAVRRVKKSDMEKLAKATGAKIVTNVKDLTSEDLGYAELVEERKVA-GENMIFVEG 365

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  ++L+RG  + V+DE ER+L DA+ VV+ ++    ++ GGGA EIELS +L  
Sbjct: 366 CKNP-KAVTILIRGGTEHVVDEVERALEDAIKVVKDVMEDGAILPGGGATEIELSIRLDE 424

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +AK + G E   V++FAE+L++IP TLAENAGL+ I ++ +  + H       G++V  G
Sbjct: 425 FAKQVGGKEQLAVEAFAEALKIIPKTLAENAGLDTIDVLVKAISEHKNKGKAIGVDVFAG 484

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           +  ++LE  V++P  V   AI  A+E   MIL+IDD++  +
Sbjct: 485 EPADMLERGVIEPARVKRQAIKSASEVAIMILRIDDVIAAK 525



>gb:AY099402_588798 Methanococcus maripaludis chaperonin gene,
           complete cds.>gb:BX957223_844768 Methanococcus
           maripaludis S2 complete genome; segment 5/5.
          Length = 543

 Score =  144 bits (364), Expect = 2e-33
 Identities = 82/219 (37%), Positives = 134/219 (61%), Gaps = 1/219 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+  + V++ ++E + K      I N++   A+ LG A LVEE  +  G  ++ +  
Sbjct: 300 KEGIVAARRVKKSDMEKLAKATGANVITNIKDLSAQDLGDAGLVEERKIS-GDSMIFVEE 358

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            +   +  ++L+RG+ + VI+E  R++ DA+ VV C +    +++GGG+ E+ELS +L  
Sbjct: 359 CKHP-KAVTMLIRGTTEHVIEEVARAVDDAVGVVGCTIEDGRIVSGGGSTEVELSMKLRE 417

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHA-QGEINAGINVRK 459
           +A+ + G E   V++FA++LEVIP TLAENAGL+ I I+ ++R  HA  G   AG+NV  
Sbjct: 418 YAEGISGREQLAVRAFADALEVIPRTLAENAGLDAIEILVKVRAAHASNGNKCAGLNVFT 477

Query: 458 GQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           G + ++ E  VV+PL V T AI  A E   M+L+IDD++
Sbjct: 478 GAVEDMCENGVVEPLRVKTQAIQSAAESTEMLLRIDDVI 516



>sp|O26885|THSB_METTH Thermosome beta subunit (Thermosome subunit 2)
           (Chaperonin beta subunit).>pir|H69205|H69205 chaperonin
           - Methanobacterium thermoautotrophicum (strain Delta
           H)>gb:AE000857_28490 Methanobacterium
           thermoautotrophicum from bases 714254 to 725965 (section
           63 of 148) of the complete genome.>gb:AE000666_925572
           Methanobacterium thermoautotrophicum str. Delta H
           complete genome.
          Length = 538

 Score =  144 bits (362), Expect = 4e-33
 Identities = 78/218 (35%), Positives = 132/218 (60%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  ++ ++ V++ ++E ++K      + N+E    E LG A +V E  +  G +++ +  
Sbjct: 300 KAGVLAVRRVKKSDMEKLSKATGANIVTNIEDLSPEDLGEAGVVSEKKIS-GEEMIFVEE 358

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  ++LVRGS + V+ E ER++ DA+ VV   V    ++AGGGAPEIE++++L  
Sbjct: 359 CKEP-KAVTILVRGSTEHVVSEVERAIEDAIGVVAATVEDGKVVAGGGAPEIEIAKRLKD 417

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A  + G E   V +FAE+LE++P TLAENAGL+ I ++ +LR  H +     GI+V  G
Sbjct: 418 YADSISGREQLAVSAFAEALEIVPKTLAENAGLDSIDVLVDLRAAHEESTY-MGIDVFDG 476

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           +I ++ E  V++P  V   AI  A E   MIL+IDD++
Sbjct: 477 KIVDMKEAGVIEPHRVKKQAIQSAAEAAEMILRIDDVI 514



>gb:BA000023_691416 Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 545

 Score =  143 bits (360), Expect = 6e-33
 Identities = 80/219 (36%), Positives = 136/219 (62%), Gaps = 1/219 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KI+ +K+V R ++E + K++    I  ++    + LG+A++VEE  +G+  K V   G
Sbjct: 302 KKKIIGVKNVSRSDLEKLAKSVGAKIITTIKDVSPDDLGYAEVVEERKIGNS-KAVFFEG 360

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            +  G   ++L+RGS+ +V+DE ERS  D+L  V+ ++   +++AGGGA E+E++ +L  
Sbjct: 361 AKQ-GDAVTILIRGSSDIVMDELERSFQDSLNTVKNVLQYPYVVAGGGAFEMEMALKLRE 419

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
            A+ + G E   V+++A++LE    TLAE AGL+ +  + +LRN H++G  NAGINV  G
Sbjct: 420 EARKIGGKEQLAVEAYADALEEFAITLAETAGLDSVDALVQLRNLHSKGLRNAGINVESG 479

Query: 455 QI-TNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           ++  ++ +  V+ PL+V    I  +TE    ILKIDD +
Sbjct: 480 KVEEDMAKIGVLDPLIVKEQVIKSSTEAATAILKIDDYI 518



>gb:AE017261_420212 Picrophilus torridus DSM 9790, complete genome.
          Length = 541

 Score =  143 bits (360), Expect = 6e-33
 Identities = 75/221 (33%), Positives = 131/221 (59%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I  ++ V++ +++ + K      +++++      LG AD VE+V +GD   +  +TG
Sbjct: 305 KAGIYAVRRVKKSDVDKLAKATGAAIVSSLDEMTEADLGKADKVEQVKIGDD-YMTFVTG 363

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  S+L+RG    V+DE ERS+ D+L VV   V     + GGG+   E++ +L  
Sbjct: 364 AKNP-KAVSILIRGETDHVVDEIERSITDSLHVVAAAVEDAAYVTGGGSAAEEIAFRLRT 422

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A  + G +   ++ FA++LE IP  LAENAGL+PI I+ ++R+ HA G    G+NV  G
Sbjct: 423 YASKVGGRQQLAIERFADALEEIPRALAENAGLDPIDILIKIRSEHAAGHTKYGLNVFTG 482

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           ++ ++ + NV++P+ V   AI  AT+   MIL+IDD++  +
Sbjct: 483 EVEDMEKANVIEPIRVGKQAIDSATDAAVMILRIDDVIATK 523



>gb:AY714828_1188883 Uncultured archaeon GZfos18H11 clone
           GZfos18H11, *** SEQUENCING IN PROGRESS ***.
          Length = 555

 Score =  142 bits (359), Expect = 8e-33
 Identities = 79/218 (36%), Positives = 130/218 (59%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I  ++  ++ ++E + K      +  V+      LG+A LVEE  +  G K++ I  
Sbjct: 317 KAGIAAVRRAKKSDMEKLEKATGGNVVNAVDVLTEADLGYAGLVEERKIS-GSKMLFIEQ 375

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++     S++VRG  + V+DE +RSL D L VV C++     IAGGGA E E++ ++  
Sbjct: 376 CKNP-HAVSIIVRGGTEQVVDEVDRSLDDTLRVVGCIIEDGKAIAGGGAVETEIALRIRE 434

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           ++  L+G E   V+ FAE++E+IP TLAEN+GL+PI  + EL+  H +GE  AG++V  G
Sbjct: 435 YSTSLKGREQLAVEKFAEAMEIIPRTLAENSGLDPIDKLVELKAAHERGETTAGLDVYTG 494

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           ++ ++ +  V++PL +   A+  A E   MILKIDD++
Sbjct: 495 KVVDMWQRGVIEPLRLKKQAMDSAVEAAIMILKIDDVI 532



>sp|O24731|THSA_THEK8 Thermosome alpha subunit (Thermosome subunit
           1) (Chaperonin alpha subunit).>gb:AB001082_268
           Thermococcus sp. DNA for chaperonin alpha subunit,
           complete cds.
          Length = 549

 Score =  142 bits (358), Expect = 1e-32
 Identities = 77/221 (34%), Positives = 136/221 (61%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  IM ++ V++ ++E + K      + NV+    E LG+A++VEE  L  G  ++ + G
Sbjct: 307 KYGIMAVRRVKKSDMEKLAKATGAKIVTNVKDLTPEDLGYAEIVEERKLA-GENMIFVEG 365

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  ++L+RG  + VIDE ER+L DA+ VV+ ++    ++  GGAPEIEL+  +  
Sbjct: 366 CKNP-KAVTILIRGGTEHVIDEVERALEDAVKVVKDVMEDGAVLPAGGAPEIELAISVDE 424

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +AK + G E   +++FA++L++IP TLAENAGL+ + I+ ++ + H    +  GI+V  G
Sbjct: 425 YAKQVGGKEALAIENFADALKIIPKTLAENAGLDTVEILVKVISEHKNKGLGIGIDVFAG 484

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           +  ++LE  ++ PL V+  AI  A   + MIL+IDD++  +
Sbjct: 485 EPADMLERGIIAPLRVTKQAIKSARAAI-MILRIDDVIAAK 524



>pir|A99481|A99481 hypothetical protein thsC [imported] - Sulfolobus
           solfataricus>gb:AE006890_223719 Sulfolobus solfataricus
           P2 section 249 of 272 of the complete
           genome.>gb:AE006641_1109567 Sulfolobus solfataricus P2,
           complete genome.
          Length = 539

 Score =  142 bits (357), Expect = 1e-32
 Identities = 85/220 (38%), Positives = 134/220 (60%), Gaps = 2/220 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  IM +K+V+R +IE +++       ++++      LG A LVE  +LG      K   
Sbjct: 305 KNGIMALKNVKRSDIELLSRATGAKIASSMKDANESDLGEAKLVEVRNLGKN----KYLF 360

Query: 815 IQ-DMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLG 639
           IQ D  +  +V+++GSN ++ DEAERSL+DA   +R L+ + +++AGGGA E EL+++L 
Sbjct: 361 IQSDKAKAVTVIIKGSNNMITDEAERSLNDAFNSIRNLLLEPYIVAGGGAVEEELAKRLR 420

Query: 638 AWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRK 459
             A+ + G E     +FA++LE     L+E AG++PI+ +TE+R++HA G  NAGI+V K
Sbjct: 421 DDARKVIGKEQLAFNAFADALEEYVSILSETAGMDPISALTEIRHKHATGLKNAGIDVTK 480

Query: 458 GQI-TNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            +I  N+LE  V+  L V    +  ATE    ILKIDD++
Sbjct: 481 ARIYDNMLELRVIDSLKVKEQVLKSATEAATAILKIDDMI 520



>sp|Q9V2T7|THSG_SULSO Thermosome gamma subunit (Thermosome subunit
           3) (Chaperonin gamma subunit).>gb:AF149921_483533
           Sulfolobus solfataricus putative chaperonin gamma
           subunit gene, partial cds.
          Length = 535

 Score =  142 bits (357), Expect = 1e-32
 Identities = 85/220 (38%), Positives = 134/220 (60%), Gaps = 2/220 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  IM +K+V+R +IE +++       ++++      LG A LVE  +LG      K   
Sbjct: 301 KNGIMALKNVKRSDIELLSRATGAKIASSMKDANESDLGEAKLVEVRNLGKN----KYLF 356

Query: 815 IQ-DMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLG 639
           IQ D  +  +V+++GSN ++ DEAERSL+DA   +R L+ + +++AGGGA E EL+++L 
Sbjct: 357 IQSDKAKAVTVIIKGSNNMITDEAERSLNDAFNSIRNLLLEPYIVAGGGAVEEELAKRLR 416

Query: 638 AWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRK 459
             A+ + G E     +FA++LE     L+E AG++PI+ +TE+R++HA G  NAGI+V K
Sbjct: 417 DDARKVIGKEQLAFNAFADALEEYVSILSETAGMDPISALTEIRHKHATGLKNAGIDVTK 476

Query: 458 GQI-TNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            +I  N+LE  V+  L V    +  ATE    ILKIDD++
Sbjct: 477 ARIYDNMLELRVIDSLKVKEQVLKSATEAATAILKIDDMI 516



>sp|P48425|THSB_THEAC Thermosome beta subunit (Thermosome subunit 2)
           (Chaperonin beta subunit).>pir|S53817|S53817 thermosome
           beta chain - Thermoplasma acidophilum>gb:TACID5_197030
           Thermoplasma acidophilum complete genome; segment
           5/5.>gb:TATHSBSUB_197336 T.acidophilum gene for
           beta-subunit of the thermosome.
          Length = 543

 Score =  142 bits (357), Expect = 1e-32
 Identities = 76/218 (34%), Positives = 133/218 (61%)
 Frame = -1

Query: 986 IMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQD 807
           I  ++ V++ +++ + K      ++ ++   +  LG A+ VE+V +G+   +  +TG ++
Sbjct: 308 IYAVRRVKKSDMDKLAKATGASIVSTIDEISSSDLGTAERVEQVKVGED-YMTFVTGCKN 366

Query: 806 MGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAK 627
             +  S+LVRG  + V+DE ERS+ D+L VV   +      AGGGA   E++ +L ++A+
Sbjct: 367 P-KAVSILVRGETEHVVDEMERSITDSLHVVASALEDGAYAAGGGATAAEIAFRLRSYAQ 425

Query: 626 VLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQIT 447
            + G +   ++ FA+++E IP  LAENAGL+PI I+ +LR  HA+G    GINV  G+I 
Sbjct: 426 KIGGRQQLAIEKFADAIEEIPRALAENAGLDPIDILLKLRAEHAKGNKTYGINVFTGEIE 485

Query: 446 NILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           ++++  V++P+ V   AI  ATE   MIL+IDD++  +
Sbjct: 486 DMVKNGVIEPIRVGKQAIESATEAAIMILRIDDVIATK 523



>gb:HUMKG1DD_2033895 Homo sapiens mRNA for KIAA0098 protein, partial
           cds.
          Length = 553

 Score =  140 bits (354), Expect = 3e-32
 Identities = 81/206 (39%), Positives = 123/206 (59%), Gaps = 2/206 (0%)
 Frame = -1

Query: 956 EIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVR 777
           EIE I        +       AEKLG A LV+E+S G     + +       R  ++ +R
Sbjct: 341 EIELIAIATGGRIVPRFSELTAEKLGFAGLVQEISFGTTKDKMLVIEQCKNSRAVTIFIR 400

Query: 776 GSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCV 597
           G N+++I+EA+RSLHDALCV+R L+    ++ GGGA EI  +  +   A     +E Y +
Sbjct: 401 GGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAM 460

Query: 596 KSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEIN--AGINVRKGQITNILEENVV 423
           ++FA++LEVIP  L+EN+G+NPI  +TE+R R  + E+N   GI+       ++ +++V+
Sbjct: 461 RAFADALEVIPMALSENSGMNPIQTMTEVRARQVK-EMNPALGIDCLHKGTNDMKQQHVI 519

Query: 422 QPLLVSTSAISLATECVRMILKIDDI 345
           + L+     ISLAT+ VRMILKIDDI
Sbjct: 520 ETLIGKKQQISLATQMVRMILKIDDI 545



>gb:BC009454_1972016 Homo sapiens, clone IMAGE:3534054, mRNA,
           partial cds.
          Length = 387

 Score =  140 bits (354), Expect = 3e-32
 Identities = 81/206 (39%), Positives = 123/206 (59%), Gaps = 2/206 (0%)
 Frame = -1

Query: 956 EIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVR 777
           EIE I        +       AEKLG A LV+E+S G     + +       R  ++ +R
Sbjct: 175 EIELIAIATGGRIVPRFSELTAEKLGFAGLVQEISFGTTKDKMLVIEQCKNSRAVTIFIR 234

Query: 776 GSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCV 597
           G N+++I+EA+RSLHDALCV+R L+    ++ GGGA EI  +  +   A     +E Y +
Sbjct: 235 GGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAM 294

Query: 596 KSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEIN--AGINVRKGQITNILEENVV 423
           ++FA++LEVIP  L+EN+G+NPI  +TE+R R  + E+N   GI+       ++ +++V+
Sbjct: 295 RAFADALEVIPMALSENSGMNPIQTMTEVRARQVK-EMNPALGIDCLHKGTNDMKQQHVI 353

Query: 422 QPLLVSTSAISLATECVRMILKIDDI 345
           + L+     ISLAT+ VRMILKIDDI
Sbjct: 354 ETLIGKKQQISLATQMVRMILKIDDI 379



>gb:BC002971_1968571 Homo sapiens, clone IMAGE:3543711, mRNA,
           partial cds.
          Length = 539

 Score =  140 bits (354), Expect = 3e-32
 Identities = 81/206 (39%), Positives = 123/206 (59%), Gaps = 2/206 (0%)
 Frame = -1

Query: 956 EIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVR 777
           EIE I        +       AEKLG A LV+E+S G     + +       R  ++ +R
Sbjct: 327 EIELIAIATGGRIVPRFSELTAEKLGFAGLVQEISFGTTKDKMLVIEQCKNSRAVTIFIR 386

Query: 776 GSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCV 597
           G N+++I+EA+RSLHDALCV+R L+    ++ GGGA EI  +  +   A     +E Y +
Sbjct: 387 GGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAM 446

Query: 596 KSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEIN--AGINVRKGQITNILEENVV 423
           ++FA++LEVIP  L+EN+G+NPI  +TE+R R  + E+N   GI+       ++ +++V+
Sbjct: 447 RAFADALEVIPMALSENSGMNPIQTMTEVRARQVK-EMNPALGIDCLHKGTNDMKQQHVI 505

Query: 422 QPLLVSTSAISLATECVRMILKIDDI 345
           + L+     ISLAT+ VRMILKIDDI
Sbjct: 506 ETLIGKKQQISLATQMVRMILKIDDI 531



>gb:AE010841_267025 Methanosarcina acetivorans str. C2A, section 186
           of 534 of the complete genome.>gb:AE010299_907584
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 547

 Score =  140 bits (354), Expect = 3e-32
 Identities = 75/217 (34%), Positives = 132/217 (60%), Gaps = 2/217 (0%)
 Frame = -1

Query: 986 IMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQD 807
           I   + V+ D+++ +       P+ N++    ++LGHA L+E+    D GK    T ++D
Sbjct: 305 IYATRRVKTDDMQHLADATGGRPVRNIKELTEKELGHAGLLEQDRDEDQGK----TYLRD 360

Query: 806 M--GRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAW 633
               ++ S+++RG  + V+D  ER++ DAL VV+C+V    ++AGGGA E+E++  + ++
Sbjct: 361 CKGAKSVSIVLRGGTEHVVDNLERAIDDALRVVKCVVEDGKVVAGGGASEMEVALSIRSY 420

Query: 632 AKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQ 453
           A  + G E   + +FAE+LE IP T+A NAGL+ I  +  LR +HA+ + NAG+N++ G 
Sbjct: 421 ASSIGGREQTAITAFAEALEEIPRTIARNAGLDAIDSILNLRAKHAENK-NAGLNIQTGA 479

Query: 452 ITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
             ++LE+ VV PL V  + I   +E   M+L++D ++
Sbjct: 480 AEDMLEKGVVDPLRVKVNTIKAGSEAAAMVLRVDSML 516



>sp|P48643|TCPE_HUMAN T-complex protein 1, epsilon subunit
           (TCP-1-epsilon) (CCT-epsilon).>gb:BC006543_1970373 Homo
           sapiens chaperonin containing TCP1, subunit 5 (epsilon),
           mRNA (cDNA clone MGC:2389 IMAGE:2824199), complete
           cds.>gb:BC035499_1981574 Homo sapiens chaperonin
           containing TCP1, subunit 5 (epsilon), mRNA (cDNA clone
           MGC:20797 IMAGE:4329194), complete cds.
          Length = 541

 Score =  140 bits (354), Expect = 3e-32
 Identities = 81/206 (39%), Positives = 123/206 (59%), Gaps = 2/206 (0%)
 Frame = -1

Query: 956 EIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVR 777
           EIE I        +       AEKLG A LV+E+S G     + +       R  ++ +R
Sbjct: 329 EIELIAIATGGRIVPRFSELTAEKLGFAGLVQEISFGTTKDKMLVIEQCKNSRAVTIFIR 388

Query: 776 GSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCV 597
           G N+++I+EA+RSLHDALCV+R L+    ++ GGGA EI  +  +   A     +E Y +
Sbjct: 389 GGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAM 448

Query: 596 KSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEIN--AGINVRKGQITNILEENVV 423
           ++FA++LEVIP  L+EN+G+NPI  +TE+R R  + E+N   GI+       ++ +++V+
Sbjct: 449 RAFADALEVIPMALSENSGMNPIQTMTEVRARQVK-EMNPALGIDCLHKGTNDMKQQHVI 507

Query: 422 QPLLVSTSAISLATECVRMILKIDDI 345
           + L+     ISLAT+ VRMILKIDDI
Sbjct: 508 ETLIGKKQQISLATQMVRMILKIDDI 533



>gb:BC044997_2548956 Xenopus laevis chaperonin containing TCP1,
           subunit 5 (epsilon), mRNA (cDNA clone MGC:53061
           IMAGE:5541942), complete cds.
          Length = 541

 Score =  140 bits (353), Expect = 4e-32
 Identities = 80/216 (37%), Positives = 128/216 (59%), Gaps = 1/216 (0%)
 Frame = -1

Query: 989 KIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQ 810
           ++  ++ V   EIE I        +        EKLG+A +V+E+S G     + +    
Sbjct: 318 ELPAVRWVGGPEIELIAIATGGRIVPRFCELTPEKLGYAGIVKEISFGTTKDRMLVIEQC 377

Query: 809 DMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWA 630
              R  ++ +RG N+++I+EA+RSLHDALCV+R LV    ++ GGGA EI  +  +   A
Sbjct: 378 KNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLVRDNRIVYGGGAAEISCALAVSQAA 437

Query: 629 KVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINA-GINVRKGQ 453
                +E Y +++FA++LEVIP +LAEN+G+NPI  +TE+R+R  +    A GI+     
Sbjct: 438 DKCPSLEQYAMRAFADALEVIPMSLAENSGMNPIQTMTEVRSRQVKESNPALGIDCLHKG 497

Query: 452 ITNILEENVVQPLLVSTSAISLATECVRMILKIDDI 345
             ++ +++V++ L+     ISLAT+ V+MILKIDDI
Sbjct: 498 TNDMKQQHVIETLIGKKQQISLATQVVKMILKIDDI 533



>gb:CEU25632_1368472 Caenorhabditis elegans chaperonin CCT-2 (cct-2)
           mRNA, complete cds.
          Length = 529

 Score =  140 bits (353), Expect = 4e-32
 Identities = 72/216 (33%), Positives = 128/216 (59%)
 Frame = -1

Query: 989 KIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQ 810
           K+M I+  + + IE +   L    ++  +  +  + G  DL+EE+ +G+  ++++ +G++
Sbjct: 302 KVMAIEHADFEGIERLALVLGGEIVSTFDSPQTAQFGSCDLIEEIMIGED-RLLRFSGVK 360

Query: 809 DMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWA 630
            +G   SV++RG+ Q ++DE+ERSLHDALCV+   V +   +AG GA EI +S  +   A
Sbjct: 361 -LGEACSVVLRGATQQILDESERSLHDALCVLVTHVKESKTVAGAGASEILMSSAIAVEA 419

Query: 629 KVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQI 450
           + + G E   V++F  +L  +P  + +NAGL+   +VT LR  HA G  N GI++ KG++
Sbjct: 420 QKVAGKESLAVEAFGRALAQLPTIICDNAGLDSAELVTRLRAEHANGRHNMGIDIEKGEV 479

Query: 449 TNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            ++ +  V++   V    +S A E    IL++DDI+
Sbjct: 480 ADVTKLGVIESYNVKLCMVSSAAEATEQILRVDDII 515



>sp|P47207|TCPB_CAEEL T-complex protein 1, beta subunit (TCP-1-beta)
           (CCT-beta).>pir|T18589|T18589 chaperonin beta chain -
           Caenorhabditis elegans>gb:CET21B10_1367889
           Caenorhabditis elegans cosmid T21B10, complete
           sequence.>gb:CEVT21B10L_1368750 Caenorhabditis elegans
           plasmid VT21B10L, complete sequence.
          Length = 529

 Score =  140 bits (353), Expect = 4e-32
 Identities = 72/216 (33%), Positives = 128/216 (59%)
 Frame = -1

Query: 989 KIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQ 810
           K+M I+  + + IE +   L    ++  +  +  + G  DL+EE+ +G+  ++++ +G++
Sbjct: 302 KVMAIEHADFEGIERLALVLGGEIVSTFDSPQTAQFGSCDLIEEIMIGED-RLLRFSGVK 360

Query: 809 DMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWA 630
            +G   SV++RG+ Q ++DE+ERSLHDALCV+   V +   +AG GA EI +S  +   A
Sbjct: 361 -LGEACSVVLRGATQQILDESERSLHDALCVLVTHVKESKTVAGAGASEILMSSAIAVEA 419

Query: 629 KVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQI 450
           + + G E   V++F  +L  +P  + +NAGL+   +VT LR  HA G  N GI++ KG++
Sbjct: 420 QKVAGKEALAVEAFGRALAQLPTIICDNAGLDSAELVTRLRAEHANGRHNMGIDIEKGEV 479

Query: 449 TNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            ++ +  V++   V    +S A E    IL++DDI+
Sbjct: 480 ADVTKLGVIESYNVKLCMVSSAAEATEQILRVDDII 515



>gb:AY534910_626193 Uncultured marine group II euryarchaeote
           DeepAnt-JyKC7 clone cosmid DeepAnt-JyKC7, complete
           sequence.
          Length = 536

 Score =  140 bits (352), Expect = 5e-32
 Identities = 76/219 (34%), Positives = 129/219 (58%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  +  I+  ++ ++E ++K      + N++   A+ LG A LV+E  +GD   +V ITG
Sbjct: 303 KAGLFAIRRAKKSDMEALSKATGGKIVTNIDDLSADDLGQAALVDERKIGDSD-MVFITG 361

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
             +  ++ SVL+RG  + V+DE  R+  DA+ V         ++ GGG+    +SR L A
Sbjct: 362 CPE-AKSVSVLLRGGTEHVVDEIRRAFDDAMGVAAVAYEDGAVLTGGGSVLAAISRDLRA 420

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A+ + G E   +++FA +LEVIP TLAENAGL+P+  + +LR  H++G    G+NV  G
Sbjct: 421 YAEGIGGREQMAIEAFAVALEVIPRTLAENAGLDPVNTIIDLRKAHSEGRSTYGVNVYDG 480

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVT 339
            + ++ + +V +P  V   A+  A+E   MIL+IDD+++
Sbjct: 481 GVVDMTKSSVYEPSRVVEQAVQSASETAVMILRIDDVIS 519



>sp|Q9HH21|THSG_SULSH Thermosome gamma subunit (Thermosome subunit
           3) (Chaperonin gamma subunit) (Thermophilic factor 55
           gamma) (TF55-gamma) (HSP60 gamma
           subunit).>gb:AF313410_498695 Sulfolobus shibatae HSP60
           gamma subunit gene, complete cds.
          Length = 535

 Score =  140 bits (352), Expect = 5e-32
 Identities = 84/220 (38%), Positives = 133/220 (60%), Gaps = 2/220 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ +K+V+R +IE +++       ++++      LG A LVE  +LG      K   
Sbjct: 301 KSGIIALKNVKRSDIELLSRATGAKIASSMKDANESDLGEAKLVEVRNLGKN----KYLF 356

Query: 815 IQ-DMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLG 639
           IQ D  +  +V+++GSN +V DEAERSL+DA   +R L+ + +++AGGGA E EL+++L 
Sbjct: 357 IQSDKAKAVTVIIKGSNNMVTDEAERSLNDAFNSIRNLLLEPYIVAGGGAVEEELAKRLR 416

Query: 638 AWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRK 459
             A  + G E     +FA++LE     L+E AG++PI+ +TE+R++HA G  NAGI++ K
Sbjct: 417 ENAGKVPGKEQLAFNAFADALEEYVSILSETAGMDPISALTEIRHKHANGLKNAGIDIVK 476

Query: 458 GQI-TNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            +I  N+LE  V+  L V    +  ATE    ILKIDD++
Sbjct: 477 ARIYDNMLELKVIDSLKVKEQVLKSATEAATAILKIDDMI 516



>gb:BC075101_2558215 Xenopus tropicalis cDNA clone MGC:79582
           IMAGE:6978905, complete cds.
          Length = 469

 Score =  139 bits (349), Expect = 1e-31
 Identities = 78/216 (36%), Positives = 128/216 (59%), Gaps = 1/216 (0%)
 Frame = -1

Query: 989 KIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQ 810
           ++  ++ V   EIE I        +        EKLG+A +V+E+S G     + +    
Sbjct: 246 ELPAVRWVGGPEIELIAIATGGRIVPRFCELTPEKLGYAGIVKEISFGTTKDRMLVIEQC 305

Query: 809 DMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWA 630
              R  ++ +RG N+++I+EA+RSLHDALCV+R LV    ++ GGGA EI  +  +   A
Sbjct: 306 KNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLVRDNRIVYGGGAAEISCALAVSEAA 365

Query: 629 KVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINA-GINVRKGQ 453
                +E Y +++FA++LE+IP +LAEN+G+NPI  +TE+R++  +    A GI+     
Sbjct: 366 DKCPSLEQYAMRAFADALEIIPMSLAENSGMNPIQTMTEVRSKQVKESNPALGIDCLHKG 425

Query: 452 ITNILEENVVQPLLVSTSAISLATECVRMILKIDDI 345
             ++ +++V++ L+     ISLAT+ V+MILKIDDI
Sbjct: 426 TNDMKQQHVIETLIGKKQQISLATQVVKMILKIDDI 461



>gb:BC064254_2553807 Xenopus tropicalis hypothetical protein
           MGC76252, mRNA (cDNA clone MGC:76252 IMAGE:5379035),
           complete cds.
          Length = 541

 Score =  139 bits (349), Expect = 1e-31
 Identities = 78/216 (36%), Positives = 128/216 (59%), Gaps = 1/216 (0%)
 Frame = -1

Query: 989 KIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQ 810
           ++  ++ V   EIE I        +        EKLG+A +V+E+S G     + +    
Sbjct: 318 ELPAVRWVGGPEIELIAIATGGRIVPRFCELTPEKLGYAGIVKEISFGTTKDRMLVIEQC 377

Query: 809 DMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWA 630
              R  ++ +RG N+++I+EA+RSLHDALCV+R LV    ++ GGGA EI  +  +   A
Sbjct: 378 KNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLVRDNRIVYGGGAAEISCALAVSEAA 437

Query: 629 KVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINA-GINVRKGQ 453
                +E Y +++FA++LE+IP +LAEN+G+NPI  +TE+R++  +    A GI+     
Sbjct: 438 DKCPSLEQYAMRAFADALEIIPMSLAENSGMNPIQTMTEVRSKQVKESNPALGIDCLHKG 497

Query: 452 ITNILEENVVQPLLVSTSAISLATECVRMILKIDDI 345
             ++ +++V++ L+     ISLAT+ V+MILKIDDI
Sbjct: 498 TNDMKQQHVIETLIGKKQQISLATQVVKMILKIDDI 533



>gb:CR857360_1181603 Pongo pygmaeus mRNA; cDNA DKFZp469K0732 (from
           clone DKFZp469K0732).
          Length = 541

 Score =  139 bits (349), Expect = 1e-31
 Identities = 80/206 (38%), Positives = 122/206 (59%), Gaps = 2/206 (0%)
 Frame = -1

Query: 956 EIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVR 777
           EIE I        +       AEKLG A LV+E+S G     + +       R  ++ +R
Sbjct: 329 EIELIAIATGGRIVPRFSELTAEKLGFAGLVQEISFGTTKDKMLVIEQCKNSRAVTIFIR 388

Query: 776 GSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCV 597
           G N+++I+EA+RSLHDALCV+R L+    ++ GGGA E   +  +   A     +E Y +
Sbjct: 389 GGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAETSCALAVSQEADKCPTLEQYAM 448

Query: 596 KSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEIN--AGINVRKGQITNILEENVV 423
           ++FA++LEVIP  L+EN+G+NPI  +TE+R R  + E+N   GI+       ++ +++V+
Sbjct: 449 RAFADALEVIPMALSENSGMNPIQTMTEVRARQVK-EMNPALGIDCLHKGTNDMKQQHVI 507

Query: 422 QPLLVSTSAISLATECVRMILKIDDI 345
           + L+     ISLAT+ VRMILKIDDI
Sbjct: 508 ETLIGKKQQISLATQMVRMILKIDDI 533



>gb:CNS07EG9_1372808 chromosome II of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 484

 Score =  138 bits (347), Expect = 2e-31
 Identities = 87/221 (39%), Positives = 136/221 (61%), Gaps = 3/221 (1%)
 Frame = -1

Query: 986 IMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQD 807
           I+V+  V+R ++++I   +N  P++ V+      L  A LV+ V  G+   +++I G   
Sbjct: 281 ILVVNSVDRKDVDYICSAMNIQPVSEVD-----LLSPASLVD-VETGEVEGMLEIKGYG- 333

Query: 806 MGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAK 627
                ++L+RG + +V++EAERSL+DALCVV+CL    FL+ GGG+ E+ ++  L     
Sbjct: 334 ----CTILLRGCDDMVVEEAERSLNDALCVVKCLKELPFLVPGGGSIEMGIALMLS---- 385

Query: 626 VLQGMEG--YCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQ 453
             +  EG  Y ++  A++ E +PY LA NAGL P+ IV+ELR+   Q    AGI+VR G 
Sbjct: 386 --ESTEGNIYVLREIAKAFEGVPYFLARNAGLYPVEIVSELRSELKQ-NCCAGISVRSGH 442

Query: 452 ITNIL-EENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
             +++ +++VVQP  VS S ++LA E V MILKIDDI+  R
Sbjct: 443 AGDMVRDDSVVQPAKVSISVVTLALETVSMILKIDDILPAR 483



>sp|O24732|THSB_THEK8 Thermosome beta subunit (Thermosome subunit 2)
           (Chaperonin beta subunit).>gb:AB001083_269 Thermococcus
           sp. DNA for chaperonin beta subunit, complete cds.
          Length = 545

 Score =  138 bits (347), Expect = 2e-31
 Identities = 78/218 (35%), Positives = 132/218 (60%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  IM ++ V++ ++E + K      + NV     E LG A+LVE+  +  G  ++ + G
Sbjct: 307 KYGIMAVRRVKKSDMEKLAKATGAKIVTNVRDLTPEDLGEAELVEQRKVA-GENMIFVEG 365

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  ++L+RG  + V+DE ER+L DA+ VV+ +V    ++A GGAPEIEL+  +  
Sbjct: 366 CKNP-KAVTILIRGGTEHVVDEVERALEDAVKVVKDIVEDGKIVAAGGAPEIELAISVDE 424

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +AK + G E   +++FAE+L+VIP TLA NAGL+PI  + ++   H +     G++V +G
Sbjct: 425 YAKEVGGKEQLAIEAFAEALKVIPRTLAGNAGLDPIETLVKVIAAHKEKGPTIGVDVFEG 484

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           +  ++LE  V+ P+ V   AI  A   + MIL+IDD++
Sbjct: 485 EPADMLERGVIAPVRVPKQAIKSAKAAI-MILRIDDVI 521



>gb:AE013227_290402 Methanosarcina mazei strain Goe1, section 9 of
           379 of the complete genome.>gb:AE008384_964511
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 567

 Score =  137 bits (346), Expect = 3e-31
 Identities = 72/217 (33%), Positives = 130/217 (59%), Gaps = 2/217 (0%)
 Frame = -1

Query: 986 IMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQD 807
           I   + V+ ++++ +       P+ N++    ++LGHA L+E+    + GK    T ++D
Sbjct: 325 IYATRRVKNEDMQHLADATGGRPVRNIKELTEKELGHAGLLEQDRDDEQGK----TYLRD 380

Query: 806 M--GRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAW 633
               ++ S+++RG  + V+D  ER++ DAL V +C+V    ++AGGGA E+E++  L ++
Sbjct: 381 CKGAKSVSIVLRGGTEHVVDNLERAVDDALKVAKCVVEDGMVVAGGGASEMEVALSLRSY 440

Query: 632 AKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQ 453
           A  + G E   + +FAE+LE IP T+A NAGL+ I  +  LR +HA  + NAG+NV  G 
Sbjct: 441 ASSVGGREQMAIAAFAEALEEIPRTIARNAGLDTINTIVNLRAKHADNK-NAGLNVLTGA 499

Query: 452 ITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
             ++LE+ ++ PL V  ++I   +E   M+L++D ++
Sbjct: 500 AEDMLEKGIIDPLRVKVNSIKAGSEAATMVLRVDSML 536



>gb:CEC07G2_1360196 Caenorhabditis elegans cosmid C07G2, complete
           sequence.
          Length = 336

 Score =  137 bits (345), Expect = 3e-31
 Identities = 77/205 (37%), Positives = 120/205 (58%), Gaps = 1/205 (0%)
 Frame = -1

Query: 956 EIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVR 777
           EIE +    N   +        EKLG A LV E++ G     +         +  ++ VR
Sbjct: 122 EIELLAIATNARIVPRFSELSKEKLGTAGLVREITFGAAKDRMLSIEQCPNNKAVTIFVR 181

Query: 776 GSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCV 597
           G N+++IDEA+R+LHDALCV+R LV    ++ GGG+ E+  + Q+   A  + G+E Y  
Sbjct: 182 GGNKMIIDEAKRALHDALCVIRNLVRDSRIVYGGGSAELAAAIQVAKEADRIDGIEQYAF 241

Query: 596 KSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQ-GEINAGINVRKGQITNILEENVVQ 420
           ++FA++LE IP  LAEN+GL PI  +++L+ +  + G+ + GI+       ++ E+ V++
Sbjct: 242 RAFADALESIPMALAENSGLAPIDALSDLKAKQIETGKSSLGIDAVFAGTNDMKEQKVIE 301

Query: 419 PLLVSTSAISLATECVRMILKIDDI 345
            LL     ISLAT+ VRMILKIDD+
Sbjct: 302 TLLSKREQISLATQVVRMILKIDDV 326



>sp|P47209|TCPE_CAEEL T-complex protein 1, epsilon subunit
           (TCP-1-epsilon) (CCT-epsilon).>pir|T19063|T19063
           t-complex-type molecular chaperone C07G2.3 -
           Caenorhabditis elegans>gb:CEC07G2_1360195 Caenorhabditis
           elegans cosmid C07G2, complete
           sequence.>gb:CEF25F2_1362924 Caenorhabditis elegans
           cosmid F25F2, complete sequence.>gb:CEU25698_1368474
           Caenorhabditis elegans CCT chaperonin subunit 5 (cct-5)
           mRNA, complete cds.
          Length = 542

 Score =  137 bits (345), Expect = 3e-31
 Identities = 77/205 (37%), Positives = 120/205 (58%), Gaps = 1/205 (0%)
 Frame = -1

Query: 956 EIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVR 777
           EIE +    N   +        EKLG A LV E++ G     +         +  ++ VR
Sbjct: 328 EIELLAIATNARIVPRFSELSKEKLGTAGLVREITFGAAKDRMLSIEQCPNNKAVTIFVR 387

Query: 776 GSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCV 597
           G N+++IDEA+R+LHDALCV+R LV    ++ GGG+ E+  + Q+   A  + G+E Y  
Sbjct: 388 GGNKMIIDEAKRALHDALCVIRNLVRDSRIVYGGGSAELAAAIQVAKEADRIDGIEQYAF 447

Query: 596 KSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQ-GEINAGINVRKGQITNILEENVVQ 420
           ++FA++LE IP  LAEN+GL PI  +++L+ +  + G+ + GI+       ++ E+ V++
Sbjct: 448 RAFADALESIPMALAENSGLAPIDALSDLKAKQIETGKSSLGIDAVFAGTNDMKEQKVIE 507

Query: 419 PLLVSTSAISLATECVRMILKIDDI 345
            LL     ISLAT+ VRMILKIDD+
Sbjct: 508 TLLSKREQISLATQVVRMILKIDDV 532



>gb:AY398321_2531851 Danio rerio clone RK074A2D01 chaperonin
           containing TCP1, subunit 5 (epsilon) (CCT5) mRNA,
           complete cds.>gb:AY648807_2541635 Danio rerio TCP-1
           epsilon mRNA, complete cds.>gb:BC068037_2554990 Danio
           rerio chaperonin containing TCP1, subunit 5 (epsilon),
           mRNA (cDNA clone MGC:77639 IMAGE:6996933), complete cds.
          Length = 541

 Score =  137 bits (344), Expect = 4e-31
 Identities = 81/216 (37%), Positives = 125/216 (57%), Gaps = 1/216 (0%)
 Frame = -1

Query: 989 KIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQ 810
           ++  I+ V   EIE I        +        EKLG A LV+E+  G     + +    
Sbjct: 318 ELPAIRWVGGPEIELIAIATGGRIVPRFCELTPEKLGTAGLVKEICFGTTKDRMLVIEEC 377

Query: 809 DMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWA 630
              R  ++ +RG N+++I+EA+R+LHDALCV+R LV    ++ GGGA EI  +  +   A
Sbjct: 378 KNSRAVTIFIRGGNKMIIEEAKRALHDALCVIRNLVRDNRIVYGGGASEIACALAVNEAA 437

Query: 629 KVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINA-GINVRKGQ 453
                +E Y +++FA++LEVIP  LAEN+GLNPI  +TE+R R  +   +A GI+     
Sbjct: 438 DKCPSLEQYAMRAFADALEVIPMALAENSGLNPIQTMTEVRARQVKENNSALGIDCLHLS 497

Query: 452 ITNILEENVVQPLLVSTSAISLATECVRMILKIDDI 345
             ++ +++V++ L+     ISLAT+ V+MILKIDDI
Sbjct: 498 TNDMKQQHVIETLIGKKQQISLATQVVKMILKIDDI 533



>sp|O30560|THS2_HALVO Thermosome subunit 2 (Heat shock protein
           CCT2).>pir|T47128|T47128 heat shock protein cct2
           [imported] - Haloferax volcanii>gb:AF010469_468347
           Haloferax volcanii heat shock protein (cct2) gene,
           complete cds.
          Length = 557

 Score =  137 bits (344), Expect = 4e-31
 Identities = 72/218 (33%), Positives = 127/218 (58%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++  ++ +I F+        +++++   A  LG A +  +    + G++  + G
Sbjct: 310 KQGILAVRRTKKSDIRFLKNITGAAVVSDLDSIEAAVLGRASVRRD----EAGELFYVEG 365

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
           I D     ++L+RGS   V+DE ER + DAL VV   V+   ++AGGGA E+EL+ +L  
Sbjct: 366 IGDDVHGVTLLLRGSTDHVVDELERGVQDALDVVASTVADGRVLAGGGAIEVELASRLRN 425

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A  + G E   V+++A++LE++P  LAENAGL+ I  + +LR  H  G++ AG+NV  G
Sbjct: 426 YADSVSGREQLAVEAYADALELVPRVLAENAGLDSIDTLVDLRAAHEDGQVRAGLNVFTG 485

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           ++ +  +  VV+       A++ A+E   ++LKIDDI+
Sbjct: 486 EVEDAFDAGVVETAHAKEQAVASASEAANLVLKIDDII 523



>gb:BA000011_665594 Thermoplasma volcanium GSS1 DNA, complete
           genome.
          Length = 549

 Score =  136 bits (343), Expect = 6e-31
 Identities = 72/218 (33%), Positives = 131/218 (60%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I  ++ V++ ++E + K      + +++      LG A+ VEE  +GD  ++  +TG
Sbjct: 308 KEGIYAVRRVKKSDMEKLAKATGAKIVTDLDDLTPSVLGEAEKVEERKIGDD-RMTFVTG 366

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  S+L+RG  + V+ E ER+L+DA+ VV         + GGGA E EL+ +L  
Sbjct: 367 CKNP-KAVSILIRGGTEHVVSEVERALNDAIRVVAITKEDGKFLWGGGAVEAELAMRLAK 425

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A  + G E   +++FA++LE+IP TLAENAG++PI  + +L++ H +G+I+ G+++   
Sbjct: 426 YANSVGGREQLAIEAFAKALEIIPRTLAENAGIDPINTLIKLKSEHEKGKISMGVDLDSN 485

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
              ++ ++ V+ P+ V T A+  A E   MIL+IDD++
Sbjct: 486 GAGDMSKKGVIDPVRVKTHALESAVEVATMILRIDDVI 523



>gb:BC086201_2564781 Xenopus laevis hypothetical LOC495794, mRNA
           (cDNA clone IMAGE:7200707), partial cds.
          Length = 540

 Score =  136 bits (342), Expect = 7e-31
 Identities = 78/205 (38%), Positives = 120/205 (58%), Gaps = 1/205 (0%)
 Frame = -1

Query: 956 EIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVR 777
           EIE I        +       +EKLG A +V+E+S G     + +       R  ++ +R
Sbjct: 328 EIELIAIATGGRIVPRFSELTSEKLGFAGVVQEISFGTTKDKMLVIEKCKNSRAVTIFIR 387

Query: 776 GSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCV 597
           G N+++I+EA+RSLHDALCV+R L+    ++ GGGA EI  +  +   A     +E Y +
Sbjct: 388 GGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAM 447

Query: 596 KSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINA-GINVRKGQITNILEENVVQ 420
           ++FA++LEVIP  L+EN+G+NPI  +TE+R R  +    A GI+       ++  ++V++
Sbjct: 448 RAFADALEVIPMALSENSGMNPIQTMTEVRARQVKESNPALGIDCLHKGSNDMQYQHVIE 507

Query: 419 PLLVSTSAISLATECVRMILKIDDI 345
            L+     ISLAT+ VRMILKIDDI
Sbjct: 508 TLIGKKQQISLATQMVRMILKIDDI 532



>gb:AK129056_2069287 Mus musculus mRNA for mKIAA0098 protein.
          Length = 542

 Score =  136 bits (342), Expect = 7e-31
 Identities = 78/205 (38%), Positives = 120/205 (58%), Gaps = 1/205 (0%)
 Frame = -1

Query: 956 EIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVR 777
           EIE I        +       +EKLG A +V+E+S G     + +       R  ++ +R
Sbjct: 330 EIELIAIATGGRIVPRFSELTSEKLGFAGVVQEISFGTTKDKMLVIEKCKNSRAVTIFIR 389

Query: 776 GSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCV 597
           G N+++I+EA+RSLHDALCV+R L+    ++ GGGA EI  +  +   A     +E Y +
Sbjct: 390 GGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAM 449

Query: 596 KSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINA-GINVRKGQITNILEENVVQ 420
           ++FA++LEVIP  L+EN+G+NPI  +TE+R R  +    A GI+       ++  ++V++
Sbjct: 450 RAFADALEVIPMALSENSGMNPIQTMTEVRARQVKESNPALGIDCLHKGSNDMQYQHVIE 509

Query: 419 PLLVSTSAISLATECVRMILKIDDI 345
            L+     ISLAT+ VRMILKIDDI
Sbjct: 510 TLIGKKQQISLATQMVRMILKIDDI 534



>sp|P80316|TCPE_MOUSE T-complex protein 1, epsilon subunit
           (TCP-1-epsilon) (CCT-epsilon).>pir|S43061|S43061
           t-complex-type molecular chaperone Ccte -
           mouse>gb:AK088184_1175245 Mus musculus 2 days neonate
           thymus thymic cells cDNA, RIKEN full-length enriched
           library, clone:E430005M01 product:chaperonin subunit 5
           (epsilon), full insert sequence.>gb:A45919_1449228
           Sequence 58 from Patent WO9520654.>gb:AB022158_2044203
           Mus musculus Ccte gene for chaperonin containing TCP-1
           epsilon subunit, complete cds.>gb:MMCCTEP_2114452
           M.musculus (129/Sv) Ccte mRNA for CCT (chaperonin
           containing TCP-1) epsilon subunit.
          Length = 541

 Score =  136 bits (342), Expect = 7e-31
 Identities = 78/205 (38%), Positives = 120/205 (58%), Gaps = 1/205 (0%)
 Frame = -1

Query: 956 EIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVR 777
           EIE I        +       +EKLG A +V+E+S G     + +       R  ++ +R
Sbjct: 329 EIELIAIATGGRIVPRFSELTSEKLGFAGVVQEISFGTTKDKMLVIEKCKNSRAVTIFIR 388

Query: 776 GSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCV 597
           G N+++I+EA+RSLHDALCV+R L+    ++ GGGA EI  +  +   A     +E Y +
Sbjct: 389 GGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAM 448

Query: 596 KSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINA-GINVRKGQITNILEENVVQ 420
           ++FA++LEVIP  L+EN+G+NPI  +TE+R R  +    A GI+       ++  ++V++
Sbjct: 449 RAFADALEVIPMALSENSGMNPIQTMTEVRARQVKESNPALGIDCLHKGSNDMQYQHVIE 508

Query: 419 PLLVSTSAISLATECVRMILKIDDI 345
            L+     ISLAT+ VRMILKIDDI
Sbjct: 509 TLIGKKQQISLATQMVRMILKIDDI 533



>gb:BC079441_2107549 Rattus norvegicus chaperonin containing TCP1,
           subunit 5 (epsilon), mRNA (cDNA clone MGC:94989
           IMAGE:7115414), complete cds.
          Length = 541

 Score =  135 bits (340), Expect = 1e-30
 Identities = 78/205 (38%), Positives = 119/205 (58%), Gaps = 1/205 (0%)
 Frame = -1

Query: 956 EIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVR 777
           EIE I        +       +EKLG A +V E+S G     + +       R  ++ +R
Sbjct: 329 EIELIAIATGGRIVPRFSELTSEKLGFAGVVREISFGTTKDKMLVIEQCKNSRAVTIFIR 388

Query: 776 GSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCV 597
           G N+++I+EA+RSLHDALCV+R L+    ++ GGGA EI  +  +   A     +E Y +
Sbjct: 389 GGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAM 448

Query: 596 KSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINA-GINVRKGQITNILEENVVQ 420
           ++FA++LEVIP  L+EN+G+NPI  +TE+R R  +    A GI+       ++  ++V++
Sbjct: 449 RAFADALEVIPMALSENSGMNPIQTMTEVRARQVKESNPALGIDCLHKGSNDMQYQHVIE 508

Query: 419 PLLVSTSAISLATECVRMILKIDDI 345
            L+     ISLAT+ VRMILKIDDI
Sbjct: 509 TLIGKKQQISLATQMVRMILKIDDI 533



>gb:AY054210_1563032 Arabidopsis thaliana AT5g20890/F22D1_60 mRNA,
           complete cds.>gb:AY062651_1565307 Arabidopsis thaliana
           Unknown protein mRNA, complete cds.>gb:AY085104_1570186
           Arabidopsis thaliana clone 12972 mRNA, complete
           sequence.>gb:BT002090_1635693 Arabidopsis thaliana
           Unknown protein (At5g20890) mRNA, complete cds.
          Length = 527

 Score =  135 bits (340), Expect = 1e-30
 Identities = 68/183 (37%), Positives = 118/183 (64%)
 Frame = -1

Query: 887 KLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRC 708
           KLGH  L+EE+ +G+  K++  +G + MG+  S+++RG++  V+DEAERSLHDALCV+  
Sbjct: 337 KLGHCKLIEEIMIGED-KLIHFSGCE-MGQACSIVLRGASHHVLDEAERSLHDALCVLSQ 394

Query: 707 LVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPI 528
            V+   ++ GGG PE+ +++++   A+   G + + +++F+ +L  IP T+A+NAGL+  
Sbjct: 395 TVNDTRVLLGGGWPEMVMAKEVDELARKTAGKKSHAIEAFSRALVAIPTTIADNAGLDSA 454

Query: 527 TIVTELRNRHAQGEINAGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDD 348
            +V +LR  H     NAGI+V  G + ++ E  + +   V  + +  ATE   MIL++D+
Sbjct: 455 ELVAQLRAEHHTEGCNAGIDVITGAVGDMEERGIYEAFKVKQAVLLSATEASEMILRVDE 514

Query: 347 IVT 339
           I+T
Sbjct: 515 IIT 517



>gb:AE017341_1753888 Cryptococcus neoformans var. neoformans JEC21
           chromosome 1, complete sequence.
          Length = 548

 Score =  135 bits (339), Expect = 2e-30
 Identities = 77/217 (35%), Positives = 125/217 (57%), Gaps = 1/217 (0%)
 Frame = -1

Query: 989 KIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQ 810
           ++  ++ V   EIE I    N   +   E   A+KLGHA +V E++ G     + +    
Sbjct: 324 ELPAVRWVGGPEIELIAIATNGRIVPRFEDLTADKLGHAGVVRELTFGTTRDKMLVIEEC 383

Query: 809 DMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWA 630
              R  +V VRGSN+++IDEA+R+LHDA+CV R LV    ++ GGGA EI  S  +   A
Sbjct: 384 ANSRAVTVFVRGSNKMIIDEAKRALHDAICVARNLVRDNRVVYGGGAAEICASVAVSKRA 443

Query: 629 KVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRH-AQGEINAGINVRKGQ 453
             +  +E Y +++FA +L+ IP  LAEN+GL+PI  + ++++R   +G    GI+     
Sbjct: 444 DEIPTIEQYAMRAFANALDAIPLALAENSGLSPIDTLADVKSRQVTEGNPRLGIDCLGRA 503

Query: 452 ITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
             ++ +++V  PL+       LAT+ VRMIL++DD++
Sbjct: 504 ENDMKKQHVYDPLISKRQQFLLATQVVRMILRVDDVI 540



>gb:AE017261_419752 Picrophilus torridus DSM 9790, complete genome.
          Length = 546

 Score =  135 bits (339), Expect = 2e-30
 Identities = 75/218 (34%), Positives = 128/218 (58%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I  ++ V++ ++E + K      + +++    + LG A+ VEE  +GD  ++  ITG
Sbjct: 304 KEGIYAVRRVKQSDMEKLAKATGAKIVTDLDDLTPDSLGTAEKVEERKIGDD-RMTFITG 362

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  S+L+RG  + V+DE ER+LHDA+ VV         + GGGA E ELS ++  
Sbjct: 363 AKNP-KAVSILIRGGTEHVVDEIERALHDAIRVVAITKEDGKYLPGGGAIEAELSMKIRD 421

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A  + G E   +++FA++LE+IP TLAENAG++PI  + +L+  H +   N GIN+ + 
Sbjct: 422 YANSVGGREQLAIEAFAKALEIIPRTLAENAGMDPINTLIKLKAEHEKSNKNYGINLNEN 481

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           +I ++++  V     V   A+  A E   MIL+IDD++
Sbjct: 482 KIDDMVKLGVFDTYRVKQHALESAVEVASMILRIDDVI 519



>gb:TACID4_196739 Thermoplasma acidophilum complete genome; segment
           4/5.
          Length = 549

 Score =  135 bits (339), Expect = 2e-30
 Identities = 73/218 (33%), Positives = 127/218 (58%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I  ++ V++ ++E + K      + +++      LG A+ VEE  +GD  ++  + G
Sbjct: 308 KEGIYAVRRVKKSDMEKLAKATGAKIVTDLDDLTPSVLGEAETVEERKIGDD-RMTFVMG 366

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  S+L+RG    V+ E ER+L+DA+ VV         + GGGA E EL+ +L  
Sbjct: 367 CKNP-KAVSILIRGGTDHVVSEVERALNDAIRVVAITKEDGKFLWGGGAVEAELAMRLAK 425

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A  + G E   +++FA++LE+IP TLAENAG++PI  + +L+  H +G I+ G+++   
Sbjct: 426 YANSVGGREQLAIEAFAKALEIIPRTLAENAGIDPINTLIKLKAEHEKGRISVGVDLDNN 485

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            + ++  + VV PL V T A+  A E   MIL+IDD++
Sbjct: 486 GVGDMKAKGVVDPLRVKTHALESAVEVATMILRIDDVI 523



>sp|P48424|THSA_THEAC Thermosome alpha subunit (Thermosome subunit
           1) (Chaperonin alpha subunit).>gb:TATHSASUB_197335
           T.acidophilum gene for alpha-subunit of the thermosome.
          Length = 545

 Score =  135 bits (339), Expect = 2e-30
 Identities = 73/218 (33%), Positives = 127/218 (58%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I  ++ V++ ++E + K      + +++      LG A+ VEE  +GD  ++  + G
Sbjct: 304 KEGIYAVRRVKKSDMEKLAKATGAKIVTDLDDLTPSVLGEAETVEERKIGDD-RMTFVMG 362

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  S+L+RG    V+ E ER+L+DA+ VV         + GGGA E EL+ +L  
Sbjct: 363 CKNP-KAVSILIRGGTDHVVSEVERALNDAIRVVAITKEDGKFLWGGGAVEAELAMRLAK 421

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A  + G E   +++FA++LE+IP TLAENAG++PI  + +L+  H +G I+ G+++   
Sbjct: 422 YANSVGGREQLAIEAFAKALEIIPRTLAENAGIDPINTLIKLKAEHEKGRISVGVDLDNN 481

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            + ++  + VV PL V T A+  A E   MIL+IDD++
Sbjct: 482 GVGDMKAKGVVDPLRVKTHALESAVEVATMILRIDDVI 519



>sp|Q9UTM4|TCPE_SCHPO T-complex protein 1, epsilon subunit
           (TCP-1-epsilon) (CCT-epsilon).>pir|T37665|T37665
           probable t-complex protein 1, epsilon subunit - fission
           yeast (Schizosaccharomyces pombe)>gb:SPAC1420_1716490
           S.pombe chromosome I cosmid c1420.
          Length = 546

 Score =  134 bits (337), Expect = 3e-30
 Identities = 75/206 (36%), Positives = 122/206 (59%), Gaps = 1/206 (0%)
 Frame = -1

Query: 956 EIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVR 777
           EIE I    N   +   E   ++KLG A +V EVS G     + +       R  +V VR
Sbjct: 331 EIELIAIATNGRIVPRFEDLSSDKLGSAGIVREVSFGTTRDKILVIEKCANSRAVTVFVR 390

Query: 776 GSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCV 597
           GSN++++DEA+R+LHDALCVVR L+    ++ GGGA EI  S  +   A+ + G++ Y +
Sbjct: 391 GSNKMIVDEAKRALHDALCVVRNLIRDNRVVYGGGAAEISCSLAVTKEAEKIPGIDQYSM 450

Query: 596 KSFAESLEVIPYTLAENAGLNPITIVTELRNRHA-QGEINAGINVRKGQITNILEENVVQ 420
            +FA++L+ IP  LAEN+GL+ I  +T ++ RH  + +   GI+  +    ++ ++ V+ 
Sbjct: 451 GAFADALDTIPLALAENSGLSSIEALTAVKARHVKENKAYLGIDCLQTGSNDMRKQFVID 510

Query: 419 PLLVSTSAISLATECVRMILKIDDIV 342
           PL+     + LAT+  RM+LK++DI+
Sbjct: 511 PLIGKKQQLLLATQLCRMVLKVNDII 536



>gb:AF226724_1252686 Giardia intestinalis chaperonin subunit epsilon
            CCTepsilon (Ccte) gene, complete cds.
          Length = 553

 Score =  134 bits (336), Expect = 4e-30
 Identities = 80/226 (35%), Positives = 130/226 (57%), Gaps = 10/226 (4%)
 Frame = -1

Query: 986  IMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGG-KIVKITGIQ 810
            I  ++ V+ ++IE I        I   E   ++KLG+A++V EVSLG    K++   G+Q
Sbjct: 325  INAVRWVKGEDIEAIALITGARIIPRFEDISSDKLGYAEIVREVSLGTSSDKVMIFEGLQ 384

Query: 809  DMGRTA--------SVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIEL 654
                TA        +V +RG N ++I+EA RSLHDA+CVVR L+    +I GGG+ EI  
Sbjct: 385  PQQTTADSVPHMISTVFIRGGNNMIIEEARRSLHDAMCVVRNLIRDPRVIYGGGSAEISC 444

Query: 653  SRQLGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPI-TIVTELRNRHAQGEINA 477
            S  +   A+ +  +E Y +++F+E+L++IP TLA N+ + PI T+      +   G  + 
Sbjct: 445  SLAIAEAAEHVGTVEQYALRAFSEALDIIPLTLARNSSIQPIETLAMVKAAQKKTGSHHL 504

Query: 476  GINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVT 339
            GI+  +    ++ E++V + L      + LAT+ VRMILKID+++T
Sbjct: 505  GIDCMQRNTIDMKEQSVFETLSSKVQQLLLATQVVRMILKIDEVIT 550



>sp|P28488|THSB_SULSH Thermosome beta subunit (Thermosome subunit 2)
           (Chaperonin beta subunit) (Thermophilic factor 55 beta)
           (TF55-beta) (Ring complex beta
           subunit).>pir|S19647|S19647 T-complex protein 1 homolog
           - Sulfolobus shibatae>gb:SSTF55A_191050 Sulfolobus
           shibatae TF55 gene for thermophilic factor 55.
          Length = 552

 Score =  133 bits (334), Expect = 6e-30
 Identities = 77/220 (35%), Positives = 137/220 (62%), Gaps = 2/220 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++  ++ ++E + +      I+N++   ++ LG+A LVEE  +G+  K+V + G
Sbjct: 313 KKGILAVRRAKKSDLEKLARATGGRVISNIDELTSQDLGYAALVEERKVGED-KMVFVEG 371

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  ++ S+L+RG  + V+DE ER+L DAL  V  ++     +AGGGA EIE++++L  
Sbjct: 372 AKNP-KSVSILIRGGLERVVDETERALRDALGTVADVIRDGRAVAGGGAVEIEIAKRLRK 430

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINA--GINVR 462
           +A  + G E   ++++A ++E +   LAENAGL+PI  + +LR+ H + E N   G+N+ 
Sbjct: 431 YAPQVGGKEQLAIEAYANAIEGLIMILAENAGLDPIDKLMQLRSLH-ENETNKWYGLNLF 489

Query: 461 KGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            G   ++ +  V++P LV  +AI  ATE V ++L+IDDIV
Sbjct: 490 TGNPEDMWKLGVIEPALVKMNAIKAATEAVTLVLRIDDIV 529



>pir|E90170|E90170 hypothetical protein thsB [imported] - Sulfolobus
           solfataricus>gb:AE006663_221218 Sulfolobus solfataricus
           P2 section 22 of 272 of the complete
           genome.>gb:AE006641_1107066 Sulfolobus solfataricus P2,
           complete genome.
          Length = 557

 Score =  132 bits (333), Expect = 8e-30
 Identities = 76/220 (34%), Positives = 137/220 (62%), Gaps = 2/220 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++  ++ ++E + +      I+N++   ++ LG+A LVEE  +G+  K+V + G
Sbjct: 316 KKGILAVRRAKKSDLEKLARATGGRVISNIDELTSQDLGYAALVEERKVGED-KMVFVEG 374

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  ++ S+L+RG  + V+DE ER+L DAL  V  ++     +AGGGA EIE++++L  
Sbjct: 375 AKNP-KSVSILIRGGLERVVDETERALRDALGTVADVIRDGRAVAGGGAVEIEIAKRLRK 433

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINA--GINVR 462
           +A  + G E   ++++A ++E +   LAENAGL+PI  + +LR+ H + E N   G+N+ 
Sbjct: 434 YAPQVGGKEQLAIEAYANAIEGLIMILAENAGLDPIDKLMQLRSLH-ENETNKWYGLNLF 492

Query: 461 KGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            G   ++ +  V++P LV  +A+  ATE V ++L+IDDIV
Sbjct: 493 TGNPEDMWKLGVIEPALVKMNAVKAATEAVTLVLRIDDIV 532



>sp|Q9V2T8|THSB_SULSO Thermosome beta subunit (Thermosome subunit 2)
           (Chaperonin beta subunit) (Thermophilic factor 55 beta)
           (TF55-beta).
          Length = 554

 Score =  132 bits (333), Expect = 8e-30
 Identities = 76/220 (34%), Positives = 137/220 (62%), Gaps = 2/220 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++  ++ ++E + +      I+N++   ++ LG+A LVEE  +G+  K+V + G
Sbjct: 313 KKGILAVRRAKKSDLEKLARATGGRVISNIDELTSQDLGYAALVEERKVGED-KMVFVEG 371

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  ++ S+L+RG  + V+DE ER+L DAL  V  ++     +AGGGA EIE++++L  
Sbjct: 372 AKNP-KSVSILIRGGLERVVDETERALRDALGTVADVIRDGRAVAGGGAVEIEIAKRLRK 430

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINA--GINVR 462
           +A  + G E   ++++A ++E +   LAENAGL+PI  + +LR+ H + E N   G+N+ 
Sbjct: 431 YAPQVGGKEQLAIEAYANAIEGLIMILAENAGLDPIDKLMQLRSLH-ENETNKWYGLNLF 489

Query: 461 KGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            G   ++ +  V++P LV  +A+  ATE V ++L+IDDIV
Sbjct: 490 TGNPEDMWKLGVIEPALVKMNAVKAATEAVTLVLRIDDIV 529



>gb:AY223856_598995 Acidianus tengchongenses chaperonin gene,
           complete cds.
          Length = 553

 Score =  132 bits (332), Expect = 1e-29
 Identities = 73/221 (33%), Positives = 137/221 (61%), Gaps = 2/221 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  ++ ++  ++ ++E + +      ++N++    + LG+A L+EE  +G+  K+V + G
Sbjct: 314 KKGVLAVRRAKKSDLEKLARATGGRVVSNIDEISEQDLGYASLIEERKVGED-KMVFVEG 372

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  ++ S+L+RG  + ++DE ER+L DAL  V  ++     IAGGGA EIE++++L  
Sbjct: 373 AKNP-KSISILIRGGLERLVDETERALRDALGTVADVIKDGRAIAGGGAVEIEIAKKLRK 431

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINA--GINVR 462
           +A  + G E   V+++A +LE +   L ENAG +PI ++ +LR+ H + E N   GI++ 
Sbjct: 432 YAPQVGGKEQLAVEAYANALESLVSILIENAGFDPIDLLMKLRSTH-ENENNKWYGIDLY 490

Query: 461 KGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVT 339
            GQ  ++ ++ V++P LV  +AI  ATE   ++L+IDD+V+
Sbjct: 491 AGQPVDMWQKGVIEPALVKMNAIKAATEAATLVLRIDDVVS 531



>gb:AB027708_2461236 Carassius auratus mRNA for CCT (chaperonin
           containing T-complex polypeptide 1) epsilon subunit,
           complete cds.
          Length = 541

 Score =  132 bits (331), Expect = 1e-29
 Identities = 77/216 (35%), Positives = 123/216 (56%), Gaps = 1/216 (0%)
 Frame = -1

Query: 989 KIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQ 810
           ++  ++ V   EIE I        +        EKLG A LV+E+  G     + +    
Sbjct: 318 ELPAVRWVGGPEIELIAIATGGRIVPRFCELTPEKLGSAGLVKEICFGTTKDKMLVIEEC 377

Query: 809 DMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWA 630
              R  ++ +RG N+++I+EA+R+LHDALCV+R LV    ++ GGGA EI  +  +   A
Sbjct: 378 KNSRAVTIFIRGGNKMIIEEAKRALHDALCVIRNLVRDHRIVYGGGASEISCALAVNQAA 437

Query: 629 KVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINA-GINVRKGQ 453
                +E Y +++FA++LEVIP  LAEN+G+NPI  + E+R +  +    A GI+     
Sbjct: 438 DKCPSLEQYAMRAFADALEVIPMALAENSGMNPIQTMAEVRAQQVKENNPALGIDCLHLS 497

Query: 452 ITNILEENVVQPLLVSTSAISLATECVRMILKIDDI 345
             ++ +++V++ L+     ISLAT+ V+MILKIDDI
Sbjct: 498 TNDMKQQHVIETLIGKKQQISLATQVVKMILKIDDI 533



>gb:BA000023_690880 Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 559

 Score =  132 bits (331), Expect = 1e-29
 Identities = 73/220 (33%), Positives = 134/220 (60%), Gaps = 2/220 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++  ++ ++E + +      ++N++    + LG+A LVEE  +G+  K+V + G
Sbjct: 321 KKGILAVRRAKKSDLEKLARATGGRVVSNIDELTPQDLGYAALVEERKVGED-KMVFVEG 379

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  S+L+RG  + V+DE ER+L DAL  V  ++     +AGGGA E+E++++L  
Sbjct: 380 AKNP-KAVSILIRGGLERVVDETERALRDALGTVADVIRDGRAVAGGGAVELEIAKRLRK 438

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINA--GINVR 462
           +A  + G E   ++++A +LE +   L EN G +PI ++ +LR+ H + E N   GINV 
Sbjct: 439 YAPQIGGKEQLAIEAYASALENLVMILIENGGYDPIDLLVKLRSAH-ENEANKWYGINVF 497

Query: 461 KGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            GQ+ ++ +  V++P +V  +AI  ATE   +IL+IDD++
Sbjct: 498 TGQVEDMWKLGVIEPAVVKMNAIKAATEAATLILRIDDLI 537



>sp|O24735|THSB_SULTO Thermosome beta subunit (Thermosome subunit 2)
           (Chaperonin beta subunit).>pir|JC5617|JC5617 group II
           chaperonin beta chain - Sulfolobus sp.>gb:AB001086_272
           Sulfolobus sp. DNA for chaperonin beta subunit, complete
           cds.
          Length = 552

 Score =  132 bits (331), Expect = 1e-29
 Identities = 73/220 (33%), Positives = 134/220 (60%), Gaps = 2/220 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++  ++ ++E + +      ++N++    + LG+A LVEE  +G+  K+V + G
Sbjct: 314 KKGILAVRRAKKSDLEKLARATGGRVVSNIDELTPQDLGYAALVEERKVGED-KMVFVEG 372

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  S+L+RG  + V+DE ER+L DAL  V  ++     +AGGGA E+E++++L  
Sbjct: 373 AKNP-KAVSILIRGGLERVVDETERALRDALGTVADVIRDGRAVAGGGAVELEIAKRLRK 431

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINA--GINVR 462
           +A  + G E   ++++A +LE +   L EN G +PI ++ +LR+ H + E N   GINV 
Sbjct: 432 YAPQIGGKEQLAIEAYASALENLVMILIENGGYDPIDLLVKLRSAH-ENEANKWYGINVF 490

Query: 461 KGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            GQ+ ++ +  V++P +V  +AI  ATE   +IL+IDD++
Sbjct: 491 TGQVEDMWKLGVIEPAVVKMNAIKAATEAATLILRIDDLI 530



>pir|S53816|S53816 thermosome alpha chain - Thermoplasma acidophilum
          Length = 545

 Score =  130 bits (328), Expect = 3e-29
 Identities = 72/218 (33%), Positives = 126/218 (57%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I  ++ V++ ++E + K      + +++      LG A+ VEE  +GD  ++  + G
Sbjct: 304 KEGIYAVRRVKKSDMEKLAKATGAKIVTDLDDLTPSVLGEAETVEERKIGDD-RMTFVMG 362

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  S+L+RG    V+ E ER+L+DA+ VV         + GGGA E EL+ +L  
Sbjct: 363 CKNP-KAVSILIRGGTDHVVSEVERALNDAIRVVAITKEDGKFLWGGGAVEAELAMRLAK 421

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A  + G E   +++FA++LE+IP TLAENAG++PI  + +L+    +G I+ G+++   
Sbjct: 422 YANSVGGREQLAIEAFAKALEIIPRTLAENAGIDPINTLIKLKADDEKGRISVGVDLDNN 481

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            + ++  + VV PL V T A+  A E   MIL+IDD++
Sbjct: 482 GVGDMKAKGVVDPLRVKTHALESAVEVATMILRIDDVI 519



>gb:AC107206_1738350 Oryza sativa chromosome 3 BAC OSJNBa0063J18
           genomic sequence, complete sequence.
          Length = 525

 Score =  130 bits (327), Expect = 4e-29
 Identities = 66/216 (30%), Positives = 132/216 (61%)
 Frame = -1

Query: 986 IMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQD 807
           I+ I+  + + IE +         +  ++  + KLGH +++EE+ +G+  K++  +G+  
Sbjct: 302 ILAIEHADFEGIERLALVTGGDIASTFDNPESVKLGHCNVIEEIMIGED-KLIHFSGVA- 359

Query: 806 MGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAK 627
           MG+  ++++RG+++ V+DEAERSLHDALCV+   V+   ++ GGG PE+ +++ +   A+
Sbjct: 360 MGQACTIVLRGASEHVLDEAERSLHDALCVLSQTVNDTRVLFGGGWPEMVMAKAVDDLAR 419

Query: 626 VLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQIT 447
              G + + + +F+ +L+ IP  +A+NAGL+   ++++LR  H +    AGI+V  G + 
Sbjct: 420 KTPGKKSHAIDAFSRALQAIPTIIADNAGLDSAELISQLRAEHHKENCTAGIDVITGSVG 479

Query: 446 NILEENVVQPLLVSTSAISLATECVRMILKIDDIVT 339
           ++ +  + +   V  + +  ATE   MIL++D+I+T
Sbjct: 480 DMQKRGISEAFKVKQAILLSATEAAEMILRVDEIIT 515



>gb:AF442548_1271412 Physarum polycephalum CCT chaperonin theta
           subunit mRNA, complete cds.
          Length = 536

 Score =  130 bits (327), Expect = 4e-29
 Identities = 69/224 (30%), Positives = 121/224 (54%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           + KIM IK   + ++  I K +   PI  +     E+LGH D+V    +G   ++     
Sbjct: 300 RYKIMAIKTPSKFQLRRICKAIRATPIVKIGAPTQEELGHCDVVTVEEIGST-QVTIFRQ 358

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++    A+++VRGS   ++D+ ER++ D + V + +      +AG  A EIE++R+L  
Sbjct: 359 NKEESAVATIVVRGSTDNIMDDVERAIDDGVNVYKSMCKDGRFVAGAAAAEIEIARRLQI 418

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +A    G+E Y ++ +AES EV+  TLAEN+G N   I++ L   H +G  N G+++  G
Sbjct: 419 FADSTPGLEQYAIRKYAESFEVVARTLAENSGHNATEIISNLYAAHTKGNTNGGLDIETG 478

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR*IG 324
           ++ +  E  ++  L+   SAI LAT     +L++D I+  +  G
Sbjct: 479 EVVDAKERAILDLLITKQSAIRLATMTAATVLRVDQIIVAKPAG 522



>gb:AP003714_1832367 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0656E03.
          Length = 535

 Score =  129 bits (325), Expect = 7e-29
 Identities = 73/207 (35%), Positives = 117/207 (56%), Gaps = 1/207 (0%)
 Frame = -1

Query: 956 EIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVR 777
           E+E I        +   +    EKLG A +V E S G     +         R  ++ +R
Sbjct: 325 ELELIAIATGGRIVPRFQELSPEKLGKAGIVREKSFGTTKDRMLYIEQCANSRAVTIFIR 384

Query: 776 GSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCV 597
           G N+++I+E +RSLHDALCV R L+    ++ GGG+ EI  S  + A A    G+E Y +
Sbjct: 385 GGNKMMIEETKRSLHDALCVARNLIRNNSIVYGGGSAEISCSVAVEAAADRYPGVEQYAI 444

Query: 596 KSFAESLEVIPYTLAENAGLNPITIVTELRNRHA-QGEINAGINVRKGQITNILEENVVQ 420
           +SFA++L+ IP  LAEN+GL+PI  +T ++++   +   + GI+       ++ E+NV +
Sbjct: 445 RSFADALDAIPLALAENSGLSPIDTLTAVKSQQVKESNPHCGIDCNDVGTNHMKEQNVFE 504

Query: 419 PLLVSTSAISLATECVRMILKIDDIVT 339
            L+     I LAT+ V+MILKIDD+++
Sbjct: 505 TLIGKQQQILLATQVVKMILKIDDVIS 531



>gb:AC104709_1737779 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1214_E03, complete sequence.
          Length = 289

 Score =  129 bits (325), Expect = 7e-29
 Identities = 65/216 (30%), Positives = 134/216 (62%)
 Frame = -1

Query: 986 IMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQD 807
           I+ I+  + + IE +         +  ++  + KLGH  ++EE+ +G+  +++  +G++ 
Sbjct: 66  ILAIEHADFEGIERLALVTGGDIASTFDNPESVKLGHCKVIEEIMIGED-RLIHFSGVE- 123

Query: 806 MGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAK 627
           MG+  ++++RG+++ V+DEAERSLHDALCV+   V+   ++ GGG PE+ +++++   A+
Sbjct: 124 MGQACTIVLRGASEHVLDEAERSLHDALCVLSQTVNDTRVLYGGGWPEMVMAKEVDGLAR 183

Query: 626 VLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQIT 447
              G + + +++F+ +L+ IP  +A+NAGL+   ++++LR  H + +  AGI+V  G + 
Sbjct: 184 KTPGKKSHAIEAFSRALQSIPTIIADNAGLDSADLISQLRAEHHKEQSTAGIDVISGGVG 243

Query: 446 NILEENVVQPLLVSTSAISLATECVRMILKIDDIVT 339
           ++ +  + +      + +  ATE   MIL++D+IVT
Sbjct: 244 DMEKLGISESFKAKQAVLMSATEAAEMILRVDEIVT 279



>sp|P54411|TCE2_AVESA T-complex protein 1, epsilon subunit
           (TCP-1-epsilon) (CCT-epsilon)
           (TCP-K36).>pir|S40462|S40462 t-complex-type molecular
           chaperone tcp1 (clone ASTCP-K36) -
           oat>gb:ASTCPP1A_1542587 A.sativa (Pewi) ASTCP-K36 mRNA
           for t complex polypeptide 1.
          Length = 535

 Score =  129 bits (325), Expect = 7e-29
 Identities = 73/207 (35%), Positives = 116/207 (56%), Gaps = 1/207 (0%)
 Frame = -1

Query: 956 EIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVR 777
           E+E I        +   +    EKLG A LV E S G     +         +  ++ +R
Sbjct: 325 ELELIAIATGGRIVPRFQELSTEKLGKAGLVREKSFGTTKDRMLYIEKCANSKAVTIFIR 384

Query: 776 GSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCV 597
           G N+++I+E +RS+HDALCV R L+    ++ GGG+ EI  S  + A A    G+E Y +
Sbjct: 385 GGNKMMIEETKRSIHDALCVARNLIINNSIVYGGGSAEISCSIAVEAAADRHPGVEQYAI 444

Query: 596 KSFAESLEVIPYTLAENAGLNPITIVTELRNRHA-QGEINAGINVRKGQITNILEENVVQ 420
           ++FA++L+ IP  LAEN+GL PI  +T ++++H  +     GI+       ++ E+NV +
Sbjct: 445 RAFADALDAIPLALAENSGLPPIDTLTVVKSQHVKENNSRCGIDCNDVGTNDMKEQNVFE 504

Query: 419 PLLVSTSAISLATECVRMILKIDDIVT 339
            L+     I LAT+ V+MILKIDD++T
Sbjct: 505 TLIGKQQQILLATQVVKMILKIDDVIT 531



>sp|P40412|TCE1_AVESA T-complex protein 1, epsilon subunit
           (TCP-1-epsilon) (CCT-epsilon)
           (TCP-K19).>pir|S40461|S40461 t-complex-type molecular
           chaperone tcp1 (clone ASTCP-K19) -
           oat>gb:ASTCPP1_1542586 A.sativa (Pewi) ASTCP-K19 mRNA
           for t complex polypeptide 1.
          Length = 535

 Score =  129 bits (325), Expect = 7e-29
 Identities = 73/207 (35%), Positives = 116/207 (56%), Gaps = 1/207 (0%)
 Frame = -1

Query: 956 EIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVR 777
           E+E I        +   +    EKLG A LV E S G     +         +  ++ +R
Sbjct: 325 ELELIAIATGGRIVPRFQELSTEKLGKAGLVREKSFGTTKDRMLYIEKCANSKAVTIFIR 384

Query: 776 GSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCV 597
           G N+++I+E +RS+HDALCV R L+    ++ GGG+ EI  S  + A A    G+E Y +
Sbjct: 385 GGNKMMIEETKRSIHDALCVARNLIINNSIVYGGGSAEISCSIAVEAAADRHPGVEQYAI 444

Query: 596 KSFAESLEVIPYTLAENAGLNPITIVTELRNRHA-QGEINAGINVRKGQITNILEENVVQ 420
           ++FA++L+ IP  LAEN+GL PI  +T ++++H  +     GI+       ++ E+NV +
Sbjct: 445 RAFADALDAIPLALAENSGLPPIDTLTVVKSQHVKENNSRCGIDCNDVGTNDMKEQNVFE 504

Query: 419 PLLVSTSAISLATECVRMILKIDDIVT 339
            L+     I LAT+ V+MILKIDD++T
Sbjct: 505 TLIGKQQQILLATQVVKMILKIDDVIT 531



>gb:CR382131_1664353 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 551

 Score =  128 bits (322), Expect = 2e-28
 Identities = 76/216 (35%), Positives = 118/216 (54%), Gaps = 1/216 (0%)
 Frame = -1

Query: 986 IMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQD 807
           I  ++ V   EIE +        +   E   A KLGHA  V E+  G     + +     
Sbjct: 329 IAAVRWVGGPEIELLAIATGARIVPRFEDLSAAKLGHAGRVRELEFGTTRDRMLVVEECA 388

Query: 806 MGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAK 627
             R  +V VRGSN++++DEA+R+LHDA+CVVR LV    ++ GGGA EI  +  +   A 
Sbjct: 389 NPRAVTVFVRGSNKMIVDEAKRALHDAICVVRNLVRDNRVVYGGGAAEIACAIAVAEKAD 448

Query: 626 VLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHA-QGEINAGINVRKGQI 450
            + G++ Y  ++FA +LE IP  LA+N+GL+ I  +  +++R   +G    GI+      
Sbjct: 449 HMTGIDQYAFRAFANALEAIPTALADNSGLSSIESLASVKSRQVKEGNSRLGIDCLNTGN 508

Query: 449 TNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            ++ E  VV PL+     + LAT+  RMILKI+D++
Sbjct: 509 NDMRENFVVDPLIGKRQQLLLATQLTRMILKINDVI 544



>gb:AF442546_1271410 Physarum polycephalum CCT chaperonin beta
           subunit mRNA, complete cds.
          Length = 538

 Score =  127 bits (320), Expect = 3e-28
 Identities = 68/215 (31%), Positives = 126/215 (58%)
 Frame = -1

Query: 986 IMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQD 807
           +MVI+  + D IE I +       +  +H    KLG   L+EE+ +G+  ++++ +G+  
Sbjct: 310 VMVIEHADFDGIERIARVTGGEIASTFDHPDLVKLGECKLIEEIMIGED-QMIRFSGVP- 367

Query: 806 MGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAK 627
           +G   ++++RG+   ++DE ERSLHDALCV+  +VS+   + GGG  E+ +S+ +   AK
Sbjct: 368 VGGACTIVLRGATSHMLDETERSLHDALCVLSQVVSESKTVFGGGCAEMIMSKAIDEVAK 427

Query: 626 VLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQIT 447
              G +   + SF+++L  IP  LA+N G +   +V++LR  H +G I  G+N++ G + 
Sbjct: 428 QTPGKKALALDSFSKALRQIPTILADNGGYDSGELVSQLRAEHYKGHITTGLNMKDGSVG 487

Query: 446 NILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           ++ +  +++ L V    +  A E   MIL++D+I+
Sbjct: 488 DMEKLGILEALKVKQQVLISAAEAAEMILRVDNII 522



>gb:AC024827_1204872 Caenorhabditis elegans cosmid Y55F3AR, complete
           sequence.
          Length = 581

 Score =  127 bits (320), Expect = 3e-28
 Identities = 71/218 (32%), Positives = 119/218 (54%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K KIM ++   + ++  + +T+   P A +       LGH D V    +GD   +V    
Sbjct: 340 KYKIMAVRLTSKFDLRRLCRTVGAQPQARICAPAVNLLGHCDSVAVQEIGDENVVV-FDK 398

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
             + G+ A++++RGS+Q  ID+ ER++ DA+   + L     L+AG GA EIEL++++ +
Sbjct: 399 KSETGKVATIIIRGSSQSRIDDVERAVDDAVNTYKALTKDGKLLAGAGAVEIELAKEIES 458

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKG 456
           +     G+E Y +K FA +LE +P  +AENAG+     +T+L   H  G+ NAGI++ K 
Sbjct: 459 FGAKAPGLEQYAIKKFAHALETLPKAIAENAGMPTTETLTKLYAEHVAGKKNAGIDIWKR 518

Query: 455 QITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           +  + +  N+         AI LAT+    ILK+D I+
Sbjct: 519 ETMDAVVNNIFDLYAGKRLAIKLATDAASTILKVDQII 556



>gb:AE014298_1124891 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE014298_1124892 Drosophila melanogaster
           chromosome X, complete sequence.>gb:AE003446_1210073
           Drosophila melanogaster chromosome X, section 30 of 74
           of the complete sequence.>gb:AE003446_1210074 Drosophila
           melanogaster chromosome X, section 30 of 74 of the
           complete sequence.
          Length = 533

 Score =  127 bits (320), Expect = 3e-28
 Identities = 66/216 (30%), Positives = 126/216 (58%)
 Frame = -1

Query: 989 KIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQ 810
           ++M I+  + D IE +        ++  E+    KLG  D++E+V +G+   +++ +G++
Sbjct: 306 RVMSIEHADFDGIERLAYCTGGEIVSTFENPSLVKLGECDVIEQVMIGED-TLLRFSGVK 364

Query: 809 DMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWA 630
            +G   ++++RG+ Q ++DEA+RSLHDALCV+   V +  +I GGG  E  ++  +   A
Sbjct: 365 -LGEACTIVIRGATQQILDEADRSLHDALCVLAATVKESRIIFGGGCSEALMATAVLKKA 423

Query: 629 KVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQI 450
               G E   +++FA +L  +P  +A+NAG +   +V+ELR  HAQG+   G+++  G++
Sbjct: 424 AETPGKEAIAIEAFARALLSLPTAIADNAGYDSAQLVSELRAGHAQGKQTLGLDMELGKV 483

Query: 449 TNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            ++ E  + +   V    +  A+E   MIL++D+I+
Sbjct: 484 ADVRELGITESFAVKRQVLMSASEAAEMILRVDNII 519



>gb:AE014298_1124890 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003446_1210072 Drosophila melanogaster
           chromosome X, section 30 of 74 of the complete
           sequence.>gb:AY058756_1291910 Drosophila melanogaster
           SD02216 full length cDNA.
          Length = 535

 Score =  127 bits (320), Expect = 3e-28
 Identities = 66/216 (30%), Positives = 126/216 (58%)
 Frame = -1

Query: 989 KIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQ 810
           ++M I+  + D IE +        ++  E+    KLG  D++E+V +G+   +++ +G++
Sbjct: 308 RVMSIEHADFDGIERLAYCTGGEIVSTFENPSLVKLGECDVIEQVMIGED-TLLRFSGVK 366

Query: 809 DMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWA 630
            +G   ++++RG+ Q ++DEA+RSLHDALCV+   V +  +I GGG  E  ++  +   A
Sbjct: 367 -LGEACTIVIRGATQQILDEADRSLHDALCVLAATVKESRIIFGGGCSEALMATAVLKKA 425

Query: 629 KVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQI 450
               G E   +++FA +L  +P  +A+NAG +   +V+ELR  HAQG+   G+++  G++
Sbjct: 426 AETPGKEAIAIEAFARALLSLPTAIADNAGYDSAQLVSELRAGHAQGKQTLGLDMELGKV 485

Query: 449 TNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            ++ E  + +   V    +  A+E   MIL++D+I+
Sbjct: 486 ADVRELGITESFAVKRQVLMSASEAAEMILRVDNII 521



>gb:PFMAL3P7_1394576 Plasmodium falciparum MAL3P7, complete
           sequence.
          Length = 535

 Score =  127 bits (319), Expect = 3e-28
 Identities = 77/220 (35%), Positives = 123/220 (55%), Gaps = 2/220 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGD-GGKIVKIT 819
           K  I  I+ V   E+E I        I   E     KLG ADL+ E+S G     +V I 
Sbjct: 311 KENIPAIRWVGGVEMELIAIATGGKIIPRFEDIDESKLGKADLIREISHGTVNNPMVYIE 370

Query: 818 GIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLG 639
           G  +  +  ++L+RG NQ++I+E ERS+HDALC VR L+    ++ GGG+ EI  + ++ 
Sbjct: 371 GCSNT-KAITILLRGGNQMMIEECERSVHDALCSVRNLIRDNRILPGGGSTEIYAALEIE 429

Query: 638 AWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEI-NAGINVR 462
             A   +G+E Y +++F  +L  IP  L  N GLN I I++E++ +  Q +  N GI+  
Sbjct: 430 KVADKCKGIEQYAIRAFGNALLSIPINLCNNMGLNSIDIISEIKTKIIQDKTKNLGIDCL 489

Query: 461 KGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
             ++ +++E  + +      +  SLAT+ V+MILKIDD++
Sbjct: 490 NYKVGDMIERGIFETFNSKYNQFSLATQVVKMILKIDDVI 529



>sp|O04450|TCPE_ARATH T-complex protein 1, epsilon subunit
           (TCP-1-epsilon) (CCT-epsilon).>gb:AE005172_891404
           Arabidopsis thaliana chromosome 1, top arm complete
           sequence.>gb:AC000103_1530010 Genomic sequence for
           Arabidopsis thaliana BAC F21J9 from chromosome I,
           complete sequence.>gb:AY075611_1567758 Arabidopsis
           thaliana At1g24510/F21J9_150 mRNA, complete
           cds.>gb:BT000818_1635073 Arabidopsis thaliana T-complex
           chaperonin protein , epsilon subunit
           (At1g24510/F21J9_150) mRNA, complete cds.
          Length = 535

 Score =  127 bits (319), Expect = 3e-28
 Identities = 72/207 (34%), Positives = 118/207 (57%), Gaps = 1/207 (0%)
 Frame = -1

Query: 956 EIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVR 777
           E+E I        +   +    EKLG A +V E S G   + +         +  +V +R
Sbjct: 325 ELELIAIATGGRIVPRFQELTPEKLGKAGVVREKSFGTTKERMLYIEHCANSKAVTVFIR 384

Query: 776 GSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCV 597
           G N+++I+E +RS+HDALCV R L+  + ++ GGGA EI  S  + A A    G+E Y +
Sbjct: 385 GGNKMMIEETKRSIHDALCVARNLIRNKSIVYGGGAAEIACSLAVDAAADKYPGVEQYAI 444

Query: 596 KSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEIN-AGINVRKGQITNILEENVVQ 420
           ++FAE+L+ +P  LAEN+GL PI  ++ ++++  +  I   GI+       ++ E+NV +
Sbjct: 445 RAFAEALDSVPMALAENSGLQPIETLSAVKSQQIKENIPFYGIDCNDVGTNDMREQNVFE 504

Query: 419 PLLVSTSAISLATECVRMILKIDDIVT 339
            L+     I LAT+ V+MILKIDD+++
Sbjct: 505 TLIGKQQQILLATQVVKMILKIDDVIS 531



>gb:CR380952_1650247 Candida glabrata strain CBS138 chromosome F
           complete sequence.
          Length = 565

 Score =  127 bits (318), Expect = 4e-28
 Identities = 70/217 (32%), Positives = 122/217 (56%), Gaps = 1/217 (0%)
 Frame = -1

Query: 989 KIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQ 810
           ++  ++ V   E+E I  + N   +   +    +KLG    + E+  G     + +    
Sbjct: 342 ELPAVRWVGGQELEHIAISTNGRIVPRFQDLSPDKLGECSSIYELEFGTTKDRMLVIEQP 401

Query: 809 DMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWA 630
           +  +T +  +RGSN+++IDEA+R+LHD+LCVVR L+    ++ GGGA E+ +S  +   A
Sbjct: 402 EESKTVTCFIRGSNKMIIDEAQRALHDSLCVVRNLIKDSRIVYGGGAAEVTMSLAVSEEA 461

Query: 629 KVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINA-GINVRKGQ 453
              +G+  Y  K+FA +L+ +P TLAEN+GL+PI  ++ L+++  +  I   G++     
Sbjct: 462 DKQRGIHQYAFKAFANALDTVPMTLAENSGLDPIETLSTLKSKQLKENIPVFGVDCLGKG 521

Query: 452 ITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
             ++ E  VV P +     I LAT+  RMILKID+++
Sbjct: 522 SNDMKELFVVDPFISKKQQIMLATQLCRMILKIDNVI 558



>sp|Q9V2T3|THSB_DESMO Thermosome beta subunit (Thermosome subunit 2)
           (Chaperonin beta subunit) (Fragment).>gb:AF149925_483537
           Desulfurococcus mobilis chaperonin beta subunit gene,
           partial cds.
          Length = 502

 Score =  127 bits (318), Expect = 4e-28
 Identities = 74/214 (34%), Positives = 129/214 (60%), Gaps = 1/214 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++ V+R ++E + +      ++N+E    E LG+A LVEE  +G+  K+V I G
Sbjct: 291 KKGILAVRRVKRSDLEKLERATGGRIVSNIEDLTPEDLGYAALVEERKVGED-KMVFIEG 349

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  R+ S+++RG  + ++DEAERS+ DAL  V   +    +I GGGA EIEL++ +  
Sbjct: 350 CKNP-RSVSIVIRGGLERLVDEAERSIRDALSAVADALRDGKVIPGGGAAEIELAKHIRR 408

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEIN-AGINVRK 459
            A  + G E   +++FA++LE +  TL ENAGL+PI +V +LR  H + +     I++  
Sbjct: 409 LATRVGGKEQLAIEAFAKALEGLAVTLVENAGLDPIDMVMKLRAAHEREDGKYLSIDLAT 468

Query: 458 GQITNILEENVVQPLLVSTSAISLATECVRMILK 357
           G + N+ E+ V++P+ +  +AI   TE   +I++
Sbjct: 469 GDLVNMREKGVIEPVSILANAIKAGTEAATIIMR 502



>gb:AE013599_1131383 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003823_1226321 Drosophila melanogaster
           chromosome 2R, section 27 of 74 of the complete
           sequence.
          Length = 512

 Score =  126 bits (317), Expect = 6e-28
 Identities = 76/216 (35%), Positives = 120/216 (55%), Gaps = 1/216 (0%)
 Frame = -1

Query: 989 KIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQ 810
           ++  ++ V   EIE I        +   E    EKLG A LV E++ G     + +    
Sbjct: 289 ELPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGVAGLVREMAFGTSKDKMLVIEEC 348

Query: 809 DMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWA 630
              +  ++ +RG N ++I EA+RS+HDA+CVVR LV    ++ GGGA EI  S  +   A
Sbjct: 349 KNSKAVTIFLRGGNAMIIAEAKRSIHDAICVVRSLVKDSRIVYGGGAAEISCSLAVAKEA 408

Query: 629 KVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRH-AQGEINAGINVRKGQ 453
             L  +E Y  ++F+ +LE IP  LAEN+GL+PI  ++EL+ R  A+ + + G++     
Sbjct: 409 DQLSTLEQYAFRAFSVALESIPLALAENSGLHPIETLSELKARQVAEKKSSLGVDCMLSG 468

Query: 452 ITNILEENVVQPLLVSTSAISLATECVRMILKIDDI 345
            +++   NVV+ L      I L+T+ V+MILKIDD+
Sbjct: 469 DSDMKSHNVVESLHSKKQQILLSTQLVKMILKIDDV 504



>gb:AE013599_1131382 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003823_1226320 Drosophila melanogaster
           chromosome 2R, section 27 of 74 of the complete
           sequence.>gb:AF172635_1247434 Drosophila melanogaster
           GM12270 full insert cDNA.
          Length = 542

 Score =  126 bits (317), Expect = 6e-28
 Identities = 76/216 (35%), Positives = 120/216 (55%), Gaps = 1/216 (0%)
 Frame = -1

Query: 989 KIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQ 810
           ++  ++ V   EIE I        +   E    EKLG A LV E++ G     + +    
Sbjct: 319 ELPAVRWVGGPEIELIAIATGGRIVPRFEELTPEKLGVAGLVREMAFGTSKDKMLVIEEC 378

Query: 809 DMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWA 630
              +  ++ +RG N ++I EA+RS+HDA+CVVR LV    ++ GGGA EI  S  +   A
Sbjct: 379 KNSKAVTIFLRGGNAMIIAEAKRSIHDAICVVRSLVKDSRIVYGGGAAEISCSLAVAKEA 438

Query: 629 KVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRH-AQGEINAGINVRKGQ 453
             L  +E Y  ++F+ +LE IP  LAEN+GL+PI  ++EL+ R  A+ + + G++     
Sbjct: 439 DQLSTLEQYAFRAFSVALESIPLALAENSGLHPIETLSELKARQVAEKKSSLGVDCMLSG 498

Query: 452 ITNILEENVVQPLLVSTSAISLATECVRMILKIDDI 345
            +++   NVV+ L      I L+T+ V+MILKIDD+
Sbjct: 499 DSDMKSHNVVESLHSKKQQILLSTQLVKMILKIDDV 534



>pir|S57083|S57083 t-complex-type molecular chaperone CCT5 - yeast
           (Saccharomyces cerevisiae)>gb:SCYJR064W_1712860
           S.cerevisiae chromosome X reading frame ORF
           YJR064w.>gb:YSCORFSAA_1730072 Saccharomyces cerevisiae
           ORF genes, complete cds.
          Length = 562

 Score =  126 bits (317), Expect = 6e-28
 Identities = 74/213 (34%), Positives = 121/213 (56%), Gaps = 1/213 (0%)
 Frame = -1

Query: 977 IKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGR 798
           ++ V   E+E I  + N   +   +    +KLG    + E   G     + I       +
Sbjct: 343 VRWVGGQELEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKETK 402

Query: 797 TASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQ 618
           T +  VRGSN++++DEAER+LHD+LCVVR LV    ++ GGGA E+ +S  +   A   +
Sbjct: 403 TVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTMSLAVSEEADKQR 462

Query: 617 GMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEI-NAGINVRKGQITNI 441
           G++ Y  + FA++L+ IP TLAEN+GL+PI  ++ L+++  + +I N G++       ++
Sbjct: 463 GIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKSKQLKEKISNIGVDCLGYGSNDM 522

Query: 440 LEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            E  VV P +     I LAT+  RMILKID+++
Sbjct: 523 KELFVVDPFIGKKQQILLATQLCRMILKIDNVI 555



>sp|P40413|TCPE_YEAST T-complex protein 1, epsilon subunit
           (TCP-1-epsilon) (CCT-epsilon).
          Length = 551

 Score =  126 bits (317), Expect = 6e-28
 Identities = 74/213 (34%), Positives = 121/213 (56%), Gaps = 1/213 (0%)
 Frame = -1

Query: 977 IKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGR 798
           ++ V   E+E I  + N   +   +    +KLG    + E   G     + I       +
Sbjct: 332 VRWVGGQELEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKETK 391

Query: 797 TASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQ 618
           T +  VRGSN++++DEAER+LHD+LCVVR LV    ++ GGGA E+ +S  +   A   +
Sbjct: 392 TVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTMSLAVSEEADKQR 451

Query: 617 GMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEI-NAGINVRKGQITNI 441
           G++ Y  + FA++L+ IP TLAEN+GL+PI  ++ L+++  + +I N G++       ++
Sbjct: 452 GIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKSKQLKEKISNIGVDCLGYGSNDM 511

Query: 440 LEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            E  VV P +     I LAT+  RMILKID+++
Sbjct: 512 KELFVVDPFIGKKQQILLATQLCRMILKIDNVI 544



>gb:AE016819_1749253 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 559

 Score =  125 bits (315), Expect = 1e-27
 Identities = 69/217 (31%), Positives = 125/217 (57%), Gaps = 1/217 (0%)
 Frame = -1

Query: 989 KIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQ 810
           ++  ++ V   E+E I    N   +   +    EKLG    + E+  G   + + +    
Sbjct: 336 ELPAVRWVGGQELELIAIATNGRIVPRFQSLSPEKLGTCGSIRELEFGTTKERMLVIEEC 395

Query: 809 DMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWA 630
              +T +  +RGSN++++DEA+R+LHD+LCVVR ++    ++ GGGA E+ +S  + + A
Sbjct: 396 SNSKTVTCFLRGSNKMIVDEAKRALHDSLCVVRNMIRDSRVVYGGGAAEVTMSLAVASEA 455

Query: 629 KVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINA-GINVRKGQ 453
              +G++ Y  ++FA++L+ IP  LAEN+GL+PI  +T ++++  +  ++  G++     
Sbjct: 456 DKQRGIDQYAFRAFAQALDSIPMILAENSGLDPIETLTTVKSKQVKENVSTIGVDCLGKG 515

Query: 452 ITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
             ++ E  VV PL+     I LATE  RMILKID+++
Sbjct: 516 SNDMKELFVVDPLIGKKQQILLATELCRMILKIDNVI 552



>gb:PFMAL3P2_1394444 Plasmodium falciparum MAL3P2, complete
           sequence.
          Length = 532

 Score =  125 bits (315), Expect = 1e-27
 Identities = 65/215 (30%), Positives = 126/215 (58%), Gaps = 3/215 (1%)
 Frame = -1

Query: 977 IKDVERDEIEFITKTLNCLPIANVEHFRAE---KLGHADLVEEVSLGDGGKIVKITGIQD 807
           +  +E  + + + +  NCL       F  +   KLG+ D +EE+ +G+  K+V+ +G + 
Sbjct: 310 VMTIEHSDFDGMERLANCLDAEIASTFEKDLNIKLGYCDKIEEIIIGED-KLVRFSGCKK 368

Query: 806 MGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAK 627
            G   ++++RG++  +++E+ERSLHDAL V+   +    ++ G G  E+ +S  +   A+
Sbjct: 369 NG-ACTIILRGASTHILEESERSLHDALAVLAETMKDNRVVLGAGCVEMLMSNAVDNLAR 427

Query: 626 VLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQIT 447
            ++G +   ++++A++L  IP  + +N G +   IV+++R +H +G   AGI++ KG + 
Sbjct: 428 TVEGKKSLAIEAYAKALRQIPTYILDNGGFDSSEIVSKIRAQHTKGNKYAGIDIEKGDVG 487

Query: 446 NILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           NI+E  + +      S I+ ATE V MIL++DDI+
Sbjct: 488 NIMELGIYESYNSKLSQITSATEAVEMILRVDDII 522



>gb:AE017343_1755602 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 547

 Score =  125 bits (314), Expect = 1e-27
 Identities = 70/224 (31%), Positives = 122/224 (54%), Gaps = 2/224 (0%)
 Frame = -1

Query: 986 IMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQD 807
           I VIK + + ++  + + +   P+A +     E+ G  D+ E + +G     V      +
Sbjct: 312 IAVIKVLSKFDLRRLCRVVGATPLARLGAPTPEEAGMVDVFETIEIGGDRVTVLRQEEGE 371

Query: 806 MGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAK 627
             RTA++++RG+    +D+ ERSL D +  +R L     L+ G GA EIEL+R++ A+  
Sbjct: 372 KTRTATIVLRGATANYLDDLERSLDDGINTIRILFRDGRLVPGAGASEIELARRISAYGG 431

Query: 626 VLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINV--RKGQ 453
              G+  + +K +AE+ EV+P TLAENAGLN   +V+ L   HA G+++AG+++   K  
Sbjct: 432 KTAGLAQHSIKRWAEACEVVPRTLAENAGLNSEDVVSSLYKAHADGQVDAGVDIESEKEG 491

Query: 452 ITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR*IGL 321
           + +  +  V  P      A+ LATE    +L++D I+  +  G+
Sbjct: 492 VRSTKDMGVFDPYAAKDWALKLATEAAISVLRVDSIIVAKQAGI 535



>pir|T24508|T24508 hypothetical protein T05C12.7 - Caenorhabditis
           elegans>gb:CET05C12_1367231 Caenorhabditis elegans
           cosmid T05C12, complete sequence.
          Length = 549

 Score =  125 bits (314), Expect = 1e-27
 Identities = 77/229 (33%), Positives = 131/229 (57%), Gaps = 15/229 (6%)
 Frame = -1

Query: 983 MVIKDVERDEIEFITK------TLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKI 822
           M ++  ++ +++ I K      T++   +   E F A  LGHAD + +  + D  +++ I
Sbjct: 309 MAVRRCKKSDLKRIAKATGATLTVSLATLEGDEAFDASLLGHADEIVQERISDD-ELILI 367

Query: 821 TGIQDMGRTAS-VLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQ 645
            G +   RTAS +++RG+N +++DE ERS+HD+LCVVR ++  + L+AGGGA E  LS  
Sbjct: 368 KGPKS--RTASSIILRGANDVMLDEMERSVHDSLCVVRRVLESKKLVAGGGAVETSLSLF 425

Query: 644 LGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEIN----- 480
           L  +A+ L   E   V  FA +L +IP  LA NA  +   +VT+LR  H++ ++      
Sbjct: 426 LETYAQTLSSREQLAVAEFASALLIIPKVLASNAARDSTDLVTKLRAYHSKAQLIPQLQH 485

Query: 479 ---AGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
              AG+++ +G I +  E  +++P L    ++  ATE    IL+IDD++
Sbjct: 486 LKWAGLDLEEGTIRDNKEAGILEPALSKVKSLKFATEAAITILRIDDLI 534



>gb:AF275798_1894344 Homo sapiens PNAS-102 mRNA, complete cds.
          Length = 171

 Score =  125 bits (313), Expect = 2e-27
 Identities = 66/154 (42%), Positives = 103/154 (66%), Gaps = 2/154 (1%)
 Frame = -1

Query: 800 RTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVL 621
           R  ++ +RG N+++I+EA+RSLHDALCV+R L+    ++ GGGA EI  +  +   A   
Sbjct: 11  RAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKC 70

Query: 620 QGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEIN--AGINVRKGQIT 447
             +E Y +++FA++LEVIP  L+EN+G+NPI  +TE+R R  + E+N   GI+       
Sbjct: 71  PTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRARQVK-EMNPALGIDCLHKGTN 129

Query: 446 NILEENVVQPLLVSTSAISLATECVRMILKIDDI 345
           ++ +++V++ L+     ISLAT+ VRMILKIDDI
Sbjct: 130 DMKQQHVIETLIGKKQQISLATQMVRMILKIDDI 163



>gb:YSCTCEP_1730754 Saccharomyces cerevisiae (clone p701-6) Tcp1
           epsilon gene, complete cds.
          Length = 551

 Score =  124 bits (311), Expect = 3e-27
 Identities = 73/213 (34%), Positives = 120/213 (56%), Gaps = 1/213 (0%)
 Frame = -1

Query: 977 IKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGR 798
           ++ V   E+E I  + N   +   +    +KLG    + E   G     + I       +
Sbjct: 332 VRWVGGQELEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKETK 391

Query: 797 TASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQ 618
           T +  VRGSN++++DEAER+LHD+LCVVR LV    ++ GGGA E+ +S  +   A   +
Sbjct: 392 TVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTMSLAVSEEADKQR 451

Query: 617 GMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEI-NAGINVRKGQITNI 441
           G++ Y  + FA++L+ IP TLAEN+ L+PI  ++ L+++  + +I N G++       ++
Sbjct: 452 GIDQYAFRGFAQALDTIPMTLAENSNLDPIGTLSTLKSKQLKEKISNIGVDCLGYGSNDM 511

Query: 440 LEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            E  VV P +     I LAT+  RMILKID+++
Sbjct: 512 KELFVVDPFIGKKQQILLATQLCRMILKIDNVI 544



>sp|P41988|TCPA_CAEEL T-complex protein 1, alpha subunit
           (TCP-1-alpha) (CCT-alpha).>pir|JC4083|JC4083 chaperonin
           - Caenorhabditis elegans>gb:CEU07941_1368388
           Caenorhabditis elegans chaperonin subunit 1 (cct-1)
           gene, complete cds.
          Length = 549

 Score =  124 bits (310), Expect = 4e-27
 Identities = 77/229 (33%), Positives = 130/229 (56%), Gaps = 15/229 (6%)
 Frame = -1

Query: 983 MVIKDVERDEIEFITK------TLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKI 822
           M ++  ++ +++ I K      T++   +   E F A  LGHAD + +  + D  +++ I
Sbjct: 309 MAVRRCKKSDLKRIAKATGATLTVSLATLEGDEAFDASLLGHADEIVQERISDD-ELILI 367

Query: 821 TGIQDMGRTAS-VLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQ 645
            G +   RTAS +++RG+N +++DE ERS+HD+LCVVR ++  + L+AGGGA E  LS  
Sbjct: 368 KGPKS--RTASSIILRGANDVMLDEMERSVHDSLCVVRRVLESKKLVAGGGAVETSLSLF 425

Query: 644 LGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEIN----- 480
           L  +A+ L   E   V  FA +L +IP  LA NA  +   +VT LR  H++ ++      
Sbjct: 426 LETYAQTLSSREQLAVAEFASALLIIPKVLASNAARDSTDLVTFLRAYHSKAQLIPQLQH 485

Query: 479 ---AGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
              AG+++ +G I +  E  +++P L    ++  ATE    IL+IDD++
Sbjct: 486 LKWAGLDLEEGTIRDNKEAGILEPALSKVKSLKFATEAAITILRIDDLI 534



>gb:AF149920_483532 Sulfolobus solfataricus chaperonin beta subunit
           gene, partial cds.
          Length = 422

 Score =  123 bits (309), Expect = 5e-27
 Identities = 71/215 (33%), Positives = 132/215 (61%), Gaps = 2/215 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++  ++ ++E + +      I+N++   ++ LG+A LVEE  +G+  K+V + G
Sbjct: 211 KKGILAVRRAKKSDLEKLARATGGRVISNIDELTSQDLGYAALVEERKVGED-KMVFVEG 269

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  ++ S+L+RG  + V+DE ER+L DAL  V  ++     +AGGGA EIE++++L  
Sbjct: 270 AKNP-KSVSILIRGGLERVVDETERALRDALGTVADVIRDGRAVAGGGAVEIEIAKRLRK 328

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINA--GINVR 462
           +A  + G E   ++++A ++E +   LAENAGL+PI  + +LR+ H + E N   G+N+ 
Sbjct: 329 YAPQVGGKEQLAIEAYANAIEGLIMILAENAGLDPIDKLMQLRSLH-ENETNKWYGLNLF 387

Query: 461 KGQITNILEENVVQPLLVSTSAISLATECVRMILK 357
            G   ++ +  V++P LV  +A+  ATE V ++L+
Sbjct: 388 TGNPEDMWKLGVIEPALVKMNAVKAATEAVTLVLR 422



>pir|D84359|D84359 thermosome subunit beta [imported] - Halobacterium
            sp. NRC-1>gb:AE005099_63400 Halobacterium sp. NRC-1
            section 130 of 170 of the complete
            genome.>gb:AE004437_888319 Halobacterium sp. NRC-1
            complete genome.
          Length = 656

 Score =  123 bits (309), Expect = 5e-27
 Identities = 71/221 (32%), Positives = 125/221 (56%), Gaps = 2/221 (0%)
 Frame = -1

Query: 995  KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVE-EVSLGDGGKIVKIT 819
            K  I+ ++  ++ +IEF+T  L+   + +++         AD+V   V+     ++  + 
Sbjct: 411  KEGILAVRRTKKSDIEFLTNVLDASVVTDLD-----AASEADVVAGSVTRDSDDELFYVE 465

Query: 818  GIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLG 639
            G  +     ++L+RGS   V+DE ER + DAL V    +S   ++ GGGA E+E++ +L 
Sbjct: 466  GESEQAHGVTLLLRGSTDHVVDELERGVSDALDVSAQTLSDGRVLPGGGATEVEVASRLR 525

Query: 638  AWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHA-QGEINAGINVR 462
             +A  + G E   V++FA+SLE++P  LAENAGL+ I  + +LR+ H    + + G+NV 
Sbjct: 526  DFADSVSGREQLAVEAFADSLELVPRVLAENAGLDSIDTLVDLRSAHENDDDEHIGLNVL 585

Query: 461  KGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVT 339
             G + +  E  VV+P      A++ A+E   ++LKIDDI++
Sbjct: 586  SGDLEDTFEAGVVEPAHAKEQAVTSASEAANLVLKIDDIIS 626



>sp|Q9HNI0|THSB_HALN1 Thermosome beta subunit (Thermosome subunit 2)
           (Chaperonin beta subunit).
          Length = 556

 Score =  123 bits (309), Expect = 5e-27
 Identities = 71/221 (32%), Positives = 125/221 (56%), Gaps = 2/221 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVE-EVSLGDGGKIVKIT 819
           K  I+ ++  ++ +IEF+T  L+   + +++         AD+V   V+     ++  + 
Sbjct: 311 KEGILAVRRTKKSDIEFLTNVLDASVVTDLD-----AASEADVVAGSVTRDSDDELFYVE 365

Query: 818 GIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLG 639
           G  +     ++L+RGS   V+DE ER + DAL V    +S   ++ GGGA E+E++ +L 
Sbjct: 366 GESEQAHGVTLLLRGSTDHVVDELERGVSDALDVSAQTLSDGRVLPGGGATEVEVASRLR 425

Query: 638 AWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHA-QGEINAGINVR 462
            +A  + G E   V++FA+SLE++P  LAENAGL+ I  + +LR+ H    + + G+NV 
Sbjct: 426 DFADSVSGREQLAVEAFADSLELVPRVLAENAGLDSIDTLVDLRSAHENDDDEHIGLNVL 485

Query: 461 KGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVT 339
            G + +  E  VV+P      A++ A+E   ++LKIDDI++
Sbjct: 486 SGDLEDTFEAGVVEPAHAKEQAVTSASEAANLVLKIDDIIS 526



>gb:BC083650_2108726 Rattus norvegicus chaperonin containing TCP1,
           subunit 2 (beta), mRNA (cDNA clone MGC:94480
           IMAGE:7135109), complete cds.
          Length = 535

 Score =  123 bits (308), Expect = 6e-27
 Identities = 65/215 (30%), Positives = 121/215 (56%)
 Frame = -1

Query: 986 IMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQD 807
           +M I+  +   +E +         +  +H    KLG   L+EEV +G+  K++  +G+  
Sbjct: 309 VMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGED-KLIHFSGVA- 366

Query: 806 MGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAK 627
           +G   ++++RG+ Q ++DEAERSLHDALCV+   V     + GGG  E+ ++  +   A 
Sbjct: 367 LGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDPRTVYGGGCSEMLMAHAVTMLAS 426

Query: 626 VLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQIT 447
              G E   ++SFA++L ++P  +A+NAG +   +V +LR  H++G I AG+++++G I 
Sbjct: 427 RTPGKEAVAMESFAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGRITAGLDMKEGSIG 486

Query: 446 NILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           ++    + +   V    +  A E   +IL++D+I+
Sbjct: 487 DMAVLGITESFQVKRQVLLSAAEAAEVILRVDNII 521



>gb:CR382137_1670387 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 540

 Score =  123 bits (308), Expect = 6e-27
 Identities = 70/209 (33%), Positives = 124/209 (59%)
 Frame = -1

Query: 968 VERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTAS 789
           V  ++++ + K +     +   +   + LG  +  EEV +G     V   G     +T +
Sbjct: 319 VSAEDMDRVIKAVGGRIQSTCSNIDEKDLGTCEDFEEVQIGSDRYNV-FKGCPQT-KTCT 376

Query: 788 VLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGME 609
           +++RG  + VI E ERSLHDA+ +V+  V+   ++AGGGA E+E+S+ L  +AK + G +
Sbjct: 377 LILRGGAEQVIAEVERSLHDAIMIVKRAVTHNSVVAGGGAIEMEVSKHLRDYAKTVAGKQ 436

Query: 608 GYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQITNILEEN 429
              + +FA++LEVIP  L ENAGL+ I ++ +LR+ HA+GE + GI+ +K  + N ++  
Sbjct: 437 QLIIAAFAKALEVIPRQLCENAGLDGIELLNKLRSAHAKGENSYGIDFQKESVGNNMKNF 496

Query: 428 VVQPLLVSTSAISLATECVRMILKIDDIV 342
           + +P LV  ++I  ATE   ++L +D+ +
Sbjct: 497 IWEPSLVKINSIQSATEAATLLLSVDETI 525



>pir|S43059|S43059 CCT (chaperonin containing TCP-1) beta chain -
           mouse>gb:A45916_1449225 Sequence 55 from Patent
           WO9520654.>gb:MMCCTBE_2114450 M.musculus (129/Sv) Cctb
           mRNA for CCT (chaperonin containing TCP-1) beta subunit.
          Length = 535

 Score =  122 bits (307), Expect = 8e-27
 Identities = 65/215 (30%), Positives = 121/215 (56%)
 Frame = -1

Query: 986 IMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQD 807
           +M I+  +   +E +         +  +H    KLG   L+EEV +G+  K++  +G+  
Sbjct: 309 VMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGED-KLIHFSGVA- 366

Query: 806 MGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAK 627
           +G   ++++RG+ Q ++DEAERSLHDALCV+   V     + GGG  E+ ++  +   A 
Sbjct: 367 LGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDPRTVYGGGCSEMLMAHAVTQLAN 426

Query: 626 VLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQIT 447
              G E   ++SFA++L ++P  +A+NAG +   +V +LR  H++G I AG+++++G I 
Sbjct: 427 RTPGKEAVAMESFAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGHITAGLDMKEGTIG 486

Query: 446 NILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           ++    + +   V    +  A E   +IL++D+I+
Sbjct: 487 DMAVLGITESFQVKRQVLLSAAEAAEVILRVDNII 521



>sp|P80314|TCPB_MOUSE T-complex protein 1, beta subunit (TCP-1-beta)
           (CCT-beta).>gb:AK075581_1170882 Mus musculus adult male
           kidney cDNA, RIKEN full-length enriched library,
           clone:0610010P14 product:chaperonin subunit 2 (beta),
           full insert sequence.>gb:AB022156_2044201 Mus musculus
           Cctb gene for chaperonin containing TCP-1 beta subunit,
           complete cds.>gb:BC007470_2090589 Mus musculus
           chaperonin subunit 2 (beta), mRNA (cDNA clone MGC:6098
           IMAGE:3601569), complete cds.>gb:BC026918_2095629 Mus
           musculus chaperonin subunit 2 (beta), mRNA (cDNA clone
           MGC:25091 IMAGE:4500896), complete cds.
          Length = 535

 Score =  122 bits (307), Expect = 8e-27
 Identities = 65/215 (30%), Positives = 121/215 (56%)
 Frame = -1

Query: 986 IMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQD 807
           +M I+  +   +E +         +  +H    KLG   L+EEV +G+  K++  +G+  
Sbjct: 309 VMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGED-KLIHFSGVA- 366

Query: 806 MGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAK 627
           +G   ++++RG+ Q ++DEAERSLHDALCV+   V     + GGG  E+ ++  +   A 
Sbjct: 367 LGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDPRTVYGGGCSEMLMAHAVTQLAN 426

Query: 626 VLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQIT 447
              G E   ++SFA++L ++P  +A+NAG +   +V +LR  H++G I AG+++++G I 
Sbjct: 427 RTPGKEAVAMESFAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGHITAGLDMKEGTIG 486

Query: 446 NILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           ++    + +   V    +  A E   +IL++D+I+
Sbjct: 487 DMAVLGITESFQVKRQVLLSAAEAAEVILRVDNII 521



>gb:AY389968_2531458 Xenopus laevis chaperonin subunit 8 theta mRNA,
           partial cds.
          Length = 308

 Score =  122 bits (306), Expect = 1e-26
 Identities = 70/226 (30%), Positives = 124/226 (54%), Gaps = 2/226 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  +MVI+   + ++  + KT+    +  +    AE++GH D V    +GD  ++V    
Sbjct: 77  KYNLMVIRLNSKWDLRRLCKTVCATALPRMTPPTAEEMGHCDSVYLSEVGDT-QVVVFKH 135

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++ G  A+V++RGS   ++D+ ER++ DA+   + L   + L+ GGGA EIEL++Q+ +
Sbjct: 136 EKEDGAIATVVIRGSTDNLMDDVERAVDDAVNTFKVLTRDKRLVPGGGATEIELAKQITS 195

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAG--INVR 462
           + +   G++ Y +K FAE+ E IP  LAEN+G+    I+++L   H +G  N G  I   
Sbjct: 196 YGETCPGLDQYAIKKFAEAFESIPRALAENSGVKANEILSKLYAMHQEGNNNVGFDIEAE 255

Query: 461 KGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR*IG 324
              + ++LE N+    L+    I LAT     +L++D I+  +  G
Sbjct: 256 SAAVKDMLESNIFDTYLMKYWGIKLATNAAITVLRVDQIIMAKPAG 301



>gb:AF097668_1767894 Mesembryanthemum crystallinum T-complex protein
           1 epsilon subunit (TCP-1-EPSILON) mRNA, partial cds.
          Length = 418

 Score =  122 bits (306), Expect = 1e-26
 Identities = 68/207 (32%), Positives = 115/207 (55%), Gaps = 1/207 (0%)
 Frame = -1

Query: 956 EIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVR 777
           E+E I        +   +    EKLG A LV E S G     +         R  ++ +R
Sbjct: 208 ELELIAIATGGRIVPRFQELTPEKLGPAGLVREKSFGTTKDRMLYIEHCANSRAVTIFIR 267

Query: 776 GSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCV 597
           G N+++++E +RS+HDALCV R L+    ++ GGG+ EI  S  + A A    G+E Y +
Sbjct: 268 GGNKMMVEETKRSIHDALCVARNLIRNNSIVYGGGSAEIACSLAVEAAADRYPGVEQYAI 327

Query: 596 KSFAESLEVIPYTLAENAGLNPITIVTELRNRHA-QGEINAGINVRKGQITNILEENVVQ 420
           ++FA++L+ +P  LAEN+GL PI  ++ ++++   +     GI+       ++ E+NV +
Sbjct: 328 RAFADALDSVPMALAENSGLTPIETLSAVKSQQVKENNPCCGIDCNDVGTNDMREQNVFE 387

Query: 419 PLLVSTSAISLATECVRMILKIDDIVT 339
            L+     + LAT+ V+MILKIDD+++
Sbjct: 388 TLIGKKQQLLLATQVVKMILKIDDVIS 414



>gb:AF303531_1260548 Tetrahymena pyriformis CCTepsilon subunit gene,
           complete cds.
          Length = 534

 Score =  122 bits (306), Expect = 1e-26
 Identities = 68/213 (31%), Positives = 115/213 (53%), Gaps = 1/213 (0%)
 Frame = -1

Query: 977 IKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGR 798
           ++ V   +IE I        +   E    +KLG A LV E+  G   + + +       +
Sbjct: 318 VRWVSGTDIELIAVATGGRIVPRFEELSNDKLGEAKLVREIQFGTSNERMLVIEDCKQSK 377

Query: 797 TASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQ 618
             ++L+RG + +++ EA RS+HDA CV+R L+    ++ GGG+ EI  S  +   A  + 
Sbjct: 378 AVTILIRGGSNMIVSEARRSIHDANCVIRNLIKCPKIVYGGGSAEIACSLTVNQEADKIS 437

Query: 617 GMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRN-RHAQGEINAGINVRKGQITNI 441
            +E Y V++FA++LE IP  LA+N+GLNPI  V   +  +++Q     G++ +     ++
Sbjct: 438 SVEQYAVRAFADALEDIPNALADNSGLNPIEAVANAKALQNSQTNPRIGVDCQLEGTFDM 497

Query: 440 LEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            E+ V +  L       LAT+ V+MILKIDD++
Sbjct: 498 REQKVYETYLSKKQQFQLATQVVKMILKIDDVI 530



>gb:BC042347_2548155 Xenopus laevis chaperonin subunit 2 (beta),
           mRNA (cDNA clone MGC:52772 IMAGE:4684199), complete cds.
          Length = 535

 Score =  122 bits (305), Expect = 1e-26
 Identities = 65/215 (30%), Positives = 122/215 (56%)
 Frame = -1

Query: 986 IMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQD 807
           +M I+  +   +E ++        +  +H    KLG   L+EEV +G+  K++  +G+  
Sbjct: 309 VMAIEHADFAGVERLSLVTGGEIASTFDHPELVKLGTCKLIEEVMIGED-KLLHFSGVA- 366

Query: 806 MGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAK 627
           MG   ++++RG+ Q ++DEAERSLHDALCV+   V     + GGG  E+ ++  +   A 
Sbjct: 367 MGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDTRTVYGGGCSEMLMAHVVTELAN 426

Query: 626 VLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQIT 447
              G E   ++SFA++L ++P  +A+NAG +   +V++LR  H++G+   G++++ G   
Sbjct: 427 RTPGKESVAMESFAKALRMLPTIIADNAGYDSADLVSQLRAAHSEGKSTYGLDMKNGTTG 486

Query: 446 NILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           ++ E  + +   V    +  A+E   +IL++DDI+
Sbjct: 487 DMAELGITESFQVKRQVLLSASEAAEVILRVDDII 521



>gb:CR548612_1375445 Paramecium tetraurelia macronuclear largest
           chromosome, complete sequence.
          Length = 553

 Score =  121 bits (304), Expect = 2e-26
 Identities = 80/194 (41%), Positives = 108/194 (55%), Gaps = 5/194 (2%)
 Frame = -1

Query: 908 VEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVRGSNQLVIDEAERSLHD 729
           V     E  G   L EEV +G   +   +       RTA++++RG  +  I EAERSL+D
Sbjct: 337 VNGLNPETFGTCGLFEEVQVG--AERYNLFKNCPQSRTATIVLRGGAEQFIQEAERSLND 394

Query: 728 ALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCVKSFAESLEVIPYTLAE 549
           A+ +VR       ++AGGGA E+ELSR L  +A+ + G   Y V SFA++LEVIP T+AE
Sbjct: 395 AIMIVRRCFKANKIVAGGGAIELELSRYLRHYARSVTGKTQYIVNSFAKALEVIPRTIAE 454

Query: 548 NAGLNPITIVTELRNRHAQGE-----INAGINVRKGQITNILEENVVQPLLVSTSAISLA 384
           NAGLN I I+ +LR RHAQG          IN   G + +     V +P LV  +A+  A
Sbjct: 455 NAGLNSIEIMNKLRQRHAQGGEEGRWYGVDINGASG-VCDTHSSFVWEPSLVKRNALCSA 513

Query: 383 TECVRMILKIDDIV 342
           TE    IL ID+ V
Sbjct: 514 TEAACAILSIDETV 527



>gb:DDU43896_1377343 Dictyostelium discoideum molecular chaperone
           Dd-TCP1 mRNA, complete cds.
          Length = 362

 Score =  121 bits (303), Expect = 2e-26
 Identities = 72/209 (34%), Positives = 119/209 (56%)
 Frame = -1

Query: 968 VERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTAS 789
           V  D+I  + +           +   + +G  DL EEV +G G +    TG   M +TA+
Sbjct: 121 VPDDDIRRVCRATGAAIQNTTSNIIPDVIGTCDLFEEVQVG-GQRYNLFTGCT-MTQTAT 178

Query: 788 VLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGME 609
           +++RG  +  IDEAERSL D++ +VR     R ++AGGGA ++E+S+ L  ++  ++G +
Sbjct: 179 IILRGGGEQFIDEAERSLRDSIMIVRRARKHRSVVAGGGAMKMEVSKYLRDYSLSIEGKK 238

Query: 608 GYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQITNILEEN 429
              +  FA++LEVIP  +A+NAG +   I+ +LR +HAQGE   G+++    I +  E  
Sbjct: 239 QLLINRFAKALEVIPRQIADNAGFDSTDILNQLRQKHAQGEKWFGVDIVNEGICDTYESA 298

Query: 428 VVQPLLVSTSAISLATECVRMILKIDDIV 342
           + +P LV  ++I  ATE   +IL +D  V
Sbjct: 299 IWEPSLVKLNSIVAATEATCLILSVDRTV 327



>gb:BT019965_2151624 Synthetic construct Homo sapiens chaperonin
           containing TCP1, subunit 2 (beta) mRNA, partial cds.
          Length = 536

 Score =  120 bits (302), Expect = 3e-26
 Identities = 64/215 (29%), Positives = 120/215 (55%)
 Frame = -1

Query: 986 IMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQD 807
           +M I+  +   +E +         +  +H    KLG   L+EEV +G+  K++  +G+  
Sbjct: 309 VMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGED-KLIHFSGVA- 366

Query: 806 MGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAK 627
           +G   ++++RG+ Q ++DEAERSLHDALCV+   V     + GGG  E+ ++  +   A 
Sbjct: 367 LGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHAVTQLAN 426

Query: 626 VLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQIT 447
              G E   ++S+A++L ++P  +A+NAG +   +V +LR  H++G   AG+++R+G I 
Sbjct: 427 RTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDMREGTIG 486

Query: 446 NILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           ++    + +   V    +  A E   +IL++D+I+
Sbjct: 487 DMAILGITESFQVKRQVLLSAAEAAEVILRVDNII 521



>sp|P78371|TCPB_HUMAN T-complex protein 1, beta subunit (TCP-1-beta)
           (CCT-beta).>gb:AF026166_1877285 Homo sapiens
           chaperonin-containing TCP-1 beta subunit homolog mRNA,
           complete cds.>gb:AF026293_1877305 Homo sapiens
           chaperonin containing t-complex polypeptide 1, beta
           subunit (Cctb) mRNA, complete cds.>gb:BT019966_1991325
           Homo sapiens chaperonin containing TCP1, subunit 2
           (beta) mRNA, complete cds.
          Length = 535

 Score =  120 bits (302), Expect = 3e-26
 Identities = 64/215 (29%), Positives = 120/215 (55%)
 Frame = -1

Query: 986 IMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQD 807
           +M I+  +   +E +         +  +H    KLG   L+EEV +G+  K++  +G+  
Sbjct: 309 VMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGED-KLIHFSGVA- 366

Query: 806 MGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAK 627
           +G   ++++RG+ Q ++DEAERSLHDALCV+   V     + GGG  E+ ++  +   A 
Sbjct: 367 LGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHAVTQLAN 426

Query: 626 VLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQIT 447
              G E   ++S+A++L ++P  +A+NAG +   +V +LR  H++G   AG+++R+G I 
Sbjct: 427 RTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDMREGTIG 486

Query: 446 NILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           ++    + +   V    +  A E   +IL++D+I+
Sbjct: 487 DMAILGITESFQVKRQVLLSAAEAAEVILRVDNII 521



>gb:BC084429_2563805 Xenopus laevis hypothetical LOC495278, mRNA
           (cDNA clone MGC:86433 IMAGE:7011977), complete cds.
          Length = 480

 Score =  120 bits (301), Expect = 4e-26
 Identities = 63/181 (34%), Positives = 110/181 (60%)
 Frame = -1

Query: 884 LGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCL 705
           LGH  L EE  +G G +    TG     +T ++++RG  +  ++E ERSLHDA+ +VR  
Sbjct: 280 LGHCALFEEAQVG-GERYNFFTGCPK-AKTCTIILRGGAEQFLEETERSLHDAIMIVRRA 337

Query: 704 VSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPIT 525
           +    ++AGGGA E+ELS+ L  +++ + G +   + S+A++LE+IP  L +NAG +   
Sbjct: 338 IKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGSYAKALEIIPRQLCDNAGFDATN 397

Query: 524 IVTELRNRHAQGEINAGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDI 345
           I+ +LR +HAQG +  G+++    I +  E  V +P +V  +A++ A+E   +IL +D+ 
Sbjct: 398 ILNKLRAKHAQGGMWFGVDINNEDIADNFEACVWEPAIVKINALTAASEAACLILSVDET 457

Query: 344 V 342
           +
Sbjct: 458 I 458



>gb:BC042312_2548124 Xenopus laevis hypothetical LOC495278, mRNA
           (cDNA clone IMAGE:4682624), partial cds.
          Length = 561

 Score =  120 bits (301), Expect = 4e-26
 Identities = 63/181 (34%), Positives = 110/181 (60%)
 Frame = -1

Query: 884 LGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCL 705
           LGH  L EE  +G G +    TG     +T ++++RG  +  ++E ERSLHDA+ +VR  
Sbjct: 361 LGHCALFEEAQVG-GERYNFFTGCPK-AKTCTIILRGGAEQFLEETERSLHDAIMIVRRA 418

Query: 704 VSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPIT 525
           +    ++AGGGA E+ELS+ L  +++ + G +   + S+A++LE+IP  L +NAG +   
Sbjct: 419 IKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGSYAKALEIIPRQLCDNAGFDATN 478

Query: 524 IVTELRNRHAQGEINAGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDI 345
           I+ +LR +HAQG +  G+++    I +  E  V +P +V  +A++ A+E   +IL +D+ 
Sbjct: 479 ILNKLRAKHAQGGMWFGVDINNEDIADNFEACVWEPAIVKINALTAASEAACLILSVDET 538

Query: 344 V 342
           +
Sbjct: 539 I 539



>gb:AP003935_1835491 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0661G04.>gb:AP005395_1851056 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0623A10.
          Length = 560

 Score =  120 bits (301), Expect = 4e-26
 Identities = 68/184 (36%), Positives = 110/184 (59%), Gaps = 1/184 (0%)
 Frame = -1

Query: 890 EKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVR 711
           E LG  ++ EE  +G+  +   I      G+TA++++RG     I+EAERSLHDA+ +VR
Sbjct: 343 EVLGTCEVFEERQVGN--ERFNIFSGCPSGQTATIVLRGGADQFIEEAERSLHDAIMIVR 400

Query: 710 CLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNP 531
             +    ++ GGGA ++E+S+ L   A+ + G   + V SFA++LEVIP  L +NAG + 
Sbjct: 401 RALKNSTVVPGGGAIDMEISKYLRQHARTIAGKSQFFVNSFAKALEVIPRQLCDNAGFDA 460

Query: 530 ITIVTELRNRHAQGE-INAGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKI 354
             ++ +LR +HA GE  N G+++  G I +     V +P +V  +AI+ ATE   +IL +
Sbjct: 461 TDVLNKLRQKHASGEGANFGVDINTGGIADSFANFVWEPAVVKINAINAATEAACLILSV 520

Query: 353 DDIV 342
           D+ V
Sbjct: 521 DETV 524



>gb:AF188130_1249196 Oxytricha nova clone 11 chaperonin beta subunit
           gene, complete cds.
          Length = 544

 Score =  120 bits (301), Expect = 4e-26
 Identities = 72/221 (32%), Positives = 123/221 (55%), Gaps = 5/221 (2%)
 Frame = -1

Query: 989 KIMVIKDVERDEIEFITKTLNC--LPIANVEHF---RAEKLGHADLVEEVSLGDGGKIVK 825
           +IMVI   + D +E +   L    L   N   F   +  KLG   ++EE+ +G+  K++ 
Sbjct: 316 RIMVIDMPDFDGLERLAAVLGAEILSTFNSTGFSETQQPKLGSCQVIEELMIGED-KVIC 374

Query: 824 ITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQ 645
             G        S+++RGS   ++DEAERS+HDA+CV+   V    ++ GGG  EI +S  
Sbjct: 375 FKGCA-ANEACSIVLRGSGSHILDEAERSIHDAICVLVSAVKSHRVLYGGGNSEIRMSLA 433

Query: 644 LGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINV 465
           +   AK ++G +   ++S+A +L+ +P  +++NAG +   IV  LR+    G   AG+N+
Sbjct: 434 VEELAKSVRGKQALAIQSYAHALKQLPTIISDNAGYDSAEIVQNLRSEIYNGNTEAGLNM 493

Query: 464 RKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            KG++ N+ E  V + L V   A+  A+E   +IL++D+I+
Sbjct: 494 FKGEVDNMRELGVTECLRVKEQALLSASEAAELILRVDEII 534



>gb:BC075536_2558636 Xenopus tropicalis chaperonin containing TCP1,
           subunit 2 (beta), mRNA (cDNA clone MGC:89448
           IMAGE:6991207), complete cds.
          Length = 535

 Score =  120 bits (300), Expect = 5e-26
 Identities = 65/215 (30%), Positives = 121/215 (56%)
 Frame = -1

Query: 986 IMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQD 807
           +M I+  +   +E +         +  +H    KLG   L+EEV +G+  K++  +G+  
Sbjct: 309 VMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGTCKLIEEVMIGED-KLIHFSGVA- 366

Query: 806 MGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAK 627
           MG   ++++RG+ Q ++DEAERSLHDALCV+   V     + GGG  E+ ++  +   A 
Sbjct: 367 MGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDTRTVYGGGCSEMLMAHAVTELAI 426

Query: 626 VLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQIT 447
              G E   ++SFA++L ++P  +A+NAG +   +V++LR  H++G+   G++++ G I 
Sbjct: 427 RTPGKESVAMESFAKALRMLPTIIADNAGYDSADLVSQLRAAHSEGKSTYGLDMKNGTIG 486

Query: 446 NILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            + E  + +   V    +  A+E   +IL++D+I+
Sbjct: 487 EMGELGITESFQVKRQVLLSASEAAEVILRVDNII 521



>gb:CR382122_1655411 Kluyveromyces lactis strain NRRL Y-1140
           chromosome B of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 551

 Score =  120 bits (300), Expect = 5e-26
 Identities = 69/218 (31%), Positives = 122/218 (55%), Gaps = 1/218 (0%)
 Frame = -1

Query: 989 KIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQ 810
           ++  ++ V   E+E I    N   +   +    +KLG    + E+  G     + +    
Sbjct: 328 ELPAVRWVGGQELELIAIATNGRIVPRFQDLSEDKLGTCGKIYEMEFGTTKDRMLVIEEC 387

Query: 809 DMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWA 630
              +T +  +RGSN++++DEA+R+LHD+LCVVR L+    ++ GGGA E+ +S  +   A
Sbjct: 388 ANSKTVTCFLRGSNRMIVDEAKRALHDSLCVVRNLIRDSRVVYGGGAAEVTMSLAVSDEA 447

Query: 629 KVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRH-AQGEINAGINVRKGQ 453
              +G++ Y  ++F+ +L+ IP  LAEN+GL+PI  ++ L+++   +   N G++     
Sbjct: 448 DKQRGIDQYAFRAFSNALDQIPMILAENSGLDPIETLSLLKSKQLKEKSANIGVDALGRG 507

Query: 452 ITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVT 339
             ++ E  VV PL+     I LAT+  RMILKID+++T
Sbjct: 508 SNDMKELFVVDPLIGKKQQILLATQLCRMILKIDNVIT 545



>gb:OSJN00060_1694108 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0010H02, complete sequence.
          Length = 545

 Score =  119 bits (299), Expect = 7e-26
 Identities = 73/228 (32%), Positives = 118/228 (51%), Gaps = 14/228 (6%)
 Frame = -1

Query: 983 MVIKDVERDEIEFITKTLNCLPIANV------EHFRAEKLGHADLVEEVSLGDGGKIVKI 822
           + ++ V ++++  + K      ++        E F +  LGHAD V E  + D   ++ +
Sbjct: 309 IAVRRVRKEDLRHVAKATGATMVSTFADMEGEETFDSSFLGHADEVVEERIADDD-VILV 367

Query: 821 TGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQL 642
            G ++     S+++RG+N  ++DE +RSLHDALC+V+  +    ++AGGGA E  LS  L
Sbjct: 368 KGTKNTS-AVSIILRGANDFMLDEIDRSLHDALCIVKRTLESNMVVAGGGAVEAALSVYL 426

Query: 641 GAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINA----- 477
              A  L   E   +  FAESL +IP  L+ NA  +   +V +LR  H   +  A     
Sbjct: 427 ENLATTLGSREQLAIAEFAESLLIIPKVLSVNAAKDATELVAKLRAYHHTAQTKADKQHF 486

Query: 476 ---GINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
              G+++ KG I N LE  V++P +     I  ATE    IL+IDD++
Sbjct: 487 SSMGLDLSKGIIRNNLEYGVIEPAMSKVKIIQFATEAAITILRIDDMI 534



>gb:CR382138_1671760 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 544

 Score =  119 bits (298), Expect = 9e-26
 Identities = 71/215 (33%), Positives = 119/215 (55%), Gaps = 3/215 (1%)
 Frame = -1

Query: 977 IKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGR 798
           I+ +   E+E +    N   +   E    EKLG A  + E+  G     + +  ++D   
Sbjct: 325 IRWIGGSELELLAIATNGRIVPRFEDLSPEKLGRAGTIRELEFGTTRDRMLV--VEDCSN 382

Query: 797 TASV--LVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKV 624
           T +V   VRGSN++++ E  RSLHD++CVVR L+    ++ GGGA E+  S  +   A  
Sbjct: 383 TKAVTCFVRGSNEMIVAEGIRSLHDSICVVRNLIRDNRVVYGGGAAELTCSLAVSEAADN 442

Query: 623 LQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHA-QGEINAGINVRKGQIT 447
             G++ Y  ++FA SL+ IP TLAEN+GL+PI  ++ L+++   +   + G++       
Sbjct: 443 QIGIDQYAFRAFANSLDTIPMTLAENSGLDPIETLSSLKSKQVIEKSSHLGVDCLGKGTN 502

Query: 446 NILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           ++ E  V+ PL+     + LAT+  RMILKI+D++
Sbjct: 503 DMKELFVIDPLIGKKQQLLLATQLTRMILKINDVI 537



>gb:CR382126_1659302 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 551

 Score =  119 bits (298), Expect = 9e-26
 Identities = 65/185 (35%), Positives = 110/185 (59%)
 Frame = -1

Query: 896 RAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCV 717
           + E LG  +L EEV +G   +   +       +T ++L+RG  + VI E ERSLHDA+ +
Sbjct: 341 KPEHLGTCELFEEVQIGS--ERYNLFKGCPQAKTCTLLLRGGAEQVIAEVERSLHDAIMI 398

Query: 716 VRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGL 537
           V+  +  + ++ GGGA E+E+S+ L  ++K + G +   + +FA++LEVIP  L+ENAG 
Sbjct: 399 VKRALQNKLVVGGGGAIEMEISKYLRDYSKTIAGKQQLIINAFAKALEVIPRQLSENAGF 458

Query: 536 NPITIVTELRNRHAQGEINAGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILK 357
           + + I+  LR  H++GE   G++     I +   + V +P LV  +A+S ATE   +IL 
Sbjct: 459 DSVEILNRLRMAHSKGEKWYGVDFDNETIGDNFNKFVWEPALVKINALSSATEATNLILS 518

Query: 356 IDDIV 342
           +D+ +
Sbjct: 519 VDETI 523



>gb:BC059558_2552535 Danio rerio chaperonin containing TCP1, subunit
           2 (beta), mRNA (cDNA clone MGC:73212 IMAGE:4790853),
           complete cds.
          Length = 535

 Score =  119 bits (297), Expect = 1e-25
 Identities = 64/215 (29%), Positives = 119/215 (55%)
 Frame = -1

Query: 986 IMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQD 807
           +M I+  +   +E +         +  +H    KLGH  L+EEV +G+   ++  +G+  
Sbjct: 309 VMAIEHADFTGVERLALVTGGEITSTFDHPELVKLGHCKLIEEVMIGED-TLIHFSGVS- 366

Query: 806 MGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAK 627
           MG   ++++RG+ Q ++DEAERSLHDALCV+   V +   + GGG  E+ +++ +   A 
Sbjct: 367 MGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKETRTVYGGGCSEMLMAKAVSDLAN 426

Query: 626 VLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQIT 447
              G E   ++SFA++L ++P  +A+NAG +   +V++LR  H   +   G+++ +G + 
Sbjct: 427 HTPGKEAVAMESFAKALMMLPTIIADNAGYDSAELVSQLRAAHQDNKNTFGLDMTQGCVG 486

Query: 446 NILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           ++    V +   V    +  A E   MIL++D+I+
Sbjct: 487 DMSALGVTESFQVKRQVLLSAAEAAEMILRVDNII 521



>gb:AY389916_2531411 Protopterus dolloi chaperonin subunit 8 theta
           mRNA, partial cds.
          Length = 294

 Score =  119 bits (297), Expect = 1e-25
 Identities = 64/217 (29%), Positives = 123/217 (56%), Gaps = 2/217 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K +IMV++   + ++  + KT+    +  +     E++GH + V    +GD  ++V    
Sbjct: 78  KYQIMVVRLNSKWDLRRLCKTVGATALPKLTPPTPEEMGHCESVHLSEVGDT-QVVNFKH 136

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++    +++++RGS   ++D+ ER++ D +   + LV  + L+ GGGA EIELS+Q+ +
Sbjct: 137 EREDSSISTIVIRGSTDNLMDDIERAVDDGVNTFKVLVRDKRLVPGGGATEIELSKQITS 196

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINV--R 462
           + +   G++ Y +K FAE+ E IP  LA+N+G+N   I+++L   H +G  N G ++   
Sbjct: 197 YGETCPGLDQYAIKKFAEAFEAIPRALADNSGVNSNEILSKLHAVHQEGNKNVGFDIESE 256

Query: 461 KGQITNILEENVVQPLLVSTSAISLATECVRMILKID 351
              + ++LE  V++P L+    I LAT     +L++D
Sbjct: 257 SAAVKDMLECGVLEPYLLKHWGIKLATNAAVTVLRVD 293



>gb:CR457071_1993278 Homo sapiens full open reading frame cDNA clone
           RZPDo834F0614D for gene CCT2, chaperonin containing
           TCP1, subunit 2 (beta); complete cds, incl. stopcodon.
          Length = 535

 Score =  119 bits (297), Expect = 1e-25
 Identities = 64/215 (29%), Positives = 119/215 (55%)
 Frame = -1

Query: 986 IMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQD 807
           +M I+  +   +E +         +  +H    KLG   L+EEV +G+  K++  +G+  
Sbjct: 309 VMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGED-KLIHFSGVA- 366

Query: 806 MGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAK 627
           +G   ++++RG+ Q ++DEAERSLHDALCV+   V     + GGG  E+ ++  +   A 
Sbjct: 367 LGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHAVTQLAN 426

Query: 626 VLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQIT 447
              G E   ++S+A++L ++P  +A+NAG +   +V +LR  H++G   AG+++R+G I 
Sbjct: 427 RTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDMREGTIG 486

Query: 446 NILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
           ++    + +   V       A E   +IL++D+I+
Sbjct: 487 DMAILGITESFQVKRQVPLSAAEAAEVILRVDNII 521



>gb:AF494044_1276772 Physarum polycephalum chaperonin containing
           TCP-1 epsilon subunit (CCT5) mRNA, complete cds.
          Length = 536

 Score =  119 bits (297), Expect = 1e-25
 Identities = 71/217 (32%), Positives = 116/217 (53%), Gaps = 1/217 (0%)
 Frame = -1

Query: 989 KIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQ 810
           K+  ++ V   E+E I        +   E   A KLG A  V E+  G       +    
Sbjct: 314 KLPAVRWVGGLELEKIAIATGGRIVPRFEEVSAAKLGKAGKVREIGFGTTKDRYLLIEEC 373

Query: 809 DMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWA 630
              +  ++ VRG N+++++EA+RS+HDA+CV R LV    +I GGG+ EI +S  +   A
Sbjct: 374 PNTKAVTIFVRGGNKMLVEEAKRSIHDAICVTRNLVRDNRIIYGGGSAEITMSLAVSQAA 433

Query: 629 KVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRH-AQGEINAGINVRKGQ 453
             +  +E Y V++FA++L+ IP  LAEN+GL PI  +  L+  H ++   + G++     
Sbjct: 434 DKIASVEQYAVRAFADALDAIPIALAENSGLAPIETLAALKAAHISEKNPHLGVDCVGSG 493

Query: 452 ITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
             ++  + V  PL+     I LA + V+MILKIDD++
Sbjct: 494 TNDMKRQRVFDPLVGKIQQILLANQVVKMILKIDDVI 530



>gb:BC068214_2555000 Xenopus tropicalis hypothetical protein
           LOC407957, mRNA (cDNA clone IMAGE:5335230), partial cds.
          Length = 571

 Score =  118 bits (296), Expect = 2e-25
 Identities = 62/181 (34%), Positives = 110/181 (60%)
 Frame = -1

Query: 884 LGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCL 705
           LGH  L EE  +G G +    TG     +T ++++RG  +  ++E ERSLHDA+ +VR  
Sbjct: 371 LGHCALFEEAQVG-GERYNFFTGCPK-AKTCTIILRGGAEQFMEETERSLHDAIMIVRRA 428

Query: 704 VSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPIT 525
           +    ++AGGGA E+ELS+ L  +++ + G +   + S+A++LE+IP  L +NAG +   
Sbjct: 429 IKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGSYAKALEIIPRQLCDNAGFDATN 488

Query: 524 IVTELRNRHAQGEINAGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDI 345
           I+ +LR +HAQG +  G++V    I +  +  V +P +V  +A++ A+E   ++L +D+ 
Sbjct: 489 ILNKLRAKHAQGGMWYGVDVNNEDIADNFDACVWEPAIVRINALTAASEAACLVLSVDET 548

Query: 344 V 342
           +
Sbjct: 549 I 549



>gb:CR380953_1650802 Candida glabrata strain CBS138 chromosome G
           complete sequence.
          Length = 550

 Score =  118 bits (296), Expect = 2e-25
 Identities = 64/183 (34%), Positives = 112/183 (61%)
 Frame = -1

Query: 890 EKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVR 711
           E LG  ++ EE+ +G   +     G  +  +T+++L+RG  + VI E ERSLHDA+ +V+
Sbjct: 344 EHLGTCEVFEEIQIGSE-RYNLFKGCPN-AKTSTLLLRGGAEQVIAEVERSLHDAIMIVK 401

Query: 710 CLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNP 531
             +  + ++AGGGA E+E+S+ L  ++K + G +   + +FA++LEVIP  L ENAG + 
Sbjct: 402 RALQNKMVVAGGGAIEMEISKYLRDYSKTIAGKQQLIIHAFAKALEVIPRQLCENAGFDA 461

Query: 530 ITIVTELRNRHAQGEINAGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKID 351
           + ++ +LR  H++GE   GI+     + +   + V +P LV  +A+S ATE   +IL +D
Sbjct: 462 VELLNKLRLAHSKGEKWFGIDFENENVGDNFAKFVWEPALVKINALSSATEATNLILSVD 521

Query: 350 DIV 342
           + +
Sbjct: 522 ETI 524



>sp|P42943|TCPH_YEAST T-complex protein 1, eta subunit (TCP-1-eta)
           (CCT-eta).>pir|S53376|S53376 t-complex protein 1 homolog
           YJL111w - yeast (Saccharomyces
           cerevisiae)>gb:SCXLTORFS_1710940 S.cerevisiae DNA from
           left arm of chromosome X.>gb:SCYJL111W_1712674
           S.cerevisiae chromosome X reading frame ORF YJL111w.
          Length = 550

 Score =  118 bits (296), Expect = 2e-25
 Identities = 68/210 (32%), Positives = 118/210 (56%)
 Frame = -1

Query: 968 VERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTAS 789
           V  D++  + + +     +     + E LG   L EE+ +G   +   +       +T +
Sbjct: 318 VSADDMNRVIQAVGGSIQSTTSDIKPEHLGTCALFEEMQIGS--ERYNLFQGCPQAKTCT 375

Query: 788 VLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGME 609
           +L+RG  + VI E ERSLHDA+ +V+  +  + ++AGGGA E+E+S+ L  ++K + G +
Sbjct: 376 LLLRGGAEQVIAEVERSLHDAIMIVKRALQNKLIVAGGGATEMEVSKCLRDYSKTIAGKQ 435

Query: 608 GYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQITNILEEN 429
              + +FA++LEVIP  L ENAG + I I+ +LR  H++GE   G+      I +   + 
Sbjct: 436 QMIINAFAKALEVIPRQLCENAGFDAIEILNKLRLAHSKGEKWYGVVFETENIGDNFAKF 495

Query: 428 VVQPLLVSTSAISLATECVRMILKIDDIVT 339
           V +P LV  +A++ ATE   +IL +D+ +T
Sbjct: 496 VWEPALVKINALNSATEATNLILSVDETIT 525



>gb:AJ720426_2502613 Gallus gallus mRNA for hypothetical protein,
           clone 17g3.
          Length = 553

 Score =  118 bits (295), Expect = 2e-25
 Identities = 61/181 (33%), Positives = 111/181 (61%)
 Frame = -1

Query: 884 LGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCL 705
           LG  +L EE+ +G G +    TG     +T ++++RG  +  ++E ERSLHDA+ +VR  
Sbjct: 342 LGRCELFEEIQIG-GDRYNFFTGCPK-AKTCTIILRGGAEQFMEETERSLHDAIMIVRRA 399

Query: 704 VSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPIT 525
           +    ++AGGGA E+ELS+ L  +++ + G +   + ++A++LE+IP  L +NAG +   
Sbjct: 400 IKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATN 459

Query: 524 IVTELRNRHAQGEINAGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDI 345
           I+ +LR +HAQG +  G++V    I +  E  V +P +V  +A++ A+E   +I+ +D+ 
Sbjct: 460 ILNKLRAKHAQGGMWYGVDVNNEDIADNFEACVWEPAIVRINALTAASEAACLIVSVDET 519

Query: 344 V 342
           +
Sbjct: 520 I 520



>gb:AE017341_1754249 Cryptococcus neoformans var. neoformans JEC21
           chromosome 1, complete sequence.
          Length = 523

 Score =  118 bits (295), Expect = 2e-25
 Identities = 59/182 (32%), Positives = 113/182 (62%)
 Frame = -1

Query: 887 KLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRC 708
           K+G  D++EE+ +G+  K++K +G+   G   +V++RG+   +++EAERSLHDAL V+  
Sbjct: 334 KIGRCDVIEEIMIGED-KLIKFSGVA-AGEACTVVLRGATSQMVEEAERSLHDALSVLSQ 391

Query: 707 LVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPI 528
            V +  +  GGG  E+ +S Q+   A+ ++G +   V+ FA +L  +P  +A+N G +  
Sbjct: 392 TVKETRVTLGGGCAEMLMSCQVEEAARTVKGKKALAVEGFARALRQMPTIIADNGGYDSS 451

Query: 527 TIVTELRNRHAQGEINAGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDD 348
            +VT+LR  H +G+ +AG+++ KG+I ++ +  + +   +    +  A+E   MIL++D+
Sbjct: 452 DLVTKLRAAHYEGQSDAGLDMDKGEIGSMRQLGITESFKLKKQVVVSASEAAEMILRVDN 511

Query: 347 IV 342
           I+
Sbjct: 512 IL 513



>gb:AE014186_938294 Plasmodium falciparum 3D7 chromosome 11 complete
           sequence.>gb:AE014840_1229028 Plasmodium falciparum 3D7
           chromosome 11 section 5 of 8 of the complete sequence.
          Length = 544

 Score =  118 bits (295), Expect = 2e-25
 Identities = 74/230 (32%), Positives = 121/230 (52%), Gaps = 16/230 (6%)
 Frame = -1

Query: 983 MVIKDVERDEIEFITKTLN------CLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKI 822
           + ++ V +D++  I K  N         I   E F A  LG+ D V E  +GD   ++  
Sbjct: 304 IAVRRVNKDDLRRIAKLTNGQIRLTLSSIDGTEKFEASSLGYCDEVYEDKVGDWD-LMFF 362

Query: 821 TGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQL 642
            G +   ++ ++L+RG+N  V+DE +RS+HDALC V   +   +++ GGG  E+ LS  L
Sbjct: 363 KGCRT-SKSNTILLRGANDFVLDEMQRSIHDALCSVSRALESNYVVVGGGCVEVALSVYL 421

Query: 641 GAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEIN------ 480
             +AK L   E   +  FAESL VIP  LA NA  + I +V +LR  H + ++       
Sbjct: 422 EDFAKTLGSREQLAIAEFAESLLVIPKILALNASYDSIDLVCKLRAYHTKSQVMNIEDSK 481

Query: 479 ----AGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
                G+++  G++ N L+  V++ ++    +I  ATE    IL+IDD++
Sbjct: 482 DYKWYGLDLVNGKVANNLKNGVLEAMISKIKSIRFATEATITILRIDDLI 531



>gb:D89272_1675389 Schizosaccharomyces pombe mRNA, partial cds,
           clone: SY 1780.
          Length = 557

 Score =  117 bits (294), Expect = 3e-25
 Identities = 65/221 (29%), Positives = 124/221 (56%), Gaps = 3/221 (1%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           + +I+VI+   + E+  + + +   P+A +     E++G  D+VE + +G G ++     
Sbjct: 318 RFEILVIRVPSKFELRRLCRVVGATPLARMGVPMPEEMGSVDVVETIEIG-GDRVTVFRQ 376

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
           ++D+ RTA++++RG+ +  +D+ ER++ D + +V+ LV    LI G GA +++L  +L +
Sbjct: 377 VEDITRTATIVLRGATKTYLDDLERAIDDGVNIVKALVKDNRLIFGAGASDMQLCIRLIS 436

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRH--AQGE-INAGINV 465
             +   G+  + +K + E+ EV+P T++ENAGL+P  ++++L   H    GE I   +  
Sbjct: 437 VGEKTPGIYQHAIKQYGEAFEVVPRTISENAGLDPTDVISKLYAAHHKENGESIGVDVEC 496

Query: 464 RKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
                 +  E  +   LL   SAI LATE V  +L +D +V
Sbjct: 497 ENDGTLDAKEAGIFDVLLAKKSAIRLATETVLTVLNVDQVV 537



>gb:LMFL2719_1387894 Leishmania major Friedlin chromosome 23 cosmid
           L2719, complete sequence.
          Length = 551

 Score =  117 bits (294), Expect = 3e-25
 Identities = 73/220 (33%), Positives = 118/220 (53%), Gaps = 1/220 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I  I+ + + +   I +  +   ++ VE    E +G A L E   +GD      ITG
Sbjct: 308 KAGITCIRRLRKTDNNRIARATSATIVSRVEELTQEHIGKAGLFEIKKIGDE-YFTFITG 366

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
               G   S+L+RG+++  ++E ER+LHDA+CV R ++ +  ++ G  + E+ +S  L A
Sbjct: 367 CPG-GSACSILLRGASKDTLNEMERNLHDAMCVARNIILEPRIVYGAASCEMSVSSTLMA 425

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGE-INAGINVRK 459
            AK + G+E    ++ A +LEV+P  L  N G N I +VT+LR RH   E    GI+   
Sbjct: 426 KAKSIGGVEQAAYQAVAMALEVVPRILTSNCGANVIRVVTDLRARHTNPEGWYWGIDGHS 485

Query: 458 GQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVT 339
           G I ++    V++P  V   A+  A E   MIL++DD+V+
Sbjct: 486 GHIVDVRTIKVIEPAAVKVQALKTAIEAASMILRVDDVVS 525



>pir|T43202|T43202 probable chaperonin, t-complex-type - fission
           yeast  (Schizosaccharomyces pombe) (fragment)
          Length = 557

 Score =  117 bits (294), Expect = 3e-25
 Identities = 65/221 (29%), Positives = 124/221 (56%), Gaps = 3/221 (1%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           + +I+VI+   + E+  + + +   P+A +     E++G  D+VE + +G G ++     
Sbjct: 318 RFEILVIRVPSKFELRRLCRVVGATPLARMGVPMPEEMGSVDVVETIEIG-GDRVTVFRQ 376

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
           ++D+ RTA++++RG+ +  +D+ ER++ D + +V+ LV    LI G GA +++L  +L +
Sbjct: 377 VEDITRTATIVLRGATKTYLDDLERAIDDGVNIVKALVKDNRLIFGAGASDMQLCIRLIS 436

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRH--AQGE-INAGINV 465
             +   G+  + +K + E+ EV+P T++ENAGL+P  ++++L   H    GE I   +  
Sbjct: 437 VGEKTPGIYQHAIKQYGEAFEVVPRTISENAGLDPTDVISKLYAAHHKENGESIGVDVEC 496

Query: 464 RKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
                 +  E  +   LL   SAI LATE V  +L +D +V
Sbjct: 497 ENDGTLDAKEAGIFDVLLAKKSAIRLATETVLTVLNVDQVV 537



>sp|P78921|TCPQ_SCHPO Probable T-complex protein 1, theta subunit
           (TCP-1-theta) (CCT-theta).>pir|T40258|T40258 probable
           t-complex protein 1, theta subunit - fission yeast
           (Schizosaccharomyces pombe)>gb:SPBC337_1719940 S.pombe
           chromosome II cosmid c337.
          Length = 546

 Score =  117 bits (294), Expect = 3e-25
 Identities = 65/221 (29%), Positives = 124/221 (56%), Gaps = 3/221 (1%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           + +I+VI+   + E+  + + +   P+A +     E++G  D+VE + +G G ++     
Sbjct: 307 RFEILVIRVPSKFELRRLCRVVGATPLARMGVPMPEEMGSVDVVETIEIG-GDRVTVFRQ 365

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
           ++D+ RTA++++RG+ +  +D+ ER++ D + +V+ LV    LI G GA +++L  +L +
Sbjct: 366 VEDITRTATIVLRGATKTYLDDLERAIDDGVNIVKALVKDNRLIFGAGASDMQLCIRLIS 425

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRH--AQGE-INAGINV 465
             +   G+  + +K + E+ EV+P T++ENAGL+P  ++++L   H    GE I   +  
Sbjct: 426 VGEKTPGIYQHAIKQYGEAFEVVPRTISENAGLDPTDVISKLYAAHHKENGESIGVDVEC 485

Query: 464 RKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
                 +  E  +   LL   SAI LATE V  +L +D +V
Sbjct: 486 ENDGTLDAKEAGIFDVLLAKKSAIRLATETVLTVLNVDQVV 526



>sp|P87153|TCPH_SCHPO Probable T-complex protein 1, eta subunit
           (TCP-1-eta) (CCT-eta).>pir|T40007|T40007 Cct7p - fission
           yeast (Schizosaccharomyces pombe)>gb:SPBC25H2_1719651
           S.pombe chromosome II cosmid c25H2.
          Length = 558

 Score =  117 bits (294), Expect = 3e-25
 Identities = 68/209 (32%), Positives = 116/209 (55%)
 Frame = -1

Query: 968 VERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTAS 789
           V  D++  + + +     +   +   + LG  D  EE  +G G +     G     +T +
Sbjct: 319 VAADDLNRVVQAVGGSIQSTCSNIEEKHLGTCDTFEERQIG-GDRFNLFEGCPK-AKTCT 376

Query: 788 VLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGME 609
           +++RG     I E ERSLHDA+ +V+  +    ++AGGGA E+ELS+ L  ++  + G +
Sbjct: 377 LILRGGADQFIAEVERSLHDAIMIVKHALKNNLVVAGGGACEMELSKYLRDYSLTISGKQ 436

Query: 608 GYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQITNILEEN 429
              + +FA SLEVIP  L +NAG +   I+ +LR +HA+GE+ AG+++    + N  E+ 
Sbjct: 437 QNFIAAFARSLEVIPRQLCDNAGFDSTNILNKLRMQHAKGEMWAGVDMDSEGVANNFEKF 496

Query: 428 VVQPLLVSTSAISLATECVRMILKIDDIV 342
           V +P  V ++AI  ATE   +IL +D+ +
Sbjct: 497 VWEPSTVKSNAILSATEAATLILSVDETI 525



>gb:A45921_1449230 Sequence 60 from Patent WO9520654.
          Length = 543

 Score =  117 bits (293), Expect = 4e-25
 Identities = 60/181 (33%), Positives = 110/181 (60%)
 Frame = -1

Query: 884 LGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCL 705
           LGH  + EE  +G G +    TG     +T ++++RG  +  ++E ERSLHDA+ +VR  
Sbjct: 341 LGHCQVFEETQIG-GERYNFFTGCPK-AKTCTIILRGGAEQFMEETERSLHDAIMIVRRA 398

Query: 704 VSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPIT 525
           +    ++AGGGA E+ELS+ L  +++ + G +   + ++A++LE+IP  L +NAG +   
Sbjct: 399 IKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATN 458

Query: 524 IVTELRNRHAQGEINAGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDI 345
           I+ +LR RHAQG +  G+++    I +  +  V +P +V  +A++ A+E   +I+ +D+ 
Sbjct: 459 ILNKLRARHAQGGMWYGVDINNENIADNFQAFVWEPAMVRINALTAASEAACLIVSVDET 518

Query: 344 V 342
           +
Sbjct: 519 I 519



>gb:AK077781_1172056 Mus musculus adult male thymus cDNA, RIKEN
           full-length enriched library, clone:5830447N23
           product:chaperonin subunit 7 (eta), full insert
           sequence.
          Length = 544

 Score =  117 bits (293), Expect = 4e-25
 Identities = 60/181 (33%), Positives = 110/181 (60%)
 Frame = -1

Query: 884 LGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCL 705
           LGH  + EE  +G G +    TG     +T ++++RG  +  ++E ERSLHDA+ +VR  
Sbjct: 342 LGHCQVFEETQIG-GERYNFFTGCPK-AKTCTIILRGGAEQFMEETERSLHDAIMIVRRA 399

Query: 704 VSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPIT 525
           +    ++AGGGA E+ELS+ L  +++ + G +   + ++A++LE+IP  L +NAG +   
Sbjct: 400 IKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATN 459

Query: 524 IVTELRNRHAQGEINAGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDI 345
           I+ +LR RHAQG +  G+++    I +  +  V +P +V  +A++ A+E   +I+ +D+ 
Sbjct: 460 ILNKLRARHAQGGMWYGVDINNENIADNFQAFVWEPAMVRINALTAASEAACLIVSVDET 519

Query: 344 V 342
           +
Sbjct: 520 I 520



>sp|P80313|TCPH_MOUSE T-complex protein 1, eta subunit (TCP-1-eta)
           (CCT-eta).>pir|S43058|S43058 CCTeta protein eta chain -
           mouse>gb:AB022160_2044205 Mus musculus Ccth gene for
           chaperonin containing TCP-1 eta subunit, complete
           cds.>gb:BC008255_2090683 Mus musculus chaperonin subunit
           7 (eta), mRNA (cDNA clone MGC:6499 IMAGE:2648519),
           complete cds.>gb:MMCCTHE_2114454 M.musculus Ccth mRNA
           for CCT eta subunit (chaperonin containing
           TCP-1).>gb:BC086098_2564686 Xenopus laevis hypothetical
           LOC495614, mRNA (cDNA clone MGC:98477 IMAGE:7198406),
           complete cds.
          Length = 544

 Score =  117 bits (293), Expect = 4e-25
 Identities = 60/181 (33%), Positives = 110/181 (60%)
 Frame = -1

Query: 884 LGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCL 705
           LGH  + EE  +G G +    TG     +T ++++RG  +  ++E ERSLHDA+ +VR  
Sbjct: 342 LGHCQVFEETQIG-GERYNFFTGCPK-AKTCTIILRGGAEQFMEETERSLHDAIMIVRRA 399

Query: 704 VSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPIT 525
           +    ++AGGGA E+ELS+ L  +++ + G +   + ++A++LE+IP  L +NAG +   
Sbjct: 400 IKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATN 459

Query: 524 IVTELRNRHAQGEINAGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDI 345
           I+ +LR RHAQG +  G+++    I +  +  V +P +V  +A++ A+E   +I+ +D+ 
Sbjct: 460 ILNKLRARHAQGGMWYGVDINNENIADNFQAFVWEPAMVRINALTAASEAACLIVSVDET 519

Query: 344 V 342
           +
Sbjct: 520 I 520



>gb:BC068901_2555397 Xenopus laevis t-complex polypeptide 1, mRNA
           (cDNA clone MGC:83095 IMAGE:6317335), complete cds.
          Length = 555

 Score =  117 bits (292), Expect = 5e-25
 Identities = 77/229 (33%), Positives = 125/229 (54%), Gaps = 15/229 (6%)
 Frame = -1

Query: 983 MVIKDVERDEIEFITKTLN---CLPIANVE---HFRAEKLGHAD-LVEEVSLGDGGKIVK 825
           M ++ V + +++ I K      C  +AN+E    F A  LG A+ +V+E    D   +VK
Sbjct: 306 MAVRRVLKKDLKRIAKATGATMCSTLANLEGEESFEASMLGQAEEVVQERICDDELILVK 365

Query: 824 ITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQ 645
            T  +     AS+++RG+N  + DE ERS+HDALCVV+ ++  ++++ GGGA E  LS  
Sbjct: 366 NTKARTC---ASIILRGANDFMCDEMERSVHDALCVVKRVLESKYVVPGGGAVEAALSIY 422

Query: 644 LGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEIN----- 480
           L  +A  +   E   +  FA +L VIP TLA NA  +   +V +LR  H + ++N     
Sbjct: 423 LENYATSMGSREQLAIAEFARALLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKN 482

Query: 479 ---AGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
               G+++  G+  +  +  V +P LV T ++  ATE    IL+IDD++
Sbjct: 483 LKWIGLDLLNGKPRDNKQAGVFEPTLVKTKSLKFATEAAITILRIDDVI 531



>gb:BC080140_2561571 Xenopus tropicalis cct8-prov protein, mRNA
           (cDNA clone MGC:89698 IMAGE:7026586), complete cds.
          Length = 554

 Score =  116 bits (291), Expect = 6e-25
 Identities = 66/226 (29%), Positives = 123/226 (54%), Gaps = 2/226 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  +MV++   + ++  + KT+    +  +    AE++G  D V    +GD  ++V    
Sbjct: 307 KYNLMVVRLNSKWDLRRLCKTVCGTALPRLTPPTAEEMGRCDSVYLSEVGDT-QVVVFKH 365

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++ G  A+V++RGS   ++D+ ER++ DA+   + L   + L+ GGGA E+EL++Q+ +
Sbjct: 366 DKEDGAIATVVIRGSTDNLMDDVERAVDDAVNTFKILTRDKRLVPGGGATEVELAKQITS 425

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAG--INVR 462
           + +   G++ Y +K FAE+ E IP  LAEN+G+    I+++L   H +G  N G  I   
Sbjct: 426 YGETCPGLDQYAIKKFAEAFESIPRALAENSGVKANEIISKLYAMHQEGNKNVGFDIEAE 485

Query: 461 KGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR*IG 324
              + +++E N++   L     I LAT     +L++D I+  +  G
Sbjct: 486 SAAVKDMMESNILDTYLGKYWGIKLATNAAITVLRVDQIIMAKAAG 531



>gb:AK172867_2069801 Mus musculus mRNA for mKIAA0002 protein.
          Length = 555

 Score =  116 bits (291), Expect = 6e-25
 Identities = 64/226 (28%), Positives = 126/226 (55%), Gaps = 2/226 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  IM+++   + ++  + KT+    +  +     E++GH D V    +GD  ++V    
Sbjct: 314 KYNIMLVRLNSKWDLRRLCKTVGATALPKLTPPVQEEMGHCDSVYLSEVGDT-QVVVFKH 372

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++ G  +++++RGS   ++D+ ER++ D +   + L   + L+ GGGA EIEL++Q+ +
Sbjct: 373 EKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELAKQITS 432

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRK- 459
           + +   G+E Y +K FAE+ E IP  LAEN+G+    ++++L + H +G  N G+++   
Sbjct: 433 YGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYSVHQEGNKNVGLDIEAE 492

Query: 458 -GQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR*IG 324
              + ++LE +++   L    AI LAT     +L++D I+  +  G
Sbjct: 493 VPAVKDMLEASILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAG 538



>gb:AB022161_2044206 Mus musculus Cctq gene for chaperonin
           containing TCP-1 theta subunit, complete cds.
          Length = 547

 Score =  116 bits (291), Expect = 6e-25
 Identities = 64/226 (28%), Positives = 126/226 (55%), Gaps = 2/226 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  IM+++   + ++  + KT+    +  +     E++GH D V    +GD  ++V    
Sbjct: 306 KYNIMLVRLNSKWDLRRLCKTVGATALPKLTPPVQEEMGHCDSVYLSEVGDT-QVVVFKH 364

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++ G  +++++RGS   ++D+ ER++ D +   + L   + L+ GGGA EIEL++Q+ +
Sbjct: 365 EKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELAKQITS 424

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRK- 459
           + +   G+E Y +K FAE+ E IP  LAEN+G+    ++++L + H +G  N G+++   
Sbjct: 425 YGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYSVHQEGNKNVGLDIEAE 484

Query: 458 -GQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR*IG 324
              + ++LE +++   L    AI LAT     +L++D I+  +  G
Sbjct: 485 VPAVKDMLEASILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAG 530



>gb:AK075880_1171074 Mus musculus adult male tongue cDNA, RIKEN
           full-length enriched library, clone:2310021D01
           product:chaperonin subunit 8 (theta), full insert
           sequence.
          Length = 548

 Score =  116 bits (291), Expect = 6e-25
 Identities = 64/226 (28%), Positives = 126/226 (55%), Gaps = 2/226 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  IM+++   + ++  + KT+    +  +     E++GH D V    +GD  ++V    
Sbjct: 307 KYNIMLVRLNSKWDLRRLCKTVGATALPKLTPPVQEEMGHCDSVYLSEVGDT-QVVVFKH 365

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++ G  +++++RGS   ++D+ ER++ D +   + L   + L+ GGGA EIEL++Q+ +
Sbjct: 366 EKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELAKQITS 425

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRK- 459
           + +   G+E Y +K FAE+ E IP  LAEN+G+    ++++L + H +G  N G+++   
Sbjct: 426 YGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYSVHQEGNKNVGLDIEAE 485

Query: 458 -GQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR*IG 324
              + ++LE +++   L    AI LAT     +L++D I+  +  G
Sbjct: 486 VPAVKDMLEASILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAG 531



>gb:AK014005_1157744 Mus musculus 13 days embryo head cDNA, RIKEN
           full-length enriched library, clone:3110005N06
           product:chaperonin subunit 8 (theta), full insert
           sequence.
          Length = 263

 Score =  116 bits (291), Expect = 6e-25
 Identities = 64/226 (28%), Positives = 126/226 (55%), Gaps = 2/226 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  IM+++   + ++  + KT+    +  +     E++GH D V    +GD  ++V    
Sbjct: 22  KYNIMLVRLNSKWDLRRLCKTVGATALPKLTPPVQEEMGHCDSVYLSEVGDT-QVVVFKH 80

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++ G  +++++RGS   ++D+ ER++ D +   + L   + L+ GGGA EIEL++Q+ +
Sbjct: 81  EKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELAKQITS 140

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRK- 459
           + +   G+E Y +K FAE+ E IP  LAEN+G+    ++++L + H +G  N G+++   
Sbjct: 141 YGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYSVHQEGNKNVGLDIEAE 200

Query: 458 -GQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR*IG 324
              + ++LE +++   L    AI LAT     +L++D I+  +  G
Sbjct: 201 VPAVKDMLEASILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAG 246



>sp|P42932|TCPQ_MOUSE T-complex protein 1, theta subunit
           (TCP-1-theta) (CCT-theta).>pir|JC4073|JC4073 TCP-1
           containing cytosolic chaperonin (CCT) theta chain -
           mouse>gb:A45922_1449231 Sequence 61 from Patent
           WO9520654.>gb:BC009007_2090769 Mus musculus chaperonin
           subunit 8 (theta), mRNA (cDNA clone MGC:6053
           IMAGE:3582639), complete cds.>gb:MMCCTQG_2114455
           M.musculus Cctq mRNA encoding cytosolic chaperone
           containing TCP-1, theta subunit (CCTtheta).
          Length = 548

 Score =  116 bits (291), Expect = 6e-25
 Identities = 64/226 (28%), Positives = 126/226 (55%), Gaps = 2/226 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  IM+++   + ++  + KT+    +  +     E++GH D V    +GD  ++V    
Sbjct: 307 KYNIMLVRLNSKWDLRRLCKTVGATALPKLTPPVQEEMGHCDSVYLSEVGDT-QVVVFKH 365

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++ G  +++++RGS   ++D+ ER++ D +   + L   + L+ GGGA EIEL++Q+ +
Sbjct: 366 EKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELAKQITS 425

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRK- 459
           + +   G+E Y +K FAE+ E IP  LAEN+G+    ++++L + H +G  N G+++   
Sbjct: 426 YGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYSVHQEGNKNVGLDIEAE 485

Query: 458 -GQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR*IG 324
              + ++LE +++   L    AI LAT     +L++D I+  +  G
Sbjct: 486 VPAVKDMLEASILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAG 531



>gb:BC077927_2560573 Xenopus laevis chaperonin containing TCP1,
           subunit 7 (eta), mRNA (cDNA clone MGC:80866
           IMAGE:5514818), complete cds.
          Length = 542

 Score =  116 bits (290), Expect = 8e-25
 Identities = 63/181 (34%), Positives = 109/181 (60%)
 Frame = -1

Query: 884 LGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCL 705
           LG   L EE  +G G +    TG     +T ++++RG  +  ++E ERSLHDA+ +VR  
Sbjct: 342 LGGCALFEETQVG-GERYNFFTGCPK-AKTCTIILRGGAEQFMEETERSLHDAIMIVRRA 399

Query: 704 VSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPIT 525
           +    ++AGGGA E+ELS+ L  +++ + G +   + S+A++LE+IP  L +NAG +   
Sbjct: 400 IKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGSYAKALEIIPRQLCDNAGFDATN 459

Query: 524 IVTELRNRHAQGEINAGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDI 345
           I+ +LR +HAQG +  G++V    I +  E  V +P +V  +A++ A+E   +IL +D+ 
Sbjct: 460 ILNKLRAKHAQGGMWYGVDVNNEDIADNFEACVWEPAIVRINALTAASEAACLILSVDET 519

Query: 344 V 342
           +
Sbjct: 520 I 520



>gb:BC045074_2549026 Xenopus laevis chaperonin containing TCP1,
           subunit 7 (eta), mRNA (cDNA clone IMAGE:5542129),
           partial cds.
          Length = 554

 Score =  116 bits (290), Expect = 8e-25
 Identities = 63/181 (34%), Positives = 109/181 (60%)
 Frame = -1

Query: 884 LGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCL 705
           LG   L EE  +G G +    TG     +T ++++RG  +  ++E ERSLHDA+ +VR  
Sbjct: 354 LGGCALFEETQVG-GERYNFFTGCPK-AKTCTIILRGGAEQFMEETERSLHDAIMIVRRA 411

Query: 704 VSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPIT 525
           +    ++AGGGA E+ELS+ L  +++ + G +   + S+A++LE+IP  L +NAG +   
Sbjct: 412 IKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGSYAKALEIIPRQLCDNAGFDATN 471

Query: 524 IVTELRNRHAQGEINAGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDI 345
           I+ +LR +HAQG +  G++V    I +  E  V +P +V  +A++ A+E   +IL +D+ 
Sbjct: 472 ILNKLRAKHAQGGMWYGVDVNNEDIADNFEACVWEPAIVRINALTAASEAACLILSVDET 531

Query: 344 V 342
           +
Sbjct: 532 I 532



>gb:CR382129_1662145 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 554

 Score =  116 bits (290), Expect = 8e-25
 Identities = 69/185 (37%), Positives = 110/185 (59%), Gaps = 2/185 (1%)
 Frame = -1

Query: 890 EKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVR 711
           E LG  +  EE  +G G +    TG     +T ++++RG  +  I E ERSLHDA+ +V+
Sbjct: 344 EALGTCERFEERQIG-GERFNIFTGCPK-AKTCTLILRGGAEQFIAEVERSLHDAIMIVK 401

Query: 710 CLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNP 531
             V+   ++AGGGA E+E+S+ L   AK + G +   + +FA +LEVIP  L  NAG + 
Sbjct: 402 RAVANTSVVAGGGALEMEVSKYLRDHAKTVAGKQQLIIGAFARALEVIPRQLCANAGFDG 461

Query: 530 ITIVTELRNRHAQGEINAGINVR--KGQITNILEENVVQPLLVSTSAISLATECVRMILK 357
             I+ +LR RHA+G+  AG++ R   G +T+ ++  V +P LV  +A+  ATE   ++L 
Sbjct: 462 TDILNQLRMRHAKGDTWAGVDFRDDNGGVTDNMKTYVWEPALVKINALQSATEAACLVLS 521

Query: 356 IDDIV 342
           +D+ V
Sbjct: 522 VDETV 526



>gb:AF494046_1276774 Physarum polycephalum chaperonin containing
           TCP-1 eta subunit (CCT7) mRNA, complete cds.
          Length = 552

 Score =  116 bits (290), Expect = 8e-25
 Identities = 66/209 (31%), Positives = 114/209 (54%)
 Frame = -1

Query: 968 VERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTAS 789
           V  +++  + +         V +     LG     EE  +G   +    TG  +   +A+
Sbjct: 313 VAEEDLRRVCRATGAATQTTVNNLIPSVLGTCAKFEEKQVG-ANRYNLFTGCTE-AHSAT 370

Query: 788 VLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGME 609
           +++RG  +  I+EAERSLHDA+ +VR       ++AGGGA E+E+S+ L   A  + G +
Sbjct: 371 IILRGGGEQFIEEAERSLHDAIMIVRRARKTHSVVAGGGAIEMEVSKYLREHALTIAGKQ 430

Query: 608 GYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQITNILEEN 429
            Y  ++FA++LE+IP  +A+NAG + I ++T+LR +H QG    G++V      +     
Sbjct: 431 QYLTRAFAKALEIIPRQIADNAGFDSIDLLTQLRQKHDQGHKWYGVDVTNETACDTFANF 490

Query: 428 VVQPLLVSTSAISLATECVRMILKIDDIV 342
           V +P L+ T++ + ATE   +IL +D+ V
Sbjct: 491 VWEPTLIKTNSFTAATEAACLILSVDETV 519



>gb:AF442545_1271409 Physarum polycephalum CCT chaperonin alpha
           subunit mRNA, complete cds.
          Length = 546

 Score =  116 bits (290), Expect = 8e-25
 Identities = 75/230 (32%), Positives = 125/230 (54%), Gaps = 14/230 (6%)
 Frame = -1

Query: 983 MVIKDVERDEIEFITKTLN---CLPIANVE---HFRAEKLGHADLVEEVSLGDGGKIVKI 822
           M ++  ++++++ I K       L +AN+E    F A  LG  + V E  + D   I+  
Sbjct: 309 MAVRRCKKEDLKRIAKATGGSVLLTLANLEGDESFDASNLGTCEEVVEERIADDECILIK 368

Query: 821 TGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQL 642
           T   D  +++S+++RG+N +++DE ERS+HDAL +V+  +    ++AGGGA E  LS  L
Sbjct: 369 T---DNKKSSSIILRGANSVMLDEMERSMHDALSIVKRTLESNTVVAGGGAVEASLSIYL 425

Query: 641 GAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEIN------ 480
              A  L   E   +  +AE++ VIP TLA NA  +   +V +LR  H   + +      
Sbjct: 426 ENCATTLGSREQLAIAEYAEAMLVIPKTLAVNAAKDATDLVAKLRAHHNAAQTDATKKQY 485

Query: 479 --AGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTV 336
             AG+++  G++ N LE  V++P +     I  ATE    IL+ID++VT+
Sbjct: 486 AYAGLDLVNGKVRNNLEAGVLEPAMSKVKMIKFATEAAITILRIDELVTL 535



>gb:CR456719_1992926 Homo sapiens full open reading frame cDNA clone
           RZPDo834H033D for gene CCT7, chaperonin containing TCP1,
           subunit 7 (eta); complete cds, incl. stopcodon.
          Length = 543

 Score =  115 bits (288), Expect = 1e-24
 Identities = 62/190 (32%), Positives = 111/190 (58%)
 Frame = -1

Query: 911 NVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVRGSNQLVIDEAERSLH 732
           +V    A+ LG   + EE  +G G +    TG     +T + ++RG  +  ++E ERSLH
Sbjct: 333 SVNALSADVLGRCQVFEETQIG-GERYNFFTGCPK-AKTCTFILRGGAEQFMEETERSLH 390

Query: 731 DALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCVKSFAESLEVIPYTLA 552
           DA+ +VR  +    ++AGGGA E+ELS+ L  +++ + G +   + ++A++LE+IP  L 
Sbjct: 391 DAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLC 450

Query: 551 ENAGLNPITIVTELRNRHAQGEINAGINVRKGQITNILEENVVQPLLVSTSAISLATECV 372
           +NAG +   I+ +LR RHAQG    G+++    I +  E  V +P +V  +A++ A+E  
Sbjct: 451 DNAGFDATNILNKLRARHAQGGTWYGVDINNEDIADNFEAFVWEPAMVRINALTAASEAA 510

Query: 371 RMILKIDDIV 342
            +I+ +D+ +
Sbjct: 511 CLIVSVDETI 520



>gb:CR860934_1184977 Pongo pygmaeus mRNA; cDNA DKFZp469M1631 (from
           clone DKFZp469M1631).
          Length = 543

 Score =  115 bits (288), Expect = 1e-24
 Identities = 62/190 (32%), Positives = 111/190 (58%)
 Frame = -1

Query: 911 NVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVRGSNQLVIDEAERSLH 732
           +V    A+ LG   + EE  +G G +    TG     +T + ++RG  +  ++E ERSLH
Sbjct: 333 SVNALSADVLGRCQVFEETQIG-GERYNFFTGCPK-AKTCTFILRGGAEQFMEETERSLH 390

Query: 731 DALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCVKSFAESLEVIPYTLA 552
           DA+ +VR  +    ++AGGGA E+ELS+ L  +++ + G +   + ++A++LE+IP  L 
Sbjct: 391 DAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLC 450

Query: 551 ENAGLNPITIVTELRNRHAQGEINAGINVRKGQITNILEENVVQPLLVSTSAISLATECV 372
           +NAG +   I+ +LR RHAQG    G+++    I +  E  V +P +V  +A++ A+E  
Sbjct: 451 DNAGFDATNILNKLRARHAQGGTWYGVDINNEDIADNFEAFVWEPAMVRINALTAASEAA 510

Query: 371 RMILKIDDIV 342
            +I+ +D+ +
Sbjct: 511 CLIVSVDETI 520



>sp|Q99832|TCPH_HUMAN T-complex protein 1, eta subunit (TCP-1-eta)
           (CCT-eta) (HIV-1 Nef interacting
           protein).>gb:AF026292_1877304 Homo sapiens chaperonin
           containing t-complex polypeptide 1, eta subunit (Ccth)
           mRNA, complete cds.>gb:BC019296_1976809 Homo sapiens
           chaperonin containing TCP1, subunit 7 (eta), mRNA (cDNA
           clone MGC:4110 IMAGE:2905446), complete
           cds.>gb:BC088351_1989958 Homo sapiens chaperonin
           containing TCP1, subunit 7 (eta), mRNA (cDNA clone
           MGC:110985 IMAGE:6202511), complete
           cds.>gb:CR536511_1993805 Homo sapiens full open reading
           frame cDNA clone RZPDo834H1221D for gene CCT7,
           chaperonin containing TCP1, subunit 7 (eta); complete
           cds, incl. stopcodon.
          Length = 543

 Score =  115 bits (288), Expect = 1e-24
 Identities = 62/190 (32%), Positives = 111/190 (58%)
 Frame = -1

Query: 911 NVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVRGSNQLVIDEAERSLH 732
           +V    A+ LG   + EE  +G G +    TG     +T + ++RG  +  ++E ERSLH
Sbjct: 333 SVNALSADVLGRCQVFEETQIG-GERYNFFTGCPK-AKTCTFILRGGAEQFMEETERSLH 390

Query: 731 DALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCVKSFAESLEVIPYTLA 552
           DA+ +VR  +    ++AGGGA E+ELS+ L  +++ + G +   + ++A++LE+IP  L 
Sbjct: 391 DAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLC 450

Query: 551 ENAGLNPITIVTELRNRHAQGEINAGINVRKGQITNILEENVVQPLLVSTSAISLATECV 372
           +NAG +   I+ +LR RHAQG    G+++    I +  E  V +P +V  +A++ A+E  
Sbjct: 451 DNAGFDATNILNKLRARHAQGGTWYGVDINNEDIADNFEAFVWEPAMVRINALTAASEAA 510

Query: 371 RMILKIDDIV 342
            +I+ +D+ +
Sbjct: 511 CLIVSVDETI 520



>sp|O15891|TCPA_TETPY T-complex protein 1, alpha subunit
           (TCP-1-alpha) (CCT-alpha).>gb:TPU85397_1400544
           Tetrahymena pyriformis CCTalpha chaperonin subunit
           (TpCCTalpha) gene, complete cds.
          Length = 547

 Score =  115 bits (288), Expect = 1e-24
 Identities = 71/231 (30%), Positives = 124/231 (53%), Gaps = 16/231 (6%)
 Frame = -1

Query: 986 IMVIKDVERDEIEFITKTLNCLPIANV------EHFRAEKLGHADLVEEVSLGDGGKIVK 825
           +M ++ V++ ++  + K      +  +      E F A  LG    V E ++GD   I  
Sbjct: 305 VMGLRRVDKHDLRRLAKATGGTIVTTLATPEGDEVFEASYLGECAEVYEEAVGDNDCIF- 363

Query: 824 ITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQ 645
             G +     AS+++RG+N+ ++DE +RSLHD+LCVV+  +   +++ GGGA EI LS +
Sbjct: 364 FKGTK-RANCASIIIRGANEFMVDEVDRSLHDSLCVVKRTLESGYVVPGGGAVEIALSIK 422

Query: 644 LGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEI------ 483
           L  +A+ L   E   V  F E+L +IP  LA NA  +   +V++LR  HA  +       
Sbjct: 423 LEDFARTLGTKEQTAVAEFCEALNIIPKVLAANAAQDATELVSKLRALHAASQSSDDPAK 482

Query: 482 ----NAGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
               N G+++  G++ N ++  V++P++    ++  ATE    IL+IDD++
Sbjct: 483 KELKNCGLDLSLGKVRNNVKAGVLEPMVSKIKSLRFATEAAITILRIDDMI 533



>sp|Q9W790|TCPA_PALPA T-complex protein 1, alpha subunit
           (TCP-1-alpha) (CCT-alpha).>gb:AF143496_2477001
           Paleosuchus palpebrosus t-complex polypeptide 1 (TCP1)
           mRNA, complete cds.
          Length = 559

 Score =  115 bits (288), Expect = 1e-24
 Identities = 76/229 (33%), Positives = 125/229 (54%), Gaps = 15/229 (6%)
 Frame = -1

Query: 983 MVIKDVERDEIEFITKTLN---CLPIANVE---HFRAEKLGHAD-LVEEVSLGDGGKIVK 825
           M ++ V + +++ I K      C  +AN+E    F A  LG A+ +V+E    D   ++K
Sbjct: 309 MAVRRVLKKDLKRIAKASGATVCSTLANLEGEESFEASMLGQAEEVVQERVCDDELILIK 368

Query: 824 ITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQ 645
            T  +    +AS+++RG+N  + DE ERS+HDALCVV+ ++  + ++ GGGA E  LS  
Sbjct: 369 NTKART---SASIILRGANDFMCDEMERSIHDALCVVKRVLESKSVVPGGGAVEAALSIY 425

Query: 644 LGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEIN----- 480
           L  +A  +   E   +  FA SL +IP TLA NA  +   +V +LR  H + ++N     
Sbjct: 426 LENYATSMGSREQLAIAEFARSLLIIPNTLAVNAAQDATDLVAKLRAFHNEAQVNPERKN 485

Query: 479 ---AGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
               G+++  G+  +  +  V +P LV T ++  ATE    IL+IDD++
Sbjct: 486 LKWIGLDLINGKPRDNKQAGVFEPTLVKTKSLKFATEAAITILRIDDLI 534



>gb:AF143494_2477000 Xenopus laevis t-complex polypeptide 1 (TCP1)
           mRNA, complete cds.
          Length = 555

 Score =  115 bits (287), Expect = 2e-24
 Identities = 77/229 (33%), Positives = 124/229 (54%), Gaps = 15/229 (6%)
 Frame = -1

Query: 983 MVIKDVERDEIEFITKTLN---CLPIANVE---HFRAEKLGHAD-LVEEVSLGDGGKIVK 825
           M ++ V + +++ I K      C  +AN+E    F A  LG A+ +V+E    D   +VK
Sbjct: 306 MAVRRVLKKDLKRIAKATGATMCSTLANLEGEESFEASMLGQAEEVVQERICDDELILVK 365

Query: 824 ITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQ 645
            T  +     AS+++RG+N  + DE ERS+HDALCVV+ ++  + ++ GGGA E  LS  
Sbjct: 366 NTKARTC---ASIILRGANDFMCDEMERSVHDALCVVKRVLESKSVVPGGGAVEAALSIY 422

Query: 644 LGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEIN----- 480
           L  +A  +   E   +  FA +L VIP TLA NA  +   +V +LR  H + ++N     
Sbjct: 423 LENYATSMGSREQLAIAEFARALLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKN 482

Query: 479 ---AGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
               G+++  G+  +  +  V +P LV T ++  ATE    IL+IDD++
Sbjct: 483 LKWIGLDLLNGKPRDNKQAGVFEPTLVKTKSLKFATEAAITILRIDDVI 531



>gb:HUMKIAA000_2033901 Homo sapiens cosmid Q7A10 (D21S246) insert
           DNA, complete sequence.
          Length = 539

 Score =  115 bits (287), Expect = 2e-24
 Identities = 64/226 (28%), Positives = 124/226 (54%), Gaps = 2/226 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  IM+++   + ++  + KT+    +  +     E++GH D V    +GD  ++V    
Sbjct: 307 KYNIMLVRLNSKWDLRRLCKTVGATALPRLTPPVLEEMGHCDSVYLSEVGDT-QVVVFKH 365

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++ G  +++++RGS   ++D+ ER++ D +   + L   + L+ GGGA EIEL++Q+ +
Sbjct: 366 EKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELAKQITS 425

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRK- 459
           + +   G+E Y +K FAE+ E IP  LAEN+G+    ++++L   H +G  N G+++   
Sbjct: 426 YGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYAVHQEGNKNVGLDIEAE 485

Query: 458 -GQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR*IG 324
              + ++LE  ++   L    AI LAT     +L++D I+  +  G
Sbjct: 486 VPAVKDMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAG 531



>gb:BC012584_1973688 Homo sapiens chaperonin containing TCP1,
           subunit 8 (theta), mRNA (cDNA clone MGC:13491
           IMAGE:4133182), complete cds.
          Length = 497

 Score =  115 bits (287), Expect = 2e-24
 Identities = 64/226 (28%), Positives = 124/226 (54%), Gaps = 2/226 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  IM+++   + ++  + KT+    +  +     E++GH D V    +GD  ++V    
Sbjct: 256 KYNIMLVRLNSKWDLRRLCKTVGATALPRLTPPVLEEMGHCDSVYLSEVGDT-QVVVFKH 314

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++ G  +++++RGS   ++D+ ER++ D +   + L   + L+ GGGA EIEL++Q+ +
Sbjct: 315 EKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELAKQITS 374

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRK- 459
           + +   G+E Y +K FAE+ E IP  LAEN+G+    ++++L   H +G  N G+++   
Sbjct: 375 YGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYAVHQEGNKNVGLDIEAE 434

Query: 458 -GQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR*IG 324
              + ++LE  ++   L    AI LAT     +L++D I+  +  G
Sbjct: 435 VPAVKDMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAG 480



>gb:ATAC016795_1543596 Arabidopsis thaliana chromosome III BAC
           F26K24 genomic sequence, complete
           sequence.>gb:AY070472_1566855 Arabidopsis thaliana
           AT3g11830/F26K24_12 mRNA, complete
           cds.>gb:AY102137_1577742 Arabidopsis thaliana
           AT3g11830/F26K24_12 mRNA, complete cds.
          Length = 557

 Score =  115 bits (287), Expect = 2e-24
 Identities = 68/193 (35%), Positives = 112/193 (58%), Gaps = 3/193 (1%)
 Frame = -1

Query: 911 NVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVRGSNQLVIDEAERSLH 732
           +V +   E LG  ++ EE  +G  G+   I      GRTA++++RG     I+EAERSLH
Sbjct: 336 SVNNIIDEVLGTCEIFEEKQVG--GERFNIFSGCPSGRTATIVLRGGADQFIEEAERSLH 393

Query: 731 DALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCVKSFAESLEVIPYTLA 552
           DA+ +VR  V    ++ GGGA ++E+S+ L   ++ + G     + S+A++LEVIP  L 
Sbjct: 394 DAIMIVRRAVKNSTVVPGGGAIDMEISKYLRQHSRTIAGKSQLFINSYAKALEVIPRQLC 453

Query: 551 ENAGLNPITIVTELRNRHA--QGE-INAGINVRKGQITNILEENVVQPLLVSTSAISLAT 381
           +NAG +   ++ +LR +HA   GE  + G+++  G I +     V +P +V  +AI+ AT
Sbjct: 454 DNAGFDATDVLNKLRQKHAMQSGEGASYGVDINTGGIADSFANFVWEPAVVKINAINAAT 513

Query: 380 ECVRMILKIDDIV 342
           E   +IL +D+ V
Sbjct: 514 EAACLILSVDETV 526



>gb:AY251815_1313170 Bigelowiella natans chaperonin-containing TCP-1
           theta mRNA, complete cds.
          Length = 550

 Score =  115 bits (287), Expect = 2e-24
 Identities = 71/234 (30%), Positives = 127/234 (54%), Gaps = 10/234 (4%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHAD--LVEEVSLGDGGKIVKI 822
           K  +M+I+ + + E+  + KT+       +     E  G+     V EV L       K+
Sbjct: 308 KYGMMLIRILSKFELRRLAKTVKANMQVRLGAVPPEAQGYCAKAYVREVGLQ------KV 361

Query: 821 TGIQ----DMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIEL 654
           T  +    D+ + A++++RGS + ++++ ER++ D + V++ LV     + GGGA EIEL
Sbjct: 362 TVFEQKKTDLSQIATIMLRGSTKNILNDIERAVDDGVNVIKSLVKDGRFLPGGGATEIEL 421

Query: 653 SRQLGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAG 474
           +R+L   +   + +  Y +K FA+S E+IP TLAENAGL P+ ++T L + H  G+ +AG
Sbjct: 422 ARKLAELSNKEKTLSQYAIKKFAQSFEIIPTTLAENAGLKPLDVLTLLYSEHESGKKSAG 481

Query: 473 INVR----KGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR*IG 324
           IN+     K  + ++ ++ +   L     AI LAT+    +L++D I+  +  G
Sbjct: 482 INIDAQDVKQSVKDLAKDRIFDSLPAKKMAIKLATDAAVTVLRVDQIIMAKPAG 535



>sp|P50990|TCPQ_HUMAN T-complex protein 1, theta subunit
           (TCP-1-theta) (CCT-theta).>gb:CR858974_1183114 Pongo
           pygmaeus mRNA; cDNA DKFZp469C2223 (from clone
           DKFZp469C2223).>gb:BC072001_1988939 Homo sapiens
           chaperonin containing TCP1, subunit 8 (theta), mRNA
           (cDNA clone MGC:88704 IMAGE:6298609), complete
           cds.>gb:HS21C049_1997560 Homo sapiens chromosome 21
           segment HS21C049.
          Length = 548

 Score =  115 bits (287), Expect = 2e-24
 Identities = 64/226 (28%), Positives = 124/226 (54%), Gaps = 2/226 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  IM+++   + ++  + KT+    +  +     E++GH D V    +GD  ++V    
Sbjct: 307 KYNIMLVRLNSKWDLRRLCKTVGATALPRLTPPVLEEMGHCDSVYLSEVGDT-QVVVFKH 365

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++ G  +++++RGS   ++D+ ER++ D +   + L   + L+ GGGA EIEL++Q+ +
Sbjct: 366 EKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELAKQITS 425

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRK- 459
           + +   G+E Y +K FAE+ E IP  LAEN+G+    ++++L   H +G  N G+++   
Sbjct: 426 YGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYAVHQEGNKNVGLDIEAE 485

Query: 458 -GQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR*IG 324
              + ++LE  ++   L    AI LAT     +L++D I+  +  G
Sbjct: 486 VPAVKDMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAG 531



>gb:BC045040_2548995 Xenopus laevis chaperonin containing TCP1,
           subunit 8 (theta), mRNA (cDNA clone MGC:53230
           IMAGE:5543459), complete cds.
          Length = 546

 Score =  114 bits (286), Expect = 2e-24
 Identities = 64/226 (28%), Positives = 122/226 (53%), Gaps = 2/226 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  +MV++   + ++  + KT+    +  +    AE++GH D V    +GD  ++V    
Sbjct: 307 KYNLMVVRLNSKWDLRRLCKTVCATALPRMTPPTAEEIGHCDSVYLSEVGDT-QVVVFKH 365

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++ G  A++++RGS   ++D+ ER++ DA+   + L   + L+ GGGA EIEL++ + +
Sbjct: 366 EKEDGAIATIVIRGSTDNLMDDVERAVDDAVNTFKVLTRDKRLVPGGGAVEIELAKHITS 425

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAG--INVR 462
           + +   G++ Y +K FAE+ E IP  LA N+G+    ++++L   H +G  N G  I   
Sbjct: 426 YGETCPGLDQYAIKKFAEAFESIPRALAGNSGVKANEVLSKLYAMHQEGNKNVGFDIEAE 485

Query: 461 KGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR*IG 324
              + +++E  ++   LV    I LAT     +L++D I+  +  G
Sbjct: 486 TAAVKDMMESKILDTYLVKYWGIKLATNAAITVLRVDQIIMAKPAG 531



>gb:NCB23G1_1689750 Neurospora crassa DNA linkage group II BAC
           contig B23G1.
          Length = 540

 Score =  114 bits (286), Expect = 2e-24
 Identities = 70/222 (31%), Positives = 126/222 (56%), Gaps = 1/222 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLG-HADLVEEVSLGDGGKIVKIT 819
           K  +  ++ V + +   I +      +  VE  +   +G +  L E   +GD      +T
Sbjct: 306 KANVTALRRVRKTDNNRIARATGATIVNRVEDLQESDVGTNCGLFEVEKIGDE-YFTFLT 364

Query: 818 GIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLG 639
             +D  +  +VL+RG ++ V++E ER+L DA+ V R ++    L  GGGA E+ +S +L 
Sbjct: 365 KCKDP-KACTVLLRGPSKDVLNEIERNLQDAMGVARNVMFHPRLSPGGGATEMAVSVRLT 423

Query: 638 AWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRK 459
             AK ++G++ +  K+ AE+LEVIP TL +NAG +P+ ++T+LR +HA+G+ + GIN   
Sbjct: 424 QLAKSIEGVQQWPYKAVAEALEVIPRTLVQNAGKSPVRVLTDLRAKHAEGKNSWGINGDT 483

Query: 458 GQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           G I ++ +  V +P  +   ++  A E   ++L++DDI + R
Sbjct: 484 GAIVDMKDYGVWEPEAIKVQSMKTAIEAACLLLRVDDICSAR 525



>gb:AF506229_2498563 Danio rerio chaperonin-containing T-complex
           protein 1 eta subunit (cct7) mRNA, complete cds.
          Length = 547

 Score =  114 bits (285), Expect = 3e-24
 Identities = 59/181 (32%), Positives = 109/181 (60%)
 Frame = -1

Query: 884 LGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCL 705
           LG  +L EEV +G  G+           +T ++++RG  +  ++E +RSLHDA+ +VR  
Sbjct: 342 LGQCELFEEVQVG--GERYNFFKGCPKAKTCTIILRGGAEQFMEETDRSLHDAIMIVRRA 399

Query: 704 VSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPIT 525
           +    ++AGGGA E+ELS+ L  +++ + G +   + ++A++LE+IP  L +NAG +   
Sbjct: 400 IKNDSIVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATN 459

Query: 524 IVTELRNRHAQGEINAGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDI 345
           I+ +LR +HAQG +  G++V    I +  +  V +P +V  +A++ A+E   +IL +D+ 
Sbjct: 460 ILNKLRAKHAQGGMWYGVDVNNEDIADNFQACVWEPSIVRINALTAASEAACLILSVDET 519

Query: 344 V 342
           +
Sbjct: 520 I 520



>gb:AC116979_1207127 Dictyostelium discoideum chromosome 2 map
           6445720-6776760 strain AX4, complete sequence.
          Length = 537

 Score =  114 bits (285), Expect = 3e-24
 Identities = 64/220 (29%), Positives = 118/220 (53%), Gaps = 2/220 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHAD--LVEEVSLGDGGKIVKI 822
           + KIM+++   + ++  + K +   P+  +     E+LG+ D  LVEE+      K    
Sbjct: 301 RFKIMLVRIQSKFQLRRVCKAIGATPLVKLGAPIPEELGYCDEVLVEEIG---STKCCIF 357

Query: 821 TGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQL 642
              ++    ++++VRGS   ++D+ ER++ D + V + +      +AG GA EIE SR+L
Sbjct: 358 RQNKEESEISTIVVRGSTNNILDDIERAIDDGVNVFKGMCKDGRFLAGAGAFEIEASRKL 417

Query: 641 GAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVR 462
            A+A    G+  Y ++ +AE+ E+IP TLAE +G +    ++ +   H +G  N G+++ 
Sbjct: 418 QAFADATPGLSQYSIRQYAEAFEIIPRTLAETSGHDSSKAISNIYAAHTKGNTNYGLDIE 477

Query: 461 KGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
            GQ  ++LE +V+        AI LAT     +L++D I+
Sbjct: 478 SGQPKSVLEMDVLDAFASKLFAIKLATNTANTVLRVDQII 517



>gb:HUMRSC548_2036442 Homo sapiens KIAA0002 mRNA, partial cds.
          Length = 555

 Score =  114 bits (284), Expect = 4e-24
 Identities = 64/226 (28%), Positives = 123/226 (54%), Gaps = 2/226 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  IM+++   + ++  + KT+    +  +     E++GH D V    +GD  ++V    
Sbjct: 314 KYNIMLVRLNSKWDLRRLCKTVGATALPRLTPPVLEEMGHCDSVYLSEVGDT-QVVVFKH 372

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++ G  +++++RGS   ++D+ ER + D +   + L   + L+ GGGA EIEL++Q+ +
Sbjct: 373 EKEDGAISTIVLRGSTDNLMDDIERVVDDGVNTFKVLTRDKRLVPGGGATEIELAKQITS 432

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRK- 459
           + +   G+E Y +K FAE+ E IP  LAEN+G+    ++++L   H +G  N G+++   
Sbjct: 433 YGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYAVHQEGNKNVGLDIEAE 492

Query: 458 -GQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR*IG 324
              + ++LE  ++   L    AI LAT     +L++D I+  +  G
Sbjct: 493 VPAVKDMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAG 538



>gb:AE014297_1138542 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003680_1220535 Drosophila melanogaster
           chromosome 3R, section 18 of 118 of the complete
           sequence.>gb:AY122201_1301563 Drosophila melanogaster
           LD47396 full insert cDNA.
          Length = 544

 Score =  114 bits (284), Expect = 4e-24
 Identities = 63/209 (30%), Positives = 117/209 (55%)
 Frame = -1

Query: 968 VERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTAS 789
           V  ++++   K      +      +   LG  +  EE  +G G +     G  +  +T++
Sbjct: 313 VPEEDLKRTMKACGGAVMTTANDIKPNVLGLCEHFEERQVG-GERFNLFQGCPN-AKTST 370

Query: 788 VLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGME 609
           +++RG  +  ++E ERSLHDA+ +VR  +    ++AGGGA E+ELS+ L  +++ + G E
Sbjct: 371 LILRGGAEQFLEETERSLHDAIMIVRRTIKHDSVVAGGGAIEMELSKLLRDYSRTIAGKE 430

Query: 608 GYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQITNILEEN 429
              + + A+ LE+IP  L +NAG +   I+ +LR +HAQG    G+++ K  I++  E+ 
Sbjct: 431 QLLIAAIAKGLEIIPRQLCDNAGFDATNILNKLRQKHAQGGQWYGVDINKEDISDNYEQC 490

Query: 428 VVQPLLVSTSAISLATECVRMILKIDDIV 342
           V +P ++  +A++ A E   MIL +D+ +
Sbjct: 491 VWEPSIIKINALTAAAEAACMILSVDETI 519



>sp|Q9V2T4|THSB_SULAC Thermosome beta subunit (Thermosome subunit 2)
           (Chaperonin beta subunit) (Thermophilic factor 55 beta)
           (TF55-beta) (Fragment).>gb:AF149924_483536 Sulfolobus
           acidocaldarius chaperonin beta subunit gene, partial
           cds.
          Length = 495

 Score =  114 bits (284), Expect = 4e-24
 Identities = 67/198 (33%), Positives = 118/198 (59%), Gaps = 2/198 (1%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  I+ ++  ++ ++E + +      ++N++   ++ LG+A LVEE  +G+  K+V I G
Sbjct: 300 KKGILAVRRAKKSDLEKLARATGGRVVSNIDELTSQDLGYATLVEERKIGED-KMVFIEG 358

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++  +  S+L+RG  + V+DE ER+L DAL  V  +V     IAGGGA E E++++L  
Sbjct: 359 AKNP-KAVSILIRGGLERVVDETERALRDALGTVADVVRDGRAIAGGGAVETEIAKRLRK 417

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINA--GINVR 462
           +A  + G E   ++++A +LE +   L EN G +PI ++ +LR+ H + E N   GINV 
Sbjct: 418 YAPQVGGKEQLAIEAYANALESLVMILIENGGFDPIELLVKLRSAH-ENETNKWHGINVY 476

Query: 461 KGQITNILEENVVQPLLV 408
            GQI ++    V++P +V
Sbjct: 477 TGQIQDMWSLGVIEPAVV 494



>gb:AJ719415_2501602 Gallus gallus mRNA for hypothetical protein,
           clone 2b5.
          Length = 558

 Score =  113 bits (283), Expect = 5e-24
 Identities = 74/229 (32%), Positives = 125/229 (54%), Gaps = 15/229 (6%)
 Frame = -1

Query: 983 MVIKDVERDEIEFITKTLN---CLPIANVE---HFRAEKLGHAD-LVEEVSLGDGGKIVK 825
           M ++ V + +++ I K      C  +AN+E    F A  LG A+ +++E    D   ++K
Sbjct: 309 MAVRRVVKKDLKRIAKASGATICSTLANLEGEESFEALMLGQAEEVIQERICDDELILIK 368

Query: 824 ITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQ 645
            T  +    +AS+++RG+N  + DE ERS+HDALCVV+ ++  + ++ GGGA E  LS  
Sbjct: 369 NTKART---SASIILRGANDFMCDEMERSIHDALCVVKRVLESKSVVPGGGAVEAALSIY 425

Query: 644 LGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEIN----- 480
           L  +A  +   E   +  FA SL +IP TLA NA  +   +V +LR  H + ++N     
Sbjct: 426 LENYATSMGSREQLAIAEFARSLLIIPNTLAVNAAQDATDLVAKLRAFHNEAQVNPDRKN 485

Query: 479 ---AGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
               G+++  G+  +  +  V +P +V T ++  ATE    IL+IDD++
Sbjct: 486 LKWIGLDLVNGKPRDNKQAGVFEPTMVKTKSLKFATEAAITILRIDDLI 534



>gb:AE017351_1759459 Cryptococcus neoformans var. neoformans JEC21
           chromosome 11, complete sequence.
          Length = 567

 Score =  113 bits (283), Expect = 5e-24
 Identities = 69/222 (31%), Positives = 119/222 (53%), Gaps = 1/222 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLG-HADLVEEVSLGDGGKIVKIT 819
           K  I  ++ V + +   I + +    +  VE  R   +G    L     +GD  +     
Sbjct: 323 KANITALRRVRKSDNNRIARAVGATIVNRVEDLRESDVGTQCGLFHIEKMGD--EYFTFL 380

Query: 818 GIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLG 639
                 +  ++L+RG ++ +++E +R+L DA+ V R +V    L  GGGA E+ +S  LG
Sbjct: 381 DQCQNPKACTILLRGPSKDILNEIDRNLADAMSVARNVVFNPTLTPGGGAIEMAISVSLG 440

Query: 638 AWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRK 459
             AK+L G+ G   K+ A++LEVIP TL +N G N I  +TELR +HA+G+   G++   
Sbjct: 441 EKAKLLPGVAGAPYKAIADALEVIPRTLVQNCGGNAIRTLTELRAKHAEGQHLYGVDGET 500

Query: 458 GQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR 333
           G++T++ E  +++   V    +  A E   ++L++DDIV+ R
Sbjct: 501 GKVTDMKEYGLLESASVKIQTLKTAIESATLLLRVDDIVSAR 542



>gb:AE016819_1748902 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 548

 Score =  113 bits (283), Expect = 5e-24
 Identities = 65/185 (35%), Positives = 107/185 (57%)
 Frame = -1

Query: 896 RAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCV 717
           R E LG     EE+ +G   +     G  +  +T ++L+RG  + VI E ERSLHDA+ +
Sbjct: 341 RVEHLGTCATFEEMQIGSE-RYNLFQGCPE-AKTCTLLLRGGAEQVIAEVERSLHDAIMI 398

Query: 716 VRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGL 537
           V+  +  + ++AGGGA E+E+S+ L  ++K + G +   + +FA++LEVIP  L ENAG 
Sbjct: 399 VKRALQNKLVVAGGGAIEMEISKYLRDYSKTIAGKQQLIINAFAKALEVIPRQLCENAGF 458

Query: 536 NPITIVTELRNRHAQGEINAGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILK 357
           + I I+  LR  H++ E   G++     I +   + V +P LV  +A+S A E   +IL 
Sbjct: 459 DAIEILNRLRLAHSKDEKWYGVDFETENIGDNFAKFVWEPALVKINALSSAAEAANLILS 518

Query: 356 IDDIV 342
           +D+ +
Sbjct: 519 VDETI 523



>gb:AB073552_1523189 Bruguiera sexangula bstcp-1 mRNA for t-complex
           polypeptide 1, complete cds.
          Length = 546

 Score =  113 bits (283), Expect = 5e-24
 Identities = 72/228 (31%), Positives = 115/228 (50%), Gaps = 14/228 (6%)
 Frame = -1

Query: 983 MVIKDVERDEIEFITKTLNCLPIANV------EHFRAEKLGHADLVEEVSLGDGGKIVKI 822
           + ++ V ++++  + K      ++        E F +  LG A+ V E  + D   ++ I
Sbjct: 309 IAVRRVRKEDMRHVAKATGATLVSTFADMEGEETFDSSLLGQAEEVVEERIADDD-VIMI 367

Query: 821 TGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQL 642
            G +      S+++RG+N  ++DE ER+LHDALC+V+  +    ++AGGGA E  LS  L
Sbjct: 368 KGTKTTS-AVSLILRGANDYMLDEMERALHDALCIVKRTLESNTVVAGGGAVEAALSVHL 426

Query: 641 GAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINA----- 477
              A  L   E   +  FAESL +IP  LA NA  +   +  +LR  H   +  A     
Sbjct: 427 EYLATTLGSREQLAIAEFAESLLIIPKVLAVNAAKDATELAAKLRAYHHTAQTKADKKHL 486

Query: 476 ---GINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
              G+++ KG I N LE  V++P +     I  ATE    IL+IDD++
Sbjct: 487 SSMGLDLSKGTIRNNLEAGVIEPAMSKIKIIQFATEAAITILRIDDMI 534



>gb:AY507656_1430669 Oryctolagus cuniculus chaperonin-containing
           TCP-1 subunit eta (CCT7) mRNA, partial cds.
          Length = 223

 Score =  113 bits (283), Expect = 5e-24
 Identities = 61/190 (32%), Positives = 110/190 (57%)
 Frame = -1

Query: 911 NVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQDMGRTASVLVRGSNQLVIDEAERSLH 732
           +V     + LG   + EE  +G G +    TG     +T + ++RG  +  ++E ERSLH
Sbjct: 13  SVNALSPDVLGRCQVFEETQIG-GERYNFFTGCPK-AKTCTFILRGGAEQFMEETERSLH 70

Query: 731 DALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAKVLQGMEGYCVKSFAESLEVIPYTLA 552
           DA+ +VR  +    ++AGGGA E+ELS+ L  +++ + G +   + ++A++LE+IP  L 
Sbjct: 71  DAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLC 130

Query: 551 ENAGLNPITIVTELRNRHAQGEINAGINVRKGQITNILEENVVQPLLVSTSAISLATECV 372
           +NAG +   I+ +LR RHAQG +  G+++    I +  E  V +P +V  +A++ A E  
Sbjct: 131 DNAGFDATNILNKLRARHAQGGMWYGVDINNEDIADNFEAFVWEPAMVRINALTAALEAA 190

Query: 371 RMILKIDDIV 342
            +I+ +D+ +
Sbjct: 191 CLIVSVDETI 200



>gb:AY393846_2531631 Gallus gallus chaperonin subunit 8 theta mRNA,
           complete cds.
          Length = 548

 Score =  113 bits (282), Expect = 7e-24
 Identities = 62/226 (27%), Positives = 121/226 (53%), Gaps = 2/226 (0%)
 Frame = -1

Query: 995 KXKIMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITG 816
           K  +M+++   + ++  + KT+    +  +     E++GH + V    +GD  ++V    
Sbjct: 307 KYNLMIVRLNSKWDLRRLCKTVGATALPRLTPPTLEEMGHCNSVYLSEVGDT-QVVVFKH 365

Query: 815 IQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGA 636
            ++ G  +++L+RGS   ++D+ ER++ D +   + L   + L+ GGGA EIEL++Q+ +
Sbjct: 366 EKEDGAISTILIRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELAKQITS 425

Query: 635 WAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAG--INVR 462
           + +   G++ Y +K FAE+ E IP  LAEN+G+    ++++L   H +G  N G  I   
Sbjct: 426 YGETCPGLDQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYAVHQEGNKNVGFDIEAE 485

Query: 461 KGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVTVR*IG 324
              + ++LE  ++   L     I LAT     +L++D I+  +  G
Sbjct: 486 AAAVKDMLEAGILDTYLGKYWGIKLATNAAVTVLRVDQIIMAKPAG 531



>gb:CR382130_1662768 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 561

 Score =  113 bits (282), Expect = 7e-24
 Identities = 64/224 (28%), Positives = 118/224 (52%), Gaps = 3/224 (1%)
 Frame = -1

Query: 986 IMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGHADLVEEVSLGDGGKIVKITGIQD 807
           ++ +K   + ++  + + +   P+A V     E++G  D+VE + +G G ++  +    +
Sbjct: 322 LIALKVPSKFDLRRLCRVVGATPLARVGAPLPEEMGTVDVVETIEIG-GDRVTVLRQEDE 380

Query: 806 MGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQLGAWAK 627
             RTA+V+VRG+ Q  +D+ ER++ D + VV+ +     L+ G GA EI L   +    +
Sbjct: 381 ATRTATVVVRGATQNALDDVERAIDDGVSVVKSISKDPRLVPGAGATEIRLVSTIVQQGE 440

Query: 626 VLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEINAGINVRKGQIT 447
             QG+  + +K++ ++ EV+P TLAENAGL+ I ++  L   H++G    G++V     T
Sbjct: 441 RTQGLMQHAIKAYGQAFEVLPETLAENAGLDAIEVLARLYAAHSEGRNTTGVDVDDNDST 500

Query: 446 NILE---ENVVQPLLVSTSAISLATECVRMILKIDDIVTVR*IG 324
              +    ++        SAI LAT+    IL +D I+  +  G
Sbjct: 501 GTCDASAADIFDSYSAKMSAIELATDVANTILTVDQIIMAKRAG 544



>sp|O00782|TCPG_OXYGR T-complex protein 1, gamma subunit (TCP-1-gamma)
            (CCT-gamma) (Chaperonin subunit CCTV
            gamma).>gb:OGCCTG_1391211 O.granulifera macronuclear CCT
            gamma gene.
          Length = 559

 Score =  113 bits (282), Expect = 7e-24
 Identities = 75/237 (31%), Positives = 128/237 (54%), Gaps = 21/237 (8%)
 Frame = -1

Query: 986  IMVIKDVERDEIEFITKTLNCLPIANVEHFRAEKLGH------ADLVEEVSLGDGGKIVK 825
            ++  K V      F+ K  NC  I  +      ++        A+  EE+   D G    
Sbjct: 291  VITEKGVSDTAQHFLLKYGNCTVIRRIRKTDNNRIARVTGATIANRPEELQESDVGTKCG 350

Query: 824  ITGIQDMG-------------RTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLI 684
            +  I+ +G             +  S+L+RG+++ V++E ER+LHDAL V R ++    L+
Sbjct: 351  LFEIKKIGDEYFSFMTKCENPKACSILLRGASKDVLNEIERNLHDALGVARNVMVNPKLV 410

Query: 683  AGGGAPEIELSRQLGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRN 504
             GGGA E+EL+ +L  +++ ++GM+ +  K+ A +LEVIP TLA+N G + + ++TELR 
Sbjct: 411  PGGGAIEMELACRLMEFSQKIEGMQQWPFKALAGALEVIPRTLAQNCGADVVRVMTELRA 470

Query: 503  RHAQGE--INAGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIVT 339
            +HA  +  +  GI+   G+I ++ E NV  P+ V    +  + E   M+L+IDDIV+
Sbjct: 471  KHANDKEGLYWGIDGNTGKIRDMRESNVWDPISVKQQTLKTSIEATCMLLRIDDIVS 527



>gb:BC044397_2548706 Danio rerio t-complex polypeptide 1, mRNA (cDNA
           clone MGC:55424 IMAGE:2639388), complete cds.
          Length = 558

 Score =  112 bits (281), Expect = 9e-24
 Identities = 75/229 (32%), Positives = 124/229 (54%), Gaps = 15/229 (6%)
 Frame = -1

Query: 983 MVIKDVERDEIEFITKTLN---CLPIANVEH---FRAEKLGHAD-LVEEVSLGDGGKIVK 825
           M ++ V + +++ I K      C  ++N+E    F    LG A+ +V+E    D   ++K
Sbjct: 309 MAVRRVLKKDLKRIAKATGATVCSSLSNLEGEETFEPSMLGQAEEVVQERVCDDELILIK 368

Query: 824 ITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQ 645
            T  +    +AS+++RG+N  + DE ERSLHDALCVV+ ++  + ++ GGGA E  LS  
Sbjct: 369 NTKART---SASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIY 425

Query: 644 LGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEIN----- 480
           L  +A  +   E   +  FA SL VIP TLA NA  +   +V +LR  H + ++N     
Sbjct: 426 LENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPDRKN 485

Query: 479 ---AGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
               G+++  G+  +  +  V +P +V T ++  ATE    IL+IDD++
Sbjct: 486 LKWIGLDLVNGKPRDNKQAGVYEPTMVKTKSLKFATEAAITILRIDDLI 534



>gb:AF164030_2477874 Danio rerio clone T-3-7 t-complex polypeptide 1
           (Tcp1) mRNA, partial cds.
          Length = 463

 Score =  112 bits (281), Expect = 9e-24
 Identities = 75/229 (32%), Positives = 124/229 (54%), Gaps = 15/229 (6%)
 Frame = -1

Query: 983 MVIKDVERDEIEFITKTLN---CLPIANVEH---FRAEKLGHAD-LVEEVSLGDGGKIVK 825
           M ++ V + +++ I K      C  ++N+E    F    LG A+ +V+E    D   ++K
Sbjct: 214 MAVRRVLKKDLKRIAKATGATVCSSLSNLEGEETFEPSMLGQAEEVVQERVCDDELILIK 273

Query: 824 ITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQ 645
            T  +    +AS+++RG+N  + DE ERSLHDALCVV+ ++  + ++ GGGA E  LS  
Sbjct: 274 NTKART---SASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIY 330

Query: 644 LGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEIN----- 480
           L  +A  +   E   +  FA SL VIP TLA NA  +   +V +LR  H + ++N     
Sbjct: 331 LENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPDRKN 390

Query: 479 ---AGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
               G+++  G+  +  +  V +P +V T ++  ATE    IL+IDD++
Sbjct: 391 LKWIGLDLVNGKPRDNKQAGVYEPTMVKTKSLKFATEAAITILRIDDLI 439



>gb:AF164029_2477873 Danio rerio clone T-3-5 t-complex polypeptide 1
           (Tcp1) mRNA, partial cds.
          Length = 463

 Score =  112 bits (281), Expect = 9e-24
 Identities = 75/229 (32%), Positives = 124/229 (54%), Gaps = 15/229 (6%)
 Frame = -1

Query: 983 MVIKDVERDEIEFITKTLN---CLPIANVEH---FRAEKLGHAD-LVEEVSLGDGGKIVK 825
           M ++ V + +++ I K      C  ++N+E    F    LG A+ +V+E    D   ++K
Sbjct: 214 MAVRRVLKKDLKRIAKATGATVCSSLSNLEGEETFEPSMLGQAEEVVQERVCDDELILIK 273

Query: 824 ITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQ 645
            T  +    +AS+++RG+N  + DE ERSLHDALCVV+ ++  + ++ GGGA E  LS  
Sbjct: 274 NTKART---SASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIY 330

Query: 644 LGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEIN----- 480
           L  +A  +   E   +  FA SL VIP TLA NA  +   +V +LR  H + ++N     
Sbjct: 331 LENYATSMGSRERLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPDRKN 390

Query: 479 ---AGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
               G+++  G+  +  +  V +P +V T ++  ATE    IL+IDD++
Sbjct: 391 LKWIGLDLVNGKPRDNKQAGVYEPTMVKTKSLKFATEAAITILRIDDLI 439



>gb:AF164028_2477872 Danio rerio clone TA2 t-complex polypeptide 1
           (Tcp1) mRNA, partial cds.
          Length = 536

 Score =  112 bits (281), Expect = 9e-24
 Identities = 75/229 (32%), Positives = 124/229 (54%), Gaps = 15/229 (6%)
 Frame = -1

Query: 983 MVIKDVERDEIEFITKTLN---CLPIANVEH---FRAEKLGHAD-LVEEVSLGDGGKIVK 825
           M ++ V + +++ I K      C  ++N+E    F    LG A+ +V+E    D   ++K
Sbjct: 287 MAVRRVLKKDLKRIAKATGATVCSSLSNLEGEETFEPSMLGQAEEVVQERVCDDELILIK 346

Query: 824 ITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQ 645
            T  +    +AS+++RG+N  + DE ERSLHDALCVV+ ++  + ++ GGGA E  LS  
Sbjct: 347 NTKART---SASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIY 403

Query: 644 LGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEIN----- 480
           L  +A  +   E   +  FA SL VIP TLA NA  +   +V +LR  H + ++N     
Sbjct: 404 LENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPDRKN 463

Query: 479 ---AGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
               G+++  G+  +  +  V +P +V T ++  ATE    IL+IDD++
Sbjct: 464 LKWIGLDLVNGKPRDNKQAGVYEPTMVKTKSLKFATEAAITILRIDDLI 512



>gb:AF143493_2476999 Danio rerio t-complex polypeptide 1 (TCP1)
           mRNA, complete cds.>gb:BC066538_2554423 Danio rerio
           t-complex polypeptide 1, mRNA (cDNA clone MGC:77497
           IMAGE:6524710), complete cds.
          Length = 556

 Score =  112 bits (281), Expect = 9e-24
 Identities = 75/229 (32%), Positives = 124/229 (54%), Gaps = 15/229 (6%)
 Frame = -1

Query: 983 MVIKDVERDEIEFITKTLN---CLPIANVEH---FRAEKLGHAD-LVEEVSLGDGGKIVK 825
           M ++ V + +++ I K      C  ++N+E    F    LG A+ +V+E    D   ++K
Sbjct: 307 MAVRRVLKKDLKRIAKATGATVCSSLSNLEGEETFEPSMLGQAEEVVQERVCDDELILIK 366

Query: 824 ITGIQDMGRTASVLVRGSNQLVIDEAERSLHDALCVVRCLVSKRFLIAGGGAPEIELSRQ 645
            T  +    +AS+++RG+N  + DE ERSLHDALCVV+ ++  + ++ GGGA E  LS  
Sbjct: 367 NTKART---SASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIY 423

Query: 644 LGAWAKVLQGMEGYCVKSFAESLEVIPYTLAENAGLNPITIVTELRNRHAQGEIN----- 480
           L  +A  +   E   +  FA SL VIP TLA NA  +   +V +LR  H + ++N     
Sbjct: 424 LENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPDRKN 483

Query: 479 ---AGINVRKGQITNILEENVVQPLLVSTSAISLATECVRMILKIDDIV 342
               G+++  G+  +  +  V +P +V T ++  ATE    IL+IDD++
Sbjct: 484 LKWIGLDLVNGKPRDNKQAGVYEPTMVKTKSLKFATEAAITILRIDDLI 532


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,029,384,178
Number of Sequences: 1806583
Number of extensions: 21928539
Number of successful extensions: 56741
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 53452
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 56189
length of database: 581,917,975
effective HSP length: 125
effective length of database: 356,095,100
effective search space used: 73355590600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)