BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10622
         (911 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:BT004254_1637336 Arabidopsis thaliana clone RAFL15-07-P19 (R2...   313   3e-84   
pir|D84618|D84618 probable amino acid acetyltransferase [importe...   313   3e-84   Arabidopsis thaliana [mouse-ear cress]
gb:AC099041_1736975 Oryza sativa chromosome 3 BAC OSJNBa0036E17 ...   300   2e-80   
pir|T04724|T04724 hypothetical protein F19F18.160 - Arabidopsis ...   197   2e-49   Arabidopsis thaliana [mouse-ear cress]
gb:AP003803_1833595 Oryza sativa (japonica cultivar-group) genom...   186   3e-47   
gb:AE017282_428811 Methylococcus capsulatus str. Bath, complete ...   175   1e-42   
gb:AE016857_349781 Pseudomonas syringae pv. tomato str. DC3000 s...   173   4e-42   
sp|P61919|ARGA_PSESY|ARGA_PSESY Amino-acid acetyltransferase (EC 2.3.1.1) (...   173   4e-42   Pseudomonas syringae pv. syringae
sp|Q88AR2|ARGA_PSESM|ARGA_PSESM Amino-acid acetyltransferase (EC 2.3.1.1) (...   173   4e-42   Pseudomonas syringae pv. tomato
gb:BX571965_792116 Burkholderia pseudomallei strain K96243, chro...   173   5e-42   
sp|P22567|ARGA_PSEAE|ARGA_PSEAE Amino-acid acetyltransferase (EC 2.3.1.1) (...   171   1e-41   Pseudomonas aeruginosa
sp|P32042|ARGA_PSEPK|ARGA_PSEPK Amino-acid acetyltransferase (EC 2.3.1.1) (...   169   7e-41   Pseudomonas putida
sp|Q8XZZ5|ARGA_RALSO|ARGA_RALSO Amino-acid acetyltransferase (EC 2.3.1.1) (...   167   2e-40   Ralstonia solanacearum
sp|Q7N8S4|ARGA_PHOLL|ARGA_PHOLL Amino-acid acetyltransferase (EC 2.3.1.1) (...   166   4e-40   Photorhabdus laumondii subsp. laumondii
gb:AE016827_342383 Mannheimia succiniciproducens MBEL55E, comple...   166   6e-40   
sp|Q8ZMB8|ARGA_SALTY|ARGA_SALTY Amino-acid acetyltransferase (EC 2.3.1.1) (...   164   2e-39   Salmonella enterica subsp. enterica serovar Typhimurium
sp|Q8Z421|ARGA_SALTI|ARGA_SALTI Amino-acid acetyltransferase (EC 2.3.1.1) (...   164   2e-39   Salmonella enterica subsp. enterica serovar Typhi
gb:AF008117_467904 Escherichia coli K12 feedback resistant mutan...   163   4e-39   
gb:AF008116_467903 Escherichia coli K12 feedback resistant mutan...   163   4e-39   
gb:AF008115_467902 Escherichia coli K12 feedback resistant mutan...   163   4e-39   
gb:AE016765_327399 Escherichia coli CFT073 section 11 of 18 of t...   163   4e-39   
sp|P59293|ARGA_SHIFL|ARGA_SHIFL Amino-acid acetyltransferase (EC 2.3.1.1) (...   163   4e-39   Shigella flexneri
sp|Q9CMJ6|ARGA_PASMU|ARGA_PASMU Amino-acid acetyltransferase (EC 2.3.1.1) (...   163   4e-39   Pasteurella multocida
sp|P08205|ARGA_ECOLI|ARGA_ECOLI Amino-acid acetyltransferase (EC 2.3.1.1) (...   163   4e-39   Escherichia coli [E. coli]
gb:AF008119_467906 Escherichia coli K12 feedback resistant mutan...   163   5e-39   
sp|Q8ZH86|ARGA_YERPE|ARGA_YERPE Amino-acid acetyltransferase (EC 2.3.1.1) (...   163   5e-39   Yersinia pestis
gb:AF008118_467905 Escherichia coli K12 feedback resistant mutan...   161   2e-38   
gb:AE017137_388589 Yersinia pestis biovar Medievalis str. 91001 ...   158   2e-37   
gb:BX950851_839747 Erwinia carotovora subsp. atroseptica SCRI104...   156   5e-37   
sp|P59294|ARGA_VIBVU|ARGA_VIBVU Amino-acid acetyltransferase (EC 2.3.1.1) (...   156   5e-37   Vibrio vulnificus
sp|Q7VLN8|ARGA_HAEDU|ARGA_HAEDU Amino-acid acetyltransferase (EC 2.3.1.1) (...   155   8e-37   [Haemophilus] ducreyi
gb:CR543861_102117 Acinetobacter sp. ADP1 complete genome.            155   1e-36   
gb:BX321858_773106 Nitrosomonas europaea ATCC 19718, complete ge...   154   3e-36   
sp|P59099|ARGA_BUCAP|ARGA_BUCAP Amino-acid acetyltransferase (EC 2.3.1.1) (...   154   3e-36   
sp|O66143|ARGA_BUCAI|ARGA_BUCAI Amino-acid acetyltransferase (EC 2.3.1.1) (...   153   4e-36   
gb:AY086660_1571704 Arabidopsis thaliana clone 266616 mRNA, comp...   152   9e-36   
gb:CR555306_105980 Azoarcus sp. EbN1 complete genome.                 152   9e-36   
gb:CR378672_96307 Photobacterium profundum SS9; segment 10/12.        149   7e-35   
gb:AE004969_59825 Neisseria gonorrhoeae FA 1090, complete genome.     149   1e-34   
sp|Q87M87|ARGA_VIBPA|ARGA_VIBPA Amino-acid acetyltransferase (EC 2.3.1.1) (...   149   1e-34   
sp|Q9JXU9|ARGA_NEIMB|ARGA_NEIMB Amino-acid acetyltransferase (EC 2.3.1.1) (...   148   1e-34   Neisseria meningitidis serogroup B
sp|Q9JW21|ARGA_NEIMA|ARGA_NEIMA Amino-acid acetyltransferase (EC 2.3.1.1) (...   148   1e-34   
sp|P59292|ARGA_SHEON|ARGA_SHEON Amino-acid acetyltransferase (EC 2.3.1.1) (...   147   2e-34   Shewanella oneidensis
gb:BX640428_809957 Bordetella parapertussis strain 12822, comple...   146   5e-34   
gb:BX640418_806736 Bordetella pertussis strain Tohama I, complet...   146   5e-34   
gb:CP000020_870761 Vibrio fischeri ES114 chromosome I, complete ...   146   6e-34   
pir|E82093|E82093 N-acetylglutamate synthase VC2316 [imported] -...   144   2e-33   Vibrio cholerae
sp|Q9KPQ0|ARGA_VIBCH|ARGA_VIBCH Amino-acid acetyltransferase (EC 2.3.1.1) (...   144   2e-33   
gb:AE016922_358316 Chromobacterium violaceum ATCC 12472 section ...   136   6e-31   
sp|Q9K3D6|ARHA_MORAB|ARHA_MORAB Bifunctional protein argHA [Includes: Argin...    77   5e-13   Moritella abyssi
sp|P59620|ARLY_VIBPA|ARLY_VIBPA Bifunctional protein argH [Includes: Argini...    74   3e-12   
gb:AE017340_456379 Idiomarina loihiensis L2TR, complete genome.        71   3e-11   
gb:BA000030_702581 Streptomyces avermitilis MA-4680 genomic DNA,...    69   1e-10   
gb:CP000020_872479 Vibrio fischeri ES114 chromosome I, complete ...    69   2e-10   
gb:CR378663_93685 Photobacterium profundum SS9; segment 1/12.          68   3e-10   
gb:AP006618_560256 Nocardia farcinica IFM 10152 DNA, complete ge...    67   5e-10   
sp|Q8DCM9|ARLY_VIBVU|ARLY_VIBVU Bifunctional protein argH [Includes: Argini...    67   5e-10   Vibrio vulnificus
gb:AE013330_291365 Methanosarcina mazei strain Goe1, section 112...    64   4e-09   
gb:AE000516_22910 Mycobacterium tuberculosis CDC1551, complete g...    64   5e-09   
pir|T36387|T36387 probable acetyltransferase - Streptomyces coel...    64   5e-09   Streptomyces coelicolor
pir|B70879|B70879 hypothetical protein Rv2747 - Mycobacterium tu...    64   5e-09   Mycobacterium tuberculosis
sp|P59599|YM12_CHLTE|YM12_CHLTE Hypothetical protein CT2212.>gb:AE012967_28...    62   2e-08   Chlorobaculum tepidum
gb:AE016822_341055 Leifsonia xyli subsp. xyli str. CTCB07, compl...    61   3e-08   
gb:CR522870_101596 Desulfotalea psychrophila LSv54 chromosome.         60   4e-08   
pir|D87031|D87031 probable acetyltransferase [imported] - Mycoba...    60   4e-08   Mycobacterium leprae
gb:AE017237_413563 Mycobacterium avium subsp. paratuberculosis s...    60   8e-08   
gb:AE011152_269618 Methanosarcina acetivorans str. C2A, section ...    60   8e-08   
gb:AL646076_548509 Ralstonia solanacearum GMI1000 megaplasmid, c...    58   2e-07   
gb:AE016915_356564 Chromobacterium violaceum ATCC 12472 section ...    58   3e-07   
gb:AP006840_570078 Symbiobacterium thermophilum DNA, complete ge...    54   4e-06   
pir|S27600|S27600 N-acetylglutamate synthase - Pseudomonas aerug...    53   7e-06   Pseudomonas aeruginosa
gb:BA000043_739861 Geobacillus kaustophilus HTA426 DNA, complete...    52   1e-05   
gb:BX571662_779319 Wolinella succinogenes, complete genome; segm...    52   2e-05   
gb:CP000027_79462 Dehalococcoides ethenogenes 195, complete genome.    50   5e-05   
gb:AE010682_265628 Methanosarcina acetivorans str. C2A, section ...    50   6e-05   
gb:AE016932_360841 Bacteroides thetaiotaomicron VPI-5482, sectio...    44   0.003   
gb:CP000032_88020 Silicibacter pomeroyi DSS-3 plasmid megaplasmi...    44   0.003   
gb:AE017333_447791 Bacillus licheniformis DSM 13, complete genom...    42   0.013   
gb:AE015533_315292 Shewanella oneidensis MR-1 section 82 of 457 ...    42   0.013   
sp|P26945|IAAT_AZOBR|IAAT_AZOBR IAA acetyltransferase (EC 2.3.1.-).>pir|S17...    42   0.013   Azospirillum brasilense
gb:AE016811_338731 Vibrio vulnificus CMCP6 chromosome II section...    42   0.016   
pir|AF2171|AF2171 hypothetical protein alr2925 [imported] - Nost...    42   0.022   Nostoc sp. PCC 7120
gb:AE017330_444737 Listeria monocytogenes str. 4b F2365, section...    41   0.028   
pir|AF1368|AF1368 B. subtilis YtmI protein homolog lmo2350 [impo...    41   0.028   Listeria monocytogenes
gb:AF197953_1249990 Toxoplasma gondii histone acetyltransferase ...    40   0.048   
gb:AF155929_1245862 Toxoplasma gondii histone acetyltransferase ...    40   0.048   
pir|AG1737|AG1737 B. subtilis YtmI protein homolog lin2444 [impo...    40   0.048   Listeria innocua
gb:AY657259_2146269 Synthetic construct Peudomonas aeruginosa cl...    40   0.063   
gb:AE013386_291849 Methanosarcina mazei strain Goe1, section 168...    40   0.063   
gb:CR628337_114423 Legionella pneumophila str. Lens complete gen...    40   0.063   
pir|C83037|C83037 hypothetical protein PA4863 [imported] - Pseud...    40   0.063   Pseudomonas aeruginosa
pir|C69996|C69996 hypothetical protein ytmI - Bacillus subtilis>...    40   0.063   Bacillus subtilis
gb:BA000045_741715 Gloeobacter violaceus PCC 7421 DNA, complete ...    40   0.082   
gb:BX569689_774982 Synechococcus sp. WH8102 complete genome; seg...    39   0.11    
gb:SCO939107_174766 Streptomyces coelicolor A3(2) complete genom...    39   0.11    
gb:AP006840_570069 Symbiobacterium thermophilum DNA, complete ge...    39   0.14    
gb:AE017354_459582 Legionella pneumophila subsp. pneumophila str...    39   0.14    
gb:AE017166_396257 Prochlorococcus marinus subsp. marinus str. C...    39   0.14    
gb:CR628336_111329 Legionella pneumophila str. Paris complete ge...    39   0.14    
gb:AP006840_569162 Symbiobacterium thermophilum DNA, complete ge...    39   0.18    
gb:AE010151_259834 Pyrococcus furiosus DSM 3638, section 26 of 1...    39   0.18    
gb:CP000025_878052 Campylobacter jejuni RM1221, complete genome.       38   0.24    
gb:CP000001_852070 Bacillus cereus ZK, complete genome.                38   0.24    
gb:BA000043_737440 Geobacillus kaustophilus HTA426 DNA, complete...    38   0.24    
gb:BA000012_670286 Mesorhizobium loti MAFF303099 DNA, complete g...    38   0.24    
gb:BA000012_666506 Mesorhizobium loti MAFF303099 DNA, complete g...    38   0.24    
gb:AF093219_478641 Campylobacter jejuni N-acetyl-glutamyl-phosph...    38   0.24    
gb:AE017029_381774 Bacillus anthracis str. Ames section 6 of 18 ...    38   0.24    
gb:AE013045_288464 Thermoanaerobacter tengcongensis MB4, section...    38   0.24    
gb:SME591787_185450 Sinorhizobium meliloti 1021 complete chromos...    38   0.24    
pir|E97249|E97249 probable acetyltransferase [imported] - Clostr...    38   0.24    Clostridium acetobutylicum
sp|Q9PIR8|ARGB_CAMJE|ARGB_CAMJE Acetylglutamate kinase (EC 2.7.2.8) (NAG ki...    38   0.24    
gb:BA000038_725616 Vibrio vulnificus YJ016 DNA, chromosome II, c...    38   0.31    
gb:BA000016_674409 Clostridium perfringens str. 13 DNA, complete...    38   0.31    
gb:AY509864_623820 Corynebacterium crenatum N-acetylglutamate-5-...    38   0.31    
sp|Q8PXJ8|ARGB_METMA|ARGB_METMA Acetylglutamate kinase (EC 2.7.2.8) (NAG ki...    38   0.31    Methanosarcina mazei
sp|Q59281|ARGB_CORGL|ARGB_CORGL Acetylglutamate kinase (EC 2.7.2.8) (NAG ki...    38   0.31    Corynebacterium glutamicum
gb:BA000045_742758 Gloeobacter violaceus PCC 7421 DNA, complete ...    37   0.41    
gb:AE017297_434878 Leptospira interrogans serovar Copenhageni st...    37   0.41    
gb:AE013024_288238 Thermoanaerobacter tengcongensis MB4, section...    37   0.41    
sp|Q60382|ARGB_METJA|ARGB_METJA Probable acetylglutamate kinase (EC 2.7.2.8...    37   0.41    Methanocaldococcus jannaschii
sp|P59297|ARGB_CHLTE|ARGB_CHLTE Acetylglutamate kinase (EC 2.7.2.8) (NAG ki...    37   0.41    Chlorobaculum tepidum
gb:AY875982_1354720 Toxoplasma gondii GNAT family histone acetyl...    37   0.53    
gb:BA000035_716311 Corynebacterium efficiens YS-314 DNA, complet...    37   0.53    
gb:AP006878_576206 Thermococcus kodakaraensis strain KOD1 DNA, c...    37   0.53    
pir|F87496|F87496 acetyltransferase, GNAT family [imported] - Ca...    37   0.53    Caulobacter vibrioides
sp|Q7M7Q9|ARGB_WOLSU|ARGB_WOLSU Acetylglutamate kinase (EC 2.7.2.8) (NAG ki...    37   0.53    Wolinella succinogenes
sp|Q9X2A4|ARGB_THEMA|ARGB_THEMA Acetylglutamate kinase (EC 2.7.2.8) (NAG ki...    37   0.53    Thermotoga maritima
sp|Q8FTN3|ARGB_COREF|ARGB_COREF Acetylglutamate kinase (EC 2.7.2.8) (NAG ki...    37   0.53    Corynebacterium efficiens
gb:AE016959_1022577 Oryza sativa (japonica cultivar-group) chrom...    37   0.69    
gb:BA000023_692588 Sulfolobus tokodaii str. 7 DNA, complete genome.    37   0.69    
gb:AP006618_558333 Nocardia farcinica IFM 10152 DNA, complete ge...    37   0.69    
gb:AE016947_364371 Enterococcus faecalis V583, section 1 of 11 o...    37   0.69    
pir|T02518|T02518 hypothetical protein At2g37520 [imported] - Ar...    37   0.69    Arabidopsis thaliana [mouse-ear cress]
pir|F82277|F82277 citrate (pro-3S)-lyase ligase VC0796 [imported...    37   0.69    Vibrio cholerae
sp|Q8R7C0|ARGB_THETN|ARGB_THETN Acetylglutamate kinase (EC 2.7.2.8) (NAG ki...    37   0.69    
sp|Q8THJ9|ARGB_METAC|ARGB_METAC Acetylglutamate kinase (EC 2.7.2.8) (NAG ki...    37   0.69    Methanosarcina acetivorans
gb:AY459293_1328230 Plasmodium falciparum histone acetyltransfer...    36   0.91    
gb:AP006878_575483 Thermococcus kodakaraensis strain KOD1 DNA, c...    36   0.91    
gb:AE016920_357912 Chromobacterium violaceum ATCC 12472 section ...    36   0.91    
gb:AE016785_332379 Pseudomonas putida KT2440 section 12 of 21 of...    36   0.91    
gb:AE014961_313608 Streptococcus mutans UA159 section 109 of 185...    36   0.91    
gb:CR555306_107859 Azoarcus sp. EbN1 complete genome.                  36   0.91    
gb:BX842649_824367 Bdellovibrio bacteriovorus complete genome, s...    36   1.2     
gb:BA000040_735663 Bradyrhizobium japonicum USDA 110 DNA, comple...    36   1.2     
gb:BA000030_699794 Streptomyces avermitilis MA-4680 genomic DNA,...    36   1.2     
gb:AY780525_645953 Bacillus sp. MB24 transposon TnARS1, complete...    36   1.2     
gb:AE013361_291623 Methanosarcina mazei strain Goe1, section 143...    36   1.2     
pir|AE1339|AE1339 hypothetical protein lmo2117 [imported] - List...    36   1.2     Listeria monocytogenes
sp|Q7UQZ8|ARGB_RHOBA|ARGB_RHOBA Acetylglutamate kinase (EC 2.7.2.8) (NAG ki...    36   1.2     Rhodopirellula baltica
sp|O28988|ARGB_ARCFU|ARGB_ARCFU Probable acetylglutamate kinase (EC 2.7.2.8...    36   1.2     Archaeoglobus fulgidus
gb:AY658957_2147967 Synthetic construct Peudomonas aeruginosa cl...    35   1.5     
gb:ZMA428540_1731528 Zea mays mRNA for GCN5 protein.>gb:ZMA42854...    35   1.5     
gb:OSJN00099_1694895 Oryza sativa genomic DNA, chromosome 4, BAC...    35   1.5     
gb:BX950851_839624 Erwinia carotovora subsp. atroseptica SCRI104...    35   1.5     
gb:BA000030_704448 Streptomyces avermitilis MA-4680 genomic DNA,...    35   1.5     
gb:BA000028_694721 Oceanobacillus iheyensis HTE831 DNA, complete...    35   1.5     
gb:ZMPDHBGEN_212037 Zymomonas mobilis pdhB & lpd genes & ORF's 4...    35   1.5     
pir|C83402|C83402 hypothetical protein PA1943 [imported] - Pseud...    35   1.5     Pseudomonas aeruginosa
pir|T45908|T45908 hypothetical protein F4P12.380 - Arabidopsis t...    35   1.5     Arabidopsis thaliana [mouse-ear cress]
gb:AF187100_2058293 Rattus norvegicus putative N-acetyltransfera...    35   2.0     
gb:AE016809_338145 Vibrio vulnificus CMCP6 chromosome II section...    35   2.0     
gb:AE010349_262181 Methanopyrus kandleri AV19 section 48 of 157 ...    35   2.0     
gb:CR522870_99284 Desulfotalea psychrophila LSv54 chromosome.          35   2.0     
pir|D72219|D72219 conserved hypothetical protein - Thermotoga ma...    35   2.0     Thermotoga maritima
sp|O05501|YDHI_BACSU|YDHI_BACSU Hypothetical protein ydhI.>pir|E69784|E6978...    35   2.0     Bacillus subtilis
gb:BX957219_843316 Methanococcus maripaludis S2 complete genome;...    35   2.6     
gb:BX950851_838792 Erwinia carotovora subsp. atroseptica SCRI104...    35   2.6     
gb:AY596297_631574 Haloarcula marismortui ATCC 43049 chromosome ...    35   2.6     
gb:AP006878_575384 Thermococcus kodakaraensis strain KOD1 DNA, c...    35   2.6     
gb:AF009672_468232 Acinetobacter sp. ADP1 VanR (vanR), vanillate...    35   2.6     
gb:AE017282_429474 Methylococcus capsulatus str. Bath, complete ...    35   2.6     
gb:AE010642_265281 Fusobacterium nucleatum subsp. nucleatum ATCC...    35   2.6     
gb:CR543861_102962 Acinetobacter sp. ADP1 complete genome.             35   2.6     
pir|A71455|A71455 probable acetyltransferase - Pyrococcus horiko...    35   2.6     Pyrococcus horikoshii
pir|F75490|F75490 probable acetyltransferase - Deinococcus radio...    35   2.6     Deinococcus radiodurans
pir|F84206|F84206 hypothetical protein Vng0482h [imported] - Hal...    35   2.6     Halobacterium salinarum
pir|D95389|D95389 protein [imported] - Sinorhizobium meliloti (s...    35   2.6     Sinorhizobium meliloti
pir|H75432|H75432 hypothetical protein - Deinococcus radiodurans...    35   2.6     Deinococcus radiodurans
sp|Q9LCS6|ARGB_STRCL|ARGB_STRCL Acetylglutamate kinase (EC 2.7.2.8) (NAG ki...    35   2.6     Streptomyces clavuligerus
sp|Q7NR63|ARGB_CHRVO|ARGB_CHRVO Acetylglutamate kinase (EC 2.7.2.8) (NAG ki...    35   2.6     Chromobacterium violaceum
gb:CR382127_1659951 Yarrowia lipolytica chromosome A of strain C...    34   3.4     
gb:BX640435_812282 Bordetella parapertussis strain 12822, comple...    34   3.4     
gb:BA000031_706669 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    34   3.4     
gb:AJ749949_530634 Francisella tularensis subsp. tularensis comp...    34   3.4     
gb:AE017004_376999 Bacillus cereus ATCC 14579 section 7 of 18 of...    34   3.4     
gb:AE008692_240246 Zymomonas mobilis subsp. mobilis ZM4, complet...    34   3.4     
pir|T41544|T41544 hypothetical protein SPCC663.13c - fission yea...    34   3.4     Schizosaccharomyces pombe
pir|C83718|C83718 ribosomal-protein (S18)-alanine acetyltransfer...    34   3.4     Bacillus halodurans
pir|A82980|A82980 acetylglutamate kinase PA5323 [imported] - Pse...    34   3.4     Pseudomonas aeruginosa
sp|Q9HTN2|ARGB_PSEAE|ARGB_PSEAE Acetylglutamate kinase (EC 2.7.2.8) (NAG ki...    34   3.4     Pseudomonas aeruginosa
sp|Q7VSM2|ARGB_BORPE|ARGB_BORPE Acetylglutamate kinase (EC 2.7.2.8) (NAG ki...    34   3.4     Bordetella pertussis
sp|Q7W3I6|ARGB_BORPA|ARGB_BORPA Acetylglutamate kinase (EC 2.7.2.8) (NAG ki...    34   3.4     Bordetella parapertussis
sp|Q7WEW1|ARGB_BORBR|ARGB_BORBR Acetylglutamate kinase (EC 2.7.2.8) (NAG ki...    34   3.4     Bordetella bronchiseptica
gb:BX640445_815535 Bordetella bronchiseptica strain RB50, comple...    34   4.5     
gb:BX640414_805723 Bordetella pertussis strain Tohama I, complet...    34   4.5     
gb:BX571657_777461 Wolinella succinogenes, complete genome; segm...    34   4.5     
gb:BA000031_706668 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    34   4.5     
gb:BA000030_699379 Streptomyces avermitilis MA-4680 genomic DNA,...    34   4.5     
gb:AP006840_569703 Symbiobacterium thermophilum DNA, complete ge...    34   4.5     
gb:AE017283_431133 Propionibacterium acnes KPA171202, complete g...    34   4.5     
gb:AE016822_339791 Leifsonia xyli subsp. xyli str. CTCB07, compl...    34   4.5     
gb:AE011110_269263 Methanosarcina acetivorans str. C2A, section ...    34   4.5     
pir|D87228|D87228 aminoglycoside 2'-N-acetyltransferase [importe...    34   4.5     Mycobacterium leprae
pir|T00896|T00896 acetyltransferase homolog F21B7.10 - Arabidops...    34   4.5     Arabidopsis thaliana [mouse-ear cress]
pir|D75017|D75017 n-terminal acetyltransferase PAB1098 - Pyrococ...    34   4.5     Pyrococcus abyssi
sp|Q9L1A3|ARGB_STRCO|ARGB_STRCO Acetylglutamate kinase (EC 2.7.2.8) (NAG ki...    34   4.5     
sp|Q828A4|ARGB_STRAW|ARGB_STRAW Acetylglutamate kinase (EC 2.7.2.8) (NAG ki...    34   4.5     Streptomyces avermitilis
sp|Q7VJR4|ARGB_HELHP|ARGB_HELHP Acetylglutamate kinase (EC 2.7.2.8) (NAG ki...    34   4.5     Helicobacter hepaticus
gb:AE016814_1745728 Ashbya gossypii (= Eremothecium gossypii) AT...    33   5.9     
gb:BX640432_811164 Bordetella parapertussis strain 12822, comple...    33   5.9     
gb:BX571659_778334 Wolinella succinogenes, complete genome; segm...    33   5.9     
gb:BA000040_729348 Bradyrhizobium japonicum USDA 110 DNA, comple...    33   5.9     
gb:BA000038_725047 Vibrio vulnificus YJ016 DNA, chromosome II, c...    33   5.9     
gb:BA000037_723454 Vibrio vulnificus YJ016 DNA, chromosome I, co...    33   5.9     
gb:BA000030_698590 Streptomyces avermitilis MA-4680 genomic DNA,...    33   5.9     
gb:AL935253_550665 Lactobacillus plantarum strain WCFS1 complete...    33   5.9     
gb:AE017355_462763 Bacillus thuringiensis serovar konkukian str....    33   5.9     
gb:AE017333_448143 Bacillus licheniformis DSM 13, complete genom...    33   5.9     
gb:AE016802_336445 Vibrio vulnificus CMCP6 chromosome I section ...    33   5.9     
gb:AE014295_311445 Bifidobacterium longum NCC2705, complete genome.    33   5.9     
gb:AE010690_265709 Methanosarcina acetivorans str. C2A, section ...    33   5.9     
pir|AF1821|AF1821 hypothetical protein all0118 [imported] - Nost...    33   5.9     Nostoc sp. PCC 7120
sp|P59300|ARGB_PSEPK|ARGB_PSEPK Acetylglutamate kinase (EC 2.7.2.8) (NAG ki...    33   5.9     Pseudomonas putida
sp|P59295|ARGB_BIFLO|ARGB_BIFLO Acetylglutamate kinase (EC 2.7.2.8) (NAG ki...    33   5.9     Bifidobacterium longum
gb:AY657275_2146285 Synthetic construct Peudomonas aeruginosa cl...    33   7.7     
gb:AX878780_1477558 Sequence 13685 from Patent EP1074617.>gb:AK0...    33   7.7     
gb:BA000016_675206 Clostridium perfringens str. 13 DNA, complete...    33   7.7     
gb:AY596297_632417 Haloarcula marismortui ATCC 43049 chromosome ...    33   7.7     
gb:AP008231_582177 Synechococcus elongatus PCC 6301 DNA, complet...    33   7.7     
gb:AP006841_574340 Bacteroides fragilis YCH46 DNA, complete genome.    33   7.7     
gb:AF521015_518779 Rhizobium vitis strain F2/5 partial genomic s...    33   7.7     
gb:AE017272_423852 Bacillus cereus ATCC 10987, section 9 of 18 o...    33   7.7     
gb:AE016917_357151 Chromobacterium violaceum ATCC 12472 section ...    33   7.7     
gb:AE013429_292258 Methanosarcina mazei strain Goe1, section 211...    33   7.7     
gb:CR543861_102896 Acinetobacter sp. ADP1 complete genome.             33   7.7     
pir|B83079|B83079 hypothetical protein PA4534 [imported] - Pseud...    33   7.7     Pseudomonas aeruginosa
pir|D84223|D84223 hypothetical protein Vng0654c [imported] - Hal...    33   7.7     Halobacterium salinarum
pir|C84294|C84294 hypothetical protein Vng1398c [imported] - Hal...    33   7.7     Halobacterium salinarum
pir|D70477|D70477 acetylglutamate kinase - Aquifex aeolicus>gb:A...    33   7.7     Aquifex aeolicus
sp|P43577|GNA1_YEAST|GNA1_YEAST Glucosamine 6-phosphate N-acetyltransferase...    33   7.7     Saccharomyces cerevisiae [brewer's yeast]
sp|Q7VD84|ARGB_PROMA|ARGB_PROMA Acetylglutamate kinase (EC 2.7.2.8) (NAG ki...    33   7.7     Prochlorococcus marinus
sp|Q9JUK2|ARGB_NEIMA|ARGB_NEIMA Acetylglutamate kinase (EC 2.7.2.8) (NAG ki...    33   7.7     
sp|O67848|ARGB_AQUAE|ARGB_AQUAE Acetylglutamate kinase (EC 2.7.2.8) (NAG ki...    33   7.7     Aquifex aeolicus
sp|Q8YXG8|ARGB_ANASP|ARGB_ANASP Acetylglutamate kinase (EC 2.7.2.8) (NAG ki...    33   7.7     Anabaena sp.


>gb:BT004254_1637336 Arabidopsis thaliana clone RAFL15-07-P19
           (R20510) putative amino acid acetyltransferase
           (At2g22910) mRNA, complete cds.>gb:BT006149_1639043
           Arabidopsis thaliana clone U20510 putative amino acid
           acetyltransferase (At2g22910) mRNA, complete cds.
          Length = 609

 Score =  313 bits (802), Expect = 3e-84
 Identities = 152/200 (76%), Positives = 176/200 (88%)
 Frame = -2

Query: 910 ELAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGI 731
           ELAAAAFVCRGGV+RVHLLDGTI GVL  ELF+RDG+GTMVASD+YEG R A+  D+ GI
Sbjct: 400 ELAAAAFVCRGGVKRVHLLDGTISGVLLLELFKRDGMGTMVASDVYEGNREAKVEDLAGI 459

Query: 730 KQILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVS 551
           +QI++PLEE G L+RRT+ ELL ALDSF+VVEREG IIACAALFP+ +EKCGEVA+IAV+
Sbjct: 460 RQIIKPLEESGALVRRTDEELLRALDSFVVVEREGHIIACAALFPFFEEKCGEVAAIAVA 519

Query: 550 PDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKI 371
            DCRGQGQGDKLLDYIEKKAS+ G++ LFLLTTRTADWF+RRGF EC I+ +P  RR++I
Sbjct: 520 SDCRGQGQGDKLLDYIEKKASALGLEMLFLLTTRTADWFVRRGFQECPIEMIPEARRERI 579

Query: 370 NLSRGSKYYMKKLQPDRSGI 311
           NLSR SKYYMKKL PDRSGI
Sbjct: 580 NLSRRSKYYMKKLLPDRSGI 599



>pir|D84618|D84618 probable amino acid acetyltransferase [imported] -
            Arabidopsis thaliana>gb:AC004786_1532162 Arabidopsis
            thaliana chromosome 2 clone T20K9 map CIC06C07, complete
            sequence.
          Length = 620

 Score =  313 bits (802), Expect = 3e-84
 Identities = 152/200 (76%), Positives = 176/200 (88%)
 Frame = -2

Query: 910  ELAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGI 731
            ELAAAAFVCRGGV+RVHLLDGTI GVL  ELF+RDG+GTMVASD+YEG R A+  D+ GI
Sbjct: 411  ELAAAAFVCRGGVKRVHLLDGTISGVLLLELFKRDGMGTMVASDVYEGNREAKVEDLAGI 470

Query: 730  KQILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVS 551
            +QI++PLEE G L+RRT+ ELL ALDSF+VVEREG IIACAALFP+ +EKCGEVA+IAV+
Sbjct: 471  RQIIKPLEESGALVRRTDEELLRALDSFVVVEREGHIIACAALFPFFEEKCGEVAAIAVA 530

Query: 550  PDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKI 371
             DCRGQGQGDKLLDYIEKKAS+ G++ LFLLTTRTADWF+RRGF EC I+ +P  RR++I
Sbjct: 531  SDCRGQGQGDKLLDYIEKKASALGLEMLFLLTTRTADWFVRRGFQECPIEMIPEARRERI 590

Query: 370  NLSRGSKYYMKKLQPDRSGI 311
            NLSR SKYYMKKL PDRSGI
Sbjct: 591  NLSRRSKYYMKKLLPDRSGI 610



>gb:AC099041_1736975 Oryza sativa chromosome 3 BAC OSJNBa0036E17
           genomic sequence, complete sequence.
          Length = 576

 Score =  300 bits (769), Expect = 2e-80
 Identities = 143/199 (71%), Positives = 174/199 (87%)
 Frame = -2

Query: 910 ELAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGI 731
           ELAAAA+VC GGVQRVH++DGT+GG L  ELF RDGVGTM+A D+YEGTRMAR  D+ GI
Sbjct: 368 ELAAAAYVCNGGVQRVHIIDGTVGGSLLLELFTRDGVGTMIARDMYEGTRMAREEDLSGI 427

Query: 730 KQILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVS 551
           ++I++PLEE G L+RRT+ ELLEAL SFIVVER+G IIACAALFP+L++K GEVA+IAVS
Sbjct: 428 RKIIRPLEESGVLVRRTDKELLEALKSFIVVERDGSIIACAALFPFLEDKSGEVAAIAVS 487

Query: 550 PDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKI 371
            +CRGQGQGDKLLDY+EKKA S G++K+FLLTTRTADWF+RRGF ECSI+ LP +RRK+I
Sbjct: 488 EECRGQGQGDKLLDYVEKKALSLGLEKIFLLTTRTADWFVRRGFKECSIESLPAQRRKRI 547

Query: 370 NLSRGSKYYMKKLQPDRSG 314
           +LSRGSKYY+K+L+    G
Sbjct: 548 DLSRGSKYYIKRLRAAEIG 566



>pir|T04724|T04724 hypothetical protein F19F18.160 - Arabidopsis
           thaliana>gb:ATCHRIV87_1547721 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           87.>gb:ATF19F18_1549307 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F19F18 (ESSA project).
          Length = 571

 Score =  197 bits (502), Expect = 2e-49
 Identities = 104/161 (64%), Positives = 119/161 (73%), Gaps = 28/161 (17%)
 Frame = -2

Query: 910 ELAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVA------------------ 785
           ELAAAAFVCRGGV+RVHLLDGTI GVL  ELF+RDG+GTMVA                  
Sbjct: 409 ELAAAAFVCRGGVKRVHLLDGTISGVLLLELFKRDGMGTMVARYIHSFRLHSHILLAFSC 468

Query: 784 ----------SDLYEGTRMARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVE 635
                     SD+YEGTR AR  D+ GI+ I++PLEE G L+RRT+ ELL ALDSF+VVE
Sbjct: 469 SYNSILPVTCSDVYEGTRDARVEDLAGIRHIIKPLEESGILVRRTDEELLRALDSFVVVE 528

Query: 634 REGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLL 512
           REGQIIACAALFP+ K+KCGEVA+IAV+ DCRGQGQGDKLL
Sbjct: 529 REGQIIACAALFPFFKDKCGEVAAIAVASDCRGQGQGDKLL 569



>gb:AP003803_1833595 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1060_D03.
          Length = 575

 Score =  186 bits (473), Expect(2) = 3e-47
 Identities = 92/133 (69%), Positives = 113/133 (84%)
 Frame = -2

Query: 910 ELAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGI 731
           ELAAAAFVC GGVQRVH++DGT+ G L  ELF RDG GTM+A D+YEGTR+AR  D+ GI
Sbjct: 382 ELAAAAFVCHGGVQRVHIIDGTVDGSLLLELFTRDGTGTMIA-DVYEGTRIAREEDLLGI 440

Query: 730 KQILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVS 551
           ++IL+PLEE G L++RT+ ELLEAL+SF VVER+G II CAALFP+ ++K GEVA+IAVS
Sbjct: 441 RKILRPLEESGVLVKRTDKELLEALESFYVVERDGSIIGCAALFPFPEDKSGEVAAIAVS 500

Query: 550 PDCRGQGQGDKLL 512
            +CRG+GQGDKLL
Sbjct: 501 EECRGRGQGDKLL 513



 Score = 25.4 bits (54), Expect(2) = 3e-47
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = -3

Query: 504 LKRRHLPMGFKSCFSLQLEQQTGL*GVAFQNVPLISYQWREGKKSTFHVDQNI 346
           L+R+  P+ +++    +  Q  GL GVA  +V L  +  +    S +H DQ+I
Sbjct: 522 LRRQQCPLVWRNYSCSRHGQLIGLCGVASWSVRLNPFLSKGENASIYHEDQSI 574



>gb:AE017282_428811 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 448

 Score =  175 bits (443), Expect = 1e-42
 Identities = 84/194 (43%), Positives = 125/194 (64%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           LAAA   CR GV R HLLD  I G L  ELF RDGVGT+V+++ +E  R AR  D+ GI 
Sbjct: 248 LAAALKACRSGVARAHLLDRHIDGALLLELFTRDGVGTLVSANPFEELRPARINDVVGIL 307

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
            +++PLE+ G L+ R+   L   ++ ++V+ER+G I+ CAAL P+  E  GE A +A+ P
Sbjct: 308 DLIRPLEQTGALVNRSRERLETEIEDYVVIERDGLIVGCAALHPFPAESVGEFACLALHP 367

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           + RG+ +G++LL++IE++A   G+ +LF LTT+   WF  RGF   S+  LP +RR   +
Sbjct: 368 EYRGESRGERLLEFIEQRARKLGLARLFALTTQAMQWFRERGFEPASLTDLPAQRRASYS 427

Query: 367 LSRGSKYYMKKLQP 326
             R S+  +K ++P
Sbjct: 428 PERNSQVLIKTIRP 441



>gb:AE016857_349781 Pseudomonas syringae pv. tomato str. DC3000
           section 2 of 21 of the complete
           genome.>gb:AE016853_1034956 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 448

 Score =  173 bits (439), Expect = 4e-42
 Identities = 92/192 (47%), Positives = 121/192 (63%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L AAA  CRGGV R H++     G L  ELF RDG GT+VA + +E  R A   D+ G+ 
Sbjct: 257 LDAAAEACRGGVARSHIVSYAEDGALLTELFTRDGGGTLVAQEQFELVREAAIEDVGGLM 316

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
            ++ PLEE G L+RR+   L   +  F VVEREG IIACAAL+P    + GE+A +AV+P
Sbjct: 317 DLITPLEEQGILVRRSREVLEREITQFSVVEREGLIIACAALYPIADSESGELACLAVNP 376

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           + R  G+GD+LL+ IE +A + GI+ LF+LTTRTA WF  RGF   S+D+LP  R    N
Sbjct: 377 EYRHGGRGDELLERIENRARALGIKTLFVLTTRTAHWFRERGFEPSSVDRLPSARASLYN 436

Query: 367 LSRGSKYYMKKL 332
             R SK + K +
Sbjct: 437 FQRNSKIFEKAI 448



>sp|P61919|ARGA_PSESY Amino-acid acetyltransferase (EC 2.3.1.1)
           (N-acetylglutamate synthase) (AGS)
           (NAGS).>gb:AY374326_614261 Pseudomonas syringae pv.
           syringae hypothetical protein, ArgA (argA), ArgE (argE),
           and hypothetical protein genes, complete cds; and
           unknown genes.
          Length = 432

 Score =  173 bits (439), Expect = 4e-42
 Identities = 92/192 (47%), Positives = 121/192 (63%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L AAA  CRGGV R H++     G L  ELF RDG GT+VA + +E  R A   D+ G+ 
Sbjct: 241 LDAAAEACRGGVARSHIVSYAENGALLTELFTRDGGGTLVAQEQFELVREAAIEDVGGLM 300

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
            ++ PLEE G L+RR+   L   +  F VVEREG IIACAAL+P    + GE+A +AV+P
Sbjct: 301 DLITPLEEQGILVRRSREVLEREITQFSVVEREGLIIACAALYPIADSESGELACLAVNP 360

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           + R  G+GD+LL+ IE +A + GI+ LF+LTTRTA WF  RGF   S+D+LP  R    N
Sbjct: 361 EYRHGGRGDELLERIENRARALGIKTLFVLTTRTAHWFRERGFEPSSVDRLPSARASLYN 420

Query: 367 LSRGSKYYMKKL 332
             R SK + K +
Sbjct: 421 YQRNSKIFEKAI 432



>sp|Q88AR2|ARGA_PSESM Amino-acid acetyltransferase (EC 2.3.1.1)
           (N-acetylglutamate synthase) (AGS) (NAGS).
          Length = 432

 Score =  173 bits (439), Expect = 4e-42
 Identities = 92/192 (47%), Positives = 121/192 (63%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L AAA  CRGGV R H++     G L  ELF RDG GT+VA + +E  R A   D+ G+ 
Sbjct: 241 LDAAAEACRGGVARSHIVSYAEDGALLTELFTRDGGGTLVAQEQFELVREAAIEDVGGLM 300

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
            ++ PLEE G L+RR+   L   +  F VVEREG IIACAAL+P    + GE+A +AV+P
Sbjct: 301 DLITPLEEQGILVRRSREVLEREITQFSVVEREGLIIACAALYPIADSESGELACLAVNP 360

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           + R  G+GD+LL+ IE +A + GI+ LF+LTTRTA WF  RGF   S+D+LP  R    N
Sbjct: 361 EYRHGGRGDELLERIENRARALGIKTLFVLTTRTAHWFRERGFEPSSVDRLPSARASLYN 420

Query: 367 LSRGSKYYMKKL 332
             R SK + K +
Sbjct: 421 FQRNSKIFEKAI 432



>gb:BX571965_792116 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.>gb:CP000010_865983
           Burkholderia mallei ATCC 23344 chromosome 1, complete
           sequence.
          Length = 458

 Score =  173 bits (438), Expect = 5e-42
 Identities = 83/192 (43%), Positives = 124/192 (64%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L  A   CRGGV R HL+  ++ G +  ELF  DGVGTM++ +  E  R A   D+ GI 
Sbjct: 267 LKHAIRACRGGVARAHLIPQSLDGSVLLELFLHDGVGTMISYENLESLREATPDDVGGIL 326

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
            +++PLE  GTL+RR   ++   +D F V+E +G +  CAAL+PY  EK GE+A + V+P
Sbjct: 327 TLIEPLETDGTLVRRGRHQIERDIDHFSVIEHDGVLFGCAALYPYPTEKIGEMACLTVAP 386

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           + +G G G++LL  +E++A + G+ ++F+LTTRT  WF++RGF + ++D LP +RRK  N
Sbjct: 387 EAQGSGDGERLLKRVEQRARARGLTRIFVLTTRTEHWFLKRGFVKATVDDLPEDRRKLYN 446

Query: 367 LSRGSKYYMKKL 332
             R S   MK+L
Sbjct: 447 WQRKSLVLMKQL 458



>sp|P22567|ARGA_PSEAE Amino-acid acetyltransferase (EC 2.3.1.1)
           (N-acetylglutamate synthase) (AGS)
           (NAGS).>pir|G82995|G82995 N-acetylglutamate synthase
           PA5204 [imported] - Pseudomonas aeruginosa (strain
           PAO1)>gb:AE004933_59436 Pseudomonas aeruginosa PAO1,
           section 494 of 529 of the complete
           genome.>gb:AE004091_973536 Pseudomonas aeruginosa PAO1,
           complete genome.
          Length = 432

 Score =  171 bits (434), Expect = 1e-41
 Identities = 88/192 (45%), Positives = 124/192 (64%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L AAA  CR GV+R H++  T  G L  ELF R G GT+VA + +E  R A   D+ G+ 
Sbjct: 241 LDAAAQACRAGVKRSHIVSYTEDGALLSELFTRTGNGTLVAQEQFEQLREAGIEDVGGLI 300

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
           ++++PLEE G L+RR+   L   ++ F +VEREG IIACAAL+P    + GE+A +AV+P
Sbjct: 301 ELIRPLEEQGILVRRSREVLEREIEQFSIVEREGLIIACAALYPIADSEAGELACLAVNP 360

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           + R  G+GD+LL+ IE++A   G++ LF+LTTRTA WF  RGF   S+++LP  R    N
Sbjct: 361 EYRHGGRGDELLERIEERARGLGLKTLFVLTTRTAHWFRERGFQPSSVERLPAARASLYN 420

Query: 367 LSRGSKYYMKKL 332
             R S+ + K L
Sbjct: 421 FQRNSQVFEKSL 432



>sp|P32042|ARGA_PSEPK Amino-acid acetyltransferase (EC 2.3.1.1)
           (N-acetylglutamate synthase) (AGS)
           (NAGS).>gb:AE016793_334564 Pseudomonas putida KT2440
           section 20 of 21 of the complete
           genome.>gb:AE015451_949641 Pseudomonas putida KT2440
           complete genome.
          Length = 432

 Score =  169 bits (428), Expect = 7e-41
 Identities = 87/192 (45%), Positives = 120/192 (62%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L AAA  C+GGV R H++     G L  ELF R G GT+V+ + +E  R A   D+ G+ 
Sbjct: 241 LDAAAEACKGGVARSHIVSYAEDGALLTELFTRGGGGTLVSQEQFEVVREATIEDVGGLL 300

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
           +++ PLEE G L+RR+   L   ++ F VVEREG IIACAAL+P    + GE+A +AV+P
Sbjct: 301 ELISPLEEQGILVRRSREVLEREIEQFSVVEREGMIIACAALYPIADSEAGELACLAVNP 360

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           + R  G+GD+LL+ IE +A   G+  LF+LTTRTA WF  RGF+   +++LP  R    N
Sbjct: 361 EYRHGGRGDELLERIESRARQMGLSTLFVLTTRTAHWFRERGFAPSGVERLPAARASLYN 420

Query: 367 LSRGSKYYMKKL 332
             R SK + K L
Sbjct: 421 YQRNSKIFEKPL 432



>sp|Q8XZZ5|ARGA_RALSO Amino-acid acetyltransferase (EC 2.3.1.1)
           (N-acetylglutamate synthase) (AGS)
           (NAGS).>gb:AL646063_546178 Ralstonia solanacearum
           GMI1000 chromosome, complete sequence; segment 7/19.
          Length = 451

 Score =  167 bits (424), Expect = 2e-40
 Identities = 85/184 (46%), Positives = 119/184 (64%)
 Frame = -2

Query: 883 RGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIKQILQPLEE 704
           RGGV+R HL+   + G +  ELF  DGVGTMV+    E  R A   D+ GI Q+++PLE 
Sbjct: 268 RGGVRRAHLIPFALDGSILLELFLHDGVGTMVSHTDLEYLREATLDDVGGIVQLIEPLEA 327

Query: 703 FGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQG 524
            GTL+ R    L   + +F V+E +G I  CAAL+PY KE  GE+A + V+PD +G G G
Sbjct: 328 DGTLVPRERRLLERDIANFSVIEHDGIIFGCAALYPYPKEGVGEMACLTVAPDTQGTGDG 387

Query: 523 DKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKINLSRGSKYY 344
           ++LL ++E +A + G+++LF+LTTRT  WF++RGF   ++D LP +RRK  N  R S   
Sbjct: 388 ERLLKHVEARARAVGLKRLFVLTTRTEHWFLKRGFVHATVDDLPEDRRKLYNWQRRSMVL 447

Query: 343 MKKL 332
           MKKL
Sbjct: 448 MKKL 451



>sp|Q7N8S4|ARGA_PHOLL Amino-acid acetyltransferase (EC 2.3.1.1)
           (N-acetylglutamate synthase) (AGS)
           (NAGS).>gb:BX571861_785503 Photorhabdus luminescens
           subsp. laumondii TTO1 complete genome; segment 3/17.
          Length = 448

 Score =  166 bits (421), Expect = 4e-40
 Identities = 84/194 (43%), Positives = 121/194 (62%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L +A   CR GV+R HLL     G L +ELF RDG+GT +  +  E  R A   DI GI 
Sbjct: 250 LRSAIKACRRGVRRSHLLSYQADGSLLQELFSRDGIGTQIVMESAEQIRRANINDIGGIL 309

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
           ++++PLE+ G L+RR+  +L   +D FI++ER+   IACAAL+PY +EK GE+A +AV+P
Sbjct: 310 ELIRPLEQQGILVRRSREQLEREIDKFIIIERDNLTIACAALYPYPEEKIGEMACLAVNP 369

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
             R   +G+ LL+ I + A   G++KLF+LTTR+  WF  RGF    +  LP++++   N
Sbjct: 370 KYRSSLRGEVLLNRIAEHAKQLGLEKLFVLTTRSIHWFQERGFEPAELSMLPIQKQVLYN 429

Query: 367 LSRGSKYYMKKLQP 326
             R SK  M  L+P
Sbjct: 430 YQRRSKILMLNLEP 443



>gb:AE016827_342383 Mannheimia succiniciproducens MBEL55E, complete
           genome.
          Length = 439

 Score =  166 bits (420), Expect = 6e-40
 Identities = 86/195 (44%), Positives = 124/195 (63%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L AA  VC+ GV+R HLL     G L +ELF RDGVGT ++ D  E  R+A   DIPG+ 
Sbjct: 244 LQAAIEVCKAGVKRSHLLSYEEDGSLLQELFTRDGVGTQLSVDNSEDIRIATVQDIPGLI 303

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
           +++ PLE+ G L++R+  +L   + ++ +++R+G IIACAAL  Y +E   E+A +AV P
Sbjct: 304 ELIHPLEQQGILVKRSREQLEMDIANYTIIDRDGVIIACAALNQYPEENMAEMACVAVHP 363

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           D R   +GD LL+ I+K+A   GI+KLF+LTTRT  WF  RGF   +++ LP E+R   N
Sbjct: 364 DYRSSSRGDILLEAIQKRARQLGIEKLFVLTTRTVHWFQERGFRLANVEDLPKEKRDHYN 423

Query: 367 LSRGSKYYMKKLQPD 323
             R SK  ++ L  +
Sbjct: 424 YQRRSKILIQPLNEE 438



>sp|Q8ZMB8|ARGA_SALTY Amino-acid acetyltransferase (EC 2.3.1.1)
           (N-acetylglutamate synthase) (AGS)
           (NAGS).>gb:CP000026_77586 Salmonella enterica subsp.
           enterica serovar Paratypi A str. ATCC
           9150.>gb:AE008837_244640 Salmonella typhimurium LT2,
           section 141 of 220 of the complete
           genome.>gb:AE006468_1001722 Salmonella typhimurium LT2,
           complete genome.
          Length = 443

 Score =  164 bits (415), Expect = 2e-39
 Identities = 81/192 (42%), Positives = 119/192 (61%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L  A   CR GV+R HL+     G L +ELF RDG+GT +  +  E  R A   DI GI 
Sbjct: 251 LRGAVKACRSGVRRCHLISYQEDGSLLQELFSRDGIGTQIVMESAEQIRRATINDIGGIL 310

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
           ++++PLE+ G L+RR+  +L   +D F +++R+   IACAAL+P+++EK GE+A +AV P
Sbjct: 311 ELIRPLEQQGILVRRSREQLEMEIDKFTIIQRDNMTIACAALYPFVEEKIGEMACVAVHP 370

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           D R   +G+ LL+ +  +A   G++KLF+LTTR+  WF  RGF+   I+ LP  ++K  N
Sbjct: 371 DYRSSSRGEVLLERVAAQARQMGLRKLFVLTTRSIHWFQERGFTPVDIELLPESKKKMYN 430

Query: 367 LSRGSKYYMKKL 332
             R SK  M  L
Sbjct: 431 YQRRSKVLMADL 442



>sp|Q8Z421|ARGA_SALTI Amino-acid acetyltransferase (EC 2.3.1.1)
           (N-acetylglutamate synthase) (AGS)
           (NAGS).>pir|AH0864|AH0864 N-acetylglutamate synthase
           [imported] - Salmonella enterica subsp. enterica serovar
           Typhi (strain CT18)>gb:AE016843_346910 Salmonella
           enterica subsp. enterica serovar Typhi Ty2, section 10
           of 16 of the complete genome.>gb:AL627277_543232
           Salmonella enterica serovar Typhi (Salmonella typhi)
           strain CT18, complete chromosome; segment
           13/20.>gb:AE014613_984242 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, complete genome.
          Length = 443

 Score =  164 bits (415), Expect = 2e-39
 Identities = 81/192 (42%), Positives = 119/192 (61%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L  A   CR GV+R HL+     G L +ELF RDG+GT +  +  E  R A   DI GI 
Sbjct: 251 LRGAVKACRSGVRRCHLISYQEDGSLLQELFSRDGIGTQIVMESAEQIRRATINDIGGIL 310

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
           ++++PLE+ G L+RR+  +L   +D F +++R+   IACAAL+P+++EK GE+A +AV P
Sbjct: 311 ELIRPLEQQGILVRRSREQLEMEIDKFTIIQRDNMTIACAALYPFVEEKIGEMACVAVHP 370

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           D R   +G+ LL+ +  +A   G++KLF+LTTR+  WF  RGF+   I+ LP  ++K  N
Sbjct: 371 DYRSSSRGEVLLERVAAQARQMGLRKLFVLTTRSIHWFQERGFTPVDIELLPESKKKMYN 430

Query: 367 LSRGSKYYMKKL 332
             R SK  M  L
Sbjct: 431 YQRRSKVLMADL 442



>gb:AF008117_467904 Escherichia coli K12 feedback resistant mutant
           EE51 N-acetylglutamate synthetase (argA) gene, complete
           cds.
          Length = 443

 Score =  163 bits (413), Expect = 4e-39
 Identities = 82/192 (42%), Positives = 117/192 (60%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L  A   CR GV+R HL+     G L +ELF RDG+GT +  +  E  R A   DI GI 
Sbjct: 251 LRGAVKACRSGVRRCHLISYQEDGALLQELFSRDGIGTQIVMESAEQIRRATINDIGGIL 310

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
           ++++PLE+ G L+RR+  +L   +D F +++R+   IACAAL+P+ +EK GE+A +AV P
Sbjct: 311 ELIRPLEQQGILVRRSREQLEMEIDKFTIIQRDNTTIACAALYPFPEEKIGEMACVAVHP 370

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           D R   +G+ LL+ I  +A   G+ KLF+LTTR+  WF  RGF+   ID LP  +++  N
Sbjct: 371 DYRSSSRGEVLLERIAAQAKQSGLSKLFVLTTRSIHWFQERGFTPVDIDLLPESKKQLYN 430

Query: 367 LSRGSKYYMKKL 332
             R SK  M  L
Sbjct: 431 YQRKSKVLMADL 442



>gb:AF008116_467903 Escherichia coli K12 feedback resistant mutant
           EE17 N-acetylglutamate synthetase (argA) gene, complete
           cds.
          Length = 443

 Score =  163 bits (413), Expect = 4e-39
 Identities = 82/192 (42%), Positives = 117/192 (60%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L  A   CR GV+R HL+     G L +ELF RDG+GT +  +  E  R A   DI GI 
Sbjct: 251 LRGAVKACRSGVRRCHLISYQEDGALLQELFSRDGIGTQIVMESAEQIRRATINDIGGIL 310

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
           ++++PLE+ G L+RR+  +L   +D F +++R+   IACAAL+P+ +EK GE+A +AV P
Sbjct: 311 ELIRPLEQQGILVRRSREQLEMEIDKFTIIQRDNTTIACAALYPFPEEKIGEMACVAVHP 370

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           D R   +G+ LL+ I  +A   G+ KLF+LTTR+  WF  RGF+   ID LP  +++  N
Sbjct: 371 DYRSSSRGEVLLERIAAQAKQSGLSKLFVLTTRSIHWFQERGFTPVDIDLLPESKKQLYN 430

Query: 367 LSRGSKYYMKKL 332
             R SK  M  L
Sbjct: 431 YQRKSKVLMADL 442



>gb:AF008115_467902 Escherichia coli K12 feedback resistant mutant
           EE11 N-acetylglutamate synthetase (argA) gene, complete
           cds.
          Length = 443

 Score =  163 bits (413), Expect = 4e-39
 Identities = 82/192 (42%), Positives = 117/192 (60%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L  A   CR GV+R HL+     G L +ELF RDG+GT +  +  E  R A   DI GI 
Sbjct: 251 LRGAVKACRSGVRRCHLISYQEDGALLQELFSRDGIGTQIVMESAEQIRRATINDIGGIL 310

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
           ++++PLE+ G L+RR+  +L   +D F +++R+   IACAAL+P+ +EK GE+A +AV P
Sbjct: 311 ELIRPLEQQGILVRRSREQLEMEIDKFTIIQRDNTTIACAALYPFPEEKIGEMACVAVHP 370

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           D R   +G+ LL+ I  +A   G+ KLF+LTTR+  WF  RGF+   ID LP  +++  N
Sbjct: 371 DYRSSSRGEVLLERIAAQAKQSGLSKLFVLTTRSIHWFQERGFTPVDIDLLPESKKQLYN 430

Query: 367 LSRGSKYYMKKL 332
             R SK  M  L
Sbjct: 431 YQRKSKVLMADL 442



>gb:AE016765_327399 Escherichia coli CFT073 section 11 of 18 of the
           complete genome.>gb:AE014075_957983 Escherichia coli
           CFT073 complete genome.
          Length = 465

 Score =  163 bits (413), Expect = 4e-39
 Identities = 82/192 (42%), Positives = 117/192 (60%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L  A   CR GV+R HL+     G L +ELF RDG+GT +  +  E  R A   DI GI 
Sbjct: 273 LRGAVKACRSGVRRCHLISYQEDGALLQELFSRDGIGTQIVMESAEQIRRATINDIGGIL 332

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
           ++++PLE+ G L+RR+  +L   +D F +++R+   IACAAL+P+ +EK GE+A +AV P
Sbjct: 333 ELIRPLEQQGILVRRSREQLEMEIDKFTIIQRDNTTIACAALYPFPEEKIGEMACVAVHP 392

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           D R   +G+ LL+ I  +A   G+ KLF+LTTR+  WF  RGF+   ID LP  +++  N
Sbjct: 393 DYRSSSRGEVLLERIAAQAKQSGLSKLFVLTTRSIHWFQERGFTPVDIDLLPESKKQLYN 452

Query: 367 LSRGSKYYMKKL 332
             R SK  M  L
Sbjct: 453 YQRKSKVLMADL 464



>sp|P59293|ARGA_SHIFL Amino-acid acetyltransferase (EC 2.3.1.1)
           (N-acetylglutamate synthase) (AGS)
           (NAGS).>gb:AE005674_72411 Shigella flexneri 2a str. 301,
           complete genome.>gb:AE016987_372589 Shigella flexneri 2a
           str. 2457T section 10 of 16 of the complete
           genome.>gb:AE014073_997339 Shigella flexneri 2a str.
           2457T complete genome.
          Length = 443

 Score =  163 bits (413), Expect = 4e-39
 Identities = 82/192 (42%), Positives = 117/192 (60%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L  A   CR GV+R HL+     G L +ELF RDG+GT +  +  E  R A   DI GI 
Sbjct: 251 LRGAVKACRSGVRRCHLISYQEDGALLQELFSRDGIGTQIVMESAEQIRRATINDIGGIL 310

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
           ++++PLE+ G L+RR+  +L   +D F +++R+   IACAAL+P+ +EK GE+A +AV P
Sbjct: 311 ELIRPLEQQGILVRRSREQLEMEIDKFTIIQRDNTTIACAALYPFPEEKIGEMACVAVHP 370

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           D R   +G+ LL+ I  +A   G+ KLF+LTTR+  WF  RGF+   ID LP  +++  N
Sbjct: 371 DYRSSSRGEVLLERIAAQAKQSGLSKLFVLTTRSIHWFQERGFTPVDIDLLPESKKQLYN 430

Query: 367 LSRGSKYYMKKL 332
             R SK  M  L
Sbjct: 431 YQRKSKVLMADL 442



>sp|Q9CMJ6|ARGA_PASMU Amino-acid acetyltransferase (EC 2.3.1.1)
           (N-acetylglutamate synthase) (AGS)
           (NAGS).>gb:AE006121_215716 Pasteurella multocida subsp.
           multocida str. Pm70 section 88 of 204 of the complete
           genome.>gb:AE004439_1118446 Pasteurella multocida subsp.
           multocida str. Pm70, complete genome.
          Length = 440

 Score =  163 bits (413), Expect = 4e-39
 Identities = 84/193 (43%), Positives = 123/193 (63%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L AA   CR G++R HL+     G L +ELF RDGVGT ++ +  E  R+A  +DIP + 
Sbjct: 244 LQAAIEACRFGIKRSHLISYEEDGSLLQELFTRDGVGTQLSMEHSETIRLATVSDIPALL 303

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
           ++++PLE+ G L++R+  +L   ++ + +++R+G IIACAAL  Y  EK  E+A +AV P
Sbjct: 304 ELIRPLEQQGILVKRSREQLEMEINQYTIIDRDGVIIACAALNCYADEKMAEMACVAVHP 363

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           D R   +GD LL+ I+K+A   GI+KLF+LTTRT  WF  RGF    I  LP ++R+  N
Sbjct: 364 DYRNSSRGDILLEAIQKRAKQLGIEKLFVLTTRTVHWFQERGFQLAEIADLPDKKRQHYN 423

Query: 367 LSRGSKYYMKKLQ 329
             R SK  ++ LQ
Sbjct: 424 YQRRSKILIQALQ 436



>sp|P08205|ARGA_ECOLI Amino-acid acetyltransferase (EC 2.3.1.1)
           (N-acetylglutamate synthase) (AGS)
           (NAGS).>pir|A30372|XYECAA amino-acid N-acetyltransferase
           (EC 2.3.1.1) - Escherichia coli (strain
           K-12)>pir|C91088|C91088 amino-acid N-acetyltransferase
           (EC 2.3.1.1) [similarity] - Escherichia coli (strain
           O157:H7, substrain RIMD 0509952)>pir|E85933|E85933
           amino-acid N-acetyltransferase (EC 2.3.1.1) [similarity]
           - Escherichia coli (strain O157:H7, substrain
           EDL933)>gb:AE005174_67928 Escherichia coli O157:H7
           EDL933, complete genome.>gb:ECARGA_125059 E. coli argA
           gene for N-acetylglutamate synthase (EC
           2.3.1.1).>gb:ECU29581_133912 Escherichia coli K-12
           genome; approximately 63 to 64 minutes.>gb:U00096_201840
           Escherichia coli K-12 MG1655 complete
           genome.>gb:BA000007_661687 Escherichia coli O157:H7 DNA,
           complete genome.
          Length = 443

 Score =  163 bits (413), Expect = 4e-39
 Identities = 82/192 (42%), Positives = 117/192 (60%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L  A   CR GV+R HL+     G L +ELF RDG+GT +  +  E  R A   DI GI 
Sbjct: 251 LRGAVKACRSGVRRCHLISYQEDGALLQELFSRDGIGTQIVMESAEQIRRATINDIGGIL 310

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
           ++++PLE+ G L+RR+  +L   +D F +++R+   IACAAL+P+ +EK GE+A +AV P
Sbjct: 311 ELIRPLEQQGILVRRSREQLEMEIDKFTIIQRDNTTIACAALYPFPEEKIGEMACVAVHP 370

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           D R   +G+ LL+ I  +A   G+ KLF+LTTR+  WF  RGF+   ID LP  +++  N
Sbjct: 371 DYRSSSRGEVLLERIAAQAKQSGLSKLFVLTTRSIHWFQERGFTPVDIDLLPESKKQLYN 430

Query: 367 LSRGSKYYMKKL 332
             R SK  M  L
Sbjct: 431 YQRKSKVLMADL 442



>gb:AF008119_467906 Escherichia coli K12 feedback resistant mutant
           PT2M217 N-acetylglutamate synthetase (argA) gene,
           complete cds.
          Length = 443

 Score =  163 bits (412), Expect = 5e-39
 Identities = 82/192 (42%), Positives = 117/192 (60%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L  A   CR GV+R HL+     G L +ELF RDG+GT +  +  E  R A   DI GI 
Sbjct: 251 LRGAVKACRSGVRRCHLISYQEDGALLQELFSRDGIGTQIVMESAEQIRRATINDIGGIL 310

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
           ++++PLE+ G L+RR+  +L   +D F +++R+   IACAAL+P+ +EK GE+A +AV P
Sbjct: 311 ELIRPLEQQGILVRRSREQLEMEIDKFTIIQRDNTTIACAALYPFPEEKIGEMACVAVHP 370

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           D R   +G+ LL+ I  +A   G+ KLF+LTTR+  WF  RGF+   ID LP  +++  N
Sbjct: 371 DYRSSSRGEVLLERIAAQAKQSGLSKLFVLTTRSIHWFQERGFTPVDIDLLPESKKQLYN 430

Query: 367 LSRGSKYYMKKL 332
             R SK  M  L
Sbjct: 431 YRRKSKVLMADL 442



>sp|Q8ZH86|ARGA_YERPE Amino-acid acetyltransferase (EC 2.3.1.1)
           (N-acetylglutamate synthase) (AGS)
           (NAGS).>pir|AF0125|AF0125 amino-acid N-acetyltransferase
           (EC 2.3.1.1) [imported] - Yersinia pestis (strain
           CO92)>gb:AE013916_301454 Yersinia pestis KIM section 316
           of 415 of the complete genome.>gb:AJ414146_522858
           Yersinia pestis strain CO92 complete genome; segment
           6/20.>gb:BX936398_837666 Yersinia pseudotuberculosis
           IP32953 genome, complete sequence.>gb:AE009952_931637
           Yersinia pestis KIM complete genome.
          Length = 441

 Score =  163 bits (412), Expect = 5e-39
 Identities = 81/192 (42%), Positives = 118/192 (61%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L  A   CR GV+R HLL     G L +ELF RDG+GT +  +  E  R A   DI GI 
Sbjct: 250 LRGAVKACRSGVRRSHLLSYQEDGALIQELFSRDGIGTQIVMESAEQVRRATINDIGGIL 309

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
           ++++PLE+ G L+RR+  +L   +D F ++ER+   IACAAL+P+  E  GE+A +AV P
Sbjct: 310 ELIRPLEQQGILVRRSREQLEMEIDKFTIIERDNLTIACAALYPFPDEHIGEMACVAVHP 369

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           D R   +G+ LL+ I  +A   G++KLF+LTTR+  WF  RGF+   +D LP+++++  N
Sbjct: 370 DYRSSSRGEMLLNRITNQARQMGLKKLFVLTTRSIHWFQERGFTPAEVDVLPIQKQELYN 429

Query: 367 LSRGSKYYMKKL 332
             R SK  +  L
Sbjct: 430 YQRRSKILLADL 441



>gb:AF008118_467905 Escherichia coli K12 feedback resistant mutant
           PT2M216 N-acetylglutamate synthetase (argA) gene,
           complete cds.
          Length = 443

 Score =  161 bits (407), Expect = 2e-38
 Identities = 81/192 (42%), Positives = 116/192 (60%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L  A   CR GV+R HL+     G L +ELF RDG+ T +  +  E  R A   DI GI 
Sbjct: 251 LRGAVKACRSGVRRCHLISYQEDGALLQELFSRDGISTQIVMESAEQIRRATINDIGGIL 310

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
           ++++PLE+ G L+RR+  +L   +D F +++R+   IACAAL+P+ +EK GE+A +AV P
Sbjct: 311 ELIRPLEQQGILVRRSREQLEMEIDKFTIIQRDNTTIACAALYPFPEEKIGEMACVAVHP 370

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           D R   +G+ LL+ I  +A   G+ KLF+LTTR+  WF  RGF+   ID LP  +++  N
Sbjct: 371 DYRSSSRGEVLLERIAAQAKQSGLSKLFVLTTRSIHWFQERGFTPVDIDLLPESKKQLYN 430

Query: 367 LSRGSKYYMKKL 332
             R SK  M  L
Sbjct: 431 YQRKSKVLMADL 442



>gb:AE017137_388589 Yersinia pestis biovar Medievalis str. 91001
           section 11 of 16 of the complete
           genome.>gb:AE017042_1145155 Yersinia pestis biovar
           Medievalis str. 91001 complete genome.
          Length = 449

 Score =  158 bits (399), Expect = 2e-37
 Identities = 77/180 (42%), Positives = 113/180 (62%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L  A   CR GV+R HLL     G L +ELF RDG+GT +  +  E  R A   DI GI 
Sbjct: 250 LRGAVKACRSGVRRSHLLSYQEDGALIQELFSRDGIGTQIVMESAEQVRRATINDIGGIL 309

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
           ++++PLE+ G L+RR+  +L   +D F ++ER+   IACAAL+P+  E  GE+A +AV P
Sbjct: 310 ELIRPLEQQGILVRRSREQLEMEIDKFTIIERDNLTIACAALYPFPDEHIGEMACVAVHP 369

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           D R   +G+ LL+ I  +A   G++KLF+LTTR+  WF  RGF+   +D LP+++++  N
Sbjct: 370 DYRSSSRGEMLLNRITNQARQMGLKKLFVLTTRSIHWFQERGFTPAEVDVLPIQKQELYN 429



>gb:BX950851_839747 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 441

 Score =  156 bits (395), Expect = 5e-37
 Identities = 80/186 (43%), Positives = 111/186 (59%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L  A   CR GV+R HL+     G L +ELF RDG+GT +  +  E  R A   DI GI 
Sbjct: 250 LRGAVKACRSGVRRSHLISYQDDGALLQELFSRDGIGTQIVMESAEQVRRATINDIGGIL 309

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
           ++++PLEE G L+RR+  +L   +D F VV R+   IACAAL+P+ +E  GE+A +AV P
Sbjct: 310 ELIRPLEEQGILVRRSREQLEMEIDKFTVVVRDNLTIACAALYPFPEESIGEMACVAVHP 369

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           D R   +GD LL  +  +A   G+QKLF+LTT +  WF  RGF    ++ LP +++   N
Sbjct: 370 DYRSSSRGDMLLMRVAAQARQQGLQKLFVLTTHSIHWFQERGFLPAEVEMLPKKKQALYN 429

Query: 367 LSRGSK 350
             R SK
Sbjct: 430 YQRRSK 435



>sp|P59294|ARGA_VIBVU Amino-acid acetyltransferase (EC 2.3.1.1)
           (N-acetylglutamate synthase) (AGS)
           (NAGS).>sp|Q7MIA6|ARGA_VIBVY Amino-acid
           acetyltransferase (EC 2.3.1.1) (N-acetylglutamate
           synthase) (AGS) (NAGS).>gb:AE016802_336460 Vibrio
           vulnificus CMCP6 chromosome I section 6 of 11 of the
           complete sequence.>gb:BA000037_723437 Vibrio vulnificus
           YJ016 DNA, chromosome I, complete
           sequence.>gb:AE016795_1046184 Vibrio vulnificus CMCP6
           chromosome I complete sequence.
          Length = 445

 Score =  156 bits (395), Expect = 5e-37
 Identities = 77/186 (41%), Positives = 115/186 (61%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L  A   CR GV R HL+   I G L +ELF  DG+GT V     E  R A   DI GI 
Sbjct: 254 LKGAVAACRAGVPRSHLISYKIDGALIQELFSFDGIGTQVVMASAEQVRQACIDDIGGIL 313

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
           ++++PLEE G L+RR+  +L + ++ F ++E++G II CAAL+PY+ E   E+A +A+ P
Sbjct: 314 ELIRPLEEQGILVRRSREQLEQEVERFTIIEKDGLIIGCAALYPYIDEHMAEMACVAIHP 373

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           D R   +G  LL+Y++ ++ S GI+++F+LTT +  WF  +GF E  +D LP+ ++   N
Sbjct: 374 DYRDGNRGLLLLNYMKHRSKSIGIEQIFVLTTHSVHWFREQGFYEIGVDSLPMAKKSLYN 433

Query: 367 LSRGSK 350
             R SK
Sbjct: 434 YQRRSK 439



>sp|Q7VLN8|ARGA_HAEDU Amino-acid acetyltransferase (EC 2.3.1.1)
           (N-acetylglutamate synthase) (AGS)
           (NAGS).>gb:AE017154_392801 Haemophilus ducreyi strain
           35000HP section 4 of 6 of the complete
           genome.>gb:AE017143_1027063 Haemophilus ducreyi strain
           35000HP complete genome.
          Length = 437

 Score =  155 bits (393), Expect = 8e-37
 Identities = 81/192 (42%), Positives = 118/192 (61%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L AA  VC  G++R HL+     G L +ELF RDGVGT ++    E  R+A + DI G+ 
Sbjct: 244 LQAAIDVCHAGIKRSHLISYQTDGSLLQELFSRDGVGTQLSEASSECIRLATSFDIAGLL 303

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
            +++PLE+ G L++R+  +L   +  + ++ER+G +IACAAL  Y  EK  E+A +AV P
Sbjct: 304 NLIRPLEDQGLLVKRSREQLEMEISQYTIIERDGIVIACAALIHYPAEKMAEMACVAVHP 363

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           D R   +GD LL+ I+++A    I+KLF+LTT+T  WF  RGF +     LPVE+++  N
Sbjct: 364 DYRDSARGDILLEAIKRRAYKLNIEKLFVLTTQTIQWFQERGFVQIQPTDLPVEKQRHYN 423

Query: 367 LSRGSKYYMKKL 332
             R SK  M  L
Sbjct: 424 YQRMSKVLMLAL 435



>gb:CR543861_102117 Acinetobacter sp. ADP1 complete genome.
          Length = 451

 Score =  155 bits (392), Expect = 1e-36
 Identities = 82/196 (41%), Positives = 112/196 (57%), Gaps = 4/196 (2%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L  A      GV RVHL+     G L +ELF RDG+GTM+    YE  R A   D+ G+ 
Sbjct: 255 LQGAQTASLSGVHRVHLISYAYDGALIEELFTRDGIGTMITDAHYEDVRTATIQDVGGLI 314

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEK----CGEVASI 560
            +L+PLEE G L+ R+   L   +  F V+ER+G I+ACAAL+P    K      E+A +
Sbjct: 315 NLLRPLEEEGILVYRSRERLESEISQFAVIERDGMILACAALYPIPTAKNEIRSAEIACV 374

Query: 559 AVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERR 380
           AV P  R   +G ++L ++E+KA   GI +LF+LTTRTA WF+  GF   S+D LP  R+
Sbjct: 375 AVDPAYRKSNRGSQILHFLEEKARQEGILQLFVLTTRTAHWFLEHGFQTASVDDLPSARQ 434

Query: 379 KKINLSRGSKYYMKKL 332
           +  N  R S  + K L
Sbjct: 435 ELYNYQRNSLVFKKIL 450



>gb:BX321858_773106 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 3/10.
          Length = 444

 Score =  154 bits (388), Expect = 3e-36
 Identities = 80/187 (42%), Positives = 112/187 (59%)
 Frame = -2

Query: 898 AAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIKQIL 719
           A   C  GV+RVHL+   I G L  ELF   G+G+M+  D  +  R A   DI  I Q++
Sbjct: 256 ALHACEKGVKRVHLVSRHIDGALLLELFTHSGIGSMITRDPLQIIRQAEIEDIGAILQLI 315

Query: 718 QPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCR 539
           +PLE  G L+RR    L   ++ F V+E +  IIACAAL+P+  +K  E+A +AV P+ R
Sbjct: 316 EPLENAGILVRRNRELLEMEIERFTVIEHDNMIIACAALYPFPDDKACELACLAVHPEYR 375

Query: 538 GQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKINLSR 359
             G G  L+D++E +A   G ++LF LTTRT  WF+ RGFSE + DQLP  ++   N  R
Sbjct: 376 KAGIGRILIDHLEDQAREQGYRRLFALTTRTTHWFVERGFSETTPDQLPRLKQNFYNYQR 435

Query: 358 GSKYYMK 338
            SK ++K
Sbjct: 436 RSKVFVK 442



>sp|P59099|ARGA_BUCAP Amino-acid acetyltransferase (EC 2.3.1.1)
           (N-acetylglutamate synthase) (AGS)
           (NAGS).>gb:AE014120_303344 Buchnera aphidicola str. Sg
           (Schizaphis graminum) section 45 of 57 of the complete
           genome.>gb:AE013218_935322 Buchnera aphidicola str. Sg
           (Schizaphis graminum) complete genome.
          Length = 442

 Score =  154 bits (388), Expect = 3e-36
 Identities = 76/182 (41%), Positives = 111/182 (60%)
 Frame = -2

Query: 886 CRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIKQILQPLE 707
           C+ GV R HL+     G L +ELF RDG+GT +  +  E  R A   DI GI ++++PLE
Sbjct: 257 CKSGVNRSHLISYHKNGALLQELFSRDGIGTQMVMESAEKIRQANINDIGGILELIRPLE 316

Query: 706 EFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQ 527
           + G L+RR+  +L   +D F ++ER+   IACAAL+P+ KEK GE+A +AV PD R   +
Sbjct: 317 KKGILVRRSREQLEMEVDKFTIIERDNLTIACAALYPFFKEKIGEMACVAVHPDYRNSSR 376

Query: 526 GDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKINLSRGSKY 347
           GD LL  ++  A    ++K+F+LTT++  WF  RGF    ++ LP  ++K  N  R SK 
Sbjct: 377 GDLLLQTMKLNAKKLNLKKIFVLTTQSIHWFQERGFILVDVEILPESKKKMYNYQRCSKI 436

Query: 346 YM 341
            M
Sbjct: 437 LM 438



>sp|O66143|ARGA_BUCAI Amino-acid acetyltransferase (EC 2.3.1.1)
           (N-acetylglutamate synthase) (AGS)
           (NAGS).>pir|B84983|B84983 amino-acid N-acetyltransferase
           (EC 2.3.1.1) [imported] - Buchnera sp. (strain
           APS)>gb:BA000003_653808 Buchnera aphidicola str. APS
           (Acyrthosiphon pisum) genomic DNA, complete sequence.
          Length = 442

 Score =  153 bits (387), Expect = 4e-36
 Identities = 77/182 (42%), Positives = 110/182 (60%)
 Frame = -2

Query: 886 CRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIKQILQPLE 707
           C+ GV R HL+     G L +ELF RDG+GT +  +  E  R A   DI GI ++++PLE
Sbjct: 257 CKSGVNRSHLISYHKSGALLQELFSRDGIGTQMVMESAEKIRGASINDIGGILELIRPLE 316

Query: 706 EFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQ 527
             G L+RR+  +L   +D F ++E +   IACAAL+P+ KEK GE+A +AV PD R   +
Sbjct: 317 HKGILVRRSREQLEIEVDKFTIIEHDNLTIACAALYPFFKEKIGEMACLAVHPDYRNSSR 376

Query: 526 GDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKINLSRGSKY 347
           GD LL  I+  A    ++++F+LTT++  WF  RGF    I+ LP  ++K  N  RGSK 
Sbjct: 377 GDALLKKIKMNAKDMHLKRIFVLTTQSIHWFQERGFILVDIEVLPESKKKMYNYQRGSKI 436

Query: 346 YM 341
            M
Sbjct: 437 LM 438



>gb:AY086660_1571704 Arabidopsis thaliana clone 266616 mRNA,
           complete sequence.
          Length = 99

 Score =  152 bits (384), Expect = 9e-36
 Identities = 73/97 (75%), Positives = 86/97 (88%)
 Frame = -2

Query: 802 VGTMVASDLYEGTRMARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQ 623
           +GTMVASD+YEGTR AR  D+ GI+ I++PLEE G L+RRT+ ELL ALDSF+VVEREGQ
Sbjct: 1   MGTMVASDVYEGTRDARVEDLAGIRHIIKPLEESGILVRRTDEELLRALDSFVVVEREGQ 60

Query: 622 IIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLL 512
           IIACAALFP+ K+KCGEVA+IAV+ DCRGQGQGDKLL
Sbjct: 61  IIACAALFPFFKDKCGEVAAIAVASDCRGQGQGDKLL 97



>gb:CR555306_105980 Azoarcus sp. EbN1 complete genome.
          Length = 468

 Score =  152 bits (384), Expect = 9e-36
 Identities = 82/192 (42%), Positives = 115/192 (59%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L  A    R GV RVHL+D    G L  E F   GVGT+V+ D     R A   D+  + 
Sbjct: 277 LPCAIRAVRRGVARVHLIDHDKDGGLLLEFFTHAGVGTIVSRDPLFRLREATVEDVAALV 336

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
            ++ P+E  GTL+RR    L + +D F VVE +G ++ CAAL+P+  E+  E+A +AV+P
Sbjct: 337 ALISPMETDGTLVRRGRELLEQEIDRFTVVEHDGVLVGCAALYPFSDERAAELACLAVTP 396

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           + R  G GD+LL  IE++A +  +++LF+LTTRTA WF  RGFSE   D LP ++R+  N
Sbjct: 397 EYRRAGLGDQLLRRIEQRARAQRLERLFVLTTRTAHWFRERGFSEIGPDALPRQKRELYN 456

Query: 367 LSRGSKYYMKKL 332
             R SK + K L
Sbjct: 457 YQRRSKVFTKPL 468



>gb:CR378672_96307 Photobacterium profundum SS9; segment 10/12.
          Length = 441

 Score =  149 bits (376), Expect = 7e-35
 Identities = 75/186 (40%), Positives = 112/186 (60%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L  A   CR GV R HL+     G L +ELF  DG+GT +     E  R A   DI GI 
Sbjct: 250 LRGAVSACRAGVPRSHLISYKEDGALIQELFSLDGIGTQIVMASAEKVRGAGIDDIGGIL 309

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
            ++ PLE+ G L+RR+  +L + ++ F ++ER+G IIACAAL+P+  EK  E+A +AV P
Sbjct: 310 DLIYPLEQEGILVRRSREQLEQEIEQFTIIERDGLIIACAALYPFPDEKIAEMACVAVHP 369

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           D R   +G  LL+ + ++A    ++ +F+LTTR+  WF+ +GF E  ++QLP+ ++   N
Sbjct: 370 DFRDGDRGVILLNRLRQQAKEQRLKHVFVLTTRSVHWFLEQGFIESDVEQLPMAKKALYN 429

Query: 367 LSRGSK 350
             R SK
Sbjct: 430 FQRRSK 435



>gb:AE004969_59825 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 436

 Score =  149 bits (375), Expect = 1e-34
 Identities = 73/177 (41%), Positives = 107/177 (60%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           +++A     GGV RV +L+G   G L +ELF R+G+GT +A + +   R A + DIP I 
Sbjct: 242 ISSAVAALEGGVHRVQILNGAADGSLLQELFTRNGIGTSIAKEAFVSIRQAHSGDIPHIA 301

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
            +++PLEE G L+ R+   L   +  F ++E +G +  CAAL  + +  CGE+A +AVSP
Sbjct: 302 ALIRPLEEQGVLLHRSREYLENHISEFSILEHDGDLYGCAALKTFAEADCGEIACLAVSP 361

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRK 377
             +  G G++LL +I  KA   GI +LF L+T T +WF  RGF   S D+LP  RRK
Sbjct: 362 QAQDGGYGERLLAHIIDKARGIGISRLFALSTNTGEWFAERGFQTASEDELPETRRK 418



>sp|Q87M87|ARGA_VIBPA Amino-acid acetyltransferase (EC 2.3.1.1)
           (N-acetylglutamate synthase) (AGS)
           (NAGS).>gb:BA000031_707831 Vibrio parahaemolyticus RIMD
           2210633 DNA, chromosome 1, complete sequence.
          Length = 445

 Score =  149 bits (375), Expect = 1e-34
 Identities = 74/186 (39%), Positives = 111/186 (59%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L  +   CR GV R HL+   + G L +ELF  DG+GT V     E  R A   DI GI 
Sbjct: 254 LKGSIAACRAGVPRSHLISYKVDGALIQELFSFDGIGTQVVMASAEQVRQAGIDDIGGIL 313

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
           +++ PLEE G L+RR+  +L + +  F ++E++G II CAAL+PY +E+  E+A +A+ P
Sbjct: 314 ELIHPLEEQGILVRRSREQLEQEIGKFTIIEKDGLIIGCAALYPYSEERKAEMACVAIHP 373

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           D R   +G  LL+Y++ ++ S  I ++F+LTT +  WF  +GF E  +D LP  ++   N
Sbjct: 374 DYRDGNRGLLLLNYMKHRSKSENINQIFVLTTHSLHWFREQGFYEVGVDYLPGAKQGLYN 433

Query: 367 LSRGSK 350
             R SK
Sbjct: 434 FQRKSK 439



>sp|Q9JXU9|ARGA_NEIMB Amino-acid acetyltransferase (EC 2.3.1.1)
           (N-acetylglutamate synthase) (AGS)
           (NAGS).>pir|B81033|B81033 N-acetylglutamate synthase
           NMB1876 [imported] - Neisseria meningitidis (strain MC58
           serogroup B)>gb:AE002537_47265 Neisseria meningitidis
           serogroup B strain MC58 section 179 of 206 of the
           complete genome.>gb:AE002098_897378 Neisseria
           meningitidis serogroup B strain MC58 complete
           genome.>gb:AX565959_1470570 Sequence 193 from Patent
           WO02077648.
          Length = 436

 Score =  148 bits (374), Expect = 1e-34
 Identities = 73/177 (41%), Positives = 107/177 (60%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           +++A     GGV RV +L+G   G L +ELF R+G+GT +A + +   R A + DIP I 
Sbjct: 242 ISSAVAALEGGVHRVQILNGAADGSLLQELFTRNGIGTSIAKEAFVSIRQAHSGDIPHIA 301

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
            +++PLEE G L+ R+   L   +  F ++E +G +  CAAL  + +  CGE+A +AVSP
Sbjct: 302 ALIRPLEEQGILLHRSREYLENHISEFSILEHDGNLYGCAALKTFAEADCGEIACLAVSP 361

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRK 377
             +  G G++LL +I  KA   GI +LF L+T T +WF  RGF   S D+LP  RRK
Sbjct: 362 QAQDGGYGERLLAHIIDKARGIGISRLFALSTNTGEWFAERGFQTASEDELPETRRK 418



>sp|Q9JW21|ARGA_NEIMA Amino-acid acetyltransferase (EC 2.3.1.1)
           (N-acetylglutamate synthase) (AGS)
           (NAGS).>pir|A81977|A81977 probable amino-acid
           N-acetyltransferase (EC 2.3.1.1) NMA0580 [imported] -
           Neisseria meningitidis (strain Z2491 serogroup
           A)>gb:NMA2Z2491_153525 Neisseria meningitidis serogroup
           A strain Z2491 complete genome; segment 2/7.
          Length = 436

 Score =  148 bits (374), Expect = 1e-34
 Identities = 73/177 (41%), Positives = 107/177 (60%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           +++A     GGV RV +L+G   G L +ELF R+G+GT +A + +   R A + DIP I 
Sbjct: 242 ISSAVAALEGGVHRVQILNGAADGSLLQELFTRNGIGTSIAKEAFVSIRQAHSGDIPHIA 301

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
            +++PLEE G L+ R+   L   +  F ++E +G +  CAAL  + +  CGE+A +AVSP
Sbjct: 302 ALIRPLEEQGILLHRSREYLENHISEFSILEHDGNLYGCAALKTFAEADCGEIACLAVSP 361

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRK 377
             +  G G++LL +I  KA   GI +LF L+T T +WF  RGF   S D+LP  RRK
Sbjct: 362 QAQDGGYGERLLAHIIDKARGIGISRLFALSTNTGEWFAERGFQTASEDELPETRRK 418



>sp|P59292|ARGA_SHEON Amino-acid acetyltransferase (EC 2.3.1.1)
           (N-acetylglutamate synthase) (AGS)
           (NAGS).>gb:AE015857_318555 Shewanella oneidensis MR-1
           section 406 of 457 of the complete
           genome.>gb:AE014299_954152 Shewanella oneidensis MR-1
           complete genome.
          Length = 445

 Score =  147 bits (372), Expect = 2e-34
 Identities = 75/186 (40%), Positives = 112/186 (60%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L A+   CR GV R HL+     G L +ELF R+G+GT + ++  E  R A  +DI GI 
Sbjct: 254 LKASIDACRNGVPRCHLVSYLDDGALLQELFSREGIGTQIVTESAERLRRASISDIGGIL 313

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
            +++PLEE G L+RR+  +L   ++ F+++ER+G +I CAAL+P+ ++  GE A + V P
Sbjct: 314 NLIRPLEEQGILVRRSREQLEIEIEQFMLIERDGLVIGCAALYPFEEDNAGEFACLVVHP 373

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           D R   +G  LL  I  +A S G  +LF LTTR+  WF+  GF    +D LP ++++  N
Sbjct: 374 DYRDADRGSLLLKNIIGQARSRGYSRLFALTTRSIHWFLEHGFVIEDVDALPQKKKQLYN 433

Query: 367 LSRGSK 350
             R SK
Sbjct: 434 YQRRSK 439



>gb:BX640428_809957 Bordetella parapertussis strain 12822, complete
           genome; segment 6/14.
          Length = 467

 Score =  146 bits (369), Expect = 5e-34
 Identities = 72/192 (37%), Positives = 116/192 (60%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L  A+   + GV R HL+   + G +  E+F  DGVGTMV  D  +  R A   D+  I 
Sbjct: 276 LQHASLAVKRGVARAHLVPYALDGSVLLEIFTHDGVGTMVVEDTLDDLRAATLDDVGAIL 335

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
            +++PLE  GTL+ R    +   ++ F V+E +G I  CAAL+P+ +++  E+A + V P
Sbjct: 336 SLIEPLETDGTLVPRPRSAIERDVERFTVLEHDGVIYGCAALYPFPEDQMAEMACLIVHP 395

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           + +G G+G+ LL ++E +A + G ++LF+LTTRT+ WF++RGF    +  LP +++   N
Sbjct: 396 EWQGSGEGEILLRHMESRARASGARRLFVLTTRTSHWFMKRGFVRGGVADLPRDKQNNYN 455

Query: 367 LSRGSKYYMKKL 332
            SR S  ++KKL
Sbjct: 456 RSRNSLVFIKKL 467



>gb:BX640418_806736 Bordetella pertussis strain Tohama I, complete
           genome; segment 8/12.
          Length = 467

 Score =  146 bits (369), Expect = 5e-34
 Identities = 72/192 (37%), Positives = 116/192 (60%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L  A+   + GV R HL+   + G +  E+F  DGVGTMV  D  +  R A   D+  I 
Sbjct: 276 LQHASLAVKRGVARAHLVPYALDGSVLLEIFTHDGVGTMVVEDTLDDLRAATLDDVGAIL 335

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
            +++PLE  GTL+ R    +   ++ F V+E +G I  CAAL+P+ +++  E+A + V P
Sbjct: 336 SLIEPLEADGTLVPRPRSAIERDVERFTVLEHDGVIYGCAALYPFPEDQMAEMACLIVHP 395

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           + +G G+G+ LL ++E +A + G ++LF+LTTRT+ WF++RGF    +  LP +++   N
Sbjct: 396 EWQGSGEGEILLRHMESRARASGARRLFVLTTRTSHWFMKRGFVRGGVADLPRDKQNNYN 455

Query: 367 LSRGSKYYMKKL 332
            SR S  ++KKL
Sbjct: 456 RSRNSLVFIKKL 467



>gb:CP000020_870761 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 446

 Score =  146 bits (368), Expect = 6e-34
 Identities = 75/191 (39%), Positives = 111/191 (58%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L  A   C+ GV R HL+     G L +ELF  DG+GT V     E  R A   DI GI 
Sbjct: 254 LKGAISACKAGVPRSHLISYKEDGALIQELFSFDGIGTQVVMASSEQVRDAEIDDIGGIL 313

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
            +++PLEE G L+RR+  +L + +  F ++E++G +IACAAL+P+ +E   E+  +AV P
Sbjct: 314 DLIRPLEEEGILVRRSREQLEQEIAQFTIIEKDGLVIACAALYPFPEEGMAEMGCVAVHP 373

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           D R   +G  LL+ +  KA    + +LF+LTTR+  WF  +GF E  +  LP++++K  N
Sbjct: 374 DYRDGDRGVTLLNRLRSKAKQFKLSQLFVLTTRSLHWFREQGFIEVDVSHLPIKKQKLYN 433

Query: 367 LSRGSKYYMKK 335
             R SK  + K
Sbjct: 434 FQRKSKILVLK 444



>pir|E82093|E82093 N-acetylglutamate synthase VC2316 [imported] -
           Vibrio cholerae (strain N16961 serogroup
           O1)>gb:AE004301_52690 Vibrio cholerae O1 biovar eltor
           str. N16961 chromosome I, section 209 of 251 of the
           complete chromosome.>gb:AE003852_1053464 Vibrio cholerae
           O1 biovar eltor str. N16961 chromosome I, complete
           chromosome.
          Length = 456

 Score =  144 bits (363), Expect = 2e-33
 Identities = 73/192 (38%), Positives = 114/192 (59%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L AA   CR GV R HL+     G L +ELF  DG+GT +     E  R A   DI GI 
Sbjct: 265 LRAALKACRAGVPRSHLVSYKEDGALIQELFSFDGIGTQIVMASAEQIRQATIDDIGGIF 324

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
            +++PLEE G L+RR+  +L + +  F +++++G +I C+AL+PY +E+  E+A +A+ P
Sbjct: 325 DLIRPLEEQGILVRRSREQLEQEIHKFTIIDKDGLVIGCSALYPYPEERMAEMACVAIHP 384

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           + R   +G  LL + + +A   GI+ LF+LTT +  WF  +GF+E  ++ LP+ ++   N
Sbjct: 385 EYRDGHRGLHLLVHSKHQAKQMGIRHLFVLTTHSTHWFREQGFNEVDVEALPMAKKSLYN 444

Query: 367 LSRGSKYYMKKL 332
             R SK  M +L
Sbjct: 445 YQRRSKILMLQL 456



>sp|Q9KPQ0|ARGA_VIBCH Amino-acid acetyltransferase (EC 2.3.1.1)
           (N-acetylglutamate synthase) (AGS) (NAGS).
          Length = 445

 Score =  144 bits (363), Expect = 2e-33
 Identities = 73/192 (38%), Positives = 114/192 (59%)
 Frame = -2

Query: 907 LAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIK 728
           L AA   CR GV R HL+     G L +ELF  DG+GT +     E  R A   DI GI 
Sbjct: 254 LRAALKACRAGVPRSHLVSYKEDGALIQELFSFDGIGTQIVMASAEQIRQATIDDIGGIF 313

Query: 727 QILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSP 548
            +++PLEE G L+RR+  +L + +  F +++++G +I C+AL+PY +E+  E+A +A+ P
Sbjct: 314 DLIRPLEEQGILVRRSREQLEQEIHKFTIIDKDGLVIGCSALYPYPEERMAEMACVAIHP 373

Query: 547 DCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKIN 368
           + R   +G  LL + + +A   GI+ LF+LTT +  WF  +GF+E  ++ LP+ ++   N
Sbjct: 374 EYRDGHRGLHLLVHSKHQAKQMGIRHLFVLTTHSTHWFREQGFNEVDVEALPMAKKSLYN 433

Query: 367 LSRGSKYYMKKL 332
             R SK  M +L
Sbjct: 434 YQRRSKILMLQL 445



>gb:AE016922_358316 Chromobacterium violaceum ATCC 12472 section 13
           of 16 of the complete genome.>gb:AE016825_1043470
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 435

 Score =  136 bits (342), Expect = 6e-31
 Identities = 71/184 (38%), Positives = 109/184 (59%)
 Frame = -2

Query: 883 RGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIKQILQPLEE 704
           R G+ R HL+     G L  E F R G GTM+A D     R A   D+  I  +++PLEE
Sbjct: 252 REGIPRAHLVSRHQDGALLLEHFTRGGNGTMIARDPLVKVRHASIEDVGDIMGLIRPLEE 311

Query: 703 FGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQG 524
            G L+RR+   L   +  + V+E +G+I  C A+ P+ + +  E+A +AVS + R  G G
Sbjct: 312 QGILVRRSRERLEVEIGEYSVLEHDGKIYGCVAMHPFPEAETAELACLAVSQEKRDGGFG 371

Query: 523 DKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKINLSRGSKYY 344
           + LL ++E +A + G++ LF+LTT+T+ WF+ RGF+E     LP+ R++  N  R SK +
Sbjct: 372 EMLLKHVEYQARTQGLRSLFVLTTQTSHWFVERGFAEADKSSLPLARQQFYNYQRRSKVF 431

Query: 343 MKKL 332
           +KKL
Sbjct: 432 VKKL 435



>sp|Q9K3D6|ARHA_MORAB Bifunctional protein argHA [Includes:
           Argininosuccinate lyase (EC 4.3.2.1) (Arginosuccinase)
           (ASAL); Amino-acid acetyltransferase (EC 2.3.1.1)
           (N-acetylglutamate synthase) (AGS)
           (NAGS)].>gb:MSP252021_150623 Moritella sp. argE gene,
           argC gene, argB gene, argF gene, argG gene and argH(A)
           gene.
          Length = 629

 Score = 77.0 bits (188), Expect = 5e-13
 Identities = 45/145 (31%), Positives = 79/145 (54%)
 Frame = -2

Query: 826 KELFQRDGVGTMVASDLYEGTRMARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSF 647
           K L +RD  G  +        R AR TD+  I++++      G  + R+  +L++A+ +F
Sbjct: 454 KRLEERDTSGISI--------RAARLTDLDDIERMVNYWANIGENLPRSRSDLVKAVGTF 505

Query: 646 IVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKL 467
            V E+  Q+  CA+++ Y      E+ S+ + P  +G GQG  +++Y+ +KA    IQK+
Sbjct: 506 AVTEKHNQVTGCASIYVY-DTGLAELRSLGIEPGYQGGGQGKAVVEYMLRKAEQMAIQKV 564

Query: 466 FLLTTRTADWFIRRGFSECSIDQLP 392
           F+L TR  ++F++ GF   S   LP
Sbjct: 565 FVL-TRVPEFFMKLGFRSTSKSMLP 588



>sp|P59620|ARLY_VIBPA Bifunctional protein argH [Includes:
           Argininosuccinate lyase (EC 4.3.2.1) (Arginosuccinase)
           (ASAL); Probable acetyltransferase (EC
           2.3.1.-)].>gb:BA000031_708216 Vibrio parahaemolyticus
           RIMD 2210633 DNA, chromosome 1, complete sequence.
          Length = 624

 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 47/145 (32%), Positives = 75/145 (51%)
 Frame = -2

Query: 826 KELFQRDGVGTMVASDLYEGTRMARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSF 647
           K L QRD     V        R AR TDI  ++ ++      G  + R+  EL+  + SF
Sbjct: 454 KRLAQRDSSAVKV--------RPARLTDIETLEGMVAYWANMGENLPRSRNELVRDIGSF 505

Query: 646 IVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKL 467
            V E  G++  CA+L+ Y      E+ S+ +    +GQGQG  +++Y+  KA    I+K+
Sbjct: 506 AVAEHHGEVTGCASLYVY-DSGLAEIRSLGIEAGWQGQGQGSAIVNYLVDKARQMAIKKV 564

Query: 466 FLLTTRTADWFIRRGFSECSIDQLP 392
           F+L TRT ++F+++ F   S   LP
Sbjct: 565 FVL-TRTPEFFMKQSFLPTSKSLLP 588



>gb:AE017340_456379 Idiomarina loihiensis L2TR, complete genome.
          Length = 620

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 43/133 (32%), Positives = 72/133 (54%)
 Frame = -2

Query: 763 RMARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKE 584
           R A   DI  I  ++Q     G  + R + +++ +++ F V E +G+++ CA+L+ Y   
Sbjct: 461 RDANLGDIGAILDLVQHWAGAGENLPRAKDDIVHSINEFAVTEVDGKVMGCASLYIYTTG 520

Query: 583 KCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSI 404
              E+ S+ V P    +GQG  L+ Y+ KKA    + ++ +LT R  D+F ++GFS CS 
Sbjct: 521 -LAEIRSLGVHPHTEVRGQGRMLVSYLLKKARLLQLNRVIVLT-RVPDFFEQQGFSHCSK 578

Query: 403 DQLPVERRKKINL 365
           D LP +  K   L
Sbjct: 579 DSLPEKVMKDCEL 591



>gb:BA000030_702581 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 180

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 43/128 (33%), Positives = 72/128 (56%), Gaps = 2/128 (1%)
 Frame = -2

Query: 763 RMARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVERE--GQIIACAALFPYL 590
           R AR +D+P ++++L      G L+ +  V L E +  F V ER+   +++ C AL   +
Sbjct: 19  RRARTSDVPAVRRLLDSYVRRGILLDKATVTLYEDIQEFWVAERDDNAEVLGCGALH-VM 77

Query: 589 KEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSEC 410
            E   EV ++AV+PD +G G G +LL  + + A   G++++F LT    D+F + GF E 
Sbjct: 78  WEDLAEVRTLAVNPDAKGLGVGHQLLGKLLQTARWLGVRRVFCLTFE-VDFFGKHGFVE- 135

Query: 409 SIDQLPVE 386
            I + PV+
Sbjct: 136 -IGETPVD 142



>gb:CP000020_872479 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 624

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 44/145 (30%), Positives = 73/145 (50%)
 Frame = -2

Query: 826 KELFQRDGVGTMVASDLYEGTRMARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSF 647
           K L +RD  G  V        R AR TD+  ++ ++      G  + R   EL+  + SF
Sbjct: 454 KRLQERDNAGVKV--------RPARLTDLDALEGMVAYWAGLGENLPRNRNELVRDIGSF 505

Query: 646 IVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKL 467
            V E  G++  CA+L+ Y      E+ S+ V    + QGQG  ++ ++ +KA    I+K+
Sbjct: 506 AVAEHHGEVTGCASLYVY-DSGLAEIRSLGVEAGWQSQGQGKAIVQHLVEKAREMAIKKV 564

Query: 466 FLLTTRTADWFIRRGFSECSIDQLP 392
           F+L TR  ++F+++ F   S   LP
Sbjct: 565 FVL-TRVPEFFMKQDFIPTSRSLLP 588



>gb:CR378663_93685 Photobacterium profundum SS9; segment 1/12.
          Length = 625

 Score = 67.8 bits (164), Expect = 3e-10
 Identities = 40/124 (32%), Positives = 67/124 (54%)
 Frame = -2

Query: 763 RMARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKE 584
           R AR TD+  I+ ++      G  + R   EL+  + SF V E  G +  CA+L+ Y   
Sbjct: 467 RGARLTDLDAIESMVVYWAGLGENLPRKRNELVRDIGSFAVAEHHGVVTGCASLYVY-DS 525

Query: 583 KCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSI 404
              E+ S+ +    + QGQG  +++Y+ +KA    I+K+F+L TR  ++F+++GF   S 
Sbjct: 526 GLAEIRSLGIEAGWQEQGQGKAIVEYLIEKAGQMAIKKVFVL-TRLPEFFMKQGFIPTSK 584

Query: 403 DQLP 392
             LP
Sbjct: 585 SLLP 588



>gb:AP006618_560256 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 188

 Score = 67.0 bits (162), Expect = 5e-10
 Identities = 44/125 (35%), Positives = 72/125 (57%)
 Frame = -2

Query: 763 RMARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKE 584
           R AR +D+P IK+++  +     L+ ++ V L EA+  F V E +G+++ C AL   L  
Sbjct: 30  RRARTSDVPEIKRLVD-VYAGRILLEKSLVTLYEAVQEFWVAELDGRVVGCGALH-VLWA 87

Query: 583 KCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSI 404
             GEV ++AV PD +G+G G  ++  + + A    +++LF+LT    ++F R GF E  I
Sbjct: 88  DLGEVRTVAVHPDVKGRGVGRLIVQRLIEVARELELRRLFVLTFE-VEFFARHGFVE--I 144

Query: 403 DQLPV 389
           D  PV
Sbjct: 145 DGTPV 149



>sp|Q8DCM9|ARLY_VIBVU Bifunctional protein argH [Includes:
           Argininosuccinate lyase (EC 4.3.2.1) (Arginosuccinase)
           (ASAL); Probable acetyltransferase (EC
           2.3.1.-)].>sp|Q7MH73|ARLY_VIBVY Bifunctional protein
           argH [Includes: Argininosuccinate lyase (EC 4.3.2.1)
           (Arginosuccinase) (ASAL); Probable acetyltransferase (EC
           2.3.1.-)].>gb:AE016801_336076 Vibrio vulnificus CMCP6
           chromosome I section 5 of 11 of the complete
           sequence.>gb:BA000037_723825 Vibrio vulnificus YJ016
           DNA, chromosome I, complete
           sequence.>gb:AE016795_1045800 Vibrio vulnificus CMCP6
           chromosome I complete sequence.
          Length = 624

 Score = 67.0 bits (162), Expect = 5e-10
 Identities = 39/124 (31%), Positives = 66/124 (53%)
 Frame = -2

Query: 763 RMARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKE 584
           R AR TDI  ++ ++      G  + RT  E++  +  F V E +G +  CA+L+ Y   
Sbjct: 467 RPARITDIETLESMVAYWANLGENLPRTRSEIIRDIGLFAVSEHQGLVTGCASLYIY-DS 525

Query: 583 KCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSI 404
              E+ S+ +    + QGQG  ++ Y+  KA    I+KLF+L TR  ++F+++ F + S 
Sbjct: 526 GLAEIRSLGIEAGWQRQGQGTAVVQYLIDKAKDMAIKKLFVL-TRAPEFFLKQNFVQTSK 584

Query: 403 DQLP 392
             LP
Sbjct: 585 SLLP 588



>gb:AE013330_291365 Methanosarcina mazei strain Goe1, section 112 of
           379 of the complete genome.>gb:AE008384_965474
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 159

 Score = 63.9 bits (154), Expect = 4e-09
 Identities = 40/124 (32%), Positives = 66/124 (53%)
 Frame = -2

Query: 763 RMARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKE 584
           R AR +D+  +KQI+        ++ R+  E+ E +  + V E EG+I+ C AL   + E
Sbjct: 11  RKARISDVVEMKQIINTYSREELMLARSLSEMYENIRDYYVCEIEGEIVGCCALH-VVWE 69

Query: 583 KCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSI 404
              E+ ++AV PDC  +G G KL+    + A S G++++F L T    +F   GF+    
Sbjct: 70  DLAEILALAVKPDCARKGVGTKLVSACLEDAKSLGMKEVFAL-TYVPGFFETLGFNIVDK 128

Query: 403 DQLP 392
           + LP
Sbjct: 129 NSLP 132



>gb:AE000516_22910 Mycobacterium tuberculosis CDC1551, complete
           genome.
          Length = 164

 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 44/128 (34%), Positives = 69/128 (53%), Gaps = 3/128 (2%)
 Frame = -2

Query: 763 RMARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVERE---GQIIACAALFPY 593
           R AR +D+P IKQ++        L+ +  V L EA+  F V E     G+++ C AL   
Sbjct: 3   RRARTSDVPAIKQLVDTYAG-KILLEKNLVTLYEAVQEFWVAEHPDLYGKVVGCGALH-V 60

Query: 592 LKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSE 413
           L    GE+ ++AV P   G G G  ++D + + A    +Q++F+LT  T ++F R GF+E
Sbjct: 61  LWSDLGEIRTVAVDPAMTGHGIGHAIVDRLLQVARDLQLQRVFVLTFET-EFFARHGFTE 119

Query: 412 CSIDQLPV 389
             I+  PV
Sbjct: 120 --IEGTPV 125



>pir|T36387|T36387 probable acetyltransferase - Streptomyces
           coelicolor>gb:SCO939116_177049 Streptomyces coelicolor
           A3(2) complete genome; segment 13/29.
          Length = 169

 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 41/128 (32%), Positives = 69/128 (53%), Gaps = 2/128 (1%)
 Frame = -2

Query: 763 RMARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVERE--GQIIACAALFPYL 590
           R AR  D+P ++++L        L+ +  V L E++  F V ER+   +++ C AL   +
Sbjct: 8   RRARTRDVPDVRRLLDAYVRDRILLDKAMVTLYESIQEFWVAERDDNAEVVGCGALH-VM 66

Query: 589 KEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSEC 410
            E   EV ++AV P  +G G G K+L+ +   A   G++++F LT    D+F + GF E 
Sbjct: 67  WEDLAEVRTLAVKPGLKGAGVGHKVLEKLLDTARWLGVRRVFCLTFE-VDFFGKHGFVE- 124

Query: 409 SIDQLPVE 386
            I + PV+
Sbjct: 125 -IGETPVD 131



>pir|B70879|B70879 hypothetical protein Rv2747 - Mycobacterium
           tuberculosis  (strain H37RV)>gb:BX248343_760125
           Mycobacterium bovis subsp. bovis AF2122/97 complete
           genome; segment 10/14.>gb:BX842580_820838 Mycobacterium
           tuberculosis H37Rv complete genome; segment 9/13.
          Length = 174

 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 44/128 (34%), Positives = 69/128 (53%), Gaps = 3/128 (2%)
 Frame = -2

Query: 763 RMARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVERE---GQIIACAALFPY 593
           R AR +D+P IKQ++        L+ +  V L EA+  F V E     G+++ C AL   
Sbjct: 13  RRARTSDVPAIKQLVDTYAG-KILLEKNLVTLYEAVQEFWVAEHPDLYGKVVGCGALH-V 70

Query: 592 LKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSE 413
           L    GE+ ++AV P   G G G  ++D + + A    +Q++F+LT  T ++F R GF+E
Sbjct: 71  LWSDLGEIRTVAVDPAMTGHGIGHAIVDRLLQVARDLQLQRVFVLTFET-EFFARHGFTE 129

Query: 412 CSIDQLPV 389
             I+  PV
Sbjct: 130 --IEGTPV 135



>sp|P59599|YM12_CHLTE Hypothetical protein
           CT2212.>gb:AE012967_287670 Chlorobium tepidum TLS
           section 188 of 194 of the complete
           genome.>gb:AE006470_934838 Chlorobium tepidum TLS
           complete genome.
          Length = 155

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 36/124 (29%), Positives = 64/124 (51%)
 Frame = -2

Query: 763 RMARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKE 584
           R AR  D   I +I +     G +++R+   ++E +  F V + +GQ+I C A+  +   
Sbjct: 9   RNARLADASAISRITEGYAGEGIMLKRSVENIIEHIRDFFVADYKGQVIGCCAI-AFYTV 67

Query: 583 KCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSI 404
           K  E+ S+AV  + R +G G  L++  E   S  G+ ++F+LT  +  +F R G+ E   
Sbjct: 68  KLAEIRSLAVLEEFRNKGIGRLLVEKAEAVLSEEGVNEVFVLTLNSG-FFKRMGYKEIEK 126

Query: 403 DQLP 392
           +  P
Sbjct: 127 EYFP 130



>gb:AE016822_341055 Leifsonia xyli subsp. xyli str. CTCB07, complete
           genome.
          Length = 165

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 40/116 (34%), Positives = 61/116 (52%), Gaps = 1/116 (0%)
 Frame = -2

Query: 763 RMARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVERE-GQIIACAALFPYLK 587
           R AR  D+PGI+++++PL +   L+ +  V   E++  F + E E G +I C AL   + 
Sbjct: 5   RRARTGDVPGIQELVEPLVQRRILLGKEAVTFYESVQEFRIAEDEDGALIGCGALH-VMW 63

Query: 586 EKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGF 419
               EV ++AV+    G G G  LL  +E  A   G+ +LF LT     +F R GF
Sbjct: 64  SDIAEVRTLAVADSWLGTGVGRALLGRLEDDARELGLSRLFCLTFE-VPFFERNGF 118



>gb:CR522870_101596 Desulfotalea psychrophila LSv54 chromosome.
          Length = 161

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 42/130 (32%), Positives = 66/130 (50%), Gaps = 3/130 (2%)
 Frame = -2

Query: 772 EGTRMAR---ATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAAL 602
           EGT M R     D+P I  +L    E G L+ R+   L + +  F+V E +G+++   AL
Sbjct: 4   EGTGMIRNATMADVPHIHSLLNDFAERGVLLGRSISSLYDKIRDFVVYEEDGEVVGVCAL 63

Query: 601 FPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRG 422
                E   E+ S+AV    +G+G G +L++    +A +  I K+F LT + A +F R G
Sbjct: 64  -QISWENLAEIRSLAVVDGAQGRGIGRQLVETCLAEARAFKITKIFTLTYQDA-FFRRLG 121

Query: 421 FSECSIDQLP 392
           F +     LP
Sbjct: 122 FYDIDKKDLP 131



>pir|D87031|D87031 probable acetyltransferase [imported] -
           Mycobacterium leprae>gb:MLCB33_145084 Mycobacterium
           leprae cosmid B33.>gb:MLEPRTN4_146780 Mycobacterium
           leprae strain TN complete genome; segment 4/10.
          Length = 180

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 43/128 (33%), Positives = 69/128 (53%), Gaps = 3/128 (2%)
 Frame = -2

Query: 763 RMARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVERE---GQIIACAALFPY 593
           R AR +DIP IKQ++        L+ +  V L EA+  F V E     G+++ C AL   
Sbjct: 19  RRARTSDIPAIKQLVDTYAG-KILLEKNLVTLYEAVQEFWVAEHPDIPGKVVGCGALH-V 76

Query: 592 LKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSE 413
           L    GE+ ++AV P   G G G  +++ + + A    +++LF+LT  T ++F + GF+E
Sbjct: 77  LWSDLGEIRTVAVDPAMTGHGVGGTIVNRLLEVARKLELERLFVLTFET-EFFSQHGFTE 135

Query: 412 CSIDQLPV 389
             I+  PV
Sbjct: 136 --IEGTPV 141



>gb:AE017237_413563 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 11 of 16 of the complete
           genome.>gb:AE016958_1056967 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 174

 Score = 59.7 bits (143), Expect = 8e-08
 Identities = 42/128 (32%), Positives = 70/128 (54%), Gaps = 3/128 (2%)
 Frame = -2

Query: 763 RMARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVE---REGQIIACAALFPY 593
           R AR +D+P IK+++        L+ +  V L EA+  F V E     G+++ C AL   
Sbjct: 13  RRARTSDVPAIKELVDTYAG-KILLEKNLVTLYEAVQEFWVAELPDSPGRVVGCGALH-V 70

Query: 592 LKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSE 413
           L    GE+ ++AV+P   G G G  ++D + + A    +++LF+LT  T ++F + GF+E
Sbjct: 71  LWSDLGEIRTVAVNPAMTGHGIGHAIVDRLLQVARELELKRLFVLTFET-EFFGKHGFTE 129

Query: 412 CSIDQLPV 389
             I+  PV
Sbjct: 130 --IEGTPV 135



>gb:AE011152_269618 Methanosarcina acetivorans str. C2A, section 497
           of 534 of the complete genome.>gb:AE010299_910177
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 151

 Score = 59.7 bits (143), Expect = 8e-08
 Identities = 39/124 (31%), Positives = 65/124 (52%)
 Frame = -2

Query: 763 RMARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKE 584
           R AR +D+  +KQI+    +   ++ R+  E+ E +  + V E EG+I+ C AL   + E
Sbjct: 3   RKARISDVVEMKQIINTYSKDELMLARSLSEIYENIRDYYVCEIEGEIVGCCALH-VVWE 61

Query: 583 KCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSI 404
              E+ ++AV PDC  +G G KL+      A   G++++F L T   D+F    F+    
Sbjct: 62  DLAEILALAVRPDCARKGVGSKLVLACLGDAKELGMKEVFAL-TYVPDFFETLEFNIVDK 120

Query: 403 DQLP 392
           + LP
Sbjct: 121 NSLP 124



>gb:AL646076_548509 Ralstonia solanacearum GMI1000 megaplasmid,
           complete sequence; segment 1/11.
          Length = 149

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 40/132 (30%), Positives = 68/132 (51%), Gaps = 9/132 (6%)
 Frame = -2

Query: 706 EFGTLIRRTEV---ELLEALDSFIVVEREGQIIACAALFPYLKEKCGE---VASIAVSPD 545
           E   L+RR  +   ++ + +D+F +   +G++I CAA+     E+ G+   V S+AV P 
Sbjct: 19  EVAALLRRCGLPADDIHDIIDAFQIALEKGRVIGCAAM-----EQGGKSIVVRSVAVDPV 73

Query: 544 CRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKI-- 371
           CR +G   +L++ +  +A   G ++ +LL+T    +F R GFS    D+ P E R     
Sbjct: 74  CRDRGIASRLIETLLLRAHGAGAREAYLLSTSAPSYFARWGFSLFPADKAPAEVRASATF 133

Query: 370 -NLSRGSKYYMK 338
            N  R S   M+
Sbjct: 134 RNAERSSALCMR 145



>gb:AE016915_356564 Chromobacterium violaceum ATCC 12472 section 6
           of 16 of the complete genome.>gb:AE016825_1041718
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 160

 Score = 57.8 bits (138), Expect = 3e-07
 Identities = 44/139 (31%), Positives = 66/139 (47%), Gaps = 15/139 (10%)
 Frame = -2

Query: 763 RMARATDIPGIKQILQ----PLEEF----GTLIRRTEVELLEALDS---FIVVEREGQII 617
           R+A   D+P I+ +LQ    PL+       T +  T   L   L S     V ER+GQ +
Sbjct: 7   RLAGWDDLPAIRLLLQQAFGPLQTMLPSRPTALDETVASLTGHLASGSQIFVAERQGQPV 66

Query: 616 ACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTR---- 449
           AC  + P   + C EV  +   PD +G G G  L+ + E + S  G++KL L T R    
Sbjct: 67  ACLLVLPP-DDGCAEVKRVCTHPDWQGYGLGSALMSHAEHQLSRQGVRKLKLSTRRRLPD 125

Query: 448 TADWFIRRGFSECSIDQLP 392
              ++ R G+S+ +I   P
Sbjct: 126 NLRFYQRLGYSQSAIQPYP 144



>gb:AP006840_570078 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 175

 Score = 53.9 bits (128), Expect = 4e-06
 Identities = 37/125 (29%), Positives = 67/125 (53%), Gaps = 1/125 (0%)
 Frame = -2

Query: 763 RMARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIV-VEREGQIIACAALFPYLK 587
           R A   DIP   +I+      G ++RR  + L E++  F V V+ +GQ++  AAL    +
Sbjct: 4   RKAVMADIPAAHEIINGYAAQGLMLRRPLMMLYESVRDFTVAVDDDGQVLGVAALHIMWR 63

Query: 586 EKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECS 407
           +   E+ S+AV P    +G G  L++ + ++A + G++++F LT +   +F + GF    
Sbjct: 64  D-LAEIRSLAVRPGLTRRGVGRGLVEQLLEEARALGLKRIFALTYQPG-FFAKCGFEVVP 121

Query: 406 IDQLP 392
            + LP
Sbjct: 122 KESLP 126



>pir|S27600|S27600 N-acetylglutamate synthase - Pseudomonas
           aeruginosa>gb:PSEARGA_160341 P.aeruginosa
           N-acetylglutamate synthase (argA) gene, complete cds.
          Length = 397

 Score = 53.1 bits (126), Expect = 7e-06
 Identities = 48/150 (32%), Positives = 73/150 (48%), Gaps = 4/150 (2%)
 Frame = -2

Query: 880 GGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARATDIPGIKQILQPLEEF 701
           G      +   T G  L  ELF R G GT              + D+ G+ ++++PLEE 
Sbjct: 241 GRESSARISSATRGRPLLSELFTRTGNGTWSPRSSSSSCARWASRDVGGLIELIRPLEEQ 300

Query: 700 GTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEK--CGEVAS--IAVSPDCRGQ 533
           G L+RR+   L   + S +      +  A   L   L ++   G  AS  +AV+P+ R  
Sbjct: 301 GILVRRSREWLEREIASPVASASSQRRRADHRLRRALPDRRFRGRRASPCLAVNPEYR-H 359

Query: 532 GQGDKLLDYIEKKASSHGIQKLFLLTTRTA 443
           G   +LL+ IE++A   G++ LF+LTTRTA
Sbjct: 360 GAWHELLERIEERARL-GLKTLFVLTTRTA 388



>gb:BA000043_739861 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 150

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 35/122 (28%), Positives = 61/122 (50%)
 Frame = -2

Query: 757 ARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKC 578
           A  +D+  +  ++Q   + G ++ R+ + + + L    V    GQI+  A L   L    
Sbjct: 6   AVTSDVKDMHALIQHYAKKGLVLPRSLLSIYQHLQCMYVARENGQIVGTAGLH-ILGHDL 64

Query: 577 GEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQ 398
           GEV S+ VSPD  G+G G  L+ +I  +A+  G+++L   T +  ++F + GF       
Sbjct: 65  GEVRSLVVSPDHMGKGIGRLLVHHIADEAARLGVKRLISFTYQ-VEFFRKCGFEIVDKST 123

Query: 397 LP 392
           LP
Sbjct: 124 LP 125



>gb:BX571662_779319 Wolinella succinogenes, complete genome; segment
           6/7.
          Length = 152

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 32/118 (27%), Positives = 62/118 (52%)
 Frame = -2

Query: 745 DIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVA 566
           ++  ++ +L+P  E G ++ RT  E+  A+ S+ V   EG+I+   AL  +      E+ 
Sbjct: 11  EVGAMRNLLRPEVERGVILERTADEIANAIRSYNVAWEEGEIVGFCALHIH-SPSLAEIR 69

Query: 565 SIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLP 392
           S+ V    RG+G    +++   K+A   G++++ +LT +    F + GF E S + +P
Sbjct: 70  SLIVKESHRGRGIATSIIEVSLKEALGLGVKEVLVLTYQRT-LFEKLGFVEVSKEAIP 126



>gb:CP000027_79462 Dehalococcoides ethenogenes 195, complete genome.
          Length = 158

 Score = 50.4 bits (119), Expect = 5e-05
 Identities = 38/123 (30%), Positives = 63/123 (51%), Gaps = 1/123 (0%)
 Frame = -2

Query: 757 ARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVERE-GQIIACAALFPYLKEK 581
           A   D   I +++    + G ++ R+  E+ E L  F V+  + G++IACAAL     + 
Sbjct: 7   ATIKDATTIHKLVNNFADHGQMLARSLAEIYENLRDFYVIRGDNGEVIACAALHISWAD- 65

Query: 580 CGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSID 401
             EV S+AVS +   QG G+ ++    + A S  I  +F LT + A +F + GF +   +
Sbjct: 66  LAEVKSLAVSEERHRQGLGEMVVKACLEDAKSLQIPTVFCLTYKPA-FFAKCGFHQVEKN 124

Query: 400 QLP 392
            LP
Sbjct: 125 ALP 127



>gb:AE010682_265628 Methanosarcina acetivorans str. C2A, section 27
           of 534 of the complete genome.>gb:AE010299_906187
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 153

 Score = 50.1 bits (118), Expect = 6e-05
 Identities = 39/125 (31%), Positives = 66/125 (52%), Gaps = 10/125 (8%)
 Frame = -2

Query: 763 RMARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKE 584
           R A   D+P I+++L             ++E LE  D F++ E EG+++ CAAL   ++ 
Sbjct: 7   RKAEKKDLPAIQRLLSTYF--------LDIEELEPED-FVLAEEEGKVVGCAAL---IRN 54

Query: 583 KCGE-----VASIAVSPDCRGQGQGDKLLDYI-----EKKASSHGIQKLFLLTTRTADWF 434
           + GE     + SIAV P+ RG+G G +L++Y+     E + S     +L++ TT    +F
Sbjct: 55  RSGEKTFMELHSIAVHPNLRGKGIGTRLMEYLINTIDEPEISEAPALELYVRTT-APGFF 113

Query: 433 IRRGF 419
            + GF
Sbjct: 114 EKLGF 118



>gb:AE016932_360841 Bacteroides thetaiotaomicron VPI-5482, section 7
           of 21 of the complete genome.>gb:AE015928_987329
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 151

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 30/86 (34%), Positives = 46/86 (53%), Gaps = 1/86 (1%)
 Frame = -2

Query: 763 RMARATDIPGIKQILQPLEEFGTLIRRTEVELL-EALDSFIVVEREGQIIACAALFPYLK 587
           R A+A DIP I +I Q   +  +  R   V L+  +  +F VV  + +IIA  +L  +  
Sbjct: 9   RQAKAGDIPAILEIEQECFQEDSFSREQFVYLICRSKGTFYVVVEQERIIAYVSLLFHAG 68

Query: 586 EKCGEVASIAVSPDCRGQGQGDKLLD 509
            +   + SIAV PDCRG+  G  L++
Sbjct: 69  TRYLRIYSIAVHPDCRGRKLGQLLME 94



>gb:CP000032_88020 Silicibacter pomeroyi DSS-3 plasmid megaplasmid,
           complete sequence.
          Length = 159

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 30/87 (34%), Positives = 46/87 (52%), Gaps = 2/87 (2%)
 Frame = -2

Query: 673 ELLEALDSFIVVEREGQIIACAALFPYLKEK-CGEVASIAVSPDCRGQGQGDKLLDYIEK 497
           ++++    F ++ R GQI A  AL    +    G V    V P CRGQG    LL  +E 
Sbjct: 50  QMMDEGAEFWLLTRAGQIAAVGALAEIDQTAGTGRVTLNYVDPACRGQGASAALLAGLEA 109

Query: 496 KASSHGIQKLFLLTTRTA-DWFIRRGF 419
           + S  GI++  L +T TA D+++ RG+
Sbjct: 110 RLSEQGIERGLLTSTATARDFYLSRGW 136



>gb:AE017333_447791 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_857598 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 164

 Score = 42.4 bits (98), Expect = 0.013
 Identities = 27/70 (38%), Positives = 39/70 (55%), Gaps = 4/70 (5%)
 Frame = -2

Query: 652 SFIVVEREGQIIACAALFPYLKEKCGE--VASIAVSPD--CRGQGQGDKLLDYIEKKASS 485
           S +V E +G+I+  A+L PY   +C    VA ++V  D  CRG+G G  LL  +EK A  
Sbjct: 54  SVLVAESKGEIVGWASLNPY-SHRCAYQGVADLSVYVDRACRGKGIGGLLLQALEKTAKE 112

Query: 484 HGIQKLFLLT 455
           +   K+ L T
Sbjct: 113 NSFYKIVLFT 122



>gb:AE015533_315292 Shewanella oneidensis MR-1 section 82 of 457 of
           the complete genome.>gb:AE014299_950889 Shewanella
           oneidensis MR-1 complete genome.
          Length = 169

 Score = 42.4 bits (98), Expect = 0.013
 Identities = 35/98 (35%), Positives = 45/98 (45%), Gaps = 7/98 (7%)
 Frame = -2

Query: 700 GTLIRRTEVELLEALDS-----FIVVEREGQIIACAALFPY--LKEKCGEVASIAVSPDC 542
           G LI  TE EL E         F V E+   +     +     L E   +V ++ VSPD 
Sbjct: 34  GDLIIWTEGELTEQFSRIVDAHFYVAEQSNNVPPLKRVIGMVMLDEPYAQVEALFVSPDA 93

Query: 541 RGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIR 428
            G G G  LL +IE KA + GI +L L +T  A  F R
Sbjct: 94  MGLGVGKSLLQFIETKAFNLGIAQLRLESTLNAVGFYR 131



>sp|P26945|IAAT_AZOBR IAA acetyltransferase (EC
           2.3.1.-).>pir|S17706|S17706 acetyl transferase -
           Azospirillum brasilense>gb:ABTRPGDC_18452 A.brasilense
           trpG, trpD, trpC gene.
          Length = 153

 Score = 42.4 bits (98), Expect = 0.013
 Identities = 28/84 (33%), Positives = 44/84 (52%), Gaps = 5/84 (5%)
 Frame = -2

Query: 649 FIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQK 470
           F+V  R G ++ C A+    +   GEV  + V P  RG   G +LL+ IE +A + G+  
Sbjct: 51  FLVARRSGTVVGCGAIAIDTEGGYGEVKRMFVQPTARGGQIGRRLLERIEDEARAAGLSA 110

Query: 469 LFLLT-----TRTADWFIRRGFSE 413
           L L T     TR A  + ++GF++
Sbjct: 111 LLLETGVYQATRIA-LYRKQGFAD 133



>gb:AE016811_338731 Vibrio vulnificus CMCP6 chromosome II section 4
           of 6 of the complete sequence.>gb:AE016796_1048455
           Vibrio vulnificus CMCP6 chromosome II complete sequence.
          Length = 178

 Score = 42.0 bits (97), Expect = 0.016
 Identities = 27/86 (31%), Positives = 43/86 (50%), Gaps = 7/86 (8%)
 Frame = -2

Query: 709 EEFGTLIRRTEVELLEAL---DSFIVVEREGQIIACAALFPYLKEKCGE----VASIAVS 551
           E  G LI +   +L+E     D FI +  EG+ +  A LF  L   CG     +A +AV+
Sbjct: 28  EAEGQLIGQLASDLIEQTHNDDLFIYIAAEGEAVVGAILFTRLHYPCGTPVFVMAPVAVA 87

Query: 550 PDCRGQGQGDKLLDYIEKKASSHGIQ 473
             C GQG G  L+ +  ++  + G++
Sbjct: 88  TSCHGQGIGQALIAFGLQEIKAQGVE 113



>pir|AF2171|AF2171 hypothetical protein alr2925 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_683914 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 160

 Score = 41.6 bits (96), Expect = 0.022
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 1/66 (1%)
 Frame = -2

Query: 649 FIVVEREGQIIACAALFPYLK-EKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQ 473
           F V+E + QI+   A +P  + EK  E+  + + P  RG G G  LL  +E   +S G Q
Sbjct: 59  FWVIEHQSQIVGTGAYYPVNRGEKAVEIRKMYLLPSVRGLGLGKYLLQQLEAAITSRGFQ 118

Query: 472 KLFLLT 455
           ++++ T
Sbjct: 119 EIWIET 124



>gb:AE017330_444737 Listeria monocytogenes str. 4b F2365, section 9
           of 10 of the complete genome.>gb:AE017262_1077093
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 178

 Score = 41.2 bits (95), Expect = 0.028
 Identities = 37/136 (27%), Positives = 63/136 (46%), Gaps = 21/136 (15%)
 Frame = -2

Query: 763 RMARATDIPGIKQIL----QPLEEFGTLIRRTEVELLEALDSFI-----VVEREGQIIAC 611
           R+A   D P   ++L    Q ++E G     T  +L    ++ +     V+ER G++I+ 
Sbjct: 7   RVATVDDAPEFLELLSSAFQSVKELGIDWPSTNADLAMVTENIVNSSAFVLERNGKLIST 66

Query: 610 AAL-FPYLKE----KCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRT 446
             + FP+       K   V   A +P+  GQG GDKLL Y+E++     ++   L    +
Sbjct: 67  ITVRFPWESSSPPSKYPFVWWFATAPELAGQGIGDKLLTYVEERVLRDTLKAPALTLGTS 126

Query: 445 A-------DWFIRRGF 419
           A       D ++RRG+
Sbjct: 127 ARKHPWLLDMYLRRGY 142



>pir|AF1368|AF1368 B. subtilis YtmI protein homolog lmo2350
           [imported] - Listeria monocytogenes (strain
           EGD-e)>gb:AL591983_536841 Listeria monocytogenes strain
           EGD, complete genome segment 11/12.
          Length = 178

 Score = 41.2 bits (95), Expect = 0.028
 Identities = 37/136 (27%), Positives = 63/136 (46%), Gaps = 21/136 (15%)
 Frame = -2

Query: 763 RMARATDIPGIKQIL----QPLEEFGTLIRRTEVELLEALDSFI-----VVEREGQIIAC 611
           R+A   D P   ++L    Q ++E G     T  +L    ++ +     V+ER G++I+ 
Sbjct: 7   RVATVDDAPEFLELLSSAFQSVKELGIDWPSTNADLAMVTENIVNSSAFVLERNGKLIST 66

Query: 610 AAL-FPYLKE----KCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRT 446
             + FP+       K   V   A +P+  GQG GDKLL Y+E++     ++   L    +
Sbjct: 67  ITVRFPWESSSPPSKYPFVWWFATAPELAGQGIGDKLLTYVEERVLRDTLKAPALTLGTS 126

Query: 445 A-------DWFIRRGF 419
           A       D ++RRG+
Sbjct: 127 ARKHPWLLDMYLRRGY 142



>gb:AF197953_1249990 Toxoplasma gondii histone acetyltransferase GCN5
            (GCN5) mRNA, complete cds.
          Length = 1169

 Score = 40.4 bits (93), Expect = 0.048
 Identities = 20/74 (27%), Positives = 41/74 (55%), Gaps = 1/74 (1%)
 Frame = -2

Query: 634  REGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLT 455
            ++G++I      PY +EK  E+A +AV+   + +G G +L++++++     GI+      
Sbjct: 852  KQGRVIGGVCFRPYFREKFAEIAFLAVTSTEQVKGYGTRLMNHLKEHVKKSGIEYFLTYA 911

Query: 454  TRTA-DWFIRRGFS 416
               A  +F ++GFS
Sbjct: 912  DNFAVGYFRKQGFS 925



>gb:AF155929_1245862 Toxoplasma gondii histone acetyltransferase
           GCN5 (GCN5) mRNA, complete cds.
          Length = 473

 Score = 40.4 bits (93), Expect = 0.048
 Identities = 20/74 (27%), Positives = 41/74 (55%), Gaps = 1/74 (1%)
 Frame = -2

Query: 634 REGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLT 455
           ++G++I      PY +EK  E+A +AV+   + +G G +L++++++     GI+      
Sbjct: 156 KQGRVIGGVCFRPYFREKFAEIAFLAVTSTEQVKGYGTRLMNHLKEHVKKSGIEYFLTYA 215

Query: 454 TRTA-DWFIRRGFS 416
              A  +F ++GFS
Sbjct: 216 DNFAVGYFRKQGFS 229



>pir|AG1737|AG1737 B. subtilis YtmI protein homolog lin2444
           [imported] - Listeria innocua (strain
           Clip11262)>gb:AL596172_539785 Listeria innocua Clip11262
           complete genome, segment 10/12.
          Length = 178

 Score = 40.4 bits (93), Expect = 0.048
 Identities = 38/145 (26%), Positives = 68/145 (46%), Gaps = 21/145 (14%)
 Frame = -2

Query: 790 VASDLYEGTRMARATDIPGIKQIL----QPLEEFGTLIRRTEVELLEALDSFI-----VV 638
           +A D++   R+A   D P   ++L    + ++E G     T  +L    ++ +     V+
Sbjct: 1   MAEDIF---RVATVEDAPEFLELLSSAFKSVKELGIDWPSTNADLAMVTENIVNSSAFVL 57

Query: 637 EREGQIIACAAL-FPYLKE----KCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQ 473
           ER G++I+   + FP+       K   V   A +P+  GQG GDKLL Y+E++     ++
Sbjct: 58  ERNGKLISTITVRFPWESSSPPSKYPFVWWFATAPELAGQGIGDKLLTYVEERVLRDTLK 117

Query: 472 KLFLLTTRTA-------DWFIRRGF 419
              L    +A       D ++RRG+
Sbjct: 118 APALTLGTSARKHPWLLDMYLRRGY 142



>gb:AY657259_2146269 Synthetic construct Peudomonas aeruginosa clone
           FLH043715.01F PA4863 gene, partial cds.
          Length = 151

 Score = 40.0 bits (92), Expect = 0.063
 Identities = 28/89 (31%), Positives = 45/89 (50%), Gaps = 6/89 (6%)
 Frame = -2

Query: 661 ALDSFIVVEREGQIIACAALFPYLKEKCGE--VASIAVSPDCRGQGQGDKLLDYIEKKAS 488
           A D  ++ E +GQ +         +E      V ++AV P+C+GQG G +LL+  E+ A+
Sbjct: 47  ASDRVLIAEHDGQPVGLLVT----RETADGFLVDNLAVLPECKGQGIGRQLLERAERDAT 102

Query: 487 SHGIQKLFLLT----TRTADWFIRRGFSE 413
           S G + L+L T    T     + R G+ E
Sbjct: 103 SLGYRSLYLYTNERMTENIALYARVGYLE 131



>gb:AE013386_291849 Methanosarcina mazei strain Goe1, section 168 of
           379 of the complete genome.>gb:AE008384_965958
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 156

 Score = 40.0 bits (92), Expect = 0.063
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 2/53 (3%)
 Frame = -2

Query: 655 DSFIVVEREGQIIACAALF--PYLKEKCGEVASIAVSPDCRGQGQGDKLLDYI 503
           + FI+ E  G+I  CAA     Y      E+ SIAV P+ RG+G G +L+DYI
Sbjct: 34  EDFILAEMGGKITGCAAPVRGTYGDRNFLEIHSIAVHPNFRGKGIGKRLIDYI 86



>gb:CR628337_114423 Legionella pneumophila str. Lens complete
           genome.
          Length = 319

 Score = 40.0 bits (92), Expect = 0.063
 Identities = 29/89 (32%), Positives = 42/89 (47%), Gaps = 4/89 (4%)
 Frame = -2

Query: 640 VEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFL 461
           V+ +G II    L   L    GEV    ++P  RG G   KL+  + K A  HG +KLFL
Sbjct: 206 VDEQGGIIGSIGL-KKLNHTEGEVKKFFIAPKYRGLGLAQKLMLTLVKNAMKHGFKKLFL 264

Query: 460 LTTRTAD----WFIRRGFSECSIDQLPVE 386
            T    +    ++ + GF   + + LP E
Sbjct: 265 GTVAQLNAARRFYEKNGFVLVNKNSLPKE 293



>pir|C83037|C83037 hypothetical protein PA4863 [imported] -
           Pseudomonas aeruginosa (strain PAO1)>gb:AE004900_59095
           Pseudomonas aeruginosa PAO1, section 461 of 529 of the
           complete genome.>gb:AE004091_973195 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 150

 Score = 40.0 bits (92), Expect = 0.063
 Identities = 28/89 (31%), Positives = 45/89 (50%), Gaps = 6/89 (6%)
 Frame = -2

Query: 661 ALDSFIVVEREGQIIACAALFPYLKEKCGE--VASIAVSPDCRGQGQGDKLLDYIEKKAS 488
           A D  ++ E +GQ +         +E      V ++AV P+C+GQG G +LL+  E+ A+
Sbjct: 47  ASDRVLIAEHDGQPVGLLVT----RETADGFLVDNLAVLPECKGQGIGRQLLERAERDAT 102

Query: 487 SHGIQKLFLLT----TRTADWFIRRGFSE 413
           S G + L+L T    T     + R G+ E
Sbjct: 103 SLGYRSLYLYTNERMTENIALYARVGYLE 131



>pir|C69996|C69996 hypothetical protein ytmI - Bacillus
           subtilis>gb:AF008220_468102 Bacillus subtilis rrnB-dnaB
           genomic region.>gb:BSUB0015_754904 Bacillus subtilis
           complete genome (section 15 of 21): from 2812801 to
           3013507.
          Length = 178

 Score = 40.0 bits (92), Expect = 0.063
 Identities = 33/91 (36%), Positives = 47/91 (51%), Gaps = 13/91 (14%)
 Frame = -2

Query: 652 SFIVVEREGQIIACAAL-FPYLKE----KCGEVASIAVSPDCRGQGQGDKLLDYIEKKAS 488
           S IV+ER+G++I+   + FP+  E    K   V   A  P+ +GQG G KLL Y+E+K  
Sbjct: 53  SAIVLERDGKLISTITIRFPWESETPPSKYPFVWWFATLPEYKGQGAGSKLLTYVEEKV- 111

Query: 487 SHGIQKLFLLTTRT--------ADWFIRRGF 419
              + K   LT  T        AD + RRG+
Sbjct: 112 LRDMLKAPALTLGTSARKHPWLADMYRRRGY 142



>gb:BA000045_741715 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 244

 Score = 39.7 bits (91), Expect = 0.082
 Identities = 26/75 (34%), Positives = 40/75 (53%), Gaps = 4/75 (5%)
 Frame = -2

Query: 631 EGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFL--- 461
           +G I ACA + P   +    VASIAV    +G+G G ++L  +E++A + G+  L +   
Sbjct: 65  DGPIAACARIAPE-NDGAWYVASIAVDTAQQGKGTGREILAEVERQARAAGVPALRITVI 123

Query: 460 -LTTRTADWFIRRGF 419
            L      W+ RRGF
Sbjct: 124 NLRHELIAWYERRGF 138



>gb:BX569689_774982 Synechococcus sp. WH8102 complete genome;
           segment 1/7.
          Length = 179

 Score = 39.3 bits (90), Expect = 0.11
 Identities = 18/61 (29%), Positives = 38/61 (62%)
 Frame = -2

Query: 562 IAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVER 383
           I V+ D +G+G G ++++ +    S  G+++++L+TT +A ++ + GF +    QL V +
Sbjct: 119 IVVAGDLQGRGFGRRIVEELLHTPSVAGVERIYLMTTNSAGFYRQLGFRDADPQQLLVLK 178

Query: 382 R 380
           R
Sbjct: 179 R 179



>gb:SCO939107_174766 Streptomyces coelicolor A3(2) complete genome;
           segment 4/29.
          Length = 179

 Score = 39.3 bits (90), Expect = 0.11
 Identities = 30/95 (31%), Positives = 51/95 (53%), Gaps = 9/95 (9%)
 Frame = -2

Query: 676 VELLEALDS-FIVVEREGQIIACAALFPYLKEKCGEVA---SIAVSPDCRGQGQGDKLLD 509
           +E+++A DS  + VER+G+I+AC  L     E  G  A     AVSP  +G G G  ++ 
Sbjct: 56  LEVVKAPDSRLLTVERDGRIVACCQL-----EHRGAHAYFGMFAVSPALQGAGLGKAIIA 110

Query: 508 YIEKKA-SSHGIQKLFLLTTRTAD----WFIRRGF 419
             E++A ++ G+ ++ +      D    W+ RRG+
Sbjct: 111 EAERQARTTWGVTEMHMTVISVRDDLIAWYERRGY 145



>gb:AP006840_570069 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 293

 Score = 38.9 bits (89), Expect = 0.14
 Identities = 17/31 (54%), Positives = 22/31 (70%)
 Frame = -2

Query: 880 GGVQRVHLLDGTIGGVLFKELFQRDGVGTMV 788
           GGV RVH++DG +   L  E+F  +GVGTMV
Sbjct: 261 GGVNRVHIIDGRVPHSLLLEIFTDEGVGTMV 291



>gb:AE017354_459582 Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1, complete genome.
          Length = 323

 Score = 38.9 bits (89), Expect = 0.14
 Identities = 28/89 (31%), Positives = 42/89 (47%), Gaps = 4/89 (4%)
 Frame = -2

Query: 640 VEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFL 461
           V+ +G II    L   L    GEV    ++P  RG G   KL+  + + A  HG +KLFL
Sbjct: 210 VDEQGGIIGSIGL-KKLNHTEGEVKKFFIAPKYRGLGLAQKLMLTLVRNAMKHGFKKLFL 268

Query: 460 LTTRTAD----WFIRRGFSECSIDQLPVE 386
            T    +    ++ + GF   + + LP E
Sbjct: 269 GTVAQLNAARRFYEKNGFVLVNKNSLPKE 297



>gb:AE017166_396257 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 6 of 6 of the complete
           genome.>gb:AE017126_1031926 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 153

 Score = 38.9 bits (89), Expect = 0.14
 Identities = 15/59 (25%), Positives = 36/59 (61%)
 Frame = -2

Query: 562 IAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVE 386
           I V+ D +G G G K+++ +  +    G+++++L+TT +++++ + GF  C    L ++
Sbjct: 91  IVVADDLQGLGLGKKVVEALLSRPCIKGVERIYLMTTNSSEFYKQFGFENCHHQSLLIK 149



>gb:CR628336_111329 Legionella pneumophila str. Paris complete
           genome.
          Length = 319

 Score = 38.9 bits (89), Expect = 0.14
 Identities = 28/89 (31%), Positives = 42/89 (47%), Gaps = 4/89 (4%)
 Frame = -2

Query: 640 VEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFL 461
           V+ +G II    L   L    GEV    ++P  RG G   KL+  + + A  HG +KLFL
Sbjct: 206 VDEQGGIIGSIGL-KKLNHTEGEVKKFFIAPKYRGLGLAQKLMLTLVRSAMKHGFKKLFL 264

Query: 460 LTTRTAD----WFIRRGFSECSIDQLPVE 386
            T    +    ++ + GF   + + LP E
Sbjct: 265 GTVAQLNAARRFYEKNGFVLVNKNSLPKE 293



>gb:AP006840_569162 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 147

 Score = 38.5 bits (88), Expect = 0.18
 Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 4/87 (4%)
 Frame = -2

Query: 673 ELLEALDS----FIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDY 506
           E L+ LD      + ++  G+ +A   + PY  E  G++  IAV P+ RGQG G  ++  
Sbjct: 35  EELDGLDHTAAHVLALDPAGRPVATGRIIPY-GEGTGKLQRIAVLPEFRGQGYGRAVVGA 93

Query: 505 IEKKASSHGIQKLFLLTTRTADWFIRR 425
           +E+   + G ++  L     A+ F RR
Sbjct: 94  LEEMGRAMGFRRFVLGAQTHAEPFYRR 120



>gb:AE010151_259834 Pyrococcus furiosus DSM 3638, section 26 of 173
           of the complete genome.>gb:AE009950_900615 Pyrococcus
           furiosus DSM 3638, complete genome.
          Length = 170

 Score = 38.5 bits (88), Expect = 0.18
 Identities = 35/97 (36%), Positives = 48/97 (49%), Gaps = 2/97 (2%)
 Frame = -2

Query: 763 RMARATDIPGIKQILQPLEEFGTLIRRTEVELLEAL-DSFIVVEREGQIIACAALFPYLK 587
           R A+  DIP I +I Q +       R   +  LEA  D+F+V E  G+I+    +  YL+
Sbjct: 21  RPAKLFDIPYIMRIEQ-MSFKEAYPRGLFLTFLEANPDTFLVAEYNGKIVGY--VMGYLR 77

Query: 586 EKC-GEVASIAVSPDCRGQGQGDKLLDYIEKKASSHG 479
               G + SIAV PD RG G G  L+  + KK    G
Sbjct: 78  PDMEGHIMSIAVHPDYRGNGIGKALMIAVIKKLFEKG 114



>gb:CP000025_878052 Campylobacter jejuni RM1221, complete genome.
          Length = 279

 Score = 38.1 bits (87), Expect = 0.24
 Identities = 16/41 (39%), Positives = 25/41 (60%)
 Frame = -2

Query: 910 ELAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMV 788
           +L +    C  GV++VH+LDG +   L  E F  +G+GT+V
Sbjct: 238 KLKSCIDACENGVKKVHILDGRVKHSLLLEFFTDEGIGTLV 278



>gb:CP000001_852070 Bacillus cereus ZK, complete genome.
          Length = 155

 Score = 38.1 bits (87), Expect = 0.24
 Identities = 21/59 (35%), Positives = 34/59 (57%)
 Frame = -2

Query: 643 VVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKL 467
           V ++EG++I    L    + K  E+ +IAV    +G+G G KLL++  + A  HG+ KL
Sbjct: 39  VAKQEGRVIGVYVLLE-TRPKTMEIMNIAVVEHLQGKGIGKKLLEHAVETAKEHGMSKL 96



>gb:BA000043_737440 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 144

 Score = 38.1 bits (87), Expect = 0.24
 Identities = 23/77 (29%), Positives = 39/77 (50%)
 Frame = -2

Query: 655 DSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGI 476
           DSF +V  +GQ    A    ++ E  G++  I V P  RG+G G  +++ IE+ A + G 
Sbjct: 43  DSFHLVLYDGQTPVGAGRLRFIDEGVGKIERICVLPSYRGRGAGRMVMEAIEQLAKTKGA 102

Query: 475 QKLFLLTTRTADWFIRR 425
           +   L     A+ F ++
Sbjct: 103 KTAKLNAQTHAEPFYQK 119



>gb:BA000012_670286 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 158

 Score = 38.1 bits (87), Expect = 0.24
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 6/80 (7%)
 Frame = -2

Query: 628 GQIIACAALFPYLKEKCGE--VASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLT 455
           G I+ C     + +E+  +  V  +AV+PD +G+G G +L+  +E+ A  HG   L L T
Sbjct: 63  GSIVGCV----FAQERADDFYVGKLAVAPDRQGRGIGRRLMQVVERLALDHGKAVLELQT 118

Query: 454 ----TRTADWFIRRGFSECS 407
               T     F R GF E S
Sbjct: 119 RIELTGNHATFARLGFHETS 138



>gb:BA000012_666506 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 151

 Score = 38.1 bits (87), Expect = 0.24
 Identities = 29/94 (30%), Positives = 45/94 (47%), Gaps = 5/94 (5%)
 Frame = -2

Query: 676 VELLEALDSFIVVEREGQI-IACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIE 500
           VE +   D+ + + R+  I + C AL  +     GEV  +   P  RGQ  G  +++ +E
Sbjct: 40  VEQMAGQDTTVFIARDNGIAVGCGALKRH-GGAIGEVKRMYTRPSHRGQKIGASIVERVE 98

Query: 499 KKASSHGIQKLFLLT--TRTADWFI--RRGFSEC 410
             A   G+++L L T     A W +  R GFS C
Sbjct: 99  ALARQEGLKRLVLETGDRHPAAWTVYERAGFSRC 132



>gb:AF093219_478641 Campylobacter jejuni N-acetyl-glutamyl-phosphate
           reductase (argC), streptothricin acetyltransferase
           homolog (sat), N-acetylglutamate kinase (argB), and
           acetylornithine delta-aminotransferase (argD) genes,
           complete cds.
          Length = 279

 Score = 38.1 bits (87), Expect = 0.24
 Identities = 16/41 (39%), Positives = 25/41 (60%)
 Frame = -2

Query: 910 ELAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMV 788
           +L +    C  GV++VH+LDG +   L  E F  +G+GT+V
Sbjct: 238 KLKSCIDACENGVKKVHILDGRVKHSLLLEFFTDEGIGTLV 278



>gb:AE017029_381774 Bacillus anthracis str. Ames section 6 of 18 of
           the complete genome.>gb:AE017225_406877 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_451622 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE016879_1011479 Bacillus
           anthracis str. Ames complete genome.
          Length = 155

 Score = 38.1 bits (87), Expect = 0.24
 Identities = 21/59 (35%), Positives = 34/59 (57%)
 Frame = -2

Query: 643 VVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKL 467
           V ++EG++I    L    + K  E+ +IAV    +G+G G KLL++  + A  HG+ KL
Sbjct: 39  VAKQEGRVIGVYVLLE-TRPKTMEIMNIAVVEHLQGKGIGKKLLEHAVETAKEHGMSKL 96



>gb:AE013045_288464 Thermoanaerobacter tengcongensis MB4, section 72
           of 244 of the complete genome.>gb:AE008691_1110529
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 181

 Score = 38.1 bits (87), Expect = 0.24
 Identities = 43/160 (26%), Positives = 65/160 (40%), Gaps = 21/160 (13%)
 Frame = -2

Query: 763 RMARATDIPGIKQILQPLEEFGTLI--------RRTEVELLEALDS----FIVVEREGQI 620
           R A+  D  GI ++L  + +    I           E +L++ LD      +V +  G+I
Sbjct: 20  REAKVKDAKGIVKLLNSIGKEKVYIVSESFNWTEEEERQLIKNLDRTKDLILVADYGGEI 79

Query: 619 IACAALFPYL---KEKCGEVASIAVSPDC--RGQGQGDKLLDYIEKKASSHGIQKLFLLT 455
           + C  LF Y      K   +  I +S D   R +G G +L +   K A S G +KL L  
Sbjct: 80  VGCLTLFRYYGGRSPKVQHIGEIGISVDARFRNRGIGTRLFEEAIKWAKSRGYEKLCLSV 139

Query: 454 TRTADWFI----RRGFSECSIDQLPVERRKKINLSRGSKY 347
             T +  I    + GF E        E R+K     G +Y
Sbjct: 140 FSTNEVAIHLYKKFGFIE--------EGRRKKQFKIGDEY 171



>gb:SME591787_185450 Sinorhizobium meliloti 1021 complete
           chromosome; segment 6/12.
          Length = 156

 Score = 38.1 bits (87), Expect = 0.24
 Identities = 21/66 (31%), Positives = 33/66 (50%)
 Frame = -2

Query: 652 SFIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQ 473
           SF V  R+G+++ C  L     +   E+  + V P+ RG   G  LL  +E KA+  G+ 
Sbjct: 50  SFFVARRDGEVVGCCGLVE-AGDGTAEIKRMFVDPEARGLKLGKLLLSVLEAKAAKLGLT 108

Query: 472 KLFLLT 455
            + L T
Sbjct: 109 AIRLET 114



>pir|E97249|E97249 probable acetyltransferase [imported] -
           Clostridium acetobutylicum>gb:AE007781_230145
           Clostridium acetobutylicum ATCC 824 section 269 of 356
           of the complete genome.>gb:AE001437_1093100 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 146

 Score = 38.1 bits (87), Expect = 0.24
 Identities = 24/96 (25%), Positives = 44/96 (45%), Gaps = 4/96 (4%)
 Frame = -2

Query: 679 EVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIE 500
           E EL      ++V++    ++    L+  + E  G + +IAV P+ RG G G+K+L+ + 
Sbjct: 35  EGELRNKFAKYVVIKNNNLVVGYGGLWLIIDE--GHITNIAVHPEFRGMGIGNKILEELI 92

Query: 499 KKASSHGIQKLFL----LTTRTADWFIRRGFSECSI 404
           K      I  + L      T   + + + GF E  +
Sbjct: 93  KLCEKRNIPSMTLEVRISNTIAQNLYKKFGFKEAGV 128



>sp|Q9PIR8|ARGB_CAMJE Acetylglutamate kinase (EC 2.7.2.8) (NAG
           kinase) (AGK) (N-acetyl-L- glutamate
           5-phosphotransferase).>pir|B81440|B81440 acetylglutamate
           kinase (EC 2.7.2.8) Cj0226 [imported] - Campylobacter
           jejuni (strain NCTC 11168)>gb:CJ11168X1_846634
           Campylobacter jejuni subsp. jejuni NCTC 11168 complete
           genome; segment 1/6.
          Length = 281

 Score = 38.1 bits (87), Expect = 0.24
 Identities = 16/41 (39%), Positives = 25/41 (60%)
 Frame = -2

Query: 910 ELAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMV 788
           +L +    C  GV++VH+LDG +   L  E F  +G+GT+V
Sbjct: 240 KLKSCIDACENGVKKVHILDGRVKHSLLLEFFTDEGIGTLV 280



>gb:BA000038_725616 Vibrio vulnificus YJ016 DNA, chromosome II,
           complete sequence.
          Length = 214

 Score = 37.7 bits (86), Expect = 0.31
 Identities = 26/86 (30%), Positives = 42/86 (48%), Gaps = 7/86 (8%)
 Frame = -2

Query: 709 EEFGTLIRRTEVELLEAL---DSFIVVEREGQIIACAALFPYLKEKCGE----VASIAVS 551
           E  G LI +   +L+E     D FI +  EG+ +  A LF  L   CG     +A +AV+
Sbjct: 64  EAEGQLIGQLASDLIEQTHNDDLFIYIAAEGEAVVGAILFTRLHYPCGTPVFVMAPVAVA 123

Query: 550 PDCRGQGQGDKLLDYIEKKASSHGIQ 473
               GQG G  L+ +  ++  + G++
Sbjct: 124 TSYHGQGIGQALIAFGLQEIKAQGVE 149



>gb:BA000016_674409 Clostridium perfringens str. 13 DNA, complete
           genome.
          Length = 167

 Score = 37.7 bits (86), Expect = 0.31
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 11/61 (18%)
 Frame = -2

Query: 640 VEREGQIIACAALFPYLKEKCGEVA-----------SIAVSPDCRGQGQGDKLLDYIEKK 494
           +E  G+I+A A +  Y  +   ++A            IAVSP  RG+G G K++D++E+ 
Sbjct: 55  IEASGEIVAVATINDYAYDVYNDIAWQVDGPFLSFHRIAVSPSHRGKGYGRKMIDFVEEM 114

Query: 493 A 491
           A
Sbjct: 115 A 115



>gb:AY509864_623820 Corynebacterium crenatum
           N-acetylglutamate-5-semialdehyde dehydrogenase (argC)
           gene, partial sequence; ornithine acetyltransferase
           (argJ), ArgB (argB), N-acetylornithine aminotransferase
           (argD), and ornithine carbamoyltransferase (argF) genes,
           complete cds; and argR gene, complete
           sequence.>gb:BX927152_832976 Corynebacterium glutamicum
           ATCC 13032, IS fingerprint type 4-5, complete genome;
           segment 5/10.>gb:AX064037_1458932 Sequence 319 from
           Patent WO0100843.>gb:AX764273_1474539 Sequence 85 from
           Patent WO03040681.
          Length = 317

 Score = 37.7 bits (86), Expect = 0.31
 Identities = 16/38 (42%), Positives = 23/38 (60%)
 Frame = -2

Query: 883 RGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYE 770
           RGGV   H++DG I   +  EL    G+GTMV  D+++
Sbjct: 261 RGGVSAAHVIDGRIAHSVLLELLTMGGIGTMVLPDVFD 298



>sp|Q8PXJ8|ARGB_METMA Acetylglutamate kinase (EC 2.7.2.8) (NAG
           kinase) (AGK) (N-acetyl-L- glutamate
           5-phosphotransferase).>gb:AE013352_291550 Methanosarcina
           mazei strain Goe1, section 134 of 379 of the complete
           genome.>gb:AE008384_965659 Methanosarcina mazei strain
           Goe1, complete genome.
          Length = 292

 Score = 37.7 bits (86), Expect = 0.31
 Identities = 15/41 (36%), Positives = 26/41 (63%)
 Frame = -2

Query: 910 ELAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMV 788
           ++  AA   + GV+R H+++G++   +  ELF   GVGTM+
Sbjct: 251 KIKGAAVAVKSGVERAHIINGSVSHSMLLELFTDGGVGTMI 291



>sp|Q59281|ARGB_CORGL Acetylglutamate kinase (EC 2.7.2.8) (NAG
           kinase) (AGK) (N-acetyl-L- glutamate
           5-phosphotransferase).>gb:AF049897_473174
           Corynebacterium glutamicum N-acetylglutamylphosphate
           reductase (argC), ornithine acetyltransferase (argJ),
           N-acetylglutamate kinase (argB), acetylornithine
           transaminase (argD), ornithine carbamoyltransferase
           (argF), arginine repressor (argR), argininosuccinate
           synthase (argG), and argininosuccinate lyase (argH)
           genes, complete cds.>gb:BA000036_719123 Corynebacterium
           glutamicum ATCC 13032 DNA, complete
           genome.>gb:CGARGCJBD_846047 C.glutamicum argC, argJ,
           argB, argD, and argF genes.
          Length = 294

 Score = 37.7 bits (86), Expect = 0.31
 Identities = 16/38 (42%), Positives = 23/38 (60%)
 Frame = -2

Query: 883 RGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYE 770
           RGGV   H++DG I   +  EL    G+GTMV  D+++
Sbjct: 238 RGGVSAAHVIDGRIAHSVLLELLTMGGIGTMVLPDVFD 275



>gb:BA000045_742758 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 173

 Score = 37.4 bits (85), Expect = 0.41
 Identities = 26/91 (28%), Positives = 47/91 (51%), Gaps = 7/91 (7%)
 Frame = -2

Query: 664 EALDSFIVVEREGQIIACAALFPY-LKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKAS 488
           +A D F +   +G  +A A   P  + +    +  IAV PD +GQG+G  LL ++E+  +
Sbjct: 54  DASDDFWLTSDDGGPVAVAYYAPERMTQGTWNLLLIAVDPDRQGQGRGSALLCHVEQALA 113

Query: 487 SHGIQKLFLLTT------RTADWFIRRGFSE 413
           + G + L + T+      RT  ++ + G+ E
Sbjct: 114 ARGERVLLVETSGLPSFARTRAFYQKCGYEE 144



>gb:AE017297_434878 Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130, chromosome I, section 11 of 14 of the
           complete sequence.>gb:AE016823_1067889 Leptospira
           interrogans serovar Copenhageni str. Fiocruz L1-130,
           chromosome I, complete sequence.
          Length = 142

 Score = 37.4 bits (85), Expect = 0.41
 Identities = 25/81 (30%), Positives = 41/81 (50%)
 Frame = -2

Query: 661 ALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSH 482
           +L +FI+ + +  II    L  +  ++   + S+ V    R +G G  L + I   A S 
Sbjct: 39  SLKNFIIAKYQNNIIGNIGLEIF--DEFALIRSLCVEEAYRKEGIGISLYENILTYAQSK 96

Query: 481 GIQKLFLLTTRTADWFIRRGF 419
           GI++L+LLTT    +F   GF
Sbjct: 97  GIKELYLLTTTAESFFSHLGF 117



>gb:AE013024_288238 Thermoanaerobacter tengcongensis MB4, section 51
           of 244 of the complete genome.>gb:AE008691_1110303
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 149

 Score = 37.4 bits (85), Expect = 0.41
 Identities = 20/63 (31%), Positives = 36/63 (57%)
 Frame = -2

Query: 649 FIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQK 470
           +IV E + +++  A  +  L E  G + +IAV P+ RG+G G +L++ +   A  +GI  
Sbjct: 46  YIVAEVDKKVVGYAGFWVVLDE--GHITNIAVHPEYRGKGIGSRLMEGLIDLAKKNGITS 103

Query: 469 LFL 461
           + L
Sbjct: 104 MTL 106



>sp|Q60382|ARGB_METJA Probable acetylglutamate kinase (EC 2.7.2.8)
           (NAG kinase) (AGK) (N- acetyl-L-glutamate
           5-phosphotransferase).>pir|E64308|E64308 acetylglutamate
           kinase (EC 2.7.2.8) - Methanococcus
           jannaschii>gb:U67464_206155 Methanocaldococcus
           jannaschii DSM 2661 section 6 of 150 of the complete
           genome.>gb:L77117_1098913 Methanocaldococcus jannaschii
           DSM 2661, complete genome.
          Length = 300

 Score = 37.4 bits (85), Expect = 0.41
 Identities = 15/41 (36%), Positives = 25/41 (60%)
 Frame = -2

Query: 901 AAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASD 779
           +A +    GV+ VH+++G I   L  E+F  +G+GTM+  D
Sbjct: 260 SALYALEHGVKSVHIINGKIPHALLLEIFTEEGIGTMITRD 300



>sp|P59297|ARGB_CHLTE Acetylglutamate kinase (EC 2.7.2.8) (NAG
           kinase) (AGK) (N-acetyl-L- glutamate
           5-phosphotransferase).>gb:AE012873_286586 Chlorobium
           tepidum TLS section 94 of 194 of the complete
           genome.>gb:AE006470_933754 Chlorobium tepidum TLS
           complete genome.
          Length = 285

 Score = 37.4 bits (85), Expect = 0.41
 Identities = 17/35 (48%), Positives = 23/35 (65%)
 Frame = -2

Query: 880 GGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDL 776
           GGV +VHL+DG I   L  E+F  +GVGT   ++L
Sbjct: 240 GGVGKVHLIDGQITHSLLLEVFTNEGVGTQFVNEL 274



>gb:AY875982_1354720 Toxoplasma gondii GNAT family histone
           acetyltransferase GCN5-B (HAT) mRNA, complete cds.
          Length = 1032

 Score = 37.0 bits (84), Expect = 0.53
 Identities = 19/77 (24%), Positives = 41/77 (53%), Gaps = 1/77 (1%)
 Frame = -2

Query: 640 VEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFL 461
           + +E  II      PY ++K  E+A +AV+   + +G G +L++++++     GI+    
Sbjct: 681 LNKEDTIIGGCCFRPYFQQKFAEIAFLAVTSTEQVKGYGTRLMNHLKEHVKKSGIEYFLT 740

Query: 460 LTTRTA-DWFIRRGFSE 413
                A  +F ++GF++
Sbjct: 741 YADNFAVGYFRKQGFTQ 757



>gb:BA000035_716311 Corynebacterium efficiens YS-314 DNA, complete
           genome.
          Length = 317

 Score = 37.0 bits (84), Expect = 0.53
 Identities = 17/37 (45%), Positives = 21/37 (56%)
 Frame = -2

Query: 883 RGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLY 773
           RGGV   H++DG I   +  EL    G+GTMV  D Y
Sbjct: 261 RGGVNAAHVIDGRIAHSVLLELLTMGGIGTMVLPDNY 297



>gb:AP006878_576206 Thermococcus kodakaraensis strain KOD1 DNA,
           complete genome.
          Length = 177

 Score = 37.0 bits (84), Expect = 0.53
 Identities = 31/124 (25%), Positives = 53/124 (42%), Gaps = 15/124 (12%)
 Frame = -2

Query: 745 DIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLK------- 587
           D  G K++ +P  EF     R   E  E    +++ + +G+I    AL   L+       
Sbjct: 45  DFDGFKKVYEPFLEF-----RLGKEFDEL---YVLRDNDGKIAGTVALVYNLEGKDVWWV 96

Query: 586 ------EKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLL--TTRTADWFI 431
                 EK G +    V PD +G+G G KLL +  ++  + G     +        ++++
Sbjct: 97  PEEIKDEKTGLIEFFMVHPDYKGKGYGSKLLGFAIERLKNLGKDPYIITFPNLEAYEYYL 156

Query: 430 RRGF 419
           RRGF
Sbjct: 157 RRGF 160



>pir|F87496|F87496 acetyltransferase, GNAT family [imported] -
           Caulobacter crescentus>gb:AE005873_213133 Caulobacter
           crescentus CB15 section 199 of 359 of the complete
           genome.>gb:AE005673_923032 Caulobacter crescentus CB15
           complete genome.
          Length = 156

 Score = 37.0 bits (84), Expect = 0.53
 Identities = 24/81 (29%), Positives = 39/81 (48%), Gaps = 7/81 (8%)
 Frame = -2

Query: 631 EGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTT 452
           +G  +A       L +  GE+ S+  +   RG+G G  +LD++   A + G+Q+L  L T
Sbjct: 58  DGDALAGFGAVKQLGDGHGEIKSMHTAAAYRGRGVGQAVLDHLSTHARALGLQRL-SLET 116

Query: 451 RTADWFI-------RRGFSEC 410
              D+F+       R GF  C
Sbjct: 117 GAGDFFVPARAMYARNGFQTC 137



>sp|Q7M7Q9|ARGB_WOLSU Acetylglutamate kinase (EC 2.7.2.8) (NAG
           kinase) (AGK) (N-acetyl-L- glutamate
           5-phosphotransferase).>gb:BX571662_779390 Wolinella
           succinogenes, complete genome; segment 6/7.
          Length = 284

 Score = 37.0 bits (84), Expect = 0.53
 Identities = 14/35 (40%), Positives = 23/35 (65%)
 Frame = -2

Query: 883 RGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASD 779
           +GGV++ H++DG +   L  ELF  +G+GT +  D
Sbjct: 250 KGGVEKAHIIDGRVEHSLLLELFTSEGIGTEILRD 284



>sp|Q9X2A4|ARGB_THEMA Acetylglutamate kinase (EC 2.7.2.8) (NAG
           kinase) (AGK) (N-acetyl-L- glutamate
           5-phosphotransferase).>pir|C72211|C72211 acetylglutamate
           kinase - Thermotoga maritima (strain
           MSB8)>gb:AE001816_39675 Thermotoga maritima MSB8 section
           128 of 136 of the complete genome.>gb:AE000512_1114148
           Thermotoga maritima MSB8, complete genome.
          Length = 282

 Score = 37.0 bits (84), Expect = 0.53
 Identities = 15/41 (36%), Positives = 25/41 (60%)
 Frame = -2

Query: 910 ELAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMV 788
           ++  A    RGGV  VH+++G +   +  E+F R G+GTM+
Sbjct: 237 KVECAVSAVRGGVGAVHIINGGLEHAILLEIFSRKGIGTMI 277



>sp|Q8FTN3|ARGB_COREF Acetylglutamate kinase (EC 2.7.2.8) (NAG
           kinase) (AGK) (N-acetyl-L- glutamate
           5-phosphotransferase).
          Length = 302

 Score = 37.0 bits (84), Expect = 0.53
 Identities = 17/37 (45%), Positives = 21/37 (56%)
 Frame = -2

Query: 883 RGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLY 773
           RGGV   H++DG I   +  EL    G+GTMV  D Y
Sbjct: 246 RGGVNAAHVIDGRIAHSVLLELLTMGGIGTMVLPDNY 282



>gb:AE016959_1022577 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017094_1752396
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 48 of 77 of the complete sequence.
          Length = 583

 Score = 36.6 bits (83), Expect = 0.69
 Identities = 21/86 (24%), Positives = 48/86 (55%), Gaps = 3/86 (3%)
 Frame = -2

Query: 646 IVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKA-SSHGIQK 470
           ++V R   ++      PY  +K GE+A  A++ D + +G G +L++++++ A  + G+  
Sbjct: 209 MMVIRNNIVVGGITYRPYTSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDADGLTH 268

Query: 469 LFLLTTRTA-DWFIRRGFS-ECSIDQ 398
                   A  +F+++GF+ E ++D+
Sbjct: 269 FLTYADNNAVGYFVKQGFTKEITLDK 294



>gb:BA000023_692588 Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 725

 Score = 36.6 bits (83), Expect = 0.69
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 3/73 (4%)
 Frame = -2

Query: 625 QIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKL---FLLT 455
           +II    L  + K K   +  IAV P+ +G+G G KLL +I+  A S+ +  L   F+L 
Sbjct: 491 RIIKYERLKEFGKLKGWRIIRIAVLPELQGKGLGSKLLSHIKGDAISNNLDWLGSSFILD 550

Query: 454 TRTADWFIRRGFS 416
            R  +++++  F+
Sbjct: 551 IRVLNFWVKNDFT 563



>gb:AP006618_558333 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 303

 Score = 36.6 bits (83), Expect = 0.69
 Identities = 16/41 (39%), Positives = 24/41 (58%)
 Frame = -2

Query: 910 ELAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMV 788
           ++ A     RGGV   H++DG +   +  ELF  +G+GTMV
Sbjct: 251 KMEACLRAVRGGVPTAHVIDGRVPHAVLLELFTGEGIGTMV 291



>gb:AE016947_364371 Enterococcus faecalis V583, section 1 of 11 of
           the complete genome.>gb:AE016830_990859 Enterococcus
           faecalis V583, complete genome.
          Length = 163

 Score = 36.6 bits (83), Expect = 0.69
 Identities = 22/46 (47%), Positives = 24/46 (52%)
 Frame = -2

Query: 565 SIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIR 428
           SI VSPD + QG G  LL YI+  A   GI KL L    T    IR
Sbjct: 83  SIGVSPDFQDQGIGGSLLSYIKDMAEISGIHKLSLRVMATNQEAIR 128



>pir|T02518|T02518 hypothetical protein At2g37520 [imported] -
            Arabidopsis thaliana>gb:AC004684_1532062 Arabidopsis
            thaliana chromosome 2 clone F13M22 map ve018, complete
            sequence.>gb:AC005896_1533167 Arabidopsis thaliana
            chromosome 2 clone F3G5 map ve018, complete sequence.
          Length = 825

 Score = 36.6 bits (83), Expect = 0.69
 Identities = 28/108 (25%), Positives = 53/108 (49%), Gaps = 4/108 (3%)
 Frame = -2

Query: 622  IIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTA 443
            ++  AAL     ++  E+  +A S + +G+G    L   +E   SS  ++ L L     A
Sbjct: 712  LVVSAALLRIFGQEVAELPIVATSREYQGRGYFQGLYACVENLLSSLNVENLVLPAAEEA 771

Query: 442  D--WFIRRGFSECSIDQLPVERRKKINLS--RGSKYYMKKLQPDRSGI 311
            +  W  + GF++ S  QL  E +K++ L+  +G+    KK+    +G+
Sbjct: 772  ESIWTKKFGFTKMSDQQLQ-EYQKEVQLTIFKGTSMLEKKVPKATTGL 818



>pir|F82277|F82277 citrate (pro-3S)-lyase ligase VC0796 [imported] -
           Vibrio cholerae (strain N16961 serogroup
           O1)>gb:AE004165_51190 Vibrio cholerae O1 biovar eltor
           str. N16961 chromosome I, section 73 of 251 of the
           complete chromosome.>gb:AE003852_1051964 Vibrio cholerae
           O1 biovar eltor str. N16961 chromosome I, complete
           chromosome.
          Length = 356

 Score = 36.6 bits (83), Expect = 0.69
 Identities = 37/124 (29%), Positives = 55/124 (44%), Gaps = 2/124 (1%)
 Frame = -2

Query: 658 LDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHG 479
           ++ F+V     QIIAC  +  ++      + SIAVSP  +G G   KL+  +   A   G
Sbjct: 41  VEHFVVAYGTNQIIACGGIAGHV------LKSIAVSPALQGTGFALKLMTELTNFAYEMG 94

Query: 478 IQKLFLLT-TRTADWFIRRGFSECSIDQLPVERRKKINLSRGSKYYMKKLQ-PDRSGIRF 305
              LFL T     D F + GF    +D++        N       Y K+LQ    SG + 
Sbjct: 95  RFSLFLFTKPANIDLFRQCGF--FLVDKVEPHIALLENSPNRLSVYCKQLQLLKMSGRKI 152

Query: 304 GSVI 293
           GS++
Sbjct: 153 GSIV 156



>sp|Q8R7C0|ARGB_THETN Acetylglutamate kinase (EC 2.7.2.8) (NAG
           kinase) (AGK) (N-acetyl-L- glutamate
           5-phosphotransferase).>gb:AE013191_290051
           Thermoanaerobacter tengcongensis MB4, section 218 of 244
           of the complete genome.>gb:AE008691_1112116
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 299

 Score = 36.6 bits (83), Expect = 0.69
 Identities = 13/36 (36%), Positives = 24/36 (66%)
 Frame = -2

Query: 877 GVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYE 770
           GV+R H++DG +   L  E+F  +G+GTM+  + ++
Sbjct: 260 GVKRAHIIDGRLTHSLLLEIFTDEGIGTMIGKECFD 295



>sp|Q8THJ9|ARGB_METAC Acetylglutamate kinase (EC 2.7.2.8) (NAG
           kinase) (AGK) (N-acetyl-L- glutamate
           5-phosphotransferase).>gb:AE011171_269791 Methanosarcina
           acetivorans str. C2A, section 516 of 534 of the complete
           genome.>gb:AE010299_910350 Methanosarcina acetivorans
           str. C2A, complete genome.
          Length = 299

 Score = 36.6 bits (83), Expect = 0.69
 Identities = 15/41 (36%), Positives = 26/41 (63%)
 Frame = -2

Query: 910 ELAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMV 788
           ++  AA   + GV+R H+++G++   +  ELF   GVGTM+
Sbjct: 251 KIKGAAVAVKSGVERAHVINGSVSHSMLLELFTDGGVGTML 291



>gb:AY459293_1328230 Plasmodium falciparum histone acetyltransferase
            (HAT) gene, complete cds.>gb:AY463097_1329700 Plasmodium
            falciparum histone acetyltransferase (HAT) mRNA, complete
            cds.>gb:AY498855_1331087 Plasmodium falciparum histone
            acetyltransferase mRNA, complete cds.
          Length = 1464

 Score = 36.2 bits (82), Expect = 0.91
 Identities = 18/75 (24%), Positives = 40/75 (53%), Gaps = 1/75 (1%)
 Frame = -2

Query: 634  REGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLT 455
            ++  +I      PY ++K  E+A +AV+   + +G G +L++++++     GI+      
Sbjct: 1182 KKNTVIGGVCFRPYFEQKFAEIAFLAVTSTEQVKGYGTRLMNHLKEHVKKFGIEYFLTYA 1241

Query: 454  TRTA-DWFIRRGFSE 413
               A  +F ++GFS+
Sbjct: 1242 DNFAIGYFRKQGFSQ 1256



>gb:AP006878_575483 Thermococcus kodakaraensis strain KOD1 DNA,
           complete genome.
          Length = 283

 Score = 36.2 bits (82), Expect = 0.91
 Identities = 31/97 (31%), Positives = 49/97 (50%), Gaps = 10/97 (10%)
 Frame = -2

Query: 646 IVVEREGQIIACAALFPYLKEKCGEVASIA------VSPDCRGQGQGDKLLDYIEKKASS 485
           IV E +G+I+  A +F   ++  GE+  IA      V PD RG+G G  +++YIE   + 
Sbjct: 62  IVAELDGRIVGEAEVFLSEEQINGEMMRIAHLDVIEVHPDFRGKGIGRAIIEYIEGSFAG 121

Query: 484 HGIQKLFLLTTRTAD----WFIRRGFSECSIDQLPVE 386
               K  LLTT+  +    ++ + GF E   +   VE
Sbjct: 122 ----KAELLTTQPDEEAIGFYRKLGFHEVLYENWLVE 154



>gb:AE016920_357912 Chromobacterium violaceum ATCC 12472 section 11
           of 16 of the complete genome.>gb:AE016825_1043066
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 166

 Score = 36.2 bits (82), Expect = 0.91
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 1/73 (1%)
 Frame = -2

Query: 670 LLEALDSFIVVE-REGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKK 494
           LL+   +F V+   EG  + C A+      + GE+  + V P+ RG G    LL ++E++
Sbjct: 58  LLKPDVAFAVIRGEEGAALGCGAVC--CAAEYGELKRVFVKPESRGMGAARALLSFLEEQ 115

Query: 493 ASSHGIQKLFLLT 455
           A + G + + L T
Sbjct: 116 ARARGCETMMLET 128



>gb:AE016785_332379 Pseudomonas putida KT2440 section 12 of 21 of
           the complete genome.>gb:AE015451_947456 Pseudomonas
           putida KT2440 complete genome.
          Length = 364

 Score = 36.2 bits (82), Expect = 0.91
 Identities = 23/71 (32%), Positives = 33/71 (46%)
 Frame = -2

Query: 703 FGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQG 524
           F  ++RR    L       IV E++G +   A L  +       + SIAVSP  RG G G
Sbjct: 34  FNWMVRRANASL-------IVAEQQGHLAGYALLLFHRGTSLARLYSIAVSPAWRGHGLG 86

Query: 523 DKLLDYIEKKA 491
            +LL+  +  A
Sbjct: 87  QQLLEQAQASA 97



>gb:AE014961_313608 Streptococcus mutans UA159 section 109 of 185 of
           the complete genome.>gb:AE014133_940609 Streptococcus
           mutans UA159 complete genome.
          Length = 141

 Score = 36.2 bits (82), Expect = 0.91
 Identities = 26/82 (31%), Positives = 44/82 (53%), Gaps = 5/82 (6%)
 Frame = -2

Query: 649 FIVVEREGQIIA---CAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHG 479
           F+V +   +I+A   C  L+  LK     + ++AV    + Q  G +LLDYI+  A +H 
Sbjct: 42  FVVKDDAARILAAASCQQLYQTLK-----IENLAVDSVFQKQKFGSQLLDYIKDYARAHN 96

Query: 478 IQKLFLLTT--RTADWFIRRGF 419
           I  L L T   +  D+++++GF
Sbjct: 97  ILTLTLSTRSYQAKDFYLKQGF 118



>gb:CR555306_107859 Azoarcus sp. EbN1 complete genome.
          Length = 300

 Score = 36.2 bits (82), Expect = 0.91
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = -2

Query: 910 ELAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVAS 782
           ++++A    R GV+ VH++DG +   L  E+    GVGTM+ S
Sbjct: 257 KISSALDAARNGVKSVHIIDGRVEHCLLLEILTDHGVGTMIKS 299



>gb:BX842649_824367 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 4/11.
          Length = 327

 Score = 35.8 bits (81), Expect = 1.2
 Identities = 25/77 (32%), Positives = 36/77 (46%)
 Frame = -2

Query: 691 IRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLL 512
           +   E  +L+   S  V    G+ +   AL       C E+A +AVSP  +G+  G  L 
Sbjct: 212 LENPESYILKKGGSIFVALLNGEPVGVCALIKREDLGCYELAKMAVSPKAQGKSIGFLLG 271

Query: 511 DYIEKKASSHGIQKLFL 461
             I +KA   G Q+LFL
Sbjct: 272 QAIVEKAREMGEQRLFL 288



>gb:BA000040_735663 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 154

 Score = 35.8 bits (81), Expect = 1.2
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 5/74 (6%)
 Frame = -2

Query: 652 SFIVVEREGQIIACAALFPYLKEKC-----GEVASIAVSPDCRGQGQGDKLLDYIEKKAS 488
           + +V E EG+++ C  L             G +  + V+ DCR +G G++L+ +   +A 
Sbjct: 57  ALVVAESEGRVVGCLQLAVLAGISSQGGIRGLLEDVRVAADCRSRGIGEQLVQWAIAEAK 116

Query: 487 SHGIQKLFLLTTRT 446
           + G   + LLT +T
Sbjct: 117 ARGCNLVELLTHQT 130



>gb:BA000030_699794 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 211

 Score = 35.8 bits (81), Expect = 1.2
 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 4/80 (5%)
 Frame = -2

Query: 688 RRTEVELLEALDSFIVVEREGQIIACAALFPY----LKEKCGEVASIAVSPDCRGQGQGD 521
           RRT +   +     +V ER G+++  A   PY    ++ +  E+ +I V PD  G+G G 
Sbjct: 50  RRTHLVKGDGTMVNLVAERAGEVVGWACHGPYRDGEVRTRDAELYAIYVRPDEVGKGVGQ 109

Query: 520 KLLDYIEKKASSHGIQKLFL 461
            LL    ++ +S G + +FL
Sbjct: 110 ALLRESTRRCASAGHRHMFL 129



>gb:AY780525_645953 Bacillus sp. MB24 transposon TnARS1, complete
           sequence.
          Length = 164

 Score = 35.8 bits (81), Expect = 1.2
 Identities = 25/71 (35%), Positives = 36/71 (50%), Gaps = 5/71 (7%)
 Frame = -2

Query: 652 SFIVVEREGQIIACAALFPYLKEKC-----GEVASIAVSPDCRGQGQGDKLLDYIEKKAS 488
           S IV+E    I+  A++ PY   +C     GE+ SI +  + RG+G G KLL  +EK   
Sbjct: 51  SVIVMEENSHIVGWASINPY-SHRCAYRGVGEL-SIYIKREYRGKGLGQKLLLALEKTGQ 108

Query: 487 SHGIQKLFLLT 455
            +   K  L T
Sbjct: 109 KNEFYKFVLFT 119



>gb:AE013361_291623 Methanosarcina mazei strain Goe1, section 143 of
           379 of the complete genome.>gb:AE008384_965732
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 176

 Score = 35.8 bits (81), Expect = 1.2
 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 14/95 (14%)
 Frame = -2

Query: 655 DSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYI--------- 503
           D F+V E+EG+++     +   + + G + S+ V  + RG+G G +L+  I         
Sbjct: 38  DGFLVAEQEGKVVGYVVGYRSAENE-GHIFSVGVKKEYRGRGIGTELIHAICDIFVANGL 96

Query: 502 -----EKKASSHGIQKLFLLTTRTADWFIRRGFSE 413
                E + S+ G QKL+     T  W  ++ +S+
Sbjct: 97  RYARLEVRTSNTGAQKLYRSIGFTQCWTEKKYYSD 131



>pir|AE1339|AE1339 hypothetical protein lmo2117 [imported] -
           Listeria monocytogenes (strain EGD-e)>gb:AL591982_536608
           Listeria monocytogenes strain EGD, complete genome,
           segment 10/12.
          Length = 153

 Score = 35.8 bits (81), Expect = 1.2
 Identities = 35/124 (28%), Positives = 58/124 (46%), Gaps = 2/124 (1%)
 Frame = -2

Query: 682 TEVELLEALDSFIVVE--REGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLD 509
           +E ++ + LD   V +   +  +I    LFP   ++  E+ +IAVS D R QG G KLL+
Sbjct: 23  SEKQIAKYLDKSHVFQLMHDDIVIGIICLFPLNNDQL-EIMNIAVSSDYRNQGIGKKLLE 81

Query: 508 YIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQLPVERRKKINLSRGSKYYMKKLQ 329
               KA  + I K F+         ++ G S  SIDQL   ++    +      Y  +  
Sbjct: 82  ----KAFDYAIHKHFIKI------IVKTGNS--SIDQLAFYQKNGFRMQHIIPNYFTENY 129

Query: 328 PDRS 317
           P+++
Sbjct: 130 PNQT 133



>sp|Q7UQZ8|ARGB_RHOBA Acetylglutamate kinase (EC 2.7.2.8) (NAG
           kinase) (AGK) (N-acetyl-L- glutamate
           5-phosphotransferase).>gb:BX294143_768345 Pirellula sp.
           strain 1 complete genome; segment 11/24.
          Length = 287

 Score = 35.8 bits (81), Expect = 1.2
 Identities = 15/30 (50%), Positives = 21/30 (70%)
 Frame = -2

Query: 877 GVQRVHLLDGTIGGVLFKELFQRDGVGTMV 788
           GVQ+VH++DG +   L  E+F  DGVGT +
Sbjct: 256 GVQKVHIIDGRLRHSLLLEIFTTDGVGTEI 285



>sp|O28988|ARGB_ARCFU Probable acetylglutamate kinase (EC 2.7.2.8)
           (NAG kinase) (AGK) (N- acetyl-L-glutamate
           5-phosphotransferase).>pir|G69409|G69409 acetylglutamate
           kinase (argB) homolog - Archaeoglobus
           fulgidus>gb:AE001016_30636 Archaeoglobus fulgidus DSM
           4304 section 91 of 172 of the complete
           genome.>gb:AE000782_975165 Archaeoglobus fulgidus DSM
           4304 complete genome.
          Length = 290

 Score = 35.8 bits (81), Expect = 1.2
 Identities = 14/32 (43%), Positives = 23/32 (71%)
 Frame = -2

Query: 883 RGGVQRVHLLDGTIGGVLFKELFQRDGVGTMV 788
           + GV+R H++DG+    +  ELF ++G+GTMV
Sbjct: 257 KSGVERAHIIDGSRPHSILIELFTKEGIGTMV 288



>gb:AY658957_2147967 Synthetic construct Peudomonas aeruginosa clone
           FLH047008.01F PA5323 gene, partial cds.
          Length = 302

 Score = 35.4 bits (80), Expect = 1.5
 Identities = 14/43 (32%), Positives = 25/43 (58%)
 Frame = -2

Query: 910 ELAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVAS 782
           ++  A    +GGV   H++DG +   +  E+F   GVGT+++S
Sbjct: 255 KIRCALEAVQGGVTSAHIIDGRVPNAVLLEIFTDSGVGTLISS 297



>gb:ZMA428540_1731528 Zea mays mRNA for GCN5
           protein.>gb:ZMA428542_1731529 Zea mays GCN5 gene for
           histone acetyltransferase, complete
           cds.>gb:AF440227_1800056 Zea mays histone acetyl
           transferase (HAC104) mRNA, complete cds.
          Length = 515

 Score = 35.4 bits (80), Expect = 1.5
 Identities = 20/86 (23%), Positives = 48/86 (55%), Gaps = 3/86 (3%)
 Frame = -2

Query: 646 IVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKA-SSHGIQK 470
           ++V R   ++      PY  ++ GE+A  A++ D + +G G +L++++++ A  + G+  
Sbjct: 213 MMVIRNNIVVGGITYRPYASQRFGEIAFCAITADEQVKGYGTRLMNHLKQHARDADGLTH 272

Query: 469 LFLLTTRTA-DWFIRRGFS-ECSIDQ 398
                   A  +F+++GF+ E ++D+
Sbjct: 273 FLTYADNNAVGYFVKQGFTKEITLDK 298



>gb:OSJN00099_1694895 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0020J19, complete sequence.
          Length = 1566

 Score = 35.4 bits (80), Expect = 1.5
 Identities = 29/108 (26%), Positives = 43/108 (39%), Gaps = 2/108 (1%)
 Frame = -2

Query: 649  FIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQK 470
            + V+  +G  I C A       K  E+  IA S D R QG   +L+D IE    S  ++ 
Sbjct: 1214 YTVILEKGDEILCVASIRVHGTKAAELPFIATSVDYRRQGMCRRLMDTIEMMLRSFHVET 1273

Query: 469  LFL--LTTRTADWFIRRGFSECSIDQLPVERRKKINLSRGSKYYMKKL 332
            L L  +      W    GF     ++    R   + L  G+    K+L
Sbjct: 1274 LVLSAIPELVNTWVSGFGFKPIEDNEKKQLRNVNLMLFPGTSLLTKRL 1321



>gb:BX950851_839624 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 141

 Score = 35.4 bits (80), Expect = 1.5
 Identities = 22/72 (30%), Positives = 36/72 (50%)
 Frame = -2

Query: 655 DSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGI 476
           D F+V E  G+I+  + +  Y   + G    + V PD RG+G  + L+  +EKK  + G 
Sbjct: 43  DLFLVAEVNGEIVG-SVMGGYDGHR-GSAYYLGVHPDFRGRGIANALISRLEKKLIARGC 100

Query: 475 QKLFLLTTRTAD 440
            K+ L+     D
Sbjct: 101 PKIHLMVREDND 112



>gb:BA000030_704448 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 156

 Score = 35.4 bits (80), Expect = 1.5
 Identities = 16/37 (43%), Positives = 25/37 (67%)
 Frame = -2

Query: 565 SIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLT 455
           SIAV PD  GQG G +LL +++ +A + G+ ++ L T
Sbjct: 83  SIAVRPDAHGQGVGRRLLAFVDARARALGLDEVRLYT 119



>gb:BA000028_694721 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 168

 Score = 35.4 bits (80), Expect = 1.5
 Identities = 23/63 (36%), Positives = 37/63 (58%), Gaps = 3/63 (4%)
 Frame = -2

Query: 646 IVVEREGQIIACAALFP-YLKEKCGEVASIAVSPD--CRGQGQGDKLLDYIEKKASSHGI 476
           +V E EG+I    +L   Y +    + A +++  D   RG+G G KLL+YI +K+ S+GI
Sbjct: 58  LVAELEGEICGWISLESFYGRPAYNQTAEVSIYIDERFRGEGLGKKLLNYIIEKSPSYGI 117

Query: 475 QKL 467
           + L
Sbjct: 118 EIL 120



>gb:ZMPDHBGEN_212037 Zymomonas mobilis pdhB & lpd genes & ORF's
           4,5,6,7 & 8.
          Length = 143

 Score = 35.4 bits (80), Expect = 1.5
 Identities = 21/68 (30%), Positives = 35/68 (51%)
 Frame = -2

Query: 628 GQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTR 449
           G  ++  A F +L+     +  +AVSP+ RGQG G  LL +  +K  +  + +++L    
Sbjct: 49  GDKLSGCASFHHLEGHKKRIRRVAVSPEYRGQGLGSALLKHAMEKLVTPDLTEIWLNARL 108

Query: 448 TADWFIRR 425
            A  F RR
Sbjct: 109 PAQNFYRR 116



>pir|C83402|C83402 hypothetical protein PA1943 [imported] -
           Pseudomonas aeruginosa (strain PAO1)>gb:AE004621_56179
           Pseudomonas aeruginosa PAO1, section 182 of 529 of the
           complete genome.>gb:AE004091_970279 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 365

 Score = 35.4 bits (80), Expect = 1.5
 Identities = 26/92 (28%), Positives = 42/92 (45%), Gaps = 1/92 (1%)
 Frame = -2

Query: 763 RMARATDIPGIKQILQPLEEFGTLIRRT-EVELLEALDSFIVVEREGQIIACAALFPYLK 587
           R A   D+  + ++     ++  L RR  +  L  A  S  V E +G ++  A +  +  
Sbjct: 6   RPAGVDDLSALVELENRCFDYDRLSRRNFQWMLTRAHASLTVAEGDGGVLGYALVLFHEG 65

Query: 586 EKCGEVASIAVSPDCRGQGQGDKLLDYIEKKA 491
                + SIA+ P  RG G G KLL+  E+ A
Sbjct: 66  TSLARLYSIAIDPRARGIGLGQKLLEAAEQAA 97



>pir|T45908|T45908 hypothetical protein F4P12.380 - Arabidopsis
            thaliana>gb:ATF4P12_1550753 Arabidopsis thaliana DNA
            chromosome 3, BAC clone F4P12.
          Length = 839

 Score = 35.4 bits (80), Expect = 1.5
 Identities = 25/109 (22%), Positives = 51/109 (46%), Gaps = 3/109 (2%)
 Frame = -2

Query: 649  FIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQK 470
            + +V     ++  AAL     +K  E+  +A S + +G+G    L   +E   SS  ++ 
Sbjct: 721  YCLVLMVNSLVVSAALLRIFGQKVAELPIVATSREYQGRGYFQGLFACVENLLSSLNVEN 780

Query: 469  LFLLTTRTAD--WFIRRGFSECSIDQLP-VERRKKINLSRGSKYYMKKL 332
            L L     A+  W  + GF++ +  +L   +R  ++ + +G+    KK+
Sbjct: 781  LLLPAAEEAESIWTNKFGFTKMTEHRLQRYQREVQLTIFKGTSMLEKKV 829



>gb:AF187100_2058293 Rattus norvegicus putative N-acetyltransferase
           CML5 (Cml5) mRNA, partial cds.
          Length = 145

 Score = 35.0 bits (79), Expect = 2.0
 Identities = 25/97 (25%), Positives = 44/97 (45%), Gaps = 9/97 (9%)
 Frame = -2

Query: 715 PLEEFGTLIRRTEV-----ELLEALDSFIVVEREGQIIACAALFPYLKEKCG----EVAS 563
           P +E+  +  +T++       L +  SF V E  GQ++   A  P  +   G    ++  
Sbjct: 1   PFKEYVAMCLQTDMADITKSYLNSHGSFWVAESGGQVVGIVAALPVKESPSGRKQLQLFH 60

Query: 562 IAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTT 452
           ++VS  CRGQG    L+  + + A   G   + L T+
Sbjct: 61  LSVSSQCRGQGIAKALVRTVLQFARDQGYTDVVLETS 97



>gb:AE016809_338145 Vibrio vulnificus CMCP6 chromosome II section 2
           of 6 of the complete sequence.>gb:AE016796_1047869
           Vibrio vulnificus CMCP6 chromosome II complete sequence.
          Length = 138

 Score = 35.0 bits (79), Expect = 2.0
 Identities = 25/65 (38%), Positives = 36/65 (55%), Gaps = 2/65 (3%)
 Frame = -2

Query: 649 FIVVEREGQIIACAALFPYLKEKCGE--VASIAVSPDCRGQGQGDKLLDYIEKKASSHGI 476
           FIV E E QI     + P   +KC E  + S+AVSP  +G+G   KL+ Y   + S +  
Sbjct: 27  FIVAECEHQIAGYVLIVPKA-DKCNEAWMLSLAVSPAYQGRGIAKKLVKYALARQSHY-- 83

Query: 475 QKLFL 461
           QK++L
Sbjct: 84  QKIYL 88



>gb:AE010349_262181 Methanopyrus kandleri AV19 section 48 of 157 of
           the complete genome.>gb:AE009439_902962 Methanopyrus
           kandleri AV19, complete genome.
          Length = 185

 Score = 35.0 bits (79), Expect = 2.0
 Identities = 31/106 (29%), Positives = 51/106 (48%), Gaps = 5/106 (4%)
 Frame = -2

Query: 763 RMARATDIPGIKQILQ---PLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAA--LF 599
           R A+ +DIP + +I +   P   + T +      L    + F+V E  G+++      L 
Sbjct: 35  RRAKRSDIPEVVEIEERAFPKSPYPTYVFL--YNLSNNPEGFLVAEVGGKVVGYVIFELR 92

Query: 598 PYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFL 461
           P+L E  G + SIAV P+ R  G G  L+   E+K +  G + + L
Sbjct: 93  PWLGE--GHIVSIAVHPNYRRTGIGTILMGEAERKIAEAGYETVRL 136



>gb:CR522870_99284 Desulfotalea psychrophila LSv54 chromosome.
          Length = 296

 Score = 35.0 bits (79), Expect = 2.0
 Identities = 13/32 (40%), Positives = 22/32 (68%)
 Frame = -2

Query: 883 RGGVQRVHLLDGTIGGVLFKELFQRDGVGTMV 788
           +GGV + +++DG +   +  E+F RDGVGT +
Sbjct: 264 KGGVAKTYIVDGRVEHAILLEIFTRDGVGTEI 295



>pir|D72219|D72219 conserved hypothetical protein - Thermotoga
           maritima (strain MSB8)>gb:AE001811_39614 Thermotoga
           maritima MSB8 section 123 of 136 of the complete
           genome.>gb:AE000512_1114087 Thermotoga maritima MSB8,
           complete genome.
          Length = 144

 Score = 35.0 bits (79), Expect = 2.0
 Identities = 18/62 (29%), Positives = 38/62 (61%)
 Frame = -2

Query: 646 IVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKL 467
           +++E+EG+ I  A +   + +   ++  +A+  + R +G G  L++ IE++ SS G+QK+
Sbjct: 46  VLLEKEGKFIGTARIRK-IDDGTFKIERVAILKEERRKGHGRFLMESIERELSSKGVQKI 104

Query: 466 FL 461
            L
Sbjct: 105 VL 106



>sp|O05501|YDHI_BACSU Hypothetical protein ydhI.>pir|E69784|E69784
           conserved hypothetical protein ydhI - Bacillus
           subtilis>gb:D88802_121151 Bacillus subtilis DNA for
           phoB-rrnE-groESL region, complete
           cds.>gb:BSUB0004_752542 Bacillus subtilis complete
           genome (section 4 of 21): from 611631 to 813719.
          Length = 160

 Score = 35.0 bits (79), Expect = 2.0
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 4/102 (3%)
 Frame = -2

Query: 664 EALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASS 485
           + LD F  V   G+II C      +  K  E+  I++      +G G  LL  +E+KA  
Sbjct: 38  DELDGFAAVNESGEIIGCITY--TIDGKDCEI--ISLDSMIENKGIGTALLQQVEEKAKH 93

Query: 484 HGIQKLFLLTT----RTADWFIRRGFSECSIDQLPVERRKKI 371
              Q++ L+TT        ++ +RG+   ++    VE+ +++
Sbjct: 94  AHCQRIKLITTNDNVNAIAFYQKRGYQFAAVFPNAVEKARRL 135



>gb:BX957219_843316 Methanococcus maripaludis S2 complete genome;
           segment 1/5.
          Length = 294

 Score = 34.7 bits (78), Expect = 2.6
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = -2

Query: 877 GVQRVHLLDGTIGGVLFKELFQRDGVGTMVASD 779
           GVQ VH+++G     +  E+F  DGVGTMV  +
Sbjct: 262 GVQSVHIVNGKTPHAVLLEIFTEDGVGTMVVRE 294



>gb:BX950851_838792 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 328

 Score = 34.7 bits (78), Expect = 2.6
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 1/76 (1%)
 Frame = -2

Query: 643 VVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLF 464
           VV+ +G+++A   L      +   +  +AV PD RG+G G  L   +E  A   G++++ 
Sbjct: 63  VVDEQGRLVAIGRLSINADNEAA-IRFLAVHPDLRGKGLGTLLAITLESVARQEGVKRVV 121

Query: 463 LLTTRTA-DWFIRRGF 419
                 A D+F + GF
Sbjct: 122 CSAREDAMDFFSKLGF 137



>gb:AY596297_631574 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 167

 Score = 34.7 bits (78), Expect = 2.6
 Identities = 20/71 (28%), Positives = 36/71 (50%)
 Frame = -2

Query: 679 EVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIE 500
           E EL+E+    +V ERE  ++  A    +  ++ G +  + V PD R +G G  LL+   
Sbjct: 49  ESELVESQTLLLVAEREEHVVGFAHATWHETDQEGYILRLYVHPDYRREGIGRSLLEQTC 108

Query: 499 KKASSHGIQKL 467
           ++   H I ++
Sbjct: 109 EELFEHDIHRI 119



>gb:AP006878_575384 Thermococcus kodakaraensis strain KOD1 DNA,
           complete genome.
          Length = 273

 Score = 34.7 bits (78), Expect = 2.6
 Identities = 20/53 (37%), Positives = 31/53 (58%)
 Frame = -2

Query: 652 SFIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKK 494
           +F V+E EG++I  A L   L ++ G +  + V PD RG+G G  L ++I  K
Sbjct: 42  NFYVLELEGKVIGTAKL-TLLPKRVGWMEGLRVHPDYRGRGFGRMLHNFIVSK 93



>gb:AF009672_468232 Acinetobacter sp. ADP1 VanR (vanR), vanillate
           demethylase (vanB), vanillate demethylase (vanA), and
           VanK (vanK) genes, complete cds; and unknown genes.
          Length = 155

 Score = 34.7 bits (78), Expect = 2.6
 Identities = 13/31 (41%), Positives = 22/31 (70%)
 Frame = -2

Query: 556 VSPDCRGQGQGDKLLDYIEKKASSHGIQKLF 464
           VSPDCRGQ  G  L++Y++++A +    +L+
Sbjct: 94  VSPDCRGQHIGKSLIEYVQQQAKTQHATRLY 124



>gb:AE017282_429474 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 300

 Score = 34.7 bits (78), Expect = 2.6
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = -2

Query: 883 RGGVQRVHLLDGTIGGVLFKELFQRDGVGTMV 788
           RGGV   H++DG I   +  ELF   G+GT++
Sbjct: 266 RGGVNSAHIIDGRIDHAVLLELFTDQGIGTLL 297



>gb:AE010642_265281 Fusobacterium nucleatum subsp. nucleatum ATCC
           25586, section 184 of 197 of the complete
           genome.>gb:AE009951_912449 Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586, complete genome.
          Length = 122

 Score = 34.7 bits (78), Expect = 2.6
 Identities = 13/27 (48%), Positives = 20/27 (74%)
 Frame = -2

Query: 574 EVASIAVSPDCRGQGQGDKLLDYIEKK 494
           E+ +IA+ PDC+ +G G  L+D+I KK
Sbjct: 34  EIKNIAIEPDCQRKGYGKALIDFIAKK 60



>gb:CR543861_102962 Acinetobacter sp. ADP1 complete genome.
          Length = 151

 Score = 34.7 bits (78), Expect = 2.6
 Identities = 13/31 (41%), Positives = 22/31 (70%)
 Frame = -2

Query: 556 VSPDCRGQGQGDKLLDYIEKKASSHGIQKLF 464
           VSPDCRGQ  G  L++Y++++A +    +L+
Sbjct: 90  VSPDCRGQHIGKSLIEYVQQQAKTQHATRLY 120



>pir|A71455|A71455 probable acetyltransferase - Pyrococcus
           horikoshii>gb:BA000001_648930 Pyrococcus horikoshii OT3
           DNA, complete genome.
          Length = 172

 Score = 34.7 bits (78), Expect = 2.6
 Identities = 32/98 (32%), Positives = 48/98 (48%), Gaps = 3/98 (3%)
 Frame = -2

Query: 763 RMARATDIPGIKQILQPL--EEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYL 590
           R A+  DIP I +I Q    E++   +  T +E     D+F+V E  G++I    +  YL
Sbjct: 23  RSAKLFDIPFIMRIEQASFREKYPRGLFLTFLE--SNPDTFLVAEYNGKVIGY--VMGYL 78

Query: 589 KEKC-GEVASIAVSPDCRGQGQGDKLLDYIEKKASSHG 479
           +    G + SIAV P+ RG G G  L+  +  K    G
Sbjct: 79  RPDMEGHIMSIAVDPNYRGNGIGKALMIAVINKLFKKG 116



>pir|F75490|F75490 probable acetyltransferase - Deinococcus
           radiodurans (strain R1)>gb:AE001924_40953 Deinococcus
           radiodurans R1 section 61 of 229 of the complete
           chromosome 1.>gb:AE000513_881848 Deinococcus radiodurans
           R1 complete chromosome 1.
          Length = 152

 Score = 34.7 bits (78), Expect = 2.6
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 1/66 (1%)
 Frame = -2

Query: 577 GEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTA-DWFIRRGFSECSID 401
           G V ++ V PD RGQG   +LL+ +  + ++HG+ ++ L  +      + + GF   +  
Sbjct: 86  GYVMNVYVRPDQRGQGLARRLLERVLDECAAHGVTQVSLHASEAGRPLYEKLGFKPTNEM 145

Query: 400 QLPVER 383
           +L VER
Sbjct: 146 KLKVER 151



>pir|F84206|F84206 hypothetical protein Vng0482h [imported] -
           Halobacterium sp. NRC-1>gb:AE005001_62178 Halobacterium
           sp. NRC-1 section 32 of 170 of the complete
           genome.>gb:AE004437_887097 Halobacterium sp. NRC-1
           complete genome.
          Length = 189

 Score = 34.7 bits (78), Expect = 2.6
 Identities = 23/75 (30%), Positives = 36/75 (48%)
 Frame = -2

Query: 574 EVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGFSECSIDQL 395
           E  +I V  D RG+G G  LL Y+   A   GI++ + LT   A +  + GF      +L
Sbjct: 63  EFTNIGVLDDWRGRGVGAHLLAYLVADAREQGIEEAYALTDEPA-YLDQFGFERVDEAEL 121

Query: 394 PVERRKKINLSRGSK 350
           P     ++  +R S+
Sbjct: 122 PPPLGDRLAATRESQ 136



>pir|D95389|D95389 protein [imported] - Sinorhizobium meliloti
           (strain 1021) magaplasmid pSymA>gb:AE007288_224980
           Sinorhizobium meliloti 1021 plasmid pSymA section 94 of
           121 of the complete plasmid
           sequence.>gb:AE006469_1102748 Sinorhizobium meliloti
           1021 plasmid pSymA, complete sequence.
          Length = 283

 Score = 34.7 bits (78), Expect = 2.6
 Identities = 23/92 (25%), Positives = 41/92 (44%)
 Frame = -2

Query: 688 RRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLD 509
           R  + ++  AL   IV   +G+++    + PY K  C  +  + V    RG+G G KL+D
Sbjct: 36  RLEDWQMAFALSEGIVAVEDGRVVGTVLVTPY-KRDCATINMVIVDEAVRGRGLGRKLMD 94

Query: 508 YIEKKASSHGIQKLFLLTTRTADWFIRRGFSE 413
              + A    ++   + T      + + GF E
Sbjct: 95  AAFRIAGDRPLR--LVATAEGLPLYDKLGFGE 124



>pir|H75432|H75432 hypothetical protein - Deinococcus radiodurans
           (strain R1)>gb:AE001963_41408 Deinococcus radiodurans R1
           section 100 of 229 of the complete chromosome
           1.>gb:AE000513_882303 Deinococcus radiodurans R1
           complete chromosome 1.
          Length = 329

 Score = 34.7 bits (78), Expect = 2.6
 Identities = 30/102 (29%), Positives = 43/102 (42%), Gaps = 9/102 (8%)
 Frame = -2

Query: 694 LIRRTEVELLEALDSFIVVEREGQIIACAAL--FPYLKEKCGEVASIAVSPDCRGQGQGD 521
           L+      L E +    V E  GQ++  A L  FP+L     ++  + VSPD R +G G 
Sbjct: 37  LLAEDAARLAEQVSRRWVAEEGGQVVGLAHLYFFPFLPPNFLQL-DLTVSPDARRRGHGS 95

Query: 520 KLLDYIEKKASSHGIQKLFLLTTRTAD-------WFIRRGFS 416
            L +    +  + GI     L T   D       W  RRGF+
Sbjct: 96  ALWETALAETQALGISS---LATNVRDDDPPSRTWAERRGFA 134



>sp|Q9LCS6|ARGB_STRCL Acetylglutamate kinase (EC 2.7.2.8) (NAG
           kinase) (AGK) (N-acetyl-L- glutamate
           5-phosphotransferase).>gb:SCARGGH_173077 Streptomyces
           clavuligerus arginine biosynthesis cluster (argCJBDRGH
           genes).
          Length = 302

 Score = 34.7 bits (78), Expect = 2.6
 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 3/43 (6%)
 Frame = -2

Query: 883 RGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASD---LYEGT 764
           R GV+   ++DG +   +  E+F  DGVGTMV  D   + EGT
Sbjct: 259 RNGVRTARVIDGRVPHSILLEIFTDDGVGTMVVPDEPSVSEGT 301



>sp|Q7NR63|ARGB_CHRVO Acetylglutamate kinase (EC 2.7.2.8) (NAG
           kinase) (AGK) (N-acetyl-L- glutamate
           5-phosphotransferase).>gb:AE016923_358882
           Chromobacterium violaceum ATCC 12472 section 14 of 16 of
           the complete genome.>gb:AE016825_1044036 Chromobacterium
           violaceum ATCC 12472 complete genome.
          Length = 289

 Score = 34.7 bits (78), Expect = 2.6
 Identities = 15/41 (36%), Positives = 24/41 (58%)
 Frame = -2

Query: 910 ELAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMV 788
           ++++A    R GV  VH++DG +   L  E+    GVGTM+
Sbjct: 247 KISSALDAARNGVNSVHVIDGRVKHALLLEILTAAGVGTMI 287



>gb:CR382127_1659951 Yarrowia lipolytica chromosome A of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 159

 Score = 34.3 bits (77), Expect = 3.4
 Identities = 31/108 (28%), Positives = 55/108 (50%), Gaps = 5/108 (4%)
 Frame = -2

Query: 628 GQIIACAALFP-YLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFL--L 458
           G I  C  + P + K     + +IAV    R  G G  LLD+IE+ A+   + +L +  L
Sbjct: 55  GAIRCCLEVAPEHTKPSRIYIMTIAVLSPYRENGIGGMLLDHIERYAAETFVPELSVHAL 114

Query: 457 T--TRTADWFIRRGFSECSIDQLPVERRKKINLSRGSKYYMKKLQPDR 320
           T  T   +W+ +RGF    +D++     K++  ++ +   +KKL+ D+
Sbjct: 115 TDDTEVIEWYKKRGFE--IVDEVK-GYYKRLTPAKDAYLMVKKLKKDQ 159



>gb:BX640435_812282 Bordetella parapertussis strain 12822, complete
           genome; segment 13/14.
          Length = 344

 Score = 34.3 bits (77), Expect = 3.4
 Identities = 14/43 (32%), Positives = 26/43 (60%)
 Frame = -2

Query: 910 ELAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVAS 782
           +++++    + GV  VH++DG +   L  E+    GVGTM++S
Sbjct: 301 KISSSLDAAKNGVNSVHIVDGRVPHCLLLEILTDQGVGTMISS 343



>gb:BA000031_706669 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 1, complete sequence.
          Length = 171

 Score = 34.3 bits (77), Expect = 3.4
 Identities = 30/95 (31%), Positives = 47/95 (49%), Gaps = 6/95 (6%)
 Frame = -2

Query: 712 LEEFGTLIRRTEV---ELLEALDSFIVVEREGQIIACAAL-FPY--LKEKCGEVASIAVS 551
           +E+F T+ RR  +    + E L   IVVE++G+I+   +   P    ++K   V    VS
Sbjct: 37  IEQF-TIERRERMWTRVMTEQLAQLIVVEKQGEIVGFLSYELPNHTSEDKTALVTCCYVS 95

Query: 550 PDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRT 446
           P   GQG G  LLD +E +  S  + ++ L    T
Sbjct: 96  PLHYGQGAGSALLDELETRLLSTPVMQISLKALNT 130



>gb:AJ749949_530634 Francisella tularensis subsp. tularensis
           complete genome.
          Length = 141

 Score = 34.3 bits (77), Expect = 3.4
 Identities = 20/49 (40%), Positives = 28/49 (57%)
 Frame = -2

Query: 649 FIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYI 503
           F V +R+  +      F Y  +K   V S+AVS + +GQG G KLL+YI
Sbjct: 42  FFVAKRQDSLAGYILCFEY--KKTIRVYSLAVSKNYQGQGIGKKLLEYI 88



>gb:AE017004_376999 Bacillus cereus ATCC 14579 section 7 of 18 of
           the complete genome.>gb:AE016877_1017249 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 161

 Score = 34.3 bits (77), Expect = 3.4
 Identities = 21/61 (34%), Positives = 34/61 (55%)
 Frame = -2

Query: 643 VVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLF 464
           V E EG++I  A   P   +   E+ +I + PD +G+G G  LL    K  + +GI+KL+
Sbjct: 61  VAEEEGEVIGFANFSPVRLQNEAELGAIYLLPDQQGKGIGSALLQRGIK--ALNGIRKLY 118

Query: 463 L 461
           +
Sbjct: 119 I 119



>gb:AE008692_240246 Zymomonas mobilis subsp. mobilis ZM4, complete
           genome.
          Length = 143

 Score = 34.3 bits (77), Expect = 3.4
 Identities = 21/68 (30%), Positives = 34/68 (50%)
 Frame = -2

Query: 628 GQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTR 449
           G  ++  A F +L      +  +AVSP+ RGQG G  LL +  +K  +  + +++L    
Sbjct: 49  GDKLSGCASFHHLGGHKKRIRRVAVSPEYRGQGLGSALLKHAMEKLVTPDLTEIWLNARL 108

Query: 448 TADWFIRR 425
            A  F RR
Sbjct: 109 PAQNFYRR 116



>pir|T41544|T41544 hypothetical protein SPCC663.13c - fission yeast 
           (Schizosaccharomyces pombe)>gb:SPCC663_1721548 S.pombe
           chromosome III cosmid c663.
          Length = 144

 Score = 34.3 bits (77), Expect = 3.4
 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 3/55 (5%)
 Frame = -2

Query: 574 EVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTAD---WFIRRGF 419
           ++ S+AV P  R +  G KLL+Y  + A+    +++++  +   D   WFI RGF
Sbjct: 72  QILSLAVLPAYRNRSIGTKLLEYACETAAEGKAKEIYIKLSPKLDVSEWFIHRGF 126



>pir|C83718|C83718 ribosomal-protein (S18)-alanine acetyltransferase
           BH0547 [imported] - Bacillus halodurans (strain
           C-125)>gb:BA000004_654493 Bacillus halodurans C-125 DNA,
           complete genome.
          Length = 151

 Score = 34.3 bits (77), Expect = 3.4
 Identities = 21/63 (33%), Positives = 34/63 (53%)
 Frame = -2

Query: 649 FIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQK 470
           ++V E   QI+    ++    E    + +IA+ PD RG+ +G+ LL YI + A   G +K
Sbjct: 48  YVVYEVGEQIVGYCGVWVVYDES--HITNIAIHPDYRGEKRGEALLRYILEFARLLGAKK 105

Query: 469 LFL 461
           L L
Sbjct: 106 LSL 108



>pir|A82980|A82980 acetylglutamate kinase PA5323 [imported] -
           Pseudomonas aeruginosa (strain PAO1)>gb:AE004945_59555
           Pseudomonas aeruginosa PAO1, section 506 of 529 of the
           complete genome.>gb:AE004091_973655 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 301

 Score = 34.3 bits (77), Expect = 3.4
 Identities = 13/43 (30%), Positives = 25/43 (58%)
 Frame = -2

Query: 910 ELAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVAS 782
           ++  A    +GGV   H++DG +   +  E+F   GVGT++++
Sbjct: 255 KIRCALEAVQGGVTSAHIIDGRVPNAVLLEIFTDSGVGTLISN 297



>sp|Q9HTN2|ARGB_PSEAE Acetylglutamate kinase (EC 2.7.2.8) (NAG
           kinase) (AGK) (N-acetyl-L- glutamate
           5-phosphotransferase).
          Length = 300

 Score = 34.3 bits (77), Expect = 3.4
 Identities = 13/43 (30%), Positives = 25/43 (58%)
 Frame = -2

Query: 910 ELAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVAS 782
           ++  A    +GGV   H++DG +   +  E+F   GVGT++++
Sbjct: 254 KIRCALEAVQGGVTSAHIIDGRVPNAVLLEIFTDSGVGTLISN 296



>sp|Q7VSM2|ARGB_BORPE Acetylglutamate kinase (EC 2.7.2.8) (NAG
           kinase) (AGK) (N-acetyl-L- glutamate
           5-phosphotransferase).>gb:BX640412_804828 Bordetella
           pertussis strain Tohama I, complete genome; segment
           2/12.
          Length = 300

 Score = 34.3 bits (77), Expect = 3.4
 Identities = 14/43 (32%), Positives = 26/43 (60%)
 Frame = -2

Query: 910 ELAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVAS 782
           +++++    + GV  VH++DG +   L  E+    GVGTM++S
Sbjct: 257 KISSSLDAAKNGVNSVHIVDGRVPHCLLLEILTDQGVGTMISS 299



>sp|Q7W3I6|ARGB_BORPA Acetylglutamate kinase (EC 2.7.2.8) (NAG
           kinase) (AGK) (N-acetyl-L- glutamate
           5-phosphotransferase).
          Length = 300

 Score = 34.3 bits (77), Expect = 3.4
 Identities = 14/43 (32%), Positives = 26/43 (60%)
 Frame = -2

Query: 910 ELAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVAS 782
           +++++    + GV  VH++DG +   L  E+    GVGTM++S
Sbjct: 257 KISSSLDAAKNGVNSVHIVDGRVPHCLLLEILTDQGVGTMISS 299



>sp|Q7WEW1|ARGB_BORBR Acetylglutamate kinase (EC 2.7.2.8) (NAG
           kinase) (AGK) (N-acetyl-L- glutamate
           5-phosphotransferase).>gb:BX640450_817168 Bordetella
           bronchiseptica strain RB50, complete genome; segment
           14/16.
          Length = 300

 Score = 34.3 bits (77), Expect = 3.4
 Identities = 14/43 (32%), Positives = 26/43 (60%)
 Frame = -2

Query: 910 ELAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVAS 782
           +++++    + GV  VH++DG +   L  E+    GVGTM++S
Sbjct: 257 KISSSLDAAKNGVNSVHIVDGRVPHCLLLEILTDQGVGTMISS 299



>gb:BX640445_815535 Bordetella bronchiseptica strain RB50, complete
           genome; segment 9/16.
          Length = 154

 Score = 33.9 bits (76), Expect = 4.5
 Identities = 35/121 (28%), Positives = 51/121 (42%), Gaps = 16/121 (13%)
 Frame = -2

Query: 763 RMARATDIPGIKQIL------QPLEEFGTLIRRTEVELLEALDS-----FIVVEREGQII 617
           R A ATD+P I  +L      Q  E+     +   +    A+D        VVER GQII
Sbjct: 8   RRAAATDLPAIIALLADDALGQQREDRTMPPQPAYLAAFGAIDRDPNQFLAVVERAGQII 67

Query: 616 ACAAL--FPYLKEK---CGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTT 452
            C  L   P L  +    G++ S+ V+   RG G G  L ++   +    G   + L T 
Sbjct: 68  GCLQLSFIPGLSRRGLWRGQIESVRVAASERGAGTGRALFEWAIAQCRDKGCGLVQLTTD 127

Query: 451 R 449
           +
Sbjct: 128 K 128



>gb:BX640414_805723 Bordetella pertussis strain Tohama I, complete
           genome; segment 4/12.
          Length = 154

 Score = 33.9 bits (76), Expect = 4.5
 Identities = 40/128 (31%), Positives = 53/128 (41%), Gaps = 23/128 (17%)
 Frame = -2

Query: 763 RMARATDIPGIKQIL----------------QP--LEEFGTLIRRTEVELLEALDSFIVV 638
           R A ATD+P I  +L                QP  L  FG  I R   +LL       VV
Sbjct: 8   RRAAATDLPAIIALLADDAFGQQREDPTMPPQPAYLAAFGA-IDRDPNQLLA------VV 60

Query: 637 EREGQIIACAAL--FPYLKEK---CGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQ 473
           ER GQII C  L   P L  +    G++ S+ V+   RG G G  L ++   +    G  
Sbjct: 61  ERAGQIIGCLQLSFIPGLSRRGLWRGQIESVRVAASERGAGTGRALFEWAIAQCRDKGCG 120

Query: 472 KLFLLTTR 449
            + L T +
Sbjct: 121 LVQLTTDK 128



>gb:BX571657_777461 Wolinella succinogenes, complete genome; segment
           1/7.
          Length = 153

 Score = 33.9 bits (76), Expect = 4.5
 Identities = 23/97 (23%), Positives = 45/97 (46%), Gaps = 9/97 (9%)
 Frame = -2

Query: 724 ILQPLEEFGTLIRRTEVELLEALDS-----FIVVEREGQIIACAALF----PYLKEKCGE 572
           IL P+     L +   ++L+E L        ++   EG+ +    LF     + ++    
Sbjct: 25  ILDPMGGGEPLEKEQALKLIEGLRKTPNVEILLASMEGEFVGLCTLFVNFSTFKQKPYFN 84

Query: 571 VASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFL 461
           +  + VSP+ RG+G G  +L+++ K+A      K+ L
Sbjct: 85  LHDVIVSPEARGKGVGRSMLEHLIKEAKRRDYAKVTL 121



>gb:BA000031_706668 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 1, complete sequence.
          Length = 235

 Score = 33.9 bits (76), Expect = 4.5
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 2/60 (3%)
 Frame = -2

Query: 658 LDS--FIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASS 485
           LDS  F  +  EG+++A  A + Y  ++  E  S+ VSP  R +G G +LL ++  +A +
Sbjct: 138 LDSHFFYGILEEGKLVAALASYCYKGKEPFESLSLLVSPKAREKGYGKRLLSHLVAEAKT 197



>gb:BA000030_699379 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 179

 Score = 33.9 bits (76), Expect = 4.5
 Identities = 33/135 (24%), Positives = 55/135 (40%), Gaps = 8/135 (5%)
 Frame = -2

Query: 799 GTMVASDLYEGTRMARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQI 620
           G    +D+ EG R    TD  G++ +++  +                    + VER G +
Sbjct: 37  GWTTEADILEGQR----TDPEGVRAVIKSSDS-----------------RLLTVERAGAV 75

Query: 619 IACAALFPYLKEKCGEVA---SIAVSPDCRGQGQGDKLLDYIEKKA-SSHGIQKLFLLTT 452
           +AC  L     E  G+ A     AVSP  +G G G  ++   E+ A  + G+  + +   
Sbjct: 76  VACCQL-----EHRGDHAYFGMFAVSPALQGGGLGKVIIGEAERAAREAWGVAAMHMTVI 130

Query: 451 RTAD----WFIRRGF 419
              D    W+ RRG+
Sbjct: 131 SVRDDLIAWYERRGY 145



>gb:AP006840_569703 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 157

 Score = 33.9 bits (76), Expect = 4.5
 Identities = 23/84 (27%), Positives = 40/84 (47%), Gaps = 5/84 (5%)
 Frame = -2

Query: 688 RRTEVELLEALDSFIVVEREGQIIACAALF-----PYLKEKCGEVASIAVSPDCRGQGQG 524
           RR ++       S +V+  E  +  C  ++      Y   + GEV++I V P  RG+G G
Sbjct: 43  RRNQLRAAARDPSQMVLVAEDPLGLCGFIWLVVEQDYRHRRRGEVSAIYVHPRMRGRGVG 102

Query: 523 DKLLDYIEKKASSHGIQKLFLLTT 452
            +L++  E+   S G   + L+ T
Sbjct: 103 RRLMEAGEEYLRSSGCHSVMLMVT 126



>gb:AE017283_431133 Propionibacterium acnes KPA171202, complete
           genome.
          Length = 310

 Score = 33.9 bits (76), Expect = 4.5
 Identities = 17/36 (47%), Positives = 20/36 (55%)
 Frame = -2

Query: 880 GGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLY 773
           GGV    ++DG I   L  E+F   GVGTM  SD Y
Sbjct: 274 GGVSSAAIVDGRIEHALLLEIFTTRGVGTMARSDDY 309



>gb:AE016822_339791 Leifsonia xyli subsp. xyli str. CTCB07, complete
           genome.
          Length = 302

 Score = 33.9 bits (76), Expect = 4.5
 Identities = 15/42 (35%), Positives = 25/42 (59%)
 Frame = -2

Query: 910 ELAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVA 785
           ++AA      GGV++  ++DG I   +  E+F + G+GT VA
Sbjct: 259 KMAACLAAVDGGVEKAEIIDGRIEHSILLEVFTQSGIGTEVA 300



>gb:AE011110_269263 Methanosarcina acetivorans str. C2A, section 455
           of 534 of the complete genome.>gb:AE010299_909822
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 291

 Score = 33.9 bits (76), Expect = 4.5
 Identities = 20/74 (27%), Positives = 38/74 (51%), Gaps = 3/74 (4%)
 Frame = -2

Query: 670 LLEALDS---FIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIE 500
           LLE +DS   +++VER G+I++ A+     ++   E+      P  RG+G   +L+  +E
Sbjct: 174 LLETMDSNVLYLLVERHGEIVSLASAEMDPEKASAEITDCLTVPSERGKGLMKELIKALE 233

Query: 499 KKASSHGIQKLFLL 458
           ++ S       + L
Sbjct: 234 EELSERNFLSSYTL 247



>pir|D87228|D87228 aminoglycoside 2'-N-acetyltransferase [imported]
           - Mycobacterium leprae>gb:MLEPRTN10_145900 Mycobacterium
           leprae strain TN complete genome; segment 10/10.
          Length = 182

 Score = 33.9 bits (76), Expect = 4.5
 Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 6/55 (10%)
 Frame = -2

Query: 643 VVEREGQIIACAA-----LFPYLKE-KCGEVASIAVSPDCRGQGQGDKLLDYIEK 497
           ++ R G IIA AA     LF +    +CG +  +AV  DCRG+G    LLD IE+
Sbjct: 52  LIWRHGTIIAHAAVVQRRLFYHGNALRCGYLEGVAVRKDCRGRGLVHALLDAIEQ 106



>pir|T00896|T00896 acetyltransferase homolog F21B7.10 - Arabidopsis
           thaliana>gb:BT004953_1637899 Arabidopsis thaliana clone
           U51046 unknown protein (At1g03650) mRNA, complete
           cds.>gb:AK118749_1816711 Arabidopsis thaliana At1g03650
           mRNA for unknown protein, complete cds, clone:
           RAFL21-09-N20.
          Length = 158

 Score = 33.9 bits (76), Expect = 4.5
 Identities = 20/79 (25%), Positives = 37/79 (46%)
 Frame = -2

Query: 697 TLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDK 518
           +L +  + EL +     + V+ EG  +  A ++ +       +  +AV  +CR QG G+ 
Sbjct: 36  SLAQTFDAELRKKNAGLLYVDAEGDTVGYA-MYSWPSSLSASITKLAVKENCRRQGHGEA 94

Query: 517 LLDYIEKKASSHGIQKLFL 461
           LL     K  S  +Q++ L
Sbjct: 95  LLRAAIDKCRSRKVQRVSL 113



>pir|D75017|D75017 n-terminal acetyltransferase PAB1098 - Pyrococcus
           abyssi  (strain Orsay)>gb:CNSPAX06_850436 Pyrococcus
           abyssi complete genome; segment 6/6.
          Length = 172

 Score = 33.9 bits (76), Expect = 4.5
 Identities = 31/98 (31%), Positives = 47/98 (47%), Gaps = 3/98 (3%)
 Frame = -2

Query: 763 RMARATDIPGIKQILQPL--EEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYL 590
           R A+  DIP I +I Q    E++   +  T +E     D+F+V E  G+++    +  YL
Sbjct: 23  RSAKLFDIPYIMRIEQASFREKYPRGLFLTFLE--SNPDTFLVAEYNGKVVGY--VMGYL 78

Query: 589 KEKC-GEVASIAVSPDCRGQGQGDKLLDYIEKKASSHG 479
           +    G + SIAV P  RG G G  L+  +  K    G
Sbjct: 79  RPDMEGHIMSIAVDPSYRGNGIGKALMIAVINKLFKKG 116



>sp|Q9L1A3|ARGB_STRCO Acetylglutamate kinase (EC 2.7.2.8) (NAG
           kinase) (AGK) (N-acetyl-L- glutamate
           5-phosphotransferase).>gb:SCO939109_175253 Streptomyces
           coelicolor A3(2) complete genome; segment 6/29.
          Length = 306

 Score = 33.9 bits (76), Expect = 4.5
 Identities = 14/35 (40%), Positives = 21/35 (60%)
 Frame = -2

Query: 883 RGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASD 779
           RGGV    ++DG +   +  E+F  +G+GTMV  D
Sbjct: 267 RGGVTTARVIDGRVQHSILLEIFTDEGIGTMVVPD 301



>sp|Q828A4|ARGB_STRAW Acetylglutamate kinase (EC 2.7.2.8) (NAG
           kinase) (AGK) (N-acetyl-L- glutamate
           5-phosphotransferase).>gb:BA000030_704652 Streptomyces
           avermitilis MA-4680 genomic DNA, complete genome.
          Length = 304

 Score = 33.9 bits (76), Expect = 4.5
 Identities = 15/39 (38%), Positives = 22/39 (56%)
 Frame = -2

Query: 883 RGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEG 767
           R GV    ++DG +   +  E+F  +G+GTMV  D  EG
Sbjct: 263 RNGVTTARVIDGRVQHSILLEIFTDEGIGTMVVPDEEEG 301



>sp|Q7VJR4|ARGB_HELHP Acetylglutamate kinase (EC 2.7.2.8) (NAG
           kinase) (AGK) (N-acetyl-L- glutamate
           5-phosphotransferase).>gb:AE017144_389932 Helicobacter
           hepaticus ATCC 51449 section 1 of 6 of the complete
           genome.>gb:AE017125_1024194 Helicobacter hepaticus ATCC
           51449 complete genome.
          Length = 280

 Score = 33.9 bits (76), Expect = 4.5
 Identities = 17/48 (35%), Positives = 26/48 (54%)
 Frame = -2

Query: 910 ELAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEG 767
           +L A     + GV++ H++DG I   L  ELF   G+GT    ++Y G
Sbjct: 234 KLEACVDCVQNGVEKAHIIDGRIEHSLLLELFTTQGIGT----EIYNG 277



>gb:AE016814_1745728 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome I, complete sequence.
          Length = 159

 Score = 33.5 bits (75), Expect = 5.9
 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 4/55 (7%)
 Frame = -2

Query: 571 VASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTA----DWFIRRGF 419
           + ++AV    RG+G G KLLDY+EK+      + +++    +A     W+   GF
Sbjct: 80  IDTLAVLEAYRGKGVGTKLLDYVEKETKPFQPRAIYVTVAASATGELQWYQSHGF 134



>gb:BX640432_811164 Bordetella parapertussis strain 12822, complete
           genome; segment 10/14.
          Length = 154

 Score = 33.5 bits (75), Expect = 5.9
 Identities = 38/128 (29%), Positives = 51/128 (39%), Gaps = 23/128 (17%)
 Frame = -2

Query: 763 RMARATDIPGIKQIL----------------QP--LEEFGTLIRRTEVELLEALDSFIVV 638
           R A ATD+P I  +L                QP  L  FG + R     L        VV
Sbjct: 8   RRAAATDLPAIIALLADDALGQQREDPTMPPQPAYLAAFGAIDRDPNQFLA-------VV 60

Query: 637 EREGQIIACAAL--FPYLKEK---CGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQ 473
           ER GQII C  L   P L  +    G++ S+ V+   RG G G  L ++   +    G  
Sbjct: 61  ERAGQIIGCLQLSFIPGLSRRGLWRGQIESVRVAASERGAGTGRALFEWAIAQCRDKGCG 120

Query: 472 KLFLLTTR 449
            + L T +
Sbjct: 121 LVQLTTDK 128



>gb:BX571659_778334 Wolinella succinogenes, complete genome; segment
           3/7.
          Length = 169

 Score = 33.5 bits (75), Expect = 5.9
 Identities = 36/135 (26%), Positives = 56/135 (41%), Gaps = 15/135 (11%)
 Frame = -2

Query: 778 LYEGTRMARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALF 599
           L+E  R+   T +    Q L  L+E      R + E L+ L SF +     +I+ C AL 
Sbjct: 22  LWEQFRLHYGTKVSS--QRLMELQE------RFKKERLDPLYSFFIALEGEEIVGCIALS 73

Query: 598 P-----------YLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLT- 455
           P           Y +   GE+    V    + QG G  L     ++A   G + L+L T 
Sbjct: 74  PYDQRISSLRLRYTEGFVGEIGRCYVKESLQRQGIGSFLFKQALQRAQEIGYETLYLHTH 133

Query: 454 ---TRTADWFIRRGF 419
              +   D++ +RGF
Sbjct: 134 PFLSGGFDFWKKRGF 148



>gb:BA000040_729348 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 143

 Score = 33.5 bits (75), Expect = 5.9
 Identities = 15/52 (28%), Positives = 27/52 (51%)
 Frame = -2

Query: 580 CGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRR 425
           C  +  +AV PDC+GQG G ++++ +  +   H  +K+ L      + F  R
Sbjct: 66  CAYLCDVAVRPDCQGQGLGREIIERLLARCRGH--RKIILYAVPGKEGFYER 115



>gb:BA000038_725047 Vibrio vulnificus YJ016 DNA, chromosome II,
           complete sequence.
          Length = 156

 Score = 33.5 bits (75), Expect = 5.9
 Identities = 25/65 (38%), Positives = 35/65 (53%), Gaps = 2/65 (3%)
 Frame = -2

Query: 649 FIVVEREGQIIACAALFPYLKEKCGE--VASIAVSPDCRGQGQGDKLLDYIEKKASSHGI 476
           FIV E E QI     + P    KC E  + S+AVSP  +G+G   KL+ Y   + S +  
Sbjct: 45  FIVAECEHQIAGYVLIVPKAG-KCNEAWMLSLAVSPAYQGRGIAKKLVKYALARQSHY-- 101

Query: 475 QKLFL 461
           QK++L
Sbjct: 102 QKIYL 106



>gb:BA000037_723454 Vibrio vulnificus YJ016 DNA, chromosome I,
           complete sequence.
          Length = 366

 Score = 33.5 bits (75), Expect = 5.9
 Identities = 25/102 (24%), Positives = 48/102 (47%), Gaps = 1/102 (0%)
 Frame = -2

Query: 763 RMARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLK- 587
           R+A+  D+  + ++ + L     +  R     +++  + ++V   GQ +A  AL  + + 
Sbjct: 4   RVAKIADLDALNRLERELFVGDRIAPRQMKRFIQSEHAVLLVADSGQQLAGYALLLFHQG 63

Query: 586 EKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFL 461
            +   + SIAV P+ RGQ     L++  E+ A   G   L L
Sbjct: 64  TQLSRLYSIAVRPEFRGQKIAQSLIELCEQSAIEQGFTTLRL 105



>gb:BA000030_698590 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 165

 Score = 33.5 bits (75), Expect = 5.9
 Identities = 31/118 (26%), Positives = 51/118 (43%), Gaps = 3/118 (2%)
 Frame = -2

Query: 805 GVGTMVASD--LYEGTRMARATDIP-GIKQILQPLEEFGTLIRRTEVELLEALDSFIVVE 635
           G+ T+ + D  L+   R+A  TD P      L   +  G    R    L       +V  
Sbjct: 3   GLRTLESDDWPLWRELRLAALTDAPYAFGSTLAEWQGSGDREERWRTRLSIPGARDLVAL 62

Query: 634 REGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFL 461
            +G  +   +  P  + +  E+ S+ V+P  RGQG GD L+  +E+  +  G + L L
Sbjct: 63  LDGLPVGMVSGVPGGEAENVELISLWVNPTARGQGVGDYLIQAVERWGAERGARTLRL 120



>gb:AL935253_550665 Lactobacillus plantarum strain WCFS1 complete
           genome; segment 2/11.
          Length = 160

 Score = 33.5 bits (75), Expect = 5.9
 Identities = 21/91 (23%), Positives = 48/91 (52%), Gaps = 1/91 (1%)
 Frame = -2

Query: 649 FIVVEREGQIIA-CAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQ 473
           +IV+  E +++A C  +F   ++    + +IAV PD +GQG G  ++  + K+A     Q
Sbjct: 50  YIVMRHEDRLVAFCGCVFDDRRQDA-HITNIAVHPDVQGQGLGHFMMQVMMKRARKLHYQ 108

Query: 472 KLFLLTTRTADWFIRRGFSECSIDQLPVERR 380
            +  L  R ++   ++ + +   ++  +++R
Sbjct: 109 TV-TLEVRYSNTIAQQLYRDLGFEKTGIKKR 138



>gb:AE017355_462763 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.
          Length = 155

 Score = 33.5 bits (75), Expect = 5.9
 Identities = 16/41 (39%), Positives = 25/41 (60%)
 Frame = -2

Query: 589 KEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKL 467
           + K  E+ +IAV    +G+G G KLL++  + A  HG+ KL
Sbjct: 56  RPKTMEIMNIAVVEHLQGKGIGKKLLEHAVETAKEHGMSKL 96



>gb:AE017333_448143 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_857952 Bacillus licheniformis ATCC
           14580, complete genome.>gb:AX930200_1483880 Sequence 156
           from Patent WO03087148.
          Length = 256

 Score = 33.5 bits (75), Expect = 5.9
 Identities = 24/109 (22%), Positives = 47/109 (43%)
 Frame = -2

Query: 778 LYEGTRMARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALF 599
           L +G RM +A D   I +     +    L+R+        +   +    EG+ I CA L+
Sbjct: 123 LIDGCRMMQAYDTLSINEAFAKEK----LLRKYPFYEEGIIQLCVCYSEEGEPIGCAELY 178

Query: 598 PYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTT 452
               E   ++  +A+    + +G G  L+  +   A   G++  +L+T+
Sbjct: 179 LDHDENVAKIEEVAILEPYQRKGYGSGLIKQMLTAAKQSGMESCYLVTS 227



>gb:AE016802_336445 Vibrio vulnificus CMCP6 chromosome I section 6
           of 11 of the complete sequence.>gb:AE016795_1046169
           Vibrio vulnificus CMCP6 chromosome I complete sequence.
          Length = 366

 Score = 33.5 bits (75), Expect = 5.9
 Identities = 25/102 (24%), Positives = 48/102 (47%), Gaps = 1/102 (0%)
 Frame = -2

Query: 763 RMARATDIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLK- 587
           R+A+  D+  + ++ + L     +  R     +++  + ++V   GQ +A  AL  + + 
Sbjct: 4   RVAKIADLDALNRLERELFVGDRIAPRQMKRFIQSEHAVLLVADSGQQLAGYALLLFHQG 63

Query: 586 EKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFL 461
            +   + SIAV P+ RGQ     L++  E+ A   G   L L
Sbjct: 64  TQLSRLYSIAVRPEFRGQKIAQSLIELCEQSAIEQGFTTLRL 105



>gb:AE014295_311445 Bifidobacterium longum NCC2705, complete genome.
          Length = 318

 Score = 33.5 bits (75), Expect = 5.9
 Identities = 17/41 (41%), Positives = 23/41 (56%)
 Frame = -2

Query: 880 GGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRM 758
           GGV + H++DG     +  E+F   G+GTMV  D  EG  M
Sbjct: 274 GGVPQAHVIDGRKPHSILNEIFTSAGIGTMVMPD--EGLEM 312



>gb:AE010690_265709 Methanosarcina acetivorans str. C2A, section 35
           of 534 of the complete genome.>gb:AE010299_906268
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 130

 Score = 33.5 bits (75), Expect = 5.9
 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 4/54 (7%)
 Frame = -2

Query: 562 IAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFL----LTTRTADWFIRRGFSE 413
           +AV PD R +G G  L+D++ + A  +G +K+ +       R  +W+ + GF E
Sbjct: 56  LAVHPDSRHRGYGGYLIDFVVEYAKQNGGKKVSIGIINENERLKNWYRKYGFEE 109



>pir|AF1821|AF1821 hypothetical protein all0118 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_681110 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 156

 Score = 33.5 bits (75), Expect = 5.9
 Identities = 12/48 (25%), Positives = 28/48 (58%)
 Frame = -2

Query: 562 IAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTADWFIRRGF 419
           + + PD +G G G KL++ +        +++++L+TT   +++ + GF
Sbjct: 77  VVIHPDYQGNGLGSKLVETVLAHPRMRWVERVYLMTTNRQEFYEKIGF 124



>sp|P59300|ARGB_PSEPK Acetylglutamate kinase (EC 2.7.2.8) (NAG
           kinase) (AGK) (N-acetyl-L- glutamate
           5-phosphotransferase).>gb:AE016793_334668 Pseudomonas
           putida KT2440 section 20 of 21 of the complete
           genome.>gb:AE015451_949745 Pseudomonas putida KT2440
           complete genome.
          Length = 301

 Score = 33.5 bits (75), Expect = 5.9
 Identities = 13/43 (30%), Positives = 24/43 (55%)
 Frame = -2

Query: 910 ELAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVAS 782
           ++  A    +GGV   H++DG +   +  E+F   GVGT++ +
Sbjct: 255 KIKCALDAVQGGVNSSHIIDGRVPNAVLLEIFTDSGVGTLITN 297



>sp|P59295|ARGB_BIFLO Acetylglutamate kinase (EC 2.7.2.8) (NAG
           kinase) (AGK) (N-acetyl-L- glutamate
           5-phosphotransferase).
          Length = 305

 Score = 33.5 bits (75), Expect = 5.9
 Identities = 17/41 (41%), Positives = 23/41 (56%)
 Frame = -2

Query: 880 GGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRM 758
           GGV + H++DG     +  E+F   G+GTMV  D  EG  M
Sbjct: 261 GGVPQAHVIDGRKPHSILNEIFTSAGIGTMVMPD--EGLEM 299



>gb:AY657275_2146285 Synthetic construct Peudomonas aeruginosa clone
           FLH043286.01F PA4534 gene, partial cds.
          Length = 142

 Score = 33.1 bits (74), Expect = 7.7
 Identities = 20/69 (28%), Positives = 34/69 (49%)
 Frame = -2

Query: 646 IVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKL 467
           ++VE EG++IAC  L      + G +  + V P  RG G   ++LD +  + +  GI K 
Sbjct: 47  LLVETEGEVIAC--LMAGHDGRRGYLQHLVVDPGYRGLGLARRMLDEVLARLAREGIGKS 104

Query: 466 FLLTTRTAD 440
            +     A+
Sbjct: 105 HVFVLDAAE 113



>gb:AX878780_1477558 Sequence 13685 from Patent
           EP1074617.>gb:AK021889_1908994 Homo sapiens cDNA
           FLJ11827 fis, clone HEMBA1006502.
          Length = 142

 Score = 33.1 bits (74), Expect = 7.7
 Identities = 28/81 (34%), Positives = 37/81 (45%)
 Frame = +1

Query: 520 CLLVLDLDNQEKQQ*KQPLHIFLLSMEREQHKL*FDPLFPQQ*MNPRPQEALPQSS*SMF 699
           CL   D+ N  K    +PL I+LL M      L   PLFP   + P+P + L Q      
Sbjct: 65  CLTTADIHNAMKNG--EPLLIYLLIMI----PLTSSPLFPSSSLFPQPNKKLKQ------ 112

Query: 700 QTLLKVAIFVLFQEYLLPLPF 762
                + IFVLF  YL+ L +
Sbjct: 113 -----IHIFVLFFAYLVLLSY 128



>gb:BA000016_675206 Clostridium perfringens str. 13 DNA, complete
           genome.
          Length = 148

 Score = 33.1 bits (74), Expect = 7.7
 Identities = 21/73 (28%), Positives = 35/73 (47%)
 Frame = -2

Query: 679 EVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIE 500
           E EL   L  ++V     ++I    ++    E  G++ +IAV P+ R QG G+ L+D + 
Sbjct: 35  EKELSNKLAKYLVALHGDKVIGFVGMWIVFHE--GDITNIAVHPEYRKQGVGNLLIDNLI 92

Query: 499 KKASSHGIQKLFL 461
                + I  L L
Sbjct: 93  TLCKENNINSLTL 105



>gb:AY596297_632417 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 179

 Score = 33.1 bits (74), Expect = 7.7
 Identities = 22/92 (23%), Positives = 41/92 (44%), Gaps = 4/92 (4%)
 Frame = -2

Query: 652 SFIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQ 473
           + +V E++G+II             G +  + V P+  G+G G  L D +E     HG++
Sbjct: 69  TLLVAEQDGEIIGFTQ--GITMHTMGTMLRLYVHPEHHGEGVGTALYDRLEDIFLEHGVE 126

Query: 472 KLFLL----TTRTADWFIRRGFSECSIDQLPV 389
           +   L      R+ ++F   GF   ++  L +
Sbjct: 127 QFRALDLASNDRSREFFENLGFERTNVRTLTI 158



>gb:AP008231_582177 Synechococcus elongatus PCC 6301 DNA, complete
           genome.>gb:AY354518_612704 Synechococcus elongatus PCC
           7942 ArgB gene, complete cds.
          Length = 301

 Score = 33.1 bits (74), Expect = 7.7
 Identities = 14/35 (40%), Positives = 20/35 (57%)
 Frame = -2

Query: 877 GVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLY 773
           GV+  H++DG I   L  E+F   G+GTM+    Y
Sbjct: 259 GVRAAHIIDGRIPHALLLEIFTDAGIGTMIVGSGY 293



>gb:AP006841_574340 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 151

 Score = 33.1 bits (74), Expect = 7.7
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 4/72 (5%)
 Frame = -2

Query: 649 FIVVEREGQIIACAAL----FPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSH 482
           ++++  EG+II CA L    F    +    + ++ +    RG   G+ L+  +E+     
Sbjct: 51  YLLINGEGEIIGCAGLATNDFNSRMDLYPWLVALFIEEQYRGHNYGNLLIKAVEEDTRRL 110

Query: 481 GIQKLFLLTTRT 446
           G   L+L TT T
Sbjct: 111 GFGNLYLCTTHT 122



>gb:AF521015_518779 Rhizobium vitis strain F2/5 partial genomic
           sequence.
          Length = 440

 Score = 33.1 bits (74), Expect = 7.7
 Identities = 30/128 (23%), Positives = 53/128 (41%), Gaps = 6/128 (4%)
 Frame = -2

Query: 910 ELAAAAFVCRGGVQ------RVHLLDGTIGGVLFKELFQRDGVGTMVASDLYEGTRMARA 749
           ++A AA + R G+       R+  LDG I G    +L+QR      V + L   TR+A  
Sbjct: 194 DIARAALLTRDGLDLRAYWDRIDALDGEISGEAQNDLYQRVATVYRVFTKLAIDTRLAAG 253

Query: 748 TDIPGIKQILQPLEEFGTLIRRTEVELLEALDSFIVVEREGQIIACAALFPYLKEKCGEV 569
                ++++   ++ F    R      +   D    +  E   +  A +   L E   E+
Sbjct: 254 DLSDVVRKLKSAIKSFKGFSRS-----VTPADFSAQISAEASAMTAAGVPEDLAEDLAEL 308

Query: 568 ASIAVSPD 545
            S+ V+P+
Sbjct: 309 WSLTVTPE 316



>gb:AE017272_423852 Bacillus cereus ATCC 10987, section 9 of 18 of
           the complete genome.>gb:BC332AB_748097 B.cereus DNA, two
           genes with unknown function.>gb:AE017194_1062271
           Bacillus cereus ATCC 10987, complete genome.
          Length = 145

 Score = 33.1 bits (74), Expect = 7.7
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 4/53 (7%)
 Frame = -2

Query: 562 IAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLTTRTA----DWFIRRGFS 416
           + V+ D RG G G+KLL ++E+ + + G  ++ LL++ T      +F + G++
Sbjct: 79  VIVNEDFRGNGIGEKLLKHVEEISITRGSTRIILLSSATRIKAHKFFTKNGYN 131



>gb:AE016917_357151 Chromobacterium violaceum ATCC 12472 section 8
           of 16 of the complete genome.>gb:AE016825_1042305
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 387

 Score = 33.1 bits (74), Expect = 7.7
 Identities = 18/46 (39%), Positives = 26/46 (56%)
 Frame = -2

Query: 649 FIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLL 512
           ++ V+R+GQ +    + P      GEVA + VSP CR QG   +LL
Sbjct: 299 WLSVDRDGQTLGSLLMSPD-----GEVAELQVSPPCRRQGIASQLL 339



>gb:AE013429_292258 Methanosarcina mazei strain Goe1, section 211 of
           379 of the complete genome.>gb:AE008384_966367
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 177

 Score = 33.1 bits (74), Expect = 7.7
 Identities = 38/161 (23%), Positives = 67/161 (41%), Gaps = 21/161 (13%)
 Frame = -2

Query: 763 RMARATDIPGIKQILQPL--------------EEFGTLIRRTEVELLEALDSFIVVEREG 626
           R A   DIPG+ ++                   EF  LI+  + +  +    F V+E + 
Sbjct: 13  REASTEDIPGMLEVFNYYVENSFASYLENSVGPEFFQLIQSEKDQDRDDHFPFYVIEEDS 72

Query: 625 QIIACAAL---FPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFLLT 455
           +II   AL   FP+   +   V S  + P    +G G  +L+ +  +A    +Q L    
Sbjct: 73  KIIGIGALRPYFPFPNFRHTGVVSYFILPAYTRKGLGSMMLEKLCMEAREKKMQSLLANV 132

Query: 454 T----RTADWFIRRGFSECSIDQLPVERRKKINLSRGSKYY 344
           +     + ++ +++GF EC        R KK+  S+  KY+
Sbjct: 133 SSKNEASLNFHLKKGFIECG-------RFKKVG-SKFGKYF 165



>gb:CR543861_102896 Acinetobacter sp. ADP1 complete genome.
          Length = 303

 Score = 33.1 bits (74), Expect = 7.7
 Identities = 14/46 (30%), Positives = 25/46 (54%)
 Frame = -2

Query: 910 ELAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLY 773
           ++  A    +GGV   H++DG +      E+F   GVGT++ + L+
Sbjct: 253 KVGCALDAVKGGVVSAHIVDGRVPHATLLEIFTDHGVGTLITNRLH 298



>pir|B83079|B83079 hypothetical protein PA4534 [imported] -
           Pseudomonas aeruginosa (strain PAO1)>gb:AE004867_58769
           Pseudomonas aeruginosa PAO1, section 428 of 529 of the
           complete genome.>gb:AE004091_972869 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 141

 Score = 33.1 bits (74), Expect = 7.7
 Identities = 20/69 (28%), Positives = 34/69 (49%)
 Frame = -2

Query: 646 IVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKL 467
           ++VE EG++IAC  L      + G +  + V P  RG G   ++LD +  + +  GI K 
Sbjct: 47  LLVETEGEVIAC--LMAGHDGRRGYLQHLVVDPGYRGLGLARRMLDEVLARLAREGIGKS 104

Query: 466 FLLTTRTAD 440
            +     A+
Sbjct: 105 HVFVLDAAE 113



>pir|D84223|D84223 hypothetical protein Vng0654c [imported] -
           Halobacterium sp. NRC-1>gb:AE005013_62312 Halobacterium
           sp. NRC-1 section 44 of 170 of the complete
           genome.>gb:AE004437_887231 Halobacterium sp. NRC-1
           complete genome.
          Length = 247

 Score = 33.1 bits (74), Expect = 7.7
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 3/64 (4%)
 Frame = -2

Query: 649 FIVVEREGQIIACAALFPYLKEKCGEVASIA---VSPDCRGQGQGDKLLDYIEKKASSHG 479
           ++V ER+  ++  +       E+ G+VA+I    V PD RG G G  LL   E     HG
Sbjct: 59  YLVAERDDAVVGFSE-----SERDGDVAAIQWLHVHPDARGDGVGGSLLSDTETHLLEHG 113

Query: 478 IQKL 467
             ++
Sbjct: 114 ASRI 117



>pir|C84294|C84294 hypothetical protein Vng1398c [imported] -
           Halobacterium sp. NRC-1>gb:AE005058_62879 Halobacterium
           sp. NRC-1 section 89 of 170 of the complete
           genome.>gb:AE004437_887798 Halobacterium sp. NRC-1
           complete genome.
          Length = 147

 Score = 33.1 bits (74), Expect = 7.7
 Identities = 25/101 (24%), Positives = 44/101 (43%), Gaps = 7/101 (6%)
 Frame = -2

Query: 661 ALDSFIVVEREGQIIACAALFPYLKEKCGEVASIAVSPDCRGQGQGDKLLDYIEKKASSH 482
           A D+    +   + +A A L  Y +   G+V  +AV    RG G G  ++D +E  A   
Sbjct: 47  AYDTMTGSQDATRAVAAARLRAY-EGSVGKVERVAVRASRRGNGVGATVMDAVEDAARER 105

Query: 481 GIQKLFLLTTRTADWFIRRG-------FSECSIDQLPVERR 380
             +      +R A+++  RG       F E  I+ + + +R
Sbjct: 106 FAELYLHAQSRVAEFYATRGYHREGEPFMEAGIEHVAMRKR 146



>pir|D70477|D70477 acetylglutamate kinase - Aquifex
           aeolicus>gb:AE000771_27203 Aquifex aeolicus VF5 section
           103 of 109 of the complete genome.>gb:AE000657_977734
           Aquifex aeolicus VF5 complete genome.
          Length = 272

 Score = 33.1 bits (74), Expect = 7.7
 Identities = 12/30 (40%), Positives = 22/30 (73%)
 Frame = -2

Query: 877 GVQRVHLLDGTIGGVLFKELFQRDGVGTMV 788
           GV++VH++DG +   +  E+F ++GVGT +
Sbjct: 240 GVKKVHIIDGRVKHSILLEVFTKEGVGTEI 269



>sp|P43577|GNA1_YEAST Glucosamine 6-phosphate N-acetyltransferase
           (EC 2.3.1.4) (Phosphoglucosamine transacetylase)
           (Phosphoglucosamine acetylase).>pir|S56237|S56237
           glucosamine-phosphate N-acetyltransferase (EC 2.3.1.4)
           [validated] - yeast (Saccharomyces
           cerevisiae)>gb:AB017626_1513662 Saccharomyces cerevisiae
           ScGNA1 gene for acetyltransferase, complete
           cds.>gb:AY558564_1614791 Saccharomyces cerevisiae clone
           FLH111578.01X YFL017C gene, complete
           cds.>gb:YSCCHRVIN_1728492 Saccharomyces cerevisiae
           chromosome VI complete DNA sequence.
          Length = 159

 Score = 33.1 bits (74), Expect = 7.7
 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 1/61 (1%)
 Frame = -2

Query: 580 CGEVASIAVSPDCRGQGQGDKLLDYIEKKASSHGIQKLFL-LTTRTADWFIRRGFSECSI 404
           CG +  IAV+   +GQG G  L+D +      +G  K+ L    +   ++ + GFS   +
Sbjct: 94  CGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSNAGV 153

Query: 403 D 401
           +
Sbjct: 154 E 154



>sp|Q7VD84|ARGB_PROMA Acetylglutamate kinase (EC 2.7.2.8) (NAG
           kinase) (AGK) (N-acetyl-L- glutamate
           5-phosphotransferase).>gb:AE017162_394956
           Prochlorococcus marinus subsp. marinus str. CCMP1375
           section 2 of 6 of the complete
           genome.>gb:AE017126_1030625 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 304

 Score = 33.1 bits (74), Expect = 7.7
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = -2

Query: 877 GVQRVHLLDGTIGGVLFKELFQRDGVGTMVAS 782
           GV   H++DG I   L  E+F   G+GTM+ S
Sbjct: 271 GVNAAHIIDGRIPHALLLEVFTDKGIGTMIVS 302



>sp|Q9JUK2|ARGB_NEIMA Acetylglutamate kinase (EC 2.7.2.8) (NAG
           kinase) (AGK) (N-acetyl-L- glutamate
           5-phosphotransferase).>pir|G81895|G81895 probable
           acetylglutamate kinase (EC 2.7.2.8) NMA1275 [imported] -
           Neisseria meningitidis (strain Z2491 serogroup
           A)>gb:NMA4Z2491_154184 Neisseria meningitidis serogroup
           A strain Z2491 complete genome; segment 4/7.
          Length = 298

 Score = 33.1 bits (74), Expect = 7.7
 Identities = 13/41 (31%), Positives = 24/41 (58%)
 Frame = -2

Query: 910 ELAAAAFVCRGGVQRVHLLDGTIGGVLFKELFQRDGVGTMV 788
           ++A+A      GV+  H++DG +   L  E+F   G+G+M+
Sbjct: 251 KIASAVEAAVNGVKATHIIDGRVPNALLLEIFTDAGIGSMI 291



>sp|O67848|ARGB_AQUAE Acetylglutamate kinase (EC 2.7.2.8) (NAG
           kinase) (AGK) (N-acetyl-L- glutamate
           5-phosphotransferase).
          Length = 298

 Score = 33.1 bits (74), Expect = 7.7
 Identities = 12/30 (40%), Positives = 22/30 (73%)
 Frame = -2

Query: 877 GVQRVHLLDGTIGGVLFKELFQRDGVGTMV 788
           GV++VH++DG +   +  E+F ++GVGT +
Sbjct: 266 GVKKVHIIDGRVKHSILLEVFTKEGVGTEI 295



>sp|Q8YXG8|ARGB_ANASP Acetylglutamate kinase (EC 2.7.2.8) (NAG
           kinase) (AGK) (N-acetyl-L- glutamate
           5-phosphotransferase).>pir|AB1962|AB1962 acetylglutamate
           kinase [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_682236 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 297

 Score = 33.1 bits (74), Expect = 7.7
 Identities = 14/35 (40%), Positives = 20/35 (57%)
 Frame = -2

Query: 877 GVQRVHLLDGTIGGVLFKELFQRDGVGTMVASDLY 773
           GV+  H++DG I   L  E+F   G+GTM+    Y
Sbjct: 262 GVRAAHIIDGRIPHALLLEIFTDVGIGTMILGSQY 296


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 986,614,314
Number of Sequences: 1806583
Number of extensions: 21387393
Number of successful extensions: 47068
Number of sequences better than 10.0: 245
Number of HSP's better than 10.0 without gapping: 45390
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 47033
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 64064401257
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)