BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10566
         (584 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T45739|T45739 transcription factor-like protein - Arabidopsi...   147   9e-35   Arabidopsis thaliana [mouse-ear cress]
gb:AB022211_1514983 Arabidopsis thaliana genomic DNA, chromosome...   147   1e-34   
gb:AP004839_1845774 Oryza sativa (japonica cultivar-group) genom...   143   2e-33   
gb:AB107692_1526750 Nicotiana tabacum AGP4 mRNA for AG-motif bin...   139   4e-32   
pir|T04593|T04593 hypothetical protein F23E13.130 - Arabidopsis ...   133   2e-30   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00022_1693442 Oryza sativa genomic DNA, chromosome 4, BAC...   132   4e-30   
gb:AY087597_1572627 Arabidopsis thaliana clone 36927 mRNA, compl...   127   1e-28   
gb:AB107690_1526748 Nicotiana tabacum AGP2 mRNA for AG-motif bin...   127   1e-28   
pir|T52103|T52103 GATA-binding transcription factor homolog 1 [i...   127   1e-28   Arabidopsis thaliana [mouse-ear cress]
pir|T47864|T47864 GATA transcription factor 4 - Arabidopsis thal...   127   2e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AY099790_1576815 Arabidopsis thaliana GATA transcription fact...   126   3e-28   
pir|T05288|T05288 GATA-binding transcription factor homolog 3 [i...   126   3e-28   Arabidopsis thaliana [mouse-ear cress]
pir|H85408|H85408 GATA transcription factor 3 [imported] - Arabi...   126   3e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AB107691_1526749 Nicotiana tabacum AGP3 mRNA for AG-motif bin...   125   6e-28   
gb:AE016959_1023793 Oryza sativa (japonica cultivar-group) chrom...   122   3e-27   
gb:AC069158_1540658 Genomic Sequence for Oryza sativa, Nipponbar...   122   4e-27   
pir|T52104|T52104 GATA-binding transcription factor homolog 2 [i...   122   4e-27   Arabidopsis thaliana [mouse-ear cress]
pir|T05297|T05297 hypothetical protein F26P21.10 - Arabidopsis t...   122   5e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AP003376_1828756 Oryza sativa (japonica cultivar-group) genom...   120   2e-26   
pir|T06739|T06739 hypothetical protein F28P10.210 - Arabidopsis ...   119   4e-26   Arabidopsis thaliana [mouse-ear cress]
gb:AC130611_1740892 Oryza sativa (japonica cultivar-group) chrom...   119   5e-26   
gb:AC119796_1739717 Oryza sativa (japonica cultivar-group) chrom...   117   1e-25   
gb:NTL17_1691595 Nicotiana tabacum mRNA for GATA-1 zinc finger p...   117   1e-25   
gb:AB107693_1526751 Nicotiana tabacum AGP5 mRNA for AG-motif bin...   117   1e-25   
gb:AB107689_1526747 Nicotiana tabacum AGP1 mRNA for AG-motif bin...   117   1e-25   
gb:BT014974_1641944 Arabidopsis thaliana At1g08010 gene, complet...   117   2e-25   
gb:AE005172_889808 Arabidopsis thaliana chromosome 1, top arm co...   117   2e-25   
gb:AY063953_1565898 Arabidopsis thaliana putative GATA transcrip...   113   2e-24   
pir|T47457|T47457 hypothetical protein T14D3.110 - Arabidopsis t...   110   1e-23   Arabidopsis thaliana [mouse-ear cress]
gb:AC096781_1736344 Oryza sativa chromosome 10 BAC OSJNBa0013H08...   102   4e-21   
gb:AE016959_1022927 Oryza sativa (japonica cultivar-group) chrom...   102   4e-21   
pir|F84683|F84683 hypothetical protein At2g28340 [imported] - Ar...   100   2e-20   Arabidopsis thaliana [mouse-ear cress]
pir|S46419|S46419 NTL1 protein - curled-leaved tobacco                 99   6e-20   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb:AC098693_1736835 Oryza sativa (japonica cultivar-group) chrom...    97   2e-19   
gb:AP004729_1843879 Oryza sativa (japonica cultivar-group) genom...    57   2e-07   
pir|F84563|F84563 hypothetical protein At2g18380 [imported] - Ar...    57   2e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AP003284_1827250 Oryza sativa (japonica cultivar-group) genom...    57   3e-07   
gb:AC098571_1736760 Oryza sativa (japonica cultivar-group) chrom...    57   3e-07   
gb:AC133339_1741412 Oryza sativa chromosome 3 BAC OSJNBa0078D06 ...    55   6e-07   
gb:AP004344_1840555 Oryza sativa (japonica cultivar-group) genom...    55   8e-07   
gb:AY530746_1611895 Arabidopsis thaliana At4g36620 gene, partial...    55   8e-07   
gb:AY086746_1571789 Arabidopsis thaliana clone 27213 mRNA, compl...    55   8e-07   
pir|T08408|T08408 transcription factor homolog F18B3.150 - Arabi...    55   8e-07   Arabidopsis thaliana [mouse-ear cress]
pir|D85432|D85432 transcription factor like protein [imported] -...    55   8e-07   Arabidopsis thaliana [mouse-ear cress]
gb:CR380958_1653367 Candida glabrata strain CBS138 chromosome L ...    55   1e-06   
gb:AB016872_1512922 Arabidopsis thaliana genomic DNA, chromosome...    54   1e-06   
gb:AP005797_1857946 Oryza sativa (japonica cultivar-group) genom...    54   2e-06   
gb:AY086778_1571821 Arabidopsis thaliana clone 27625 mRNA, compl...    54   2e-06   
gb:DDU68754_1377407 Dictyostelium discoideum putative transcript...    54   2e-06   
gb:AC116977_1206928 Dictyostelium discoideum chromosome 2 map 55...    54   2e-06   
pir|T01770|T01770 hypothetical protein A_IG002P16.9 - Arabidopsi...    54   2e-06   Arabidopsis thaliana [mouse-ear cress]
sp|P40209|GAT2_YEAST|GAT2_YEAST GAT2 protein.>pir|S50392|S50392 hypothetica...    54   2e-06   Saccharomyces cerevisiae [brewer's yeast]
gb:AY084525_1569614 Arabidopsis thaliana clone 110655 mRNA, comp...    53   3e-06   
gb:AY065074_1566228 Arabidopsis thaliana unknown protein (At5g56...    53   3e-06   
gb:AY063926_1565873 Arabidopsis thaliana unknown protein (At3g06...    53   3e-06   
gb:ATAC023912_1543781 Arabidopsis thaliana chromosome III BAC F3...    53   3e-06   
gb:AB020747_1514633 Arabidopsis thaliana genomic DNA, chromosome...    53   3e-06   
pir|T04270|T04270 hypothetical protein F20B18.260 - Arabidopsis ...    53   3e-06   Arabidopsis thaliana [mouse-ear cress]
gb:CR380955_1651556 Candida glabrata strain CBS138 chromosome I ...    53   4e-06   
gb:BT020259_1642654 Arabidopsis thaliana At5g47140 gene, complet...    52   9e-06   
gb:AP003228_1825696 Oryza sativa (japonica cultivar-group) genom...    51   1e-05   
gb:CR382132_1665160 Yarrowia lipolytica chromosome F of strain C...    51   1e-05   
gb:CNS09S4S_1648273 DNA centromeric region sequence from BAC DP2...    51   1e-05   
gb:AF082072_1766577 Emericella nidulans ABC transporter protein ...    51   2e-05   
gb:OSJN00102_1694951 Oryza sativa genomic DNA, chromosome 4, BAC...    51   2e-05   
gb:ENU70043_1676807 Aspergillus nidulans NsdD (nsdD) gene, compl...    51   2e-05   
pir|S69206|S69206 regulator protein white collar 1 - Neurospora ...    51   2e-05   Neurospora crassa
sp|Q01371|WC1_NEUCR|WC1_NEUCR White collar 1 protein (WC1).>gb:NCDNAWC1_16...    51   2e-05   
gb:AP003329_1827987 Oryza sativa (japonica cultivar-group) genom...    50   2e-05   
gb:AK119021_1816966 Arabidopsis thaliana At4g16141 mRNA for unkn...    50   2e-05   
gb:AE017343_1755878 Cryptococcus neoformans var. neoformans JEC2...    50   2e-05   
gb:BT010844_1640790 Arabidopsis thaliana At3g16870 mRNA, complet...    50   2e-05   
gb:AY823264_1628895 Hypocrea jecorina white collar 1 (WC1) gene,...    50   3e-05   
gb:AY628431_1618571 Trichoderma atroviride blue light regulator ...    50   3e-05   
gb:AY062562_1565218 Arabidopsis thaliana Unknown protein (Z97343...    50   3e-05   
gb:CR382138_1671875 Debaryomyces hansenii chromosome F of strain...    50   3e-05   
gb:CR382137_1669842 Debaryomyces hansenii chromosome E of strain...    50   3e-05   
gb:AY882438_1631940 Cryptococcus neoformans var. neoformans whit...    50   3e-05   
gb:AY823265_1628896 Hypocrea jecorina white collar 2 (WC2) gene,...    50   3e-05   
sp|P78714|WC2_NEUCR|WC2_NEUCR White collar 2 protein (WC2).>pir|T46648|T46...    50   3e-05   
sp|Q00858|CGPB_FUSSO|CGPB_FUSSO Cutinase gene palindrome-binding protein (P...    50   3e-05   
gb:NC123A4_1688273 Neurospora crassa DNA linkage group V cosmid ...    49   5e-05   
gb:CR382139_1672133 Debaryomyces hansenii chromosome G of strain...    49   5e-05   
gb:CR382131_1664774 Yarrowia lipolytica chromosome E of strain C...    49   5e-05   
gb:AY628432_1618572 Trichoderma atroviride blue light regulator ...    49   5e-05   
gb:AC116922_1206436 Dictyostelium discoideum chromosome 2 map 60...    49   5e-05   
gb:AB025629_1516530 Arabidopsis thaliana genomic DNA, chromosome...    49   6e-05   
gb:CR382126_1659113 Kluyveromyces lactis strain NRRL Y-1140 chro...    48   1e-04   
gb:AB183264_1202537 Dictyostelium discoideum amvA mRNA for GATA ...    48   1e-04   
gb:AF515628_1807470 Emericella nidulans GATA-factor (lreA) gene,...    47   2e-04   
gb:AE016817_1747633 Ashbya gossypii (= Eremothecium gossypii) AT...    47   2e-04   
gb:AY189831_1588432 Penicillium chrysogenum RfeH (rfeH) gene, co...    47   2e-04   
sp|Q07928|GAT3_YEAST|GAT3_YEAST GAT3 protein.>pir|S64835|S64835 hypothetica...    47   2e-04   Saccharomyces cerevisiae [brewer's yeast]
gb:AE016814_1746005 Ashbya gossypii (= Eremothecium gossypii) AT...    47   2e-04   
gb:TBO575416_1724825 Tuber borchii Tbwc-1 gene for tuber borchii...    47   2e-04   
gb:CR380950_1649809 Candida glabrata strain CBS138 chromosome D ...    47   3e-04   
sp|P40349|URB1_USTMA|URB1_USTMA Siderophore biosynthesis regulatory protein...    47   3e-04   Ustilago maydis
gb:AC116922_1206437 Dictyostelium discoideum chromosome 2 map 60...    46   4e-04   
gb:AY347827_1177986 Malus x domestica clone 18-2 putative GATA-t...    46   4e-04   
gb:CR382126_1658787 Kluyveromyces lactis strain NRRL Y-1140 chro...    45   7e-04   
sp|P40569|GAT4_YEAST|GAT4_YEAST GAT4 protein.>pir|S48357|S48357 hypothetica...    45   7e-04   Saccharomyces cerevisiae [brewer's yeast]
gb:CR382131_1663689 Yarrowia lipolytica chromosome E of strain C...    44   0.001   
gb:AC126223_1740539 Oryza sativa (japonica cultivar-group) chrom...    44   0.002   
pir|S63461|S63461 hypothetical protein YPL021w - yeast (Saccharo...    44   0.002   Saccharomyces cerevisiae [brewer's yeast]
sp|Q92259|SREP_PENCH|SREP_PENCH GATA factor SREP.>pir|JC6170|JC6170 GATA-tr...    44   0.002   Penicillium chrysogenum
gb:AF520973_1807869 Candida albicans transcription factor SFU1 g...    43   0.003   
gb:AY603044_1617445 Marchantia polymorpha male-specific transcri...    43   0.003   
gb:AY045906_1561411 Arabidopsis thaliana putative flowering prot...    43   0.003   
gb:AB119061_1527911 Arabidopsis thaliana ZML2 mRNA for GATA-type...    43   0.003   
pir|JC7336|JC7336 zinc-finger protein - Arabidopsis thaliana>gb:...    43   0.003   Arabidopsis thaliana [mouse-ear cress]
pir|T09910|T09910 hypothetical protein T22A6.300 - Arabidopsis t...    43   0.003   Arabidopsis thaliana [mouse-ear cress]
gb:AP004278_1839664 Oryza sativa (japonica cultivar-group) genom...    43   0.004   
gb:AF095898_1767795 Emericella nidulans siderophore biosynthesis...    43   0.004   
gb:CNS07EG9_1372782 chromosome II of strain GB-M1 of Encephalito...    43   0.004   
gb:AF087130_1767233 Neurospora crassa siderophore regulation pro...    42   0.006   
gb:AK118169_1816161 Arabidopsis thaliana At3g21175 mRNA for unkn...    42   0.007   
gb:AE017347_1757817 Cryptococcus neoformans var. neoformans JEC2...    42   0.007   
gb:CR382136_1668722 Debaryomyces hansenii chromosome D of strain...    42   0.007   
gb:AY085109_1570191 Arabidopsis thaliana clone 12996 mRNA, compl...    42   0.007   
gb:AY042817_1560882 Arabidopsis thaliana Unknown protein (MXL8.2...    42   0.007   
gb:AB023045_1515507 Arabidopsis thaliana genomic DNA, chromosome...    42   0.007   
gb:AP005191_1849141 Oryza sativa (japonica cultivar-group) genom...    42   0.009   
gb:AE017342_1754696 Cryptococcus neoformans var. neoformans JEC2...    42   0.009   
gb:AF320976_1785893 Aspergillus nidulans GATA factor AREB gamma ...    41   0.012   
gb:AF320976_1785892 Aspergillus nidulans GATA factor AREB gamma ...    41   0.012   
gb:D83211_1674822 Zygosaccharomyces rouxii DNA for DNA-binding p...    41   0.012   
gb:AF320976_1785894 Aspergillus nidulans GATA factor AREB gamma ...    40   0.021   
pir|T26296|T26296 hypothetical protein W09C2.1 - Caenorhabditis ...    40   0.021   Caenorhabditis elegans [roundworm]
sp|Q01168|NUT1_MAGGR|NUT1_MAGGR Nitrogen regulatory protein NUT1.>gb:U60290...    40   0.021   Magnaporthe grisea
sp|P28515|ELT1_CAEEL|ELT1_CAEEL Transcription factor elt-1.>pir|A41267|A412...    40   0.021   Caenorhabditis elegans [roundworm]
gb:AC087851_1734195 Oryza sativa chromosome 3 BAC OSJNBb0072E24 ...    40   0.027   
gb:CR382139_1672907 Debaryomyces hansenii chromosome G of strain...    40   0.027   
gb:CR382130_1663157 Yarrowia lipolytica chromosome D of strain C...    40   0.027   
gb:AE016819_1749348 Ashbya gossypii (= Eremothecium gossypii) AT...    40   0.036   
gb:BCI309051_1632782 Botrytis cinerea partial bir1 gene for GATA...    40   0.036   
gb:AY293736_1595721 Candida albicans nitrogen regulatory GATA-fa...    40   0.036   
gb:AF320305_1785839 Aspergillus oryzae AreA (areA) gene, complet...    39   0.047   
gb:AF312694_1785205 Cladosporium fulvum nitrogen response factor...    39   0.047   
gb:AF148539_1772329 Aspergillus parasiticus major nitrogen regul...    39   0.047   
gb:MAAJ6468_1685530 Metarhizium anisopliae nrr1 gene.                  39   0.047   
gb:CR382121_1654319 Kluyveromyces lactis strain NRRL Y-1140 chro...    39   0.047   
gb:AY168017_1586323 Colletotrichum lindemuthianum major nitrogen...    39   0.047   
sp|Q92269|NRFA_PENUR|NRFA_PENUR Nitrogen regulatory protein NRFA.>gb:PUU531...    39   0.047   Penicillium urticae
sp|P23767|GA1A_XENLA|GA1A_XENLA GATA binding factor-1A (Transcription facto...    39   0.047   Xenopus laevis [clawed frog]
sp|O13508|AREA_PENRO|AREA_PENRO Nitrogen regulatory protein areA (Nitrogen ...    39   0.047   Penicillium roqueforti
sp|P78688|AREA_GIBFU|AREA_GIBFU Nitrogen regulatory protein areA.>gb:GFAREA...    39   0.047   Fusarium fujikuroi
sp|P17429|AREA_EMENI|AREA_EMENI Nitrogen regulatory protein areA.>pir|A5798...    39   0.047   
sp|O13415|AREA_ASPOR|AREA_ASPOR Nitrogen regulatory protein areA.>gb:AOAJ29...    39   0.047   Aspergillus oryzae
sp|O13412|AREA_ASPNG|AREA_ASPNG Nitrogen regulatory protein areA.>gb:ANAREA...    39   0.047   Aspergillus niger
gb:AE017343_1755454 Cryptococcus neoformans var. neoformans JEC2...    39   0.061   
gb:CR382137_1669611 Debaryomyces hansenii chromosome E of strain...    39   0.061   
gb:AB025609_1516344 Arabidopsis thaliana genomic DNA, chromosome...    39   0.061   
pir|A34755|A34755 nitrogen regulatory protein nit-2 - Neurospora...    39   0.061   Neurospora crassa
sp|P19212|NIT2_NEUCR|NIT2_NEUCR Nitrogen catabolic enzyme regulatory protei...    39   0.061   
gb:AC096689_1736272 Oryza sativa chromosome 3 BAC OSJNBa0027J18 ...    39   0.080   
gb:CR382132_1665689 Yarrowia lipolytica chromosome F of strain C...    39   0.080   
gb:CR380957_1652842 Candida glabrata strain CBS138 chromosome K ...    39   0.080   
gb:CR380949_1649507 Candida glabrata strain CBS138 chromosome C ...    39   0.080   
gb:AY135715_1581783 Phaeosphaeria nodorum AreA protein (areA) ge...    39   0.080   
gb:AY745808_1349241 Aedes aegypti GATA transcription factor GATA...    39   0.080   
pir|T41087|T41087 hypothetical protein SPCC16A11.14 - fission ye...    39   0.080   Schizosaccharomyces pombe
sp|P91623|GATC_DROME|GATC_DROME GATA-binding factor-C (Transcription factor...    39   0.080   Drosophila melanogaster
gb:AE017341_1754024 Cryptococcus neoformans var. neoformans JEC2...    38   0.10    
gb:PCU96385_1699530 Penicillium chrysogenum GATA transcription f...    38   0.10    
gb:CR380950_1649670 Candida glabrata strain CBS138 chromosome D ...    38   0.10    
sp|P23768|GA1B_XENLA|GA1B_XENLA GATA binding factor-1B (Transcription facto...    38   0.10    Xenopus laevis [clawed frog]
gb:DRU18311_2571263 Danio rerio zg1 mRNA, complete cds.                38   0.14    
gb:BC076462_2559298 Danio rerio zgc:91840, mRNA (cDNA clone MGC:...    38   0.14    
gb:AB112062_2465650 Oryzias latipes mRNA for hematopietic transc...    38   0.14    
gb:BT019772_2151532 Synthetic construct Homo sapiens GATA bindin...    38   0.14    
gb:BC052653_2101180 Mus musculus GATA binding protein 1, mRNA (c...    38   0.14    
gb:BC009797_1972268 Homo sapiens GATA binding protein 1 (globin ...    38   0.14    
gb:CR382131_1664139 Yarrowia lipolytica chromosome E of strain C...    38   0.14    
sp|P43429|GAT1_RAT|GAT1_RAT Erythroid transcription factor (GATA-1) (Eryf...    38   0.14    Rattus norvegicus [brown rat]
sp|P17679|GAT1_MOUSE|GAT1_MOUSE Erythroid transcription factor (GATA-1) (Er...    38   0.14    Mus musculus [mouse]
sp|P15976|GAT1_HUMAN|GAT1_HUMAN Erythroid transcription factor (GATA-1) (Er...    38   0.14    Homo sapiens [man]
gb:BC015577_1975186 Homo sapiens GATA binding protein 2, mRNA (c...    37   0.18    
gb:YSCGLN3_1728967 S.cerevisiae nitrogen regulatory protein (GLN...    37   0.18    
gb:CR382126_1659472 Kluyveromyces lactis strain NRRL Y-1140 chro...    37   0.18    
gb:AY699608_1623564 Glomerella cingulata global nitrogen regulat...    37   0.18    
gb:AB043467_1519976 Schizophyllum commune gene for transcription...    37   0.18    
pir|S51493|S51493 major nitrogen regulation protein - Penicilliu...    37   0.18    Penicillium chrysogenum
sp|P18494|GLN3_YEAST|GLN3_YEAST Nitrogen regulatory protein GLN3.>pir|S5054...    37   0.18    Saccharomyces cerevisiae [brewer's yeast]
sp|Q01582|AREA_PENCH|AREA_PENCH Nitrogen regulatory protein areA (Nitrogen ...    37   0.18    Penicillium chrysogenum
gb:AB183298_2467103 Oryzias latipes gata-2 mRNA for transcriptio...    37   0.23    
gb:AE016819_1748904 Ashbya gossypii (= Eremothecium gossypii) AT...    37   0.23    
gb:AC007858_1536265 Oryza sativa (japonica cultivar-group) chrom...    37   0.23    
pir|I50701|I50701 transcription factor GATA-4 - chicken (fragment)     37   0.23    Gallus gallus [bantam]
sp|P43691|GAT4_CHICK|GAT4_CHICK Transcription factor GATA-4 (GATA binding f...    37   0.23    Gallus gallus [bantam]
sp|P43574|GAT1_YEAST|GAT1_YEAST Transcriptional regulatory protein GAT1.>pi...    37   0.23    Saccharomyces cerevisiae [brewer's yeast]
gb:BC075479_2558582 Xenopus tropicalis MGC89310 protein, mRNA (c...    37   0.30    
gb:BC053131_2550524 Danio rerio GATA-binding protein 2, mRNA (cD...    37   0.30    
gb:AY079198_2510963 Raja eglanteria GATA-3 mRNA, complete cds.         37   0.30    
gb:AB111059_2465528 Eptatretus burgeri Gata 2/3 mRNA for transcr...    37   0.30    
gb:BT007897_2150829 Synthetic construct Homo sapiens GATA bindin...    37   0.30    
gb:AY024364_2073974 Rattus norvegicus GATA-3 mRNA, complete cds.       37   0.30    
gb:HSGATA3_2013386 H.sapiens GATA-3 mRNA.                              37   0.30    
pir|A39794|A39794 transcription factor GATA-3 - human>gb:AL39029...    37   0.30    Homo sapiens [man]
sp|P97489|GAT5_MOUSE|GAT5_MOUSE Transcription factor GATA-5 (GATA binding f...    37   0.30    Mus musculus [mouse]
sp|P23773|GAT3_XENLA|GAT3_XENLA Transcription factor xGATA-3 (GATA binding ...    37   0.30    Xenopus laevis [clawed frog]
sp|P23772|GAT3_MOUSE|GAT3_MOUSE Trans-acting T-cell specific transcription ...    37   0.30    Mus musculus [mouse]
sp|P23771|GAT3_HUMAN|GAT3_HUMAN Trans-acting T-cell specific transcription ...    37   0.30    Homo sapiens [man]
sp|P23825|GAT3_CHICK|GAT3_CHICK GATA binding factor-3 (Transcription factor...    37   0.30    Gallus gallus [bantam]
sp|Q91428|GAT3_BRARE|GAT3_BRARE Transcription factor GATA-3 (GATA binding f...    37   0.30    Danio rerio [leopard danio]
sp|P17678|GAT1_CHICK|GAT1_CHICK Erythroid transcription factor (GATA-1) (Er...    37   0.30    Gallus gallus [bantam]
gb:BT007859_2150791 Synthetic construct Homo sapiens hypothetica...    36   0.40    
gb:BC085855_2109414 Rattus norvegicus cDNA clone MGC:94578 IMAGE...    36   0.40    
gb:AY032734_2074120 Rattus norvegicus GATA2 (Gata2) mRNA, comple...    36   0.40    
gb:AF345897_2063788 Rattus norvegicus transcription factor GATA-...    36   0.40    
gb:BC015613_1975205 Homo sapiens GATA binding protein 2, mRNA (c...    36   0.40    
gb:BC002557_1968209 Homo sapiens GATA binding protein 2, mRNA (c...    36   0.40    
gb:CR382138_1671147 Debaryomyces hansenii chromosome F of strain...    36   0.40    
gb:AY251012_1428021 Sus scrofa transcription factor GATA-2 mRNA,...    36   0.40    
gb:AK004675_1152500 Mus musculus adult male lung cDNA, RIKEN ful...    36   0.40    
gb:AK004551_1152408 Mus musculus adult male lung cDNA, RIKEN ful...    36   0.40    
pir|A40815|A40815 transcription factor GATA-2 (version 1) - huma...    36   0.40    Homo sapiens [man]
pir|B48099|B48099 transcription factor GATA-2, retinoic acid-ind...    36   0.40    Mus musculus [mouse]
sp|P43692|GAT5_CHICK|GAT5_CHICK Transcription factor GATA-5 (GATA binding f...    36   0.40    Gallus gallus [bantam]
sp|P23770|GAT2_XENLA|GAT2_XENLA Transcription factor xGATA-2 (GATA binding ...    36   0.40    Xenopus laevis [clawed frog]
sp|O09100|GAT2_MOUSE|GAT2_MOUSE Endothelial transcription factor GATA-2.>gb...    36   0.40    Mus musculus [mouse]
sp|P23769|GAT2_HUMAN|GAT2_HUMAN Endothelial transcription factor GATA-2.          36   0.40    Homo sapiens [man]
sp|P23824|GAT2_CHICK|GAT2_CHICK GATA binding factor-2 (Transcription factor...    36   0.40    Gallus gallus [bantam]
sp|P43695|GA5A_XENLA|GA5A_XENLA Transcription factor xGATA-5A (GATA binding...    36   0.40    Xenopus laevis [clawed frog]
gb:BC088567_2565697 Xenopus tropicalis hypothetical LOC496852, m...    36   0.52    
gb:BC071122_2555984 Xenopus laevis MGC81427 protein, mRNA (cDNA ...    36   0.52    
gb:BC071107_2555969 Xenopus laevis transcription factor xGATA-4,...    36   0.52    
gb:BC067710_2554877 Danio rerio GATA-binding protein 6, mRNA (cD...    36   0.52    
gb:BC055963_2551547 Xenopus laevis transcription factor xGATA-5b...    36   0.52    
gb:AY395731_2531758 Danio rerio Gata6 protein mRNA, complete cds.      36   0.52    
gb:AF191578_2479243 Danio rerio zinc finger transcription factor...    36   0.52    
gb:AF191577_2479242 Danio rerio zinc finger transcription factor...    36   0.52    
gb:AF179424_2058024 Mus musculus transcription factor GATA-4 (Ga...    36   0.52    
gb:AB075549_2047574 Mus musculus mRNA for transcription factor G...    36   0.52    
gb:BC047790_1984023 Homo sapiens GATA binding protein 5, mRNA (c...    36   0.52    
gb:AY740706_1961599 Homo sapiens GATA binding protein 4 (GATA4) ...    36   0.52    
gb:AF237674_1779678 Candida albicans zinc-finger transcription f...    36   0.52    
gb:YSPGAF1H_1731106 Schizosaccharomyces pombe gene homologous to...    36   0.52    
gb:SPCC1902_1721142 S.pombe chromosome III cosmid c1902.               36   0.52    
gb:CR382138_1670808 Debaryomyces hansenii chromosome F of strain...    36   0.52    
gb:CAL320271_1644969 Candida albicans ASH1 gene.                       36   0.52    
gb:OCU291310_1442555 Oryctolagus cuniculus partial mRNA for GATA...    36   0.52    
gb:BTA316283_1436617 Bos taurus partial mRNA for gata4 protein.        36   0.52    
gb:AY115491_1425093 Sus scrofa transcription factor GATA-4 mRNA,...    36   0.52    
gb:AF295687_1417756 Sus scrofa transcription factor GATA-6 (GATA...    36   0.52    
gb:AY496948_1330965 Nematostella vectensis GATA factor (GATA 1/2...    36   0.52    
gb:AY465174_1329752 Nematostella vectensis GATA transcription fa...    36   0.52    
gb:AF184154_1248537 Ceratitis capitata zinc finger DNA binding p...    36   0.52    
gb:AF077674_1239295 Strongylocentrotus purpuratus cell-type coel...    36   0.52    
pir|I57561|I57561 transcription factor GATA-4 - human>gb:HUMGATA...    36   0.52    Homo sapiens [man]
pir|A48099|A48099 transcription factor GATA-4, retinoic acid-ind...    36   0.52    Mus musculus [mouse]
sp|Q9BWX5|GAT5_HUMAN|GAT5_HUMAN Transcription factor GATA-5 (GATA binding f...    36   0.52    Homo sapiens [man]
sp|Q91677|GAT4_XENLA|GAT4_XENLA Transcription factor xGATA-4 (GATA binding ...    36   0.52    Xenopus laevis [clawed frog]
sp|P46152|GAT4_RAT|GAT4_RAT Transcription factor GATA-4 (GATA binding fac...    36   0.52    Rattus norvegicus [brown rat]
sp|Q08369|GAT4_MOUSE|GAT4_MOUSE Transcription factor GATA-4 (GATA binding f...    36   0.52    Mus musculus [mouse]
sp|P43694|GAT4_HUMAN|GAT4_HUMAN Transcription factor GATA-4 (GATA binding f...    36   0.52    Homo sapiens [man]
sp|Q10280|GAF1_SCHPO|GAF1_SCHPO Transcription factor gaf1 (Gaf-1).>pir|T413...    36   0.52    Schizosaccharomyces pombe
sp|P43696|GA5B_XENLA|GA5B_XENLA Transcription factor xGATA-5B (GATA binding...    36   0.52    Xenopus laevis [clawed frog]
gb:BC082349_2562586 Xenopus laevis GATA-6 protein, mRNA (cDNA cl...    35   0.68    
gb:BC076718_2559465 Xenopus laevis transcription factor xGATA-6,...    35   0.68    
gb:AY260735_2522535 Xenopus tropicalis zinc-finger transcription...    35   0.68    
gb:S68802S2_1396777 Drosophila melanogaster achaete and scute re...    35   0.68    
gb:CNS07EGF_1373914 chromosome VIII of strain GB-M1 of Encephali...    35   0.68    
gb:AY745809_1349242 Aedes aegypti GATA transcription factor GATA...    35   0.68    
gb:AY196328_1309286 Asterina miniata GATA transcription factor a...    35   0.68    
gb:AY195740_1309263 Asterina miniata GATA transcription factor (...    35   0.68    
gb:AY095095_1298245 Drosophila melanogaster SD02611 full insert ...    35   0.68    
gb:AY061878_1293494 Calliphora vicina pannier-like protein (pann...    35   0.68    
gb:AF395080_1267701 Anopheles gambiae zinc finger transcription ...    35   0.68    
gb:AE014297_1139823 Drosophila melanogaster chromosome 3R, compl...    35   0.68    
sp|P52168|PNR_DROME|PNR_DROME GATA-binding factor-A (Transcription factor ...    35   0.68    Drosophila melanogaster
sp|P43693|GAT6_CHICK|GAT6_CHICK Transcription factor GATA-6 (GATA binding f...    35   0.68    Gallus gallus [bantam]
sp|P70005|GA6B_XENLA|GA6B_XENLA Transcription factor xGATA-6B (GATA binding...    35   0.68    Xenopus laevis [clawed frog]
sp|Q91678|GA6A_XENLA|GA6A_XENLA Transcription factor xGATA-6A (GATA binding...    35   0.68    Xenopus laevis [clawed frog]
gb:AF179425_2058025 Mus musculus transcription factor GATA-6 (Ga...    35   0.88    
gb:AB034243_2044915 Mus musculus gene for transcription factor G...    35   0.88    
gb:HSGATA6PR_2013389 H.sapiens mRNA for GATA-6 DNA-binding protein.    35   0.88    
gb:AY763413_1350357 Aedes aegypti GATAa2 transcription factor mR...    35   0.88    
gb:AAE400338_1192449 Aedes aegypti mRNA for GATA transcription f...    35   0.88    
gb:AE014297_1139817 Drosophila melanogaster chromosome 3R, compl...    35   0.88    
pir|T40956|T40956 transcription factor gata-type - fission yeast...    35   0.88    
pir|A49645|A49645 transcription factor GATA - rat                      35   0.88    
pir|A41782|A41782 transcription factor GATA-2 (version 2) - huma...    35   0.88    
sp|P46153|GAT6_RAT|GAT6_RAT Transcription factor GATA-6 (GATA binding fac...    35   0.88    
sp|Q61169|GAT6_MOUSE|GAT6_MOUSE Transcription factor GATA-6 (GATA binding f...    35   0.88    
sp|Q92908|GAT6_HUMAN|GAT6_HUMAN Transcription factor GATA-6 (GATA binding f...    35   0.88    
sp|Q9HEV5|ASD4_NEUCR|ASD4_NEUCR GATA type zinc finger protein Asd4 (Ascus d...    35   0.88    
gb:DRU18312_2571264 Danio rerio zg2 mRNA, partial cds.                 35   1.2     
gb:DRE242515_2571026 Danio rerio mRNA for transcription factor g...    35   1.2     
gb:SCYKR033C_1713241 S.cerevisiae chromosome XI reading frame OR...    35   1.2     
gb:SCUGA43_1710647 S.cerevisiae UGA43 gene.                            35   1.2     
gb:CR382135_1667957 Debaryomyces hansenii chromosome C of strain...    35   1.2     
gb:CR380953_1650803 Candida glabrata strain CBS138 chromosome G ...    35   1.2     
gb:DMGATAFAC_1379544 D.melanogaster mRNA for GATA transcription ...    35   1.2     
gb:BT011543_1358011 Drosophila melanogaster LD44281 full insert ...    35   1.2     
gb:AY623814_1341390 Strongylocentrotus purpuratus GATA transcrip...    35   1.2     
gb:AY462219_1329446 Caenorhabditis elegans clone yk345d6 GATA tr...    35   1.2     
gb:AY069823_1294553 Drosophila melanogaster SD07261 full length ...    35   1.2     
gb:AF100657_1241200 Caenorhabditis elegans cosmid F52C12, comple...    35   1.2     
gb:AF077675_1239296 Strongylocentrotus purpuratus dev-stage embr...    35   1.2     
gb:AF067612_1238016 Caenorhabditis elegans cosmid F55A8, complet...    35   1.2     
gb:AB055143_1196652 Drosophila melanogaster dGATAd mRNA for GATA...    35   1.2     
gb:AE014297_1139819 Drosophila melanogaster chromosome 3R, compl...    35   1.2     
gb:AE014134_1128561 Drosophila melanogaster chromosome 2L, compl...    35   1.2     
pir|T43298|T43298 transcription factor gaf2 - fission yeast  (Sc...    35   1.2     
sp|P52172|SRP_DROME|SRP_DROME Box A-binding factor (ABF) (Serpent protein)...    35   1.2     
sp|P26343|DA80_YEAST|DA80_YEAST Nitrogen regulatory protein DAL80 (Regulato...    35   1.2     
gb:AY439009_1326521 Aedes aegypti GATA transcription factor (GAT...    34   1.5     
gb:AE016819_1749072 Ashbya gossypii (= Eremothecium gossypii) AT...    34   2.0     
gb:SPCC4F11_1721346 S.pombe chromosome III cosmid c4F11.               34   2.0     
gb:CR382129_1662223 Yarrowia lipolytica chromosome C of strain C...    34   2.0     
gb:AY860498_1354206 Schistocerca americana GATA transcription fa...    34   2.0     
pir|E88640|E88640 protein F55A8.1 [imported] - Caenorhabditis el...    34   2.0     
pir|T41352|T41352 probable transcription regulator - fission yea...    34   2.0     
pir|S46418|S46418 NTL1 protein - curled-leaved tobacco                 34   2.0     
sp|Q9URT4|AMS2_SCHPO|AMS2_SCHPO CENP-A multicopy suppressor protein 2.            34   2.0     
gb:AP003020_1824239 Oryza sativa (japonica cultivar-group) genom...    33   2.6     
gb:BMU16320_1355680 Bombyx mori transcription factor BmGATA beta...    33   2.6     
pir|S07396|S07396 hypothetical protein clone CB15A-2D - yeast (S...    33   2.6     
pir|S19428|S19428 SRD1 protein - yeast (Saccharomyces cerevisiae...    33   2.6     
pir|A53741|A53741 transcription factor BmGATA beta - silkworm>gb...    33   2.6     
sp|P09007|SRD1_YEAST|SRD1_YEAST Pre-rRNA processing protein SRD1 (Suppresso...    33   2.6     
sp|P52167|GATB_BOMMO|GATB_BOMMO Transcription factor BCFI (GATA-beta) (BmGA...    33   2.6     
sp|Q10134|FEP1_SCHPO|FEP1_SCHPO Iron-sensing transcription factor 1 (Transc...    33   2.6     
gb:MMU51335_2121894 Mus musculus transcription factor GATA-6 mRN...    33   3.4     
gb:BC060294_2103980 Mus musculus cDNA clone IMAGE:30241940, part...    33   3.4     
gb:AK173113_2070047 Mus musculus mRNA for mKIAA1150 protein.           33   3.4     
gb:AF411837_2065264 Mus musculus transcription repressor p66 mRN...    33   3.4     
gb:AF411836_1901535 Homo sapiens transcription repressor p66 mRN...    33   3.4     
gb:AB032976_1866156 Homo sapiens mRNA for KIAA1150 protein, part...    33   3.4     
gb:BMU16320_1355681 Bombyx mori transcription factor BmGATA beta...    33   3.4     
gb:BMU16320_1355679 Bombyx mori transcription factor BmGATA beta...    33   3.4     
gb:BMU16274_1355678 Bombyx mori transcription factor BmGATA beta...    33   3.4     
gb:AY333437_1320338 Haemonchus contortus GATA transcription fact...    33   3.4     
gb:AY333436_1320337 Haemonchus contortus GATA transcription fact...    33   3.4     
pir|S53811|S53811 BmGATA beta isoform 2 - silkworm (fragment)          33   3.4     
pir|S53812|S53812 BmGATA beta isoform 3 - silkworm (fragment)          33   3.4     
gb:AE017350_1759216 Cryptococcus neoformans var. neoformans JEC2...    33   4.4     
gb:HUMGATA3BP_2031398 Human Gata3 enhancer-binding protein mRNA,...    32   5.7     
gb:AY745807_1349240 Aedes aegypti GATA transcription factor GATA...    32   5.7     
gb:AY745806_1349239 Aedes aegypti GATA transcription factor GATA...    32   5.7     
sp|P42944|GZF3_YEAST|GZF3_YEAST GZF3 protein.>pir|S53377|S53377 GZF3 protei...    32   5.7     
gb:AF215896_2059363 Mus musculus striated muscle-specific serine...    32   7.5     
gb:AE016818_1748236 Ashbya gossypii (= Eremothecium gossypii) AT...    32   7.5     
gb:CR382126_1659300 Kluyveromyces lactis strain NRRL Y-1140 chro...    32   7.5     
gb:CR382122_1654912 Kluyveromyces lactis strain NRRL Y-1140 chro...    32   7.5     
gb:BC062342_1985859 Homo sapiens arginine-glutamic acid dipeptid...    32   9.8     
gb:AL356072_1924216 Human DNA sequence from clone RP11-141M15 on...    32   9.8     
gb:AL356072_1924215 Human DNA sequence from clone RP11-141M15 on...    32   9.8     
gb:AB036737_1866428 Homo sapiens mRNA for RERE, complete cds.          32   9.8     
gb:AB007927_1864044 Homo sapiens mRNA for KIAA0458 protein, part...    32   9.8     


>pir|T45739|T45739 transcription factor-like protein - Arabidopsis
           thaliana>gb:ATF24M12_1549947 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F24M12.>gb:AY064048_1565986
           Arabidopsis thaliana putative transcription factor
           (At3g51080) mRNA, complete cds.>gb:AY117315_1579356
           Arabidopsis thaliana putative transcription factor
           (At3g51080) mRNA, complete cds.
          Length = 312

 Score =  147 bits (372), Expect = 9e-35
 Identities = 68/87 (78%), Positives = 75/87 (86%), Gaps = 3/87 (3%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNH 403
           Q R+C HCGVQKTPQWRAGPLGAKTLCNACGVR+KSGRLLPEYRPACSPTFSS+LHSN+H
Sbjct: 219 QTRQCGHCGVQKTPQWRAGPLGAKTLCNACGVRYKSGRLLPEYRPACSPTFSSELHSNHH 278

Query: 402 RKVLEMRRKKESED---SPGFAPPVQS 331
            KV+EMRRKKE+ D     G   PVQ+
Sbjct: 279 SKVIEMRRKKETSDGAEETGLNQPVQT 305



>gb:AB022211_1514983 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K1L20.>gb:AY136450_1581950 Arabidopsis
           thaliana GATA-binding transcription factor-like protein
           (At5g66320) mRNA, complete cds.>gb:BT010367_1640313
           Arabidopsis thaliana At5g66320 mRNA, complete cds.
          Length = 339

 Score =  147 bits (371), Expect = 1e-34
 Identities = 68/84 (80%), Positives = 76/84 (90%), Gaps = 2/84 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           R+CSHCGVQKTPQWRAGP+GAKTLCNACGVR+KSGRLLPEYRPACSPTFSS+LHSN+HRK
Sbjct: 249 RKCSHCGVQKTPQWRAGPMGAKTLCNACGVRYKSGRLLPEYRPACSPTFSSELHSNHHRK 308

Query: 396 VLEMRRKKE--SEDSPGFAPPVQS 331
           V+EMRRKKE  S++  G    VQS
Sbjct: 309 VIEMRRKKEPTSDNETGLNQLVQS 332



>gb:AP004839_1845774 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0519A12.>gb:AP005306_1850242 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0030D07.
          Length = 387

 Score =  143 bits (360), Expect = 2e-33
 Identities = 69/84 (82%), Positives = 72/84 (85%), Gaps = 1/84 (1%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           RRCSHCGVQKTPQWRAGP GAKTLCNACGVR+KSGRLLPEYRPACSPTF S LHSN+HRK
Sbjct: 304 RRCSHCGVQKTPQWRAGPEGAKTLCNACGVRYKSGRLLPEYRPACSPTFVSSLHSNSHRK 363

Query: 396 VLEMRRKKESE-DSPGFAPPVQSF 328
           VLEMRRKKE+       AP V SF
Sbjct: 364 VLEMRRKKETPVIVAAAAPAVASF 387



>gb:AB107692_1526750 Nicotiana tabacum AGP4 mRNA for AG-motif
           binding protein-4, complete cds.
          Length = 326

 Score =  139 bits (349), Expect = 4e-32
 Identities = 61/70 (87%), Positives = 66/70 (94%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           RRC+HC VQKTPQWRAGPLG KTLCNACGVR+KSGRL PEYRPACSPTFS ++HSN+HRK
Sbjct: 242 RRCTHCQVQKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPACSPTFSQEVHSNSHRK 301

Query: 396 VLEMRRKKES 367
           VLEMRRKKES
Sbjct: 302 VLEMRRKKES 311



>pir|T04593|T04593 hypothetical protein F23E13.130 - Arabidopsis
           thaliana>gb:ATCHRIV85_1547584 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           85.>gb:ATF23E13_1549752 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F23E13 (ESSAII
           project).>gb:AY072434_1567251 Arabidopsis thaliana
           putative protein (At4g36240) mRNA, complete
           cds.>gb:AY114720_1578762 Arabidopsis thaliana putative
           protein (At4g36240) mRNA, complete cds.
          Length = 238

 Score =  133 bits (334), Expect = 2e-30
 Identities = 58/71 (81%), Positives = 66/71 (92%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           R CSHCGVQKTPQWR GPLGAKTLCNACGVRFKSGRLLPEYRPACSPTF++++HSN+HRK
Sbjct: 164 RCCSHCGVQKTPQWRMGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFTNEIHSNSHRK 223

Query: 396 VLEMRRKKESE 364
           VLE+R  K ++
Sbjct: 224 VLELRLMKVAD 234



>gb:OSJN00022_1693442 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0011L07, complete sequence.
          Length = 392

 Score =  132 bits (332), Expect = 4e-30
 Identities = 64/84 (76%), Positives = 68/84 (80%), Gaps = 5/84 (5%)
 Frame = -3

Query: 564 HCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRKVLEM 385
           HCGVQKTPQWRAGP GAKTLCNACGVR+KSGRLLPEYRPACSPTF S +HSN+HRKVLEM
Sbjct: 309 HCGVQKTPQWRAGPEGAKTLCNACGVRYKSGRLLPEYRPACSPTFVSAIHSNSHRKVLEM 368

Query: 384 RRKKESED-----SPGFAPPVQSF 328
           RRKKE        +   AP V SF
Sbjct: 369 RRKKEVGSGLLTAAAAAAPAVASF 392



>gb:AY087597_1572627 Arabidopsis thaliana clone 36927 mRNA, complete
           sequence.
          Length = 268

 Score =  127 bits (319), Expect = 1e-28
 Identities = 53/75 (70%), Positives = 66/75 (88%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           R+C HCG +KTPQWRAGP G KTLCNACGVR+KSGRL+PEYRPA SPTF+++LHSN+HRK
Sbjct: 188 RKCQHCGAEKTPQWRAGPAGPKTLCNACGVRYKSGRLVPEYRPANSPTFTAELHSNSHRK 247

Query: 396 VLEMRRKKESEDSPG 352
           ++EMR++ +S D  G
Sbjct: 248 IVEMRKQYQSGDGDG 262



>gb:AB107690_1526748 Nicotiana tabacum AGP2 mRNA for AG-motif
           binding protein-2, complete cds.
          Length = 289

 Score =  127 bits (319), Expect = 1e-28
 Identities = 56/68 (82%), Positives = 61/68 (89%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           RRC HCG  KTPQWRAGPLG KTLCNACGVR+KSGRLLPEYRPA SPTFS  +HSN+HRK
Sbjct: 205 RRCQHCGADKTPQWRAGPLGPKTLCNACGVRYKSGRLLPEYRPANSPTFSPTVHSNSHRK 264

Query: 396 VLEMRRKK 373
           VLEMR++K
Sbjct: 265 VLEMRKQK 272



>pir|T52103|T52103 GATA-binding transcription factor homolog 1
           [imported] - Arabidopsis thaliana>gb:ATY13648_1557497
           Arabidopsis thaliana mRNA for GATA transcription factor
           1.>gb:AP001297_1820958 Arabidopsis thaliana genomic DNA,
           chromosome 3, BAC clone:F14O13.
          Length = 274

 Score =  127 bits (319), Expect = 1e-28
 Identities = 53/75 (70%), Positives = 66/75 (88%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           R+C HCG +KTPQWRAGP G KTLCNACGVR+KSGRL+PEYRPA SPTF+++LHSN+HRK
Sbjct: 194 RKCQHCGAEKTPQWRAGPAGPKTLCNACGVRYKSGRLVPEYRPANSPTFTAELHSNSHRK 253

Query: 396 VLEMRRKKESEDSPG 352
           ++EMR++ +S D  G
Sbjct: 254 IVEMRKQYQSGDGDG 268



>pir|T47864|T47864 GATA transcription factor 4 - Arabidopsis
           thaliana>gb:ATT8B10_1556458 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T8B10.>gb:ATY13651_1557500
           Arabidopsis thaliana mRNA for GATA transcription factor
           4.>gb:AY039532_1560246 Arabidopsis thaliana
           AT3g60530/T8B10_190 mRNA, complete
           cds.>gb:AY050476_1562250 Arabidopsis thaliana
           AT3g60530/T8B10_190 mRNA, complete
           cds.>gb:AF378881_1793466 Arabidopsis thaliana
           AT3g60530/T8B10_190 mRNA, complete cds.
          Length = 240

 Score =  127 bits (318), Expect = 2e-28
 Identities = 56/81 (69%), Positives = 66/81 (81%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           RRC+HC  +KTPQWR GPLG KTLCNACGVR+KSGRL+PEYRPA SPTF    HSN+HRK
Sbjct: 158 RRCTHCASEKTPQWRTGPLGPKTLCNACGVRYKSGRLVPEYRPASSPTFVLTQHSNSHRK 217

Query: 396 VLEMRRKKESEDSPGFAPPVQ 334
           V+E+RR+KE ++S    PP Q
Sbjct: 218 VMELRRQKEQQESCVRIPPFQ 238



>gb:AY099790_1576815 Arabidopsis thaliana GATA transcription factor
           3 (At4g34680) mRNA, complete cds.>gb:AY128907_1580987
           Arabidopsis thaliana GATA transcription factor 3
           (At4g34680) mRNA, complete cds.
          Length = 269

 Score =  126 bits (316), Expect = 3e-28
 Identities = 56/77 (72%), Positives = 63/77 (81%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           RRCSHCG   TPQWR GP+G KTLCNACGVRFKSGRL PEYRPA SPTFS+++HSN HRK
Sbjct: 180 RRCSHCGTNNTPQWRTGPVGPKTLCNACGVRFKSGRLCPEYRPADSPTFSNEIHSNLHRK 239

Query: 396 VLEMRRKKESEDSPGFA 346
           VLE+R+ KE  +  G A
Sbjct: 240 VLELRKSKELGEETGEA 256



>pir|T05288|T05288 GATA-binding transcription factor homolog 3
           [imported] - Arabidopsis thaliana
          Length = 269

 Score =  126 bits (316), Expect = 3e-28
 Identities = 56/77 (72%), Positives = 63/77 (81%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           RRCSHCG   TPQWR GP+G KTLCNACGVRFKSGRL PEYRPA SPTFS+++HSN HRK
Sbjct: 180 RRCSHCGTNNTPQWRTGPVGPKTLCNACGVRFKSGRLCPEYRPADSPTFSNEIHSNLHRK 239

Query: 396 VLEMRRKKESEDSPGFA 346
           VLE+R+ KE  +  G A
Sbjct: 240 VLELRKSKELGEETGEA 256



>pir|H85408|H85408 GATA transcription factor 3 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV82_1547429 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           82.>gb:ATT4L20_1556072 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T4L20 (ESSA
           project).>gb:ATY13650_1557499 Arabidopsis thaliana mRNA
           for GATA transcription factor 3.
          Length = 269

 Score =  126 bits (316), Expect = 3e-28
 Identities = 56/77 (72%), Positives = 63/77 (81%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           RRCSHCG   TPQWR GP+G KTLCNACGVRFKSGRL PEYRPA SPTFS+++HSN HRK
Sbjct: 180 RRCSHCGTNNTPQWRTGPVGPKTLCNACGVRFKSGRLCPEYRPADSPTFSNEIHSNLHRK 239

Query: 396 VLEMRRKKESEDSPGFA 346
           VLE+R+ KE  +  G A
Sbjct: 240 VLELRKSKELGEETGEA 256



>gb:AB107691_1526749 Nicotiana tabacum AGP3 mRNA for AG-motif
           binding protein-3, complete cds.
          Length = 256

 Score =  125 bits (313), Expect = 6e-28
 Identities = 54/70 (77%), Positives = 61/70 (87%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHR 400
           PRRC+HC  +KTPQWR GPLG KTLCNACGVRFKSGRL+PEYRPA SPTF    HSN+HR
Sbjct: 166 PRRCTHCASEKTPQWRTGPLGPKTLCNACGVRFKSGRLVPEYRPAASPTFVLTQHSNSHR 225

Query: 399 KVLEMRRKKE 370
           KV+E+RR+KE
Sbjct: 226 KVMELRRQKE 235



>gb:AE016959_1023793 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC069300_1540802
           Oryza sativa chromosome 10 BAC OSJNBa0010C11 genomic
           sequence, complete sequence.>gb:AE017119_1753612 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           73 of 77 of the complete sequence.
          Length = 387

 Score =  122 bits (307), Expect = 3e-27
 Identities = 53/69 (76%), Positives = 60/69 (86%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           RRC+HC  +KTPQWR GPLG KTLCNACGVRFKSGRL+PEYRPA SPTF    HSN+HRK
Sbjct: 276 RRCTHCASEKTPQWRTGPLGPKTLCNACGVRFKSGRLMPEYRPAASPTFVLTQHSNSHRK 335

Query: 396 VLEMRRKKE 370
           V+E+RR+KE
Sbjct: 336 VMELRRQKE 344



>gb:AC069158_1540658 Genomic Sequence for Oryza sativa, Nipponbare
           strain, clone OSJNBa0049O12, from chromosome 2, complete
           sequence.
          Length = 418

 Score =  122 bits (306), Expect = 4e-27
 Identities = 52/74 (70%), Positives = 61/74 (82%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           RRC+HC ++KTPQWRAGPLG KTLCNACGVR+KSGRL PEYRPA SPTF   +HSN+H+K
Sbjct: 333 RRCTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFMPSIHSNSHKK 392

Query: 396 VLEMRRKKESEDSP 355
           V+EMR+K      P
Sbjct: 393 VVEMRQKATRTADP 406



>pir|T52104|T52104 GATA-binding transcription factor homolog 2
           [imported] - Arabidopsis thaliana>gb:AC007659_1536061
           Arabidopsis thaliana chromosome II section 241 of 255 of
           the complete sequence. Sequence from clones T13E15,
           T14P1.>gb:ATY13649_1557498 Arabidopsis thaliana mRNA for
           GATA transcription factor 2.>gb:BT000921_1635176
           Arabidopsis thaliana clone C105099 putative GATA-type
           zinc finger transcription factor (At2g45050) mRNA,
           complete cds.
          Length = 264

 Score =  122 bits (306), Expect = 4e-27
 Identities = 54/74 (72%), Positives = 61/74 (82%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           RRC+HC  +KTPQWR GPLG KTLCNACGVRFKSGRL+PEYRPA SPTF    HSN+HRK
Sbjct: 179 RRCTHCASEKTPQWRTGPLGPKTLCNACGVRFKSGRLVPEYRPASSPTFVLTQHSNSHRK 238

Query: 396 VLEMRRKKESEDSP 355
           V+E+RR+KE    P
Sbjct: 239 VMELRRQKEVMRQP 252



>pir|T05297|T05297 hypothetical protein F26P21.10 - Arabidopsis
           thaliana>gb:ATCHRIV78_1547209 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           78.>gb:ATF26P21_1550164 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F26P21 (ESSA
           project).>gb:BT008342_1639559 Arabidopsis thaliana
           At4g32890 mRNA, complete cds.>gb:AK117169_1815216
           Arabidopsis thaliana At4g32890 mRNA for unknown protein,
           complete cds, clone: RAFL16-71-E16.
          Length = 308

 Score =  122 bits (305), Expect = 5e-27
 Identities = 52/72 (72%), Positives = 60/72 (83%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           RRC HC  +KTPQWR GP+G KTLCNACGVR+KSGRL+PEYRPA SPTF    HSN+HRK
Sbjct: 197 RRCLHCATEKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPASSPTFVMARHSNSHRK 256

Query: 396 VLEMRRKKESED 361
           V+E+RR+KE  D
Sbjct: 257 VMELRRQKEMRD 268



>gb:AP003376_1828756 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBa0014K08.
          Length = 387

 Score =  120 bits (300), Expect = 2e-26
 Identities = 52/69 (75%), Positives = 58/69 (84%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           RRC HC   KTPQWR GP+G KTLCNACGVR+KSGRL+PEYRPA SPTF    HSN+HRK
Sbjct: 262 RRCLHCETDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFMVSKHSNSHRK 321

Query: 396 VLEMRRKKE 370
           VLE+RR+KE
Sbjct: 322 VLELRRQKE 330



>pir|T06739|T06739 hypothetical protein F28P10.210 - Arabidopsis
           thaliana>gb:ATF28P10_1550415 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F28P10.>gb:AY078029_1567998
           Arabidopsis thaliana AT3g54810/F28P10_210 mRNA, complete
           cds.>gb:AF412107_1797360 Arabidopsis thaliana
           AT3g54810/F28P10_210 mRNA, complete cds.
          Length = 322

 Score =  119 bits (298), Expect = 4e-26
 Identities = 52/73 (71%), Positives = 60/73 (82%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           R+C HC V KTPQWR GP+G KTLCNACGVR+KSGRL PEYRPA SPTF+  LHSN+H+K
Sbjct: 229 RKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPALHSNSHKK 288

Query: 396 VLEMRRKKESEDS 358
           V EMR K+ S+ S
Sbjct: 289 VAEMRNKRCSDGS 301



>gb:AC130611_1740892 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0483D07, complete
           sequence.>gb:AC132491_1741202 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone P0599F04, complete
           sequence.
          Length = 386

 Score =  119 bits (297), Expect = 5e-26
 Identities = 51/71 (71%), Positives = 59/71 (83%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           RRC HC   KTPQWR GP+G KTLCNACGVR+KSGRL+PEYRPA SPTF    HSN+HRK
Sbjct: 253 RRCLHCETDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVVSKHSNSHRK 312

Query: 396 VLEMRRKKESE 364
           V+E+RR+KE +
Sbjct: 313 VVELRRQKEMQ 323



>gb:AC119796_1739717 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1172F09, complete sequence.
          Length = 219

 Score =  117 bits (294), Expect = 1e-25
 Identities = 52/73 (71%), Positives = 60/73 (82%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           RRC+HC V +TPQWR GP G +TLCNACGVRFKSGRL PEYRPA SPTFS  LHSN+HR+
Sbjct: 122 RRCTHCAVDETPQWRLGPDGPRTLCNACGVRFKSGRLFPEYRPANSPTFSPLLHSNSHRR 181

Query: 396 VLEMRRKKESEDS 358
           V+EMR + E + S
Sbjct: 182 VMEMRLQSEEDAS 194



>gb:NTL17_1691595 Nicotiana tabacum mRNA for GATA-1 zinc finger
           protein (Ntl1-Nt7 gene).
          Length = 305

 Score =  117 bits (293), Expect = 1e-25
 Identities = 50/67 (74%), Positives = 58/67 (86%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           ++C+HC V KTPQWR GPLG KTLCNACGVR++SGRL PEYRPA SPTF   LHSN+HRK
Sbjct: 200 KKCTHCQVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFVPTLHSNSHRK 259

Query: 396 VLEMRRK 376
           V+EMR+K
Sbjct: 260 VVEMRKK 266



>gb:AB107693_1526751 Nicotiana tabacum AGP5 mRNA for AG-motif
           binding protein-5, complete cds.
          Length = 342

 Score =  117 bits (293), Expect = 1e-25
 Identities = 50/77 (64%), Positives = 61/77 (79%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           R+C HC + KTPQWRAGP+G KTLCNACGVR+KSGRL PEYRPA SPTF   +HSN+H+K
Sbjct: 240 RKCQHCEMTKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPSIHSNSHKK 299

Query: 396 VLEMRRKKESEDSPGFA 346
           V+EMR K   +++   A
Sbjct: 300 VIEMRTKFVPDNNANIA 316



>gb:AB107689_1526747 Nicotiana tabacum AGP1 mRNA for AG-motif
           binding protein-1, complete cds.
          Length = 343

 Score =  117 bits (293), Expect = 1e-25
 Identities = 49/67 (73%), Positives = 57/67 (85%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           R+C HC + KTPQWRAGP+G KTLCNACGVR+KSGRL PEYRPA SPTF   +HSN+H+K
Sbjct: 241 RKCQHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFVPAIHSNSHKK 300

Query: 396 VLEMRRK 376
           V+EMR K
Sbjct: 301 VIEMRTK 307



>gb:BT014974_1641944 Arabidopsis thaliana At1g08010 gene, complete
           cds.>gb:BT015713_1642331 Arabidopsis thaliana At1g08010
           gene, complete cds.
          Length = 303

 Score =  117 bits (292), Expect = 2e-25
 Identities = 49/71 (69%), Positives = 59/71 (83%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           R+C+HC   KTPQWR GP G KTLCNACGVRF+SGRL+PEYRPA SPTF   +HSN+HRK
Sbjct: 220 RKCTHCETTKTPQWREGPSGPKTLCNACGVRFRSGRLVPEYRPASSPTFIPAVHSNSHRK 279

Query: 396 VLEMRRKKESE 364
           ++EMRRK + +
Sbjct: 280 IIEMRRKDDEQ 290



>gb:AE005172_889808 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC026875_1539722 Genomic sequence
           for Arabidopsis thaliana BAC T6D22 from chromosome I,
           complete sequence.
          Length = 821

 Score =  117 bits (292), Expect = 2e-25
 Identities = 49/71 (69%), Positives = 59/71 (83%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           R+C+HC   KTPQWR GP G KTLCNACGVRF+SGRL+PEYRPA SPTF   +HSN+HRK
Sbjct: 295 RKCTHCETTKTPQWREGPSGPKTLCNACGVRFRSGRLVPEYRPASSPTFIPAVHSNSHRK 354

Query: 396 VLEMRRKKESE 364
           ++EMRRK + +
Sbjct: 355 IIEMRRKDDEQ 365



 Score =  113 bits (283), Expect = 2e-24
 Identities = 50/81 (61%), Positives = 60/81 (74%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           R C+HC    TPQWR GP G KTLCNACGVRFKSGRL+PEYRPA SPTF   +HSN+HRK
Sbjct: 731 RICTHCETITTPQWRQGPSGPKTLCNACGVRFKSGRLVPEYRPASSPTFIPSVHSNSHRK 790

Query: 396 VLEMRRKKESEDSPGFAPPVQ 334
           ++EMR+K +  D+      +Q
Sbjct: 791 IIEMRKKDDEFDTSMIRSDIQ 811



>gb:AY063953_1565898 Arabidopsis thaliana putative GATA
           transcription factor 3 (At1g08000) mRNA, complete
           cds.>gb:AY096723_1576259 Arabidopsis thaliana putative
           GATA transcription factor 3 (At1g08000) mRNA, complete
           cds.
          Length = 308

 Score =  113 bits (283), Expect = 2e-24
 Identities = 50/81 (61%), Positives = 60/81 (74%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           R C+HC    TPQWR GP G KTLCNACGVRFKSGRL+PEYRPA SPTF   +HSN+HRK
Sbjct: 218 RICTHCETITTPQWRQGPSGPKTLCNACGVRFKSGRLVPEYRPASSPTFIPSVHSNSHRK 277

Query: 396 VLEMRRKKESEDSPGFAPPVQ 334
           ++EMR+K +  D+      +Q
Sbjct: 278 IIEMRKKDDEFDTSMIRSDIQ 298



>pir|T47457|T47457 hypothetical protein T14D3.110 - Arabidopsis
           thaliana>gb:ATT14D3_1554451 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T14D3.
          Length = 204

 Score =  110 bits (276), Expect = 1e-23
 Identities = 47/76 (61%), Positives = 59/76 (77%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           + CSHCG +KTP WR GP GA TLCNACG+R+++GRLLPEYRPA SP F   +HSN HRK
Sbjct: 115 KSCSHCGTRKTPLWREGPRGAGTLCNACGMRYRTGRLLPEYRPASSPDFKPNVHSNFHRK 174

Query: 396 VLEMRRKKESEDSPGF 349
           V+E+RR+++S     F
Sbjct: 175 VMEIRRERKSSPPNSF 190



>gb:AC096781_1736344 Oryza sativa chromosome 10 BAC OSJNBa0013H08
           genomic sequence, complete sequence.
          Length = 369

 Score =  102 bits (254), Expect = 4e-21
 Identities = 41/66 (62%), Positives = 54/66 (81%)
 Frame = -3

Query: 573 RCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRKV 394
           +C HCG  +TPQWR GP G +TLCNAC +R++SG+L+PEYRP  SPTFS +LHSN H +V
Sbjct: 64  QCRHCGTTETPQWRHGPEGHRTLCNACSMRYRSGKLVPEYRPLRSPTFSPELHSNRHHRV 123

Query: 393 LEMRRK 376
           L++RR+
Sbjct: 124 LQLRRR 129



 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 21/37 (56%), Positives = 27/37 (72%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRL 466
           R C+HCG  KTP WR GP   + LCNACG +++SG+L
Sbjct: 235 RECAHCGTTKTPAWRLGPDSRRKLCNACGNKYRSGQL 271



>gb:AE016959_1022927 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC034258_1539933
           Oryza sativa chromosome 10 BAC OSJNBb0011A08 genomic
           sequence, complete sequence.>gb:AE017102_1752746 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           56 of 77 of the complete sequence.
          Length = 528

 Score =  102 bits (254), Expect = 4e-21
 Identities = 41/66 (62%), Positives = 54/66 (81%)
 Frame = -3

Query: 573 RCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRKV 394
           +C HCG  +TPQWR GP G +TLCNAC +R++SG+L+PEYRP  SPTFS +LHSN H +V
Sbjct: 64  QCRHCGTTETPQWRHGPEGHRTLCNACSMRYRSGKLVPEYRPLRSPTFSPELHSNRHHRV 123

Query: 393 LEMRRK 376
           L++RR+
Sbjct: 124 LQLRRR 129



 Score = 87.0 bits (214), Expect = 2e-16
 Identities = 39/70 (55%), Positives = 48/70 (68%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           RRC+HCG  KTP W +GP     LCNACG +++ GRL+PEYRP   PTFS +LHSN H  
Sbjct: 453 RRCTHCGTTKTPAWLSGPDSRGKLCNACGKQYRKGRLVPEYRPLNCPTFSPELHSNAHAH 512

Query: 396 VLEMRRKKES 367
               RR++ES
Sbjct: 513 ----RRRRES 518



 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 21/37 (56%), Positives = 27/37 (72%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRL 466
           R C+HCG  KTP WR GP   + LCNACG +++SG+L
Sbjct: 235 RECAHCGTTKTPAWRLGPDSRRKLCNACGNKYRSGQL 271



>pir|F84683|F84683 hypothetical protein At2g28340 [imported] -
           Arabidopsis thaliana>gb:AC006283_1533982 Arabidopsis
           thaliana chromosome 2 clone T1B3 map mi54, complete
           sequence.
          Length = 315

 Score =  100 bits (248), Expect = 2e-20
 Identities = 42/70 (60%), Positives = 52/70 (74%)
 Frame = -3

Query: 573 RCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRKV 394
           +C+HC    TPQWR GP G KTLCNACG+RF+SGRL+ EYRPA SPTF   +HSN H+K+
Sbjct: 216 KCTHCETTTTPQWREGPNGRKTLCNACGIRFRSGRLVLEYRPAASPTFIPTVHSNLHKKI 275

Query: 393 LEMRRKKESE 364
           + MR K   +
Sbjct: 276 IYMRMKDNDQ 285



>pir|S46419|S46419 NTL1 protein - curled-leaved tobacco
          Length = 94

 Score = 98.6 bits (244), Expect = 6e-20
 Identities = 43/55 (78%), Positives = 48/55 (87%)
 Frame = -3

Query: 540 QWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRKVLEMRRK 376
           QWR GPLG KTLCNACGVR++SGRL PEYRPA SPTF   LHSN+HRKV+EMR+K
Sbjct: 1   QWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFIPTLHSNSHRKVVEMRKK 55



>gb:AC098693_1736835 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1004C08, complete
           sequence.>gb:AP000615_1820490 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 3,
           clone:P0043E01.
          Length = 271

 Score = 97.1 bits (240), Expect = 2e-19
 Identities = 40/73 (54%), Positives = 52/73 (71%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNH 403
           + +RC HC   +TPQWR GP G  TLCNACG+R++   LLPEYRP+ SP F S  +SN H
Sbjct: 184 EEKRCGHCQTTETPQWRVGPDGPSTLCNACGIRYRIDHLLPEYRPSTSPGFGSDGYSNRH 243

Query: 402 RKVLEMRRKKESE 364
           RKV+++R KK  +
Sbjct: 244 RKVVKLREKKRKK 256



>gb:AP004729_1843879 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC
           clone:OSJNBa0006A22.>gb:AP005460_1852228 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0610D01.
          Length = 347

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 32/85 (37%), Positives = 42/85 (49%), Gaps = 6/85 (7%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRL------LPEYRPACSPTFSSQLH 415
           R CS C   KTP WR+GP G K+LCNACG+R +  R       LP    A  P  ++   
Sbjct: 201 RVCSDCNTTKTPLWRSGPCGPKSLCNACGIRQRKARRAMMASGLPASPNAAGPKAAAHSG 260

Query: 414 SNNHRKVLEMRRKKESEDSPGFAPP 340
           + N      M   +E+ +S   APP
Sbjct: 261 ATNAAAAAAM---EETAESATVAPP 282



>pir|F84563|F84563 hypothetical protein At2g18380 [imported] -
           Arabidopsis thaliana>gb:AC006439_1534289 Arabidopsis
           thaliana chromosome 2 clone T30D6 map mi39, complete
           sequence.
          Length = 207

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 22/34 (64%), Positives = 25/34 (73%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           PRRC+ C    TP WR GP G K+LCNACG+RFK
Sbjct: 90  PRRCASCDTTSTPLWRNGPKGPKSLCNACGIRFK 123



>gb:AP003284_1827250 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0671D01.
          Length = 242

 Score = 56.6 bits (135), Expect = 3e-07
 Identities = 21/34 (61%), Positives = 26/34 (76%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           PRRC++C    TP WR GP G K+LCNACG+R+K
Sbjct: 121 PRRCANCDTTSTPLWRNGPRGPKSLCNACGIRYK 154



>gb:AC098571_1736760 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1126_B10, complete
           sequence.>gb:AC120988_1740033 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBa0017N18,
           complete sequence.
          Length = 279

 Score = 56.6 bits (135), Expect = 3e-07
 Identities = 21/33 (63%), Positives = 26/33 (78%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           RRC++CG   TP WR GP G K+LCNACG+R+K
Sbjct: 152 RRCANCGTASTPLWRNGPRGPKSLCNACGIRYK 184



>gb:AC133339_1741412 Oryza sativa chromosome 3 BAC OSJNBa0078D06
           genomic sequence, complete sequence.>gb:AC133778_1741487
           Oryza sativa chromosome 3 BAC OSJNBb0027B08 genomic
           sequence, complete sequence.
          Length = 136

 Score = 55.5 bits (132), Expect = 6e-07
 Identities = 20/38 (52%), Positives = 27/38 (71%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGR 469
           +P+ C+ C   KTP WR GP G K+LCNACG+R++  R
Sbjct: 23  EPKACTDCHTTKTPLWRGGPSGPKSLCNACGIRYRKKR 60



>gb:AP004344_1840555 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC
           clone:P0639B07.>gb:AP006266_1861558 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBa0003K21.
          Length = 137

 Score = 55.1 bits (131), Expect = 8e-07
 Identities = 21/33 (63%), Positives = 24/33 (72%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRF 481
           PR CSHC   KT  WR GP G K+LCNACG+R+
Sbjct: 19  PRICSHCQTSKTSVWRNGPFGPKSLCNACGIRY 51



>gb:AY530746_1611895 Arabidopsis thaliana At4g36620 gene, partial
           cds.
          Length = 201

 Score = 55.1 bits (131), Expect = 8e-07
 Identities = 21/33 (63%), Positives = 25/33 (75%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           RRC++C    TP WR GP G K+LCNACG+RFK
Sbjct: 75  RRCANCDTTSTPLWRNGPRGPKSLCNACGIRFK 107



>gb:AY086746_1571789 Arabidopsis thaliana clone 27213 mRNA, complete
           sequence.
          Length = 294

 Score = 55.1 bits (131), Expect = 8e-07
 Identities = 21/33 (63%), Positives = 25/33 (75%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           RRC++C    TP WR GP G K+LCNACG+RFK
Sbjct: 151 RRCANCDTTSTPLWRNGPRGPKSLCNACGIRFK 183



>pir|T08408|T08408 transcription factor homolog F18B3.150 -
           Arabidopsis thaliana>gb:ATF18B3_1549091 Arabidopsis
           thaliana DNA chromosome 3, BAC clone F18B3.
          Length = 294

 Score = 55.1 bits (131), Expect = 8e-07
 Identities = 21/33 (63%), Positives = 25/33 (75%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           RRC++C    TP WR GP G K+LCNACG+RFK
Sbjct: 151 RRCANCDTTSTPLWRNGPRGPKSLCNACGIRFK 183



>pir|D85432|D85432 transcription factor like protein [imported] -
           Arabidopsis thaliana>gb:ATAP22_1544035 Arabidopsis
           thaliana DNA chromosome 4, ESSA I AP2 contig fragment
           No. 2.>gb:ATCHRIV85_1547617 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 85.
          Length = 211

 Score = 55.1 bits (131), Expect = 8e-07
 Identities = 21/33 (63%), Positives = 25/33 (75%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           RRC++C    TP WR GP G K+LCNACG+RFK
Sbjct: 75  RRCANCDTTSTPLWRNGPRGPKSLCNACGIRFK 107



>gb:CR380958_1653367 Candida glabrata strain CBS138 chromosome L
           complete sequence.
          Length = 828

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 24/55 (43%), Positives = 31/55 (56%), Gaps = 9/55 (16%)
 Frame = -3

Query: 573 RCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKS---------GRLLPEYRPACSP 436
           RC HCG   TP+WR GP G++TLCNACG+ ++          G L   YR   +P
Sbjct: 738 RCHHCGESDTPEWRRGPYGSRTLCNACGLFYRKLTKKFTVPYGNLYMRYRRIQAP 792



>gb:AB016872_1512922 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K21P3.
          Length = 139

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 20/36 (55%), Positives = 26/36 (72%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGR 469
           + C+ CG  KTP WR GP+G K+LCNACG+R +  R
Sbjct: 36  KTCADCGTSKTPLWRGGPVGPKSLCNACGIRNRKKR 71



>gb:AP005797_1857946 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:B1131G07.
          Length = 353

 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 21/36 (58%), Positives = 25/36 (69%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGR 469
           R CS C   KTP WR+GP G K+LCNACG+R +  R
Sbjct: 176 RVCSDCNTTKTPLWRSGPCGPKSLCNACGIRQRKAR 211



>gb:AY086778_1571821 Arabidopsis thaliana clone 27625 mRNA, complete
           sequence.
          Length = 120

 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 21/36 (58%), Positives = 24/36 (66%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGR 469
           R CS C   KTP WR GP G K+LCNACG+R +  R
Sbjct: 26  RCCSECKTTKTPMWRGGPTGPKSLCNACGIRHRKQR 61



>gb:DDU68754_1377407 Dictyostelium discoideum putative transcription
           factor (stkA) mRNA, complete cds.
          Length = 872

 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 26/83 (31%), Positives = 43/83 (51%), Gaps = 1/83 (1%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHR 400
           PR C  CG  +TP WR GP G  +LCNACG++++       ++P       SQ   N  +
Sbjct: 291 PRSCEFCGSSQTPTWRRGPSGKGSLCNACGIKWRLKGKDGIFKP-------SQKQQNRQK 343

Query: 399 KVLEMRRK-KESEDSPGFAPPVQ 334
            ++  +++ K+ ++ P    P Q
Sbjct: 344 PIMSAQKQPKQQQNQPQQQQPQQ 366



>gb:AC116977_1206928 Dictyostelium discoideum chromosome 2 map
           5515173-5817331 strain AX4, complete sequence.
          Length = 844

 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 26/83 (31%), Positives = 43/83 (51%), Gaps = 1/83 (1%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHR 400
           PR C  CG  +TP WR GP G  +LCNACG++++       ++P       SQ   N  +
Sbjct: 263 PRSCEFCGSSQTPTWRRGPSGKGSLCNACGIKWRLKGKDGIFKP-------SQKQQNRQK 315

Query: 399 KVLEMRRK-KESEDSPGFAPPVQ 334
            ++  +++ K+ ++ P    P Q
Sbjct: 316 PIMSAQKQPKQQQNQPQQQQPQQ 338



>pir|T01770|T01770 hypothetical protein A_IG002P16.9 - Arabidopsis
           thaliana>gb:F2P16_1678195 Arabidopsis thaliana BAC
           F2P16, complete sequence.
          Length = 550

 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 21/36 (58%), Positives = 24/36 (66%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGR 469
           R CS C   KTP WR GP G K+LCNACG+R +  R
Sbjct: 456 RCCSECKTTKTPMWRGGPTGPKSLCNACGIRHRKQR 491



>sp|P40209|GAT2_YEAST GAT2 protein.>pir|S50392|S50392 hypothetical
           protein YMR136w - yeast (Saccharomyces
           cerevisiae)>gb:SC9375_1705872 S.cerevisiae chromosome
           XIII cosmid 9375.
          Length = 560

 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 24/49 (48%), Positives = 29/49 (59%), Gaps = 9/49 (18%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRF---------KSGRLLPEYR 451
           C HCG  +TP+WR GP G +TLCNACG+ +         KS  LL  YR
Sbjct: 472 CFHCGETETPEWRKGPYGTRTLCNACGLFYRKVTKKFGSKSSNLLLRYR 520



>gb:AY084525_1569614 Arabidopsis thaliana clone 110655 mRNA,
           complete sequence.
          Length = 136

 Score = 53.1 bits (126), Expect = 3e-06
 Identities = 20/38 (52%), Positives = 26/38 (68%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGR 469
           + + C+ CG  KTP WR GP G K+LCNACG+R +  R
Sbjct: 26  EKKSCAICGTSKTPLWRGGPAGPKSLCNACGIRNRKKR 63



>gb:AY065074_1566228 Arabidopsis thaliana unknown protein
           (At5g56860; MPI10.2) mRNA, complete cds.
          Length = 398

 Score = 53.1 bits (126), Expect = 3e-06
 Identities = 21/36 (58%), Positives = 25/36 (69%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGR 469
           R CS C   KTP WR+GP G K+LCNACG+R +  R
Sbjct: 230 RVCSDCNTTKTPLWRSGPRGPKSLCNACGIRQRKAR 265



>gb:AY063926_1565873 Arabidopsis thaliana unknown protein
           (At3g06740) mRNA, complete cds.>gb:AY091250_1574458
           Arabidopsis thaliana unknown protein (At3g06740) mRNA,
           complete cds.
          Length = 149

 Score = 53.1 bits (126), Expect = 3e-06
 Identities = 20/38 (52%), Positives = 26/38 (68%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGR 469
           + + C+ CG  KTP WR GP G K+LCNACG+R +  R
Sbjct: 39  EKKSCAICGTSKTPLWRGGPAGPKSLCNACGIRNRKKR 76



>gb:ATAC023912_1543781 Arabidopsis thaliana chromosome III BAC F3E22
           genomic sequence, complete sequence.
          Length = 136

 Score = 53.1 bits (126), Expect = 3e-06
 Identities = 20/38 (52%), Positives = 26/38 (68%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGR 469
           + + C+ CG  KTP WR GP G K+LCNACG+R +  R
Sbjct: 26  EKKSCAICGTSKTPLWRGGPAGPKSLCNACGIRNRKKR 63



>gb:AB020747_1514633 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MPI10.
          Length = 398

 Score = 53.1 bits (126), Expect = 3e-06
 Identities = 21/36 (58%), Positives = 25/36 (69%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGR 469
           R CS C   KTP WR+GP G K+LCNACG+R +  R
Sbjct: 230 RVCSDCNTTKTPLWRSGPRGPKSLCNACGIRQRKAR 265



>pir|T04270|T04270 hypothetical protein F20B18.260 - Arabidopsis
           thaliana>gb:ATCHRIV64_1546496 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           64.>gb:ATF20B18_1549463 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F20B18 (ESSA project).
          Length = 352

 Score = 53.1 bits (126), Expect = 3e-06
 Identities = 21/36 (58%), Positives = 25/36 (69%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGR 469
           R CS C   KTP WR+GP G K+LCNACG+R +  R
Sbjct: 199 RICSDCNTTKTPLWRSGPRGPKSLCNACGIRQRKAR 234



>gb:CR380955_1651556 Candida glabrata strain CBS138 chromosome I
           complete sequence.
          Length = 567

 Score = 52.8 bits (125), Expect = 4e-06
 Identities = 25/55 (45%), Positives = 30/55 (54%), Gaps = 9/55 (16%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRF---------KSGRLLPEYRPACSPT 433
           C HCG   TP+WR GP G +TLCNACG+ +         K+  LL  YR   S T
Sbjct: 477 CLHCGENHTPEWRRGPYGNRTLCNACGLFYRKAISKFGVKNANLLLRYRKRISNT 531



>gb:BT020259_1642654 Arabidopsis thaliana At5g47140 gene, complete
           cds.>gb:BT020450_1642844 Arabidopsis thaliana At5g47140
           mRNA, complete cds.
          Length = 470

 Score = 51.6 bits (122), Expect = 9e-06
 Identities = 23/57 (40%), Positives = 29/57 (50%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHR 400
           C HCGV  TP WR GP     LCNACG R+++   L  Y P  +     +    +HR
Sbjct: 7   CYHCGVTSTPLWRNGPPEKPVLCNACGSRWRTKGSLVNYTPLHARAEGDETEIEDHR 63



>gb:AP003228_1825696 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0020E09.
          Length = 142

 Score = 51.2 bits (121), Expect = 1e-05
 Identities = 19/36 (52%), Positives = 25/36 (69%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGR 469
           + C+ C   KTP WR GP G K+LCNACG+R++  R
Sbjct: 22  KACADCHTTKTPLWRGGPGGPKSLCNACGIRYRKRR 57



>gb:CR382132_1665160 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 474

 Score = 51.2 bits (121), Expect = 1e-05
 Identities = 18/30 (60%), Positives = 23/30 (76%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRF 481
           C+ CG   +P+WR GP G KTLCNACG+R+
Sbjct: 433 CTECGTMNSPEWRKGPQGRKTLCNACGLRW 462



>gb:CNS09S4S_1648273 DNA centromeric region sequence from BAC DP26B06,
            DP34F04, DP16D11, DP09G08, DP35C12 of chromosome 5 of
            Podospora anserina.
          Length = 1042

 Score = 51.2 bits (121), Expect = 1e-05
 Identities = 29/93 (31%), Positives = 47/93 (50%), Gaps = 11/93 (11%)
 Frame = -3

Query: 576  RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRF------KSGRLLPEYRPACSPTFSSQLH 415
            R C++C  + TP+WR GP G + LCN+CG+R+      ++GR+ P          S + +
Sbjct: 868  RDCANCHTRNTPEWRRGPSGQRDLCNSCGLRWAKQRDAQTGRVSPRNSNRGGDAQSKKSN 927

Query: 414  SNNH-----RKVLEMRRKKESEDSPGFAPPVQS 331
            S +H     R+V     K  + D+P   P  +S
Sbjct: 928  SPSHASPLQREVNSNSTKPATTDTPPTEPGSKS 960



>gb:AF082072_1766577 Emericella nidulans ABC transporter protein
           AtrC (atrC) and GATA-factor (lreB) genes, complete cds.
          Length = 417

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 18/31 (58%), Positives = 24/31 (77%)
 Frame = -3

Query: 573 RCSHCGVQKTPQWRAGPLGAKTLCNACGVRF 481
           +C+ CG   +P+WR GP G KTLCNACG+R+
Sbjct: 375 KCADCGTSDSPEWRKGPEGPKTLCNACGLRW 405



>gb:OSJN00102_1694951 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0038F03, complete sequence.
          Length = 450

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 21/41 (51%), Positives = 24/41 (58%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRP 448
           C HCGV  TP WR GP     LCNACG R+++   L  Y P
Sbjct: 7   CRHCGVTSTPLWRNGPPDKPVLCNACGSRWRTKGSLTNYTP 47



>gb:ENU70043_1676807 Aspergillus nidulans NsdD (nsdD) gene, complete
           cds.>gb:ENU70044_1676808 Emericella nidulans DNA binding
           protein NsdD (nsd) mRNA, complete cds.
          Length = 461

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 19/33 (57%), Positives = 24/33 (72%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRF 481
           P RC  C   +TP+WR GP GA+TLCNACG+ +
Sbjct: 397 PGRCHSCNRAETPEWRRGPDGARTLCNACGLHY 429



>pir|S69206|S69206 regulator protein white collar 1 - Neurospora
            crassa
          Length = 1154

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 13/67 (19%)
 Frame = -3

Query: 576  RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRF--KSGRLLPE-----------YRPACSP 436
            R C++C  + TP+WR GP G + LCN+CG+R+  ++GR+ P             + + SP
Sbjct: 933  RDCANCHTRNTPEWRRGPSGNRDLCNSCGLRWAKQTGRVSPRTSSRGGNGDSMSKKSNSP 992

Query: 435  TFSSQLH 415
            + SS LH
Sbjct: 993  SHSSPLH 999



>sp|Q01371|WC1_NEUCR White collar 1 protein (WC1).>gb:NCDNAWC1_1690512
            Neurospora crassa wc-1 gene.
          Length = 1167

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 13/67 (19%)
 Frame = -3

Query: 576  RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRF--KSGRLLPE-----------YRPACSP 436
            R C++C  + TP+WR GP G + LCN+CG+R+  ++GR+ P             + + SP
Sbjct: 932  RDCANCHTRNTPEWRRGPSGNRDLCNSCGLRWAKQTGRVSPRTSSRGGNGDSMSKKSNSP 991

Query: 435  TFSSQLH 415
            + SS LH
Sbjct: 992  SHSSPLH 998



>gb:AP003329_1827987 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1045F02.
          Length = 131

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 18/36 (50%), Positives = 24/36 (66%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGR 469
           R C  C    TP WR+GP G ++LCNACG+R++  R
Sbjct: 19  RSCVECRATTTPMWRSGPTGPRSLCNACGIRYRKKR 54



>gb:AK119021_1816966 Arabidopsis thaliana At4g16141 mRNA for unknown
           protein, complete cds, clone: RAFL21-34-K14.
          Length = 197

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 18/36 (50%), Positives = 24/36 (66%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGR 469
           + C  CG  +TP WR GP G K+LCNACG++ +  R
Sbjct: 37  KTCVDCGTSRTPLWRGGPAGPKSLCNACGIKSRKKR 72



>gb:AE017343_1755878 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 438

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGV 487
           P  C  CG  +TP+WR GP+G +TLCNACG+
Sbjct: 356 PPTCLGCGATETPEWRRGPMGPRTLCNACGL 386



>gb:BT010844_1640790 Arabidopsis thaliana At3g16870 mRNA, complete
           cds.>gb:BT012611_1641681 Arabidopsis thaliana At1g35180
           gene, complete cds.>gb:AP001308_1821121 Arabidopsis
           thaliana genomic DNA, chromosome 3, P1 clone:MUH15.
          Length = 190

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 19/36 (52%), Positives = 24/36 (66%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGR 469
           R C  CG  +TP WR GP G K+LCNACG++ +  R
Sbjct: 42  RTCVDCGTIRTPLWRGGPAGPKSLCNACGIKSRKKR 77



>gb:AY823264_1628895 Hypocrea jecorina white collar 1 (WC1) gene,
            complete cds.
          Length = 1040

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 25/70 (35%), Positives = 38/70 (54%), Gaps = 16/70 (22%)
 Frame = -3

Query: 576  RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRF--KSGRLLPE--------------YRPA 445
            R C++C  + TP+WR GP G + LCN+CG+R+  ++GR+ P                + +
Sbjct: 898  RDCANCHTRNTPEWRRGPSGQRDLCNSCGLRWAKQTGRVSPRNSTRGSHSVNTDTYTKKS 957

Query: 444  CSPTFSSQLH 415
             SP  SS LH
Sbjct: 958  TSPIHSSPLH 967



>gb:AY628431_1618571 Trichoderma atroviride blue light regulator 1
            (blr-1) gene, complete cds.
          Length = 1020

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 25/70 (35%), Positives = 39/70 (55%), Gaps = 16/70 (22%)
 Frame = -3

Query: 576  RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRF--KSGRLLP--------------EYRPA 445
            R C++C  + TP+WR GP G + LCN+CG+R+  ++GR+ P              + + +
Sbjct: 873  RDCANCHTRNTPEWRRGPSGQRDLCNSCGLRWAKQTGRVSPRNSTRGGHSGNTDAQSKKS 932

Query: 444  CSPTFSSQLH 415
             SP  SS LH
Sbjct: 933  ASPIPSSPLH 942



>gb:AY062562_1565218 Arabidopsis thaliana Unknown protein
           (Z97343.42) mRNA, complete cds.>gb:BT020356_1642751
           Arabidopsis thaliana At4g17570 gene, complete cds.
          Length = 510

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 21/41 (51%), Positives = 24/41 (58%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRP 448
           C HCGV  TP WR GP     LCNACG R+++   L  Y P
Sbjct: 7   CYHCGVTNTPLWRNGPPEKPVLCNACGSRWRTKGTLVNYTP 47



>gb:CR382138_1671875 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 375

 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 18/32 (56%), Positives = 25/32 (78%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGV 487
           Q  +C+HC   +TP+WR GP G++TLCNACG+
Sbjct: 299 QKIKCNHCESTETPEWRRGPDGSRTLCNACGL 330



>gb:CR382137_1669842 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 288

 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 18/28 (64%), Positives = 21/28 (75%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGV 487
           C  CG  +TP+WR GP G KTLCNACG+
Sbjct: 177 CQRCGTTETPEWRRGPGGVKTLCNACGL 204



>gb:AY882438_1631940 Cryptococcus neoformans var. neoformans white
           collar 2 (BWC2) mRNA, complete cds.>gb:AE017345_1756732
           Cryptococcus neoformans var. neoformans JEC21 chromosome
           5, complete sequence.
          Length = 392

 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 19/30 (63%), Positives = 23/30 (76%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRF 481
           C  CG   +P+WR GPLG KTLCNACG+R+
Sbjct: 348 CVTCGRTDSPEWRKGPLGPKTLCNACGLRW 377



>gb:AY823265_1628896 Hypocrea jecorina white collar 2 (WC2) gene,
           complete cds.
          Length = 500

 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 18/30 (60%), Positives = 23/30 (76%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRF 481
           C+ CG   +P+WR GP G KTLCNACG+R+
Sbjct: 451 CTDCGTLDSPEWRKGPSGPKTLCNACGLRW 480



>sp|P78714|WC2_NEUCR White collar 2 protein (WC2).>pir|T46648|T46648
           zinc finger protein wc-2 [validated] - Neurospora
           crassa>gb:BX842682_1644278 Neurospora crassa DNA linkage
           group I BAC contig B13C5.>gb:NCWC2_1690722 N.crassa wc-2
           gene.
          Length = 530

 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 18/30 (60%), Positives = 23/30 (76%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRF 481
           C+ CG   +P+WR GP G KTLCNACG+R+
Sbjct: 468 CTDCGTLDSPEWRKGPSGPKTLCNACGLRW 497



>sp|Q00858|CGPB_FUSSO Cutinase gene palindrome-binding protein
           (PBP).>pir|A57506|A57506 palindrome-binding protein -
           fungus (Fusarium solani)>gb:FSU23722_1679324 Fusarium
           solani pisi cutinase gene palindrome-binding protein
           mRNA, complete cds.
          Length = 457

 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 18/30 (60%), Positives = 23/30 (76%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRF 481
           C+ CG   +P+WR GP G KTLCNACG+R+
Sbjct: 402 CTDCGTLDSPEWRKGPSGPKTLCNACGLRW 431



>gb:NC123A4_1688273 Neurospora crassa DNA linkage group V cosmid
           contig 123A4.
          Length = 445

 Score = 49.3 bits (116), Expect = 5e-05
 Identities = 19/33 (57%), Positives = 23/33 (69%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRF 481
           P RC  C    TP+WR GP GA+TLCNACG+ +
Sbjct: 390 PGRCHSCNRIDTPEWRRGPDGARTLCNACGLHY 422



>gb:CR382139_1672133 Debaryomyces hansenii chromosome G of strain
           CBS767 of Debaryomyces hansenii.
          Length = 401

 Score = 49.3 bits (116), Expect = 5e-05
 Identities = 19/32 (59%), Positives = 24/32 (75%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGV 487
           Q  RC+HCG + TP+WR G  G +TLCNACG+
Sbjct: 337 QEIRCNHCGSKNTPEWRKGLDGNRTLCNACGL 368



>gb:CR382131_1664774 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 406

 Score = 49.3 bits (116), Expect = 5e-05
 Identities = 18/28 (64%), Positives = 22/28 (78%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGV 487
           C  CG  +TP+WR GP GA+TLCNACG+
Sbjct: 350 CRGCGTTETPEWRKGPEGARTLCNACGL 377



>gb:AY628432_1618572 Trichoderma atroviride blue light regulator 2
           (blr-2) gene, complete cds.
          Length = 484

 Score = 49.3 bits (116), Expect = 5e-05
 Identities = 18/30 (60%), Positives = 23/30 (76%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRF 481
           C+ CG   +P+WR GP G KTLCNACG+R+
Sbjct: 430 CTDCGTLDSPEWRKGPNGPKTLCNACGLRW 459



>gb:AC116922_1206436 Dictyostelium discoideum chromosome 2 map
           6061442-6097630 strain AX4, complete sequence.
          Length = 587

 Score = 49.3 bits (116), Expect = 5e-05
 Identities = 18/30 (60%), Positives = 22/30 (73%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRF 481
           C  CG  +TP+WR GP G KTLCNACG+ +
Sbjct: 500 CIFCGTMETPEWRKGPGGHKTLCNACGLHY 529



>gb:AB025629_1516530 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MOE17.
          Length = 208

 Score = 48.9 bits (115), Expect = 6e-05
 Identities = 18/35 (51%), Positives = 26/35 (74%), Gaps = 2/35 (5%)
 Frame = -3

Query: 576 RRCSH--CGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           ++C++  C    TP WR GPLG K+LCNACG++F+
Sbjct: 157 KKCTNMNCNALNTPMWRRGPLGPKSLCNACGIKFR 191



>gb:CR382126_1659113 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 391

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 22/54 (40%), Positives = 27/54 (50%), Gaps = 9/54 (16%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRF---------KSGRLLPEYRPACSP 436
           C HC    TP+WR GP G +TLCNACG+ +         K   +L  YR    P
Sbjct: 300 CKHCHETVTPEWRRGPYGNRTLCNACGLFYCKLIRKFNTKDANILMHYRKMKGP 353



>gb:AB183264_1202537 Dictyostelium discoideum amvA mRNA for GATA
           zinc finger protein, complete cds.
          Length = 650

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 16/32 (50%), Positives = 24/32 (75%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRF 481
           ++C+ CG   +P+WR GP G ++LCNACG+ F
Sbjct: 520 KQCTSCGTTSSPEWRKGPAGNQSLCNACGLYF 551



>gb:AF515628_1807470 Emericella nidulans GATA-factor (lreA) gene,
           complete cds.
          Length = 836

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 16/32 (50%), Positives = 24/32 (75%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRF 481
           + C+ CG + TP+WR GP G + LCN+CG+R+
Sbjct: 785 KSCAMCGTRTTPEWRRGPSGNRDLCNSCGLRW 816



>gb:AE016817_1747633 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 625

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 17/28 (60%), Positives = 21/28 (75%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGV 487
           C HC  + TP+WR GP G +TLCNACG+
Sbjct: 536 CLHCQERDTPEWRRGPYGNRTLCNACGL 563



>gb:AY189831_1588432 Penicillium chrysogenum RfeH (rfeH) gene,
           complete cds.
          Length = 359

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 17/31 (54%), Positives = 22/31 (70%)
 Frame = -3

Query: 573 RCSHCGVQKTPQWRAGPLGAKTLCNACGVRF 481
           RC  C   +TP+WR GP G +TLCNACG+ +
Sbjct: 307 RCHSCNRSETPEWRRGPDGPRTLCNACGLHY 337



>sp|Q07928|GAT3_YEAST GAT3 protein.>pir|S64835|S64835 hypothetical
           protein YLR013w - yeast (Saccharomyces
           cerevisiae)>gb:AY558530_1614757 Saccharomyces cerevisiae
           clone FLH111026.01X YLR013W gene, complete
           cds.>gb:SCYLR013W_1713414 S.cerevisiae chromosome XII
           reading frame ORF YLR013w.
          Length = 141

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 21/34 (61%), Positives = 24/34 (70%), Gaps = 1/34 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKT-PQWRAGPLGAKTLCNACGVRFK 478
           RRC  C V KT PQWR GP G  TLCNACG+ ++
Sbjct: 70  RRCPQCAVIKTSPQWREGPDGEVTLCNACGLFYR 103



>gb:AE016814_1746005 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome I, complete sequence.
          Length = 460

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 16/28 (57%), Positives = 22/28 (78%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGV 487
           C  CG + T +WR+GPLG K++CNACG+
Sbjct: 342 CLQCGSRDTSEWRSGPLGRKSMCNACGI 369



>gb:TBO575416_1724825 Tuber borchii Tbwc-1 gene for tuber borchii
           white collar-1 protein.>gb:TBO575418_1724826 Tuber
           borchii mRNA for tuber borchii white collar-1 (Tbwc-1
           gene).
          Length = 956

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 18/39 (46%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFKS--GRLLP 460
           C++C  + TP+WR GP G + LCN+CG+R+    GR+ P
Sbjct: 830 CANCHTRVTPEWRRGPSGKRDLCNSCGLRYAKLIGRVSP 868



>gb:CR380950_1649809 Candida glabrata strain CBS138 chromosome D
           complete sequence.
          Length = 441

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 18/31 (58%), Positives = 21/31 (67%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           C  CG   TP+WR GP G  TLCNACG+ +K
Sbjct: 379 CLQCGKVDTPEWRNGPQGKATLCNACGLFYK 409



>sp|P40349|URB1_USTMA Siderophore biosynthesis regulatory protein
           URBS1.>pir|S27473|S27473 URBS1 protein - smut fungus
           (Ustilago maydis)>gb:USMURBS1A_1726941 Ustilago maydis
           URBS1 protein (urbS1) gene, complete cds.
          Length = 950

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 20/33 (60%), Positives = 24/33 (72%)
 Frame = -3

Query: 573 RCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKS 475
           RCS+CGV  TP WR  P G+ T+CNACG+  KS
Sbjct: 337 RCSNCGVTSTPLWRRAPDGS-TICNACGLYIKS 368



 Score = 32.7 bits (73), Expect = 4.4
 Identities = 14/32 (43%), Positives = 18/32 (56%)
 Frame = -3

Query: 573 RCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           RC++C    TP WR    G   +CNACG+  K
Sbjct: 481 RCTNCQTTTTPLWRRDEDG-NNICNACGLYHK 511



>gb:AC116922_1206437 Dictyostelium discoideum chromosome 2 map
           6061442-6097630 strain AX4, complete sequence.
          Length = 519

 Score = 46.2 bits (108), Expect = 4e-04
 Identities = 16/30 (53%), Positives = 22/30 (73%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRF 481
           C +C   +TP+WR GP G K+LCNACG+ +
Sbjct: 462 CRNCKTTETPEWRKGPDGTKSLCNACGLHY 491



>gb:AY347827_1177986 Malus x domestica clone 18-2 putative GATA-type
           zinc finger protein mRNA, partial cds.
          Length = 100

 Score = 46.2 bits (108), Expect = 4e-04
 Identities = 18/28 (64%), Positives = 20/28 (71%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNAC 493
           R CS C   KTP WR+GP G K+LCNAC
Sbjct: 73  RVCSDCNTTKTPLWRSGPRGPKSLCNAC 100



>gb:CR382126_1658787 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 252

 Score = 45.4 bits (106), Expect = 7e-04
 Identities = 17/34 (50%), Positives = 23/34 (67%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           P+ C HC   +T +WR GP G  TLCNACG+ ++
Sbjct: 123 PKYCVHCECVETIEWRNGPWGKATLCNACGLWYR 156



>sp|P40569|GAT4_YEAST GAT4 protein.>pir|S48357|S48357 hypothetical
           protein YIR013c - yeast (Saccharomyces
           cerevisiae)>gb:AY557847_1614074 Saccharomyces cerevisiae
           clone FLH003649.01X YIR013C gene, complete
           cds.>gb:SC9167_1705753 S.cerevisiae chromosome IX cosmid
           9167.
          Length = 121

 Score = 45.4 bits (106), Expect = 7e-04
 Identities = 23/61 (37%), Positives = 33/61 (54%), Gaps = 1/61 (1%)
 Frame = -3

Query: 576 RRCSHCGVQKTP-QWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHR 400
           R C  CG  KT  QWR GP GA  LCNACG+ F+  +L+  +  A +  +  Q+     +
Sbjct: 51  RTCGQCGEIKTSLQWREGPNGAACLCNACGLFFR--KLILRFGRAAAKRYMEQIKGTGTK 108

Query: 399 K 397
           +
Sbjct: 109 R 109



>gb:CR382131_1663689 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 805

 Score = 44.3 bits (103), Expect = 0.001
 Identities = 18/32 (56%), Positives = 23/32 (71%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFKS 475
           CS+CG  +TP WR  P GA T+CNACG+  K+
Sbjct: 228 CSNCGTTRTPLWRRAPNGA-TICNACGLYLKA 258



 Score = 36.2 bits (82), Expect = 0.40
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           C +CG   TP WR    G+ T+CNACG+ ++
Sbjct: 397 CQNCGTTITPLWRRDDSGS-TICNACGLYYR 426



>gb:AC126223_1740539 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBb0076N15, complete sequence.
          Length = 778

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 2/38 (5%)
 Frame = -3

Query: 573 RCSHCGVQK--TPQWRAGPLGAKTLCNACGVRFKSGRL 466
           RC  CG+    TP  R GP G +TLCNACG+ +  G++
Sbjct: 29  RCLRCGISANATPHMRRGPEGRRTLCNACGIAWAKGKV 66



>pir|S63461|S63461 hypothetical protein YPL021w - yeast
           (Saccharomyces cerevisiae)>gb:AY558439_1614666
           Saccharomyces cerevisiae clone FLH111506.01X YPL021W
           gene, complete cds.>gb:SCU36624_1710210 Saccharomyces
           cerevisiae chromosome XVI, left arm cosmid 9901.
          Length = 187

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 16/35 (45%), Positives = 23/35 (65%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           QP+ C+ CG   T QWR+GP G   LC+ CG+ ++
Sbjct: 128 QPKECATCGDTWTSQWRSGPNGNVELCSRCGIAYR 162



>sp|Q92259|SREP_PENCH GATA factor SREP.>pir|JC6170|JC6170
           GATA-transcription factor - Penicillium
           chrysogenum>gb:PCU48414_1699463 Penicillium chrysogenum
           GATA factor (sreP) gene, complete cds.
          Length = 532

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 22/58 (37%), Positives = 30/58 (51%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           CS+CG + TP WR  P GA  +CNACG+  K+       R    PT  +++ S    K
Sbjct: 94  CSNCGTKSTPLWRRSPTGA-MICNACGLYLKA-------RNVARPTKRNRMQSEGAEK 143



 Score = 35.0 bits (79), Expect = 0.88
 Identities = 23/66 (34%), Positives = 30/66 (45%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRKVL 391
           C +CG   TP WR    G   +CNACG+ +K   L   YRP             N +K +
Sbjct: 238 CQNCGTTVTPLWRRDEQG-HPICNACGLYYK---LHGCYRP------------TNMKKSI 281

Query: 390 EMRRKK 373
             RRK+
Sbjct: 282 IKRRKR 287



>gb:AF520973_1807869 Candida albicans transcription factor SFU1
           gene, complete cds.
          Length = 518

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 17/34 (50%), Positives = 24/34 (70%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKS 475
           ++CS+CG  KTP WR  P G   +CNACG+ ++S
Sbjct: 59  QQCSNCGTTKTPLWRRAPDGT-LICNACGLYYRS 91



 Score = 38.1 bits (87), Expect = 0.10
 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 2/74 (2%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRP--ACSPTFSSQLHSNNHRK 397
           C +CG   TP WR    G  T+CNACG+ +   RL   +RP     PT   +  + + +K
Sbjct: 185 CFNCGTTITPLWRRDDAG-NTICNACGLFY---RLHGSHRPIKMKRPTIKRRKRNVSDKK 240

Query: 396 VLEMRRKKESEDSP 355
             +  +   S+ SP
Sbjct: 241 SKDEVQMHSSDQSP 254



>gb:AY603044_1617445 Marchantia polymorpha male-specific
           transcription factor M88B7.2 (M88B7.2) mRNA, complete
           cds.
          Length = 393

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 2/69 (2%)
 Frame = -3

Query: 570 CSHCGV--QKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRK 397
           C HCG+  + TP  R GP G +TLCNACG+ + +  +L +         + Q     H++
Sbjct: 276 CVHCGIGERSTPMMRRGPSGPRTLCNACGLMWANKGVLRDLSKNPPLPGAPQQPHMLHQQ 335

Query: 396 VLEMRRKKE 370
            + MR++++
Sbjct: 336 QIIMRQQQQ 344



>gb:AY045906_1561411 Arabidopsis thaliana putative flowering protein
           CONSTANS (At1g51600) mRNA, complete cds.
          Length = 302

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 17/30 (56%), Positives = 21/30 (70%), Gaps = 2/30 (6%)
 Frame = -3

Query: 570 CSHCGV--QKTPQWRAGPLGAKTLCNACGV 487
           C HCG+  + TP  R GP G +TLCNACG+
Sbjct: 223 CRHCGIGEKSTPMMRRGPAGPRTLCNACGL 252



>gb:AB119061_1527911 Arabidopsis thaliana ZML2 mRNA for GATA-type
           zinc finger protein, complete cds.>gb:AY150395_1584960
           Arabidopsis thaliana putative flowering protein CONSTANS
           (At1g51600) mRNA, complete cds.
          Length = 302

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 17/30 (56%), Positives = 21/30 (70%), Gaps = 2/30 (6%)
 Frame = -3

Query: 570 CSHCGV--QKTPQWRAGPLGAKTLCNACGV 487
           C HCG+  + TP  R GP G +TLCNACG+
Sbjct: 223 CRHCGIGEKSTPMMRRGPAGPRTLCNACGL 252



>pir|JC7336|JC7336 zinc-finger protein - Arabidopsis
           thaliana>gb:AB035310_1518937 Arabidopsis thaliana mRNA
           for ZIM, complete cds.
          Length = 309

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 17/30 (56%), Positives = 21/30 (70%), Gaps = 2/30 (6%)
 Frame = -3

Query: 570 CSHCGVQK--TPQWRAGPLGAKTLCNACGV 487
           C+HCG+    TP  R GP G +TLCNACG+
Sbjct: 214 CTHCGISSKCTPMMRRGPSGPRTLCNACGL 243



>pir|T09910|T09910 hypothetical protein T22A6.300 - Arabidopsis
           thaliana>gb:AB035311_1518938 Arabidopsis thaliana gene
           for ZIM, complete cds.>gb:ATCHRIV61_1546330 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           61.>gb:ATT22A6_1555196 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T22A6 (ESSA
           project).>gb:AY086038_1571099 Arabidopsis thaliana clone
           20769 mRNA, complete sequence.
          Length = 309

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 17/30 (56%), Positives = 21/30 (70%), Gaps = 2/30 (6%)
 Frame = -3

Query: 570 CSHCGVQK--TPQWRAGPLGAKTLCNACGV 487
           C+HCG+    TP  R GP G +TLCNACG+
Sbjct: 214 CTHCGISSKCTPMMRRGPSGPRTLCNACGL 243



>gb:AP004278_1839664 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0468G03.>gb:AP005931_1860297 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0545E05.
          Length = 340

 Score = 42.7 bits (99), Expect = 0.004
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 2/44 (4%)
 Frame = -3

Query: 570 CSHCGV--QKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPA 445
           C HCG+  + TP  R GP G +TLCNACG+ + +  +L +   A
Sbjct: 257 CHHCGINAKATPMMRRGPDGPRTLCNACGLMWANKGMLRDLSKA 300



>gb:AF095898_1767795 Emericella nidulans siderophore biosynthesis
           repressor SREA (sreA) gene, complete cds.
          Length = 549

 Score = 42.7 bits (99), Expect = 0.004
 Identities = 17/32 (53%), Positives = 22/32 (68%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFKS 475
           CS+CG + TP WR  P GA  +CNACG+  K+
Sbjct: 106 CSNCGTKSTPLWRRSPTGA-MICNACGLYLKA 136



 Score = 35.8 bits (81), Expect = 0.52
 Identities = 18/41 (43%), Positives = 22/41 (53%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRP 448
           C +CG   TP WR    G   +CNACG+ +K   L   YRP
Sbjct: 251 CQNCGTTVTPLWRRDENG-HPICNACGLYYK---LHGSYRP 287



>gb:CNS07EG9_1372782 chromosome II of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 341

 Score = 42.7 bits (99), Expect = 0.004
 Identities = 20/40 (50%), Positives = 22/40 (55%), Gaps = 1/40 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLP 460
           R CS+C    TP WR G  G   LCNACG+  K  GR  P
Sbjct: 125 RICSNCSTTSTPSWRRGDQGKSLLCNACGLYQKLHGRTRP 164



>gb:AF087130_1767233 Neurospora crassa siderophore regulation
           protein (sre) gene, complete cds.
          Length = 587

 Score = 42.4 bits (98), Expect = 0.006
 Identities = 25/66 (37%), Positives = 33/66 (50%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRKVL 391
           CS+CG   TP WR  P GA  +CNACG+  K+       RPA      S + SN  +   
Sbjct: 118 CSNCGTTHTPLWRRSPQGA-IICNACGLYLKARNAA---RPANIRRPPSVMASNVRQAAA 173

Query: 390 EMRRKK 373
           ++  KK
Sbjct: 174 KLSPKK 179



 Score = 37.0 bits (84), Expect = 0.23
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           C +CG   TP WR    G  T+CNACG+ +K
Sbjct: 282 CQNCGTTITPLWRRDEAG-HTICNACGLYYK 311



>gb:AK118169_1816161 Arabidopsis thaliana At3g21175 mRNA for unknown
           protein, complete cds, clone: RAFL19-48-M24.
          Length = 123

 Score = 42.0 bits (97), Expect = 0.007
 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 2/58 (3%)
 Frame = -3

Query: 570 CSHCGVQK--TPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNH 403
           C HCG  +  TP  R GP G +TLCNACG+ + +   L +      P     L  N +
Sbjct: 45  CRHCGTSEKSTPMMRRGPDGPRTLCNACGLMWANKGTLRDLSKVPPPQTPQHLSLNKN 102



>gb:AE017347_1757817 Cryptococcus neoformans var. neoformans JEC21
           chromosome 7, complete sequence.
          Length = 632

 Score = 42.0 bits (97), Expect = 0.007
 Identities = 15/29 (51%), Positives = 20/29 (68%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVR 484
           C  CG +++P+WR    G K LCNACG+R
Sbjct: 563 CVMCGTKESPEWRKNTNGVKDLCNACGLR 591



>gb:CR382136_1668722 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 574

 Score = 42.0 bits (97), Expect = 0.007
 Identities = 17/34 (50%), Positives = 23/34 (67%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKS 475
           ++CS+CG  KTP WR  P G   +CNACG+  +S
Sbjct: 72  QQCSNCGTTKTPLWRRAPDGT-LICNACGLYLRS 104



 Score = 37.4 bits (85), Expect = 0.18
 Identities = 26/88 (29%), Positives = 37/88 (42%), Gaps = 8/88 (9%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRKV- 394
           C +CG   TP WR   +G  T+CNACG+ +   RL   +RP      + +    N   + 
Sbjct: 199 CFNCGSTITPLWRRDDVG-NTICNACGLYY---RLHGSHRPIKMKRNTIKRRKRNMTLIK 254

Query: 393 -------LEMRRKKESEDSPGFAPPVQS 331
                  L  R   E +  PG  P  Q+
Sbjct: 255 RDDSEERLTSRALNEPQQQPGIHPGQQT 282



>gb:AY085109_1570191 Arabidopsis thaliana clone 12996 mRNA, complete
           sequence.
          Length = 297

 Score = 42.0 bits (97), Expect = 0.007
 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 2/58 (3%)
 Frame = -3

Query: 570 CSHCGVQK--TPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNH 403
           C HCG  +  TP  R GP G +TLCNACG+ + +   L +      P     L  N +
Sbjct: 219 CRHCGTSEKSTPMMRRGPDGPRTLCNACGLMWANKGTLRDLSKVPPPQTPQHLSVNKN 276



>gb:AY042817_1560882 Arabidopsis thaliana Unknown protein (MXL8.2)
           mRNA, complete cds.>gb:AY064628_1566079 Arabidopsis
           thaliana unknown protein (MXL8.2) mRNA, complete cds.
          Length = 295

 Score = 42.0 bits (97), Expect = 0.007
 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 2/58 (3%)
 Frame = -3

Query: 570 CSHCGVQK--TPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNH 403
           C HCG  +  TP  R GP G +TLCNACG+ + +   L +      P     L  N +
Sbjct: 217 CRHCGTSEKSTPMMRRGPDGPRTLCNACGLMWANKGTLRDLSKVPPPQTPQHLSLNKN 274



>gb:AB023045_1515507 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MXL8.>gb:AB119060_1527910 Arabidopsis thaliana
           ZML1 mRNA for GATA-type zinc finger protein, complete
           cds.
          Length = 297

 Score = 42.0 bits (97), Expect = 0.007
 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 2/58 (3%)
 Frame = -3

Query: 570 CSHCGVQK--TPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNH 403
           C HCG  +  TP  R GP G +TLCNACG+ + +   L +      P     L  N +
Sbjct: 219 CRHCGTSEKSTPMMRRGPDGPRTLCNACGLMWANKGTLRDLSKVPPPQTPQHLSLNKN 276



>gb:AP005191_1849141 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0479D12.
          Length = 328

 Score = 41.6 bits (96), Expect = 0.009
 Identities = 17/30 (56%), Positives = 20/30 (66%), Gaps = 2/30 (6%)
 Frame = -3

Query: 570 CSHCGVQ--KTPQWRAGPLGAKTLCNACGV 487
           C HCG+    TP  R GP G +TLCNACG+
Sbjct: 236 CHHCGISAASTPMMRRGPDGPRTLCNACGL 265



>gb:AE017342_1754696 Cryptococcus neoformans var. neoformans JEC21
           chromosome 2, complete sequence.
          Length = 514

 Score = 41.6 bits (96), Expect = 0.009
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           RRC  CG   T +WR GP G  +LC+ CG+ ++
Sbjct: 455 RRCHGCGSSVTSEWRTGPDGPDSLCDICGMHYE 487



>gb:AF320976_1785893 Aspergillus nidulans GATA factor AREB gamma
           (areB) gene, partial cds; and GATA factors AREB alpha
           and beta (areB) gene, complete cds, alternatively
           spliced.
          Length = 320

 Score = 41.2 bits (95), Expect = 0.012
 Identities = 18/34 (52%), Positives = 21/34 (61%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           P  C +CG  KTP WR   LG+  LCNACG+  K
Sbjct: 22  PPICQNCGTSKTPLWRRDELGS-VLCNACGLFLK 54



>gb:AF320976_1785892 Aspergillus nidulans GATA factor AREB gamma
           (areB) gene, partial cds; and GATA factors AREB alpha
           and beta (areB) gene, complete cds, alternatively
           spliced.
          Length = 436

 Score = 41.2 bits (95), Expect = 0.012
 Identities = 18/34 (52%), Positives = 21/34 (61%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           P  C +CG  KTP WR   LG+  LCNACG+  K
Sbjct: 138 PPICQNCGTSKTPLWRRDELGS-VLCNACGLFLK 170



>gb:D83211_1674822 Zygosaccharomyces rouxii DNA for DNA-binding
           protein, complete cds.
          Length = 327

 Score = 41.2 bits (95), Expect = 0.012
 Identities = 25/72 (34%), Positives = 34/72 (47%), Gaps = 2/72 (2%)
 Frame = -3

Query: 573 RCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPT--FSSQLHSNNHR 400
           +C+HC  + TP WR  P+G   LCNACG+  K   L    RP    T     +  + N  
Sbjct: 245 KCTHCHTRTTPLWRRDPMG-NPLCNACGLFLK---LHGVVRPLSLKTDVIKKRQRNTNGN 300

Query: 399 KVLEMRRKKESE 364
           KV  + R +  E
Sbjct: 301 KVKGVNRVRRQE 312



>gb:AF320976_1785894 Aspergillus nidulans GATA factor AREB gamma
           (areB) gene, partial cds; and GATA factors AREB alpha
           and beta (areB) gene, complete cds, alternatively
           spliced.
          Length = 312

 Score = 40.4 bits (93), Expect = 0.021
 Identities = 17/31 (54%), Positives = 20/31 (64%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           C +CG  KTP WR   LG+  LCNACG+  K
Sbjct: 17  CQNCGTSKTPLWRRDELGS-VLCNACGLFLK 46



>pir|T26296|T26296 hypothetical protein W09C2.1 - Caenorhabditis
           elegans
          Length = 454

 Score = 40.4 bits (93), Expect = 0.021
 Identities = 18/35 (51%), Positives = 21/35 (60%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           + R C +CGV  TP WR    G   LCNACG+ FK
Sbjct: 251 EDRECVNCGVHNTPLWRRDGSG-NYLCNACGLYFK 284



>sp|Q01168|NUT1_MAGGR Nitrogen regulatory protein
           NUT1.>gb:U60290_1726347 Magnaporthe grisea nitrogen
           regulatory protein (NUT1) gene, complete cds.
          Length = 956

 Score = 40.4 bits (93), Expect = 0.021
 Identities = 17/34 (50%), Positives = 21/34 (61%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           P  C++C  Q TP WR  P G + LCNACG+  K
Sbjct: 660 PTTCTNCATQTTPLWRRNPEG-QPLCNACGLFLK 692



>sp|P28515|ELT1_CAEEL Transcription factor elt-1.>pir|A41267|A41267
           transcription factor elt-1 - Caenorhabditis
           elegans>gb:CEELT1_1361910 C.elegans elt-1 gene.
          Length = 416

 Score = 40.4 bits (93), Expect = 0.021
 Identities = 18/35 (51%), Positives = 21/35 (60%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           + R C +CGV  TP WR    G   LCNACG+ FK
Sbjct: 213 EDRECVNCGVHNTPLWRRDGSG-NYLCNACGLYFK 246



>gb:AC087851_1734195 Oryza sativa chromosome 3 BAC OSJNBb0072E24
           genomic sequence, complete sequence.
          Length = 319

 Score = 40.0 bits (92), Expect = 0.027
 Identities = 16/31 (51%), Positives = 21/31 (67%), Gaps = 2/31 (6%)
 Frame = -3

Query: 573 RCSHCGVQK--TPQWRAGPLGAKTLCNACGV 487
           +C +CG  +  TP  R GP G +TLCNACG+
Sbjct: 214 KCQNCGTSEKMTPAMRRGPAGPRTLCNACGL 244



>gb:CR382139_1672907 Debaryomyces hansenii chromosome G of strain
           CBS767 of Debaryomyces hansenii.
          Length = 702

 Score = 40.0 bits (92), Expect = 0.027
 Identities = 18/31 (58%), Positives = 20/31 (64%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           C +C   KTP WR  P G KTLCNACG+  K
Sbjct: 219 CFNCHALKTPLWRKDPQG-KTLCNACGLFLK 248



>gb:CR382130_1663157 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 238

 Score = 40.0 bits (92), Expect = 0.027
 Identities = 17/35 (48%), Positives = 22/35 (62%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           +P  C++C  Q TP WR  P G + LCNACG+  K
Sbjct: 83  KPTSCTNCHTQTTPLWRRNPEG-EPLCNACGLFLK 116



>gb:AE016819_1749348 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 468

 Score = 39.7 bits (91), Expect = 0.036
 Identities = 17/32 (53%), Positives = 21/32 (65%)
 Frame = -3

Query: 573 RCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           +CS+C  + TP WR GP G   LCNACG+  K
Sbjct: 288 KCSNCMTKTTPLWRRGPQG-DPLCNACGLFLK 318



>gb:BCI309051_1632782 Botrytis cinerea partial bir1 gene for GATA
           transcription factor, exons 1-3.
          Length = 388

 Score = 39.7 bits (91), Expect = 0.036
 Identities = 17/36 (47%), Positives = 23/36 (63%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKS 475
           Q  +  +CG  +TP WR  P GA T+CNACG+  K+
Sbjct: 114 QSNQICNCGTTRTPLWRRSPQGA-TICNACGLYQKA 148



 Score = 36.6 bits (83), Expect = 0.30
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           C +CG   TP WR    G  T+CNACG+ +K
Sbjct: 277 CQNCGTTITPLWRRDESG-HTICNACGLYYK 306



>gb:AY293736_1595721 Candida albicans nitrogen regulatory
           GATA-factor (GAT1) gene, complete cds.
          Length = 755

 Score = 39.7 bits (91), Expect = 0.036
 Identities = 16/31 (51%), Positives = 21/31 (67%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           C++CG + TP WR  P G + LCNACG+  K
Sbjct: 505 CTNCGTKTTPLWRRNPQG-QPLCNACGLFLK 534



>gb:AF320305_1785839 Aspergillus oryzae AreA (areA) gene, complete
           cds.
          Length = 853

 Score = 39.3 bits (90), Expect = 0.047
 Identities = 17/34 (50%), Positives = 21/34 (61%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           P  C++C  Q TP WR  P G + LCNACG+  K
Sbjct: 649 PTTCTNCFTQTTPLWRRNPEG-QPLCNACGLFLK 681



>gb:AF312694_1785205 Cladosporium fulvum nitrogen response factor
           NRF1 gene, complete cds.
          Length = 918

 Score = 39.3 bits (90), Expect = 0.047
 Identities = 17/34 (50%), Positives = 21/34 (61%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           P  C++C  Q TP WR  P G + LCNACG+  K
Sbjct: 670 PTSCTNCFTQTTPLWRRNPEG-QPLCNACGLFLK 702



>gb:AF148539_1772329 Aspergillus parasiticus major nitrogen
           regulatory protein (areA) gene, complete cds.
          Length = 866

 Score = 39.3 bits (90), Expect = 0.047
 Identities = 17/34 (50%), Positives = 21/34 (61%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           P  C++C  Q TP WR  P G + LCNACG+  K
Sbjct: 661 PTTCTNCFTQTTPLWRRNPEG-QPLCNACGLFLK 693



>gb:MAAJ6468_1685530 Metarhizium anisopliae nrr1 gene.
          Length = 944

 Score = 39.3 bits (90), Expect = 0.047
 Identities = 17/34 (50%), Positives = 21/34 (61%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           P  C++C  Q TP WR  P G + LCNACG+  K
Sbjct: 660 PTTCTNCFTQTTPLWRRNPEG-QPLCNACGLFLK 692



>gb:CR382121_1654319 Kluyveromyces lactis strain NRRL Y-1140
           chromosome A of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 781

 Score = 39.3 bits (90), Expect = 0.047
 Identities = 17/31 (54%), Positives = 20/31 (64%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGV 487
           P +C +C   KTP WR  P G  TLCNACG+
Sbjct: 346 PTQCYNCKTLKTPLWRRDPDG-NTLCNACGL 375



>gb:AY168017_1586323 Colletotrichum lindemuthianum major nitrogen
           regulatory protein (clnr1) gene, complete cds.
          Length = 971

 Score = 39.3 bits (90), Expect = 0.047
 Identities = 17/34 (50%), Positives = 21/34 (61%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           P  C++C  Q TP WR  P G + LCNACG+  K
Sbjct: 695 PTTCTNCFTQTTPLWRRNPEG-QPLCNACGLFLK 727



>sp|Q92269|NRFA_PENUR Nitrogen regulatory protein
           NRFA.>gb:PUU53137_1702901 Penicillium urticae nitrogen
           regulatory factor NRFA (nrfA) gene, complete cds.
          Length = 865

 Score = 39.3 bits (90), Expect = 0.047
 Identities = 17/34 (50%), Positives = 21/34 (61%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           P  C++C  Q TP WR  P G + LCNACG+  K
Sbjct: 662 PTTCTNCFTQTTPLWRRNPEG-QPLCNACGLFLK 694



>sp|P23767|GA1A_XENLA GATA binding factor-1A (Transcription factor
           xGATA-1A).>pir|A41602|A41602 transcription factor
           GATA-1A - African clawed frog>gb:XELGATAA_2581863
           X.laevis GATA-binding protein (XGATA-1A) gene, complete
           cds.
          Length = 359

 Score = 39.3 bits (90), Expect = 0.047
 Identities = 32/101 (31%), Positives = 44/101 (43%)
 Frame = -3

Query: 573 RCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRKV 394
           +CS+C    T  WR    G   +CNACG+ +K   L    RP    T   +     +RKV
Sbjct: 231 QCSNCHTSTTTLWRRNASG-DPVCNACGLYYK---LHNVNRPL---TMKKEGIQTRNRKV 283

Query: 393 LEMRRKKESEDSPGFAPPVQSF*KN*G*PFRLSLFQKKKKP 271
               +KK+  D+P F PP     +    PF   LF  +  P
Sbjct: 284 SSRSKKKKQLDNP-FEPPKAGVEEPSPYPFGPLLFHGQMPP 323



 Score = 38.1 bits (87), Expect = 0.10
 Identities = 26/78 (33%), Positives = 35/78 (44%), Gaps = 4/78 (5%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRPACSPTFSSQLH--- 415
           + R C +CG   TP WR   +    LCNACG+  K +G+  P  RP      S +     
Sbjct: 174 EDRECVNCGATVTPLWRR-DMSGHYLCNACGLYHKMNGQNRPLIRPKKRLIVSKRAGTQC 232

Query: 414 SNNHRKVLEMRRKKESED 361
           SN H     + R+  S D
Sbjct: 233 SNCHTSTTTLWRRNASGD 250



>sp|O13508|AREA_PENRO Nitrogen regulatory protein areA (Nitrogen
           regulator nmc).>gb:PRNMCGENE_1701818 Penicillium
           roqueforti nmC gene and promoter region.
          Length = 860

 Score = 39.3 bits (90), Expect = 0.047
 Identities = 17/34 (50%), Positives = 21/34 (61%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           P  C++C  Q TP WR  P G + LCNACG+  K
Sbjct: 657 PTTCTNCFTQTTPLWRRNPEG-QPLCNACGLFLK 689



>sp|P78688|AREA_GIBFU Nitrogen regulatory protein
           areA.>gb:GFAREAGEN_1679893 G.fujikuroi areA gene.
          Length = 971

 Score = 39.3 bits (90), Expect = 0.047
 Identities = 17/34 (50%), Positives = 21/34 (61%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           P  C++C  Q TP WR  P G + LCNACG+  K
Sbjct: 691 PTTCTNCFTQTTPLWRRNPEG-QPLCNACGLFLK 723



>sp|P17429|AREA_EMENI Nitrogen regulatory protein
           areA.>pir|A57988|A57988 regulatory protein areA -
           Emericella nidulans>gb:ANAREA_1819382 Aspergillus
           nidulans areA gene for DNA-binding protein.
          Length = 876

 Score = 39.3 bits (90), Expect = 0.047
 Identities = 17/34 (50%), Positives = 21/34 (61%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           P  C++C  Q TP WR  P G + LCNACG+  K
Sbjct: 670 PTTCTNCFTQTTPLWRRNPEG-QPLCNACGLFLK 702



>sp|O13415|AREA_ASPOR Nitrogen regulatory protein
           areA.>gb:AOAJ2968_1819619 Aspergillus oryzae areA gene.
          Length = 866

 Score = 39.3 bits (90), Expect = 0.047
 Identities = 17/34 (50%), Positives = 21/34 (61%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           P  C++C  Q TP WR  P G + LCNACG+  K
Sbjct: 661 PTTCTNCFTQTTPLWRRNPEG-QPLCNACGLFLK 693



>sp|O13412|AREA_ASPNG Nitrogen regulatory protein
           areA.>gb:ANAREAG_1819383 A.niger areA
           gene.>gb:ANAREAGEN_1819384 A.niger areA gene.
          Length = 882

 Score = 39.3 bits (90), Expect = 0.047
 Identities = 17/34 (50%), Positives = 21/34 (61%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           P  C++C  Q TP WR  P G + LCNACG+  K
Sbjct: 673 PTTCTNCFTQTTPLWRRNPEG-QPLCNACGLFLK 705



>gb:AE017343_1755454 Cryptococcus neoformans var. neoformans JEC21
            chromosome 3, complete sequence.
          Length = 1065

 Score = 38.9 bits (89), Expect = 0.061
 Identities = 16/35 (45%), Positives = 19/35 (54%)
 Frame = -3

Query: 570  CSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRL 466
            C  C  +    WR GP G  TLCN+CG  F  G+L
Sbjct: 920  CEGCAREGIKIWRRGPSGKGTLCNSCGDLFTEGKL 954



>gb:CR382137_1669611 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 559

 Score = 38.9 bits (89), Expect = 0.061
 Identities = 17/34 (50%), Positives = 20/34 (58%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           P  C++C    TP WR  P G K LCNACG+  K
Sbjct: 377 PISCTNCNTTATPLWRRDPKG-KPLCNACGLFLK 409



>gb:AB025609_1516344 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K14A3.
          Length = 461

 Score = 38.9 bits (89), Expect = 0.061
 Identities = 18/49 (36%), Positives = 24/49 (48%)
 Frame = -3

Query: 546 TPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHR 400
           TP WR GP     LCNACG R+++   L  Y P  +     +    +HR
Sbjct: 6   TPLWRNGPPEKPVLCNACGSRWRTKGSLVNYTPLHARAEGDETEIEDHR 54



>pir|A34755|A34755 nitrogen regulatory protein nit-2 - Neurospora
           crassa
          Length = 1036

 Score = 38.9 bits (89), Expect = 0.061
 Identities = 17/34 (50%), Positives = 21/34 (61%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           P  C++C  Q TP WR  P G + LCNACG+  K
Sbjct: 740 PTTCTNCFTQTTPLWRRNPDG-QPLCNACGLFLK 772



>sp|P19212|NIT2_NEUCR Nitrogen catabolic enzyme regulatory
           protein.>gb:NEUNIT2_1690858 N.crassa nitrogen catabolic
           enzyme regulatory protein (nit-2) gene, complete cds.
          Length = 1036

 Score = 38.9 bits (89), Expect = 0.061
 Identities = 17/34 (50%), Positives = 21/34 (61%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           P  C++C  Q TP WR  P G + LCNACG+  K
Sbjct: 740 PTTCTNCFTQTTPLWRRNPDG-QPLCNACGLFLK 772



>gb:AC096689_1736272 Oryza sativa chromosome 3 BAC OSJNBa0027J18
           genomic sequence, complete sequence.
          Length = 201

 Score = 38.5 bits (88), Expect = 0.080
 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 2/30 (6%)
 Frame = -3

Query: 570 CSHCGVQK--TPQWRAGPLGAKTLCNACGV 487
           C +CG+    TP  R GP G ++LCNACG+
Sbjct: 96  CQNCGISSRLTPAMRRGPAGPRSLCNACGL 125



>gb:CR382132_1665689 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 697

 Score = 38.5 bits (88), Expect = 0.080
 Identities = 16/32 (50%), Positives = 21/32 (65%)
 Frame = -3

Query: 573 RCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           +CS+C    TP WR  P G ++LCNACG+  K
Sbjct: 535 QCSNCNTTTTPLWRRSPEG-ESLCNACGLFLK 565



>gb:CR380957_1652842 Candida glabrata strain CBS138 chromosome K
           complete sequence.
          Length = 459

 Score = 38.5 bits (88), Expect = 0.080
 Identities = 16/31 (51%), Positives = 20/31 (64%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           C++CG   TP WR   +  K LCNACG+ FK
Sbjct: 258 CTNCGTTNTPLWRKD-IDRKPLCNACGLFFK 287



>gb:CR380949_1649507 Candida glabrata strain CBS138 chromosome C
           complete sequence.
          Length = 823

 Score = 38.5 bits (88), Expect = 0.080
 Identities = 16/28 (57%), Positives = 18/28 (64%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGV 487
           C +C   KTP WR  P G K LCNACG+
Sbjct: 338 CDNCKTYKTPLWRRSPEG-KVLCNACGL 364



>gb:AY135715_1581783 Phaeosphaeria nodorum AreA protein (areA) gene,
           complete cds.
          Length = 851

 Score = 38.5 bits (88), Expect = 0.080
 Identities = 17/34 (50%), Positives = 20/34 (58%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           P  C++C  Q TP WR  P G   LCNACG+  K
Sbjct: 628 PTTCTNCFTQTTPLWRRNPEG-HPLCNACGLFLK 660



>gb:AY745808_1349241 Aedes aegypti GATA transcription factor GATAc
           mRNA, complete cds.
          Length = 719

 Score = 38.5 bits (88), Expect = 0.080
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGV 487
           +PR C +CG   TP WR   +G  TLCNAC +
Sbjct: 472 EPRECVNCGSSDTPLWRRDNVG-HTLCNACAL 502



>pir|T41087|T41087 hypothetical protein SPCC16A11.14 - fission yeast
            (Schizosaccharomyces pombe)>gb:SPCC16A11_1721015
           S.pombe chromosome III cosmid c16A11.
          Length = 418

 Score = 38.5 bits (88), Expect = 0.080
 Identities = 22/47 (46%), Positives = 27/47 (57%), Gaps = 3/47 (6%)
 Frame = -3

Query: 582 QPR-RCSHCGVQKTPQW--RAGPLGAKTLCNACGVRFKSGRLLPEYR 451
           +PR RC  C V  T  +  R GP G K+LCNACGV +     LP +R
Sbjct: 367 RPRWRCRWCNVLGTGTFCVRRGPEGNKSLCNACGVAYAKTGQLPYWR 413



>sp|P91623|GATC_DROME GATA-binding factor-C (Transcription factor
           GATA-C) (dGATA-C) (Grain protein).>pir|A57601|A57601
           transcription factor dGATAc - fruit fly (Drosophila
           melanogaster)>gb:AE014297_1138422 Drosophila
           melanogaster chromosome 3R, complete
           sequence.>gb:AE003677_1220415 Drosophila melanogaster
           chromosome 3R, section 15 of 118 of the complete
           sequence.>gb:AY071369_1295453 Drosophila melanogaster
           RE40104 full length cDNA.>gb:DROGATA_1382055 Drosophila
           melanogaster mRNA for GATA transcription factor,
           complete cds.
          Length = 486

 Score = 38.5 bits (88), Expect = 0.080
 Identities = 21/52 (40%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRPACSPTFSS 424
           R C +CG   TP WR    G   LCNACG+ +K +G+  P  +P    T  S
Sbjct: 259 RECVNCGATSTPLWRRDGTG-HYLCNACGLYYKMNGQNRPLIKPKRRLTLQS 309



>gb:AE017341_1754024 Cryptococcus neoformans var. neoformans JEC21
            chromosome 1, complete sequence.
          Length = 1290

 Score = 38.1 bits (87), Expect = 0.10
 Identities = 16/34 (47%), Positives = 21/34 (61%)
 Frame = -3

Query: 579  PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
            P  C++C    TP WR  P G + LCNACG+ +K
Sbjct: 1183 PTMCTNCQTTNTPLWRRDPDG-QPLCNACGLFYK 1215



>gb:PCU96385_1699530 Penicillium chrysogenum GATA transcription
           factor (nreB) gene, complete cds.
          Length = 298

 Score = 38.1 bits (87), Expect = 0.10
 Identities = 16/31 (51%), Positives = 19/31 (61%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           C +CG   TP WR   LG+  LCNACG+  K
Sbjct: 17  CQNCGTSTTPLWRRDELGS-VLCNACGLFLK 46



>gb:CR380950_1649670 Candida glabrata strain CBS138 chromosome D
           complete sequence.
          Length = 712

 Score = 38.1 bits (87), Expect = 0.10
 Identities = 17/38 (44%), Positives = 22/38 (57%), Gaps = 2/38 (5%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKT--LCNACGVRFKSGR 469
           R+C  C    +P WR    G KT  LCN+CG+R+K  R
Sbjct: 623 RKCVSCNSSDSPCWRPSWSGKKTEQLCNSCGLRYKKTR 660



>sp|P23768|GA1B_XENLA GATA binding factor-1B (Transcription factor
           xGATA-1B).>pir|B41602|B41602 transcription factor
           GATA-1B - African clawed frog>gb:XELGATAB_2581864
           X.laevis GATA-binding protein (XGATA-1B ) gene, complete
           cds.
          Length = 364

 Score = 38.1 bits (87), Expect = 0.10
 Identities = 26/78 (33%), Positives = 37/78 (47%)
 Frame = -3

Query: 573 RCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRKV 394
           +CS+C    T  WR    G   +CNACG+ +K   L    RP    T   +     +RKV
Sbjct: 233 QCSNCHTSTTTLWRRNA-GGDPVCNACGLYYK---LHNVNRPL---TMKKEGIQTRNRKV 285

Query: 393 LEMRRKKESEDSPGFAPP 340
               +KK+  ++P F PP
Sbjct: 286 SSKSKKKKQLENP-FEPP 302



 Score = 37.7 bits (86), Expect = 0.14
 Identities = 20/46 (43%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           + R C +CG   TP WR   L    LCNACG+  K +G+  P  RP
Sbjct: 176 EDRECVNCGATVTPLWRR-DLSGHYLCNACGLYHKMNGQNRPLIRP 220



>gb:DRU18311_2571263 Danio rerio zg1 mRNA, complete cds.
          Length = 418

 Score = 37.7 bits (86), Expect = 0.14
 Identities = 20/46 (43%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           + R C +CG   TP WR    G   LCNACG+  K +G+  P  RP
Sbjct: 234 EARECVNCGATATPLWRQDGTG-HYLCNACGLYHKMNGQNRPLIRP 278



 Score = 32.0 bits (71), Expect = 7.5
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = -3

Query: 573 RCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           +C++C    T  WR    G + +CNACG+ FK
Sbjct: 291 QCANCHTSTTTLWRRNASG-EPVCNACGLYFK 321



>gb:BC076462_2559298 Danio rerio zgc:91840, mRNA (cDNA clone
           MGC:91840 IMAGE:7037467), complete cds.
          Length = 427

 Score = 37.7 bits (86), Expect = 0.14
 Identities = 20/44 (45%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  RP
Sbjct: 262 RECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIRP 304



>gb:AB112062_2465650 Oryzias latipes mRNA for hematopietic
           transcription factor GATA-1, complete cds.
          Length = 417

 Score = 37.7 bits (86), Expect = 0.14
 Identities = 20/46 (43%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           + R C +CG   TP WR    G   LCNACG+  K +G+  P  RP
Sbjct: 234 EARECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIRP 278



 Score = 31.6 bits (70), Expect = 9.8
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = -3

Query: 573 RCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           +C++C    T  WR    G + +CNACG+ FK
Sbjct: 291 QCANCHTSTTTLWRRNANG-EPVCNACGLYFK 321



>gb:BT019772_2151532 Synthetic construct Homo sapiens GATA binding
           protein 1 (globin transcription factor 1) mRNA, partial
           cds.
          Length = 414

 Score = 37.7 bits (86), Expect = 0.14
 Identities = 20/46 (43%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           + R C +CG   TP WR    G   LCNACG+  K +G+  P  RP
Sbjct: 200 EARECVNCGATATPLWRRDRTG-HYLCNACGLYHKMNGQNRPLIRP 244



>gb:BC052653_2101180 Mus musculus GATA binding protein 1, mRNA (cDNA
           clone MGC:60652 IMAGE:30039400), complete cds.
          Length = 413

 Score = 37.7 bits (86), Expect = 0.14
 Identities = 20/46 (43%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           + R C +CG   TP WR    G   LCNACG+  K +G+  P  RP
Sbjct: 200 EARECVNCGATATPLWRRDRTG-HYLCNACGLYHKMNGQNRPLIRP 244



>gb:BC009797_1972268 Homo sapiens GATA binding protein 1 (globin
           transcription factor 1), mRNA (cDNA clone MGC:13628
           IMAGE:4048082), complete cds.
          Length = 335

 Score = 37.7 bits (86), Expect = 0.14
 Identities = 20/46 (43%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           + R C +CG   TP WR    G   LCNACG+  K +G+  P  RP
Sbjct: 200 EARECVNCGATATPLWRRDRTG-HYLCNACGLYHKMNGQNRPLIRP 244



>gb:CR382131_1664139 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 348

 Score = 37.7 bits (86), Expect = 0.14
 Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWR-AGPLGAKTLCNACGVRFK 478
           RRC  CG  ++P WR +    A  LCN+CG+R+K
Sbjct: 262 RRCISCGSDQSPCWRPSWSASAGQLCNSCGLRYK 295



>sp|P43429|GAT1_RAT Erythroid transcription factor (GATA-1) (Eryf1)
           (GF-1) (NF-E1).>pir|S48756|S48756 transcription factor
           GATA-1 - rat>gb:RATGATA1_2132265 Rat mRNA for
           transcription factor GATA-1, complete cds.
          Length = 413

 Score = 37.7 bits (86), Expect = 0.14
 Identities = 20/46 (43%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           + R C +CG   TP WR    G   LCNACG+  K +G+  P  RP
Sbjct: 200 EARECVNCGATATPLWRRDRTG-HYLCNACGLYHKMNGQNRPLIRP 244



>sp|P17679|GAT1_MOUSE Erythroid transcription factor (GATA-1)
           (Eryf1) (GF-1) (NF-E1).>pir|S04655|S04655 transcription
           factor GATA-1 - mouse>gb:MMGF1_2115026 Mouse mRNA for
           DNA-binding protein GF-1.
          Length = 413

 Score = 37.7 bits (86), Expect = 0.14
 Identities = 20/46 (43%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           + R C +CG   TP WR    G   LCNACG+  K +G+  P  RP
Sbjct: 200 EARECVNCGATATPLWRRDRTG-HYLCNACGLYHKMNGQNRPLIRP 244



>sp|P15976|GAT1_HUMAN Erythroid transcription factor (GATA-1)
           (Eryf1) (GF-1) (NF-E1).>pir|A34888|A34888 transcription
           factor GATA-1 - human>gb:HSERYF1_2013068 Human mRNA for
           the transcription factor Eryf1.>gb:HUMGF1A_2031446 Human
           erythroid DNA-binding protein (GF-1) mRNA, complete cds.
          Length = 413

 Score = 37.7 bits (86), Expect = 0.14
 Identities = 20/46 (43%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           + R C +CG   TP WR    G   LCNACG+  K +G+  P  RP
Sbjct: 200 EARECVNCGATATPLWRRDRTG-HYLCNACGLYHKMNGQNRPLIRP 244



>gb:BC015577_1975186 Homo sapiens GATA binding protein 2, mRNA (cDNA
           clone MGC:23124 IMAGE:4127146), complete
           cds.>gb:BC018988_1976683 Homo sapiens GATA binding
           protein 2, mRNA (cDNA clone MGC:20306 IMAGE:4128414),
           complete cds.>gb:BC051272_1984543 Homo sapiens GATA
           binding protein 2, mRNA (cDNA clone MGC:59668
           IMAGE:4893358), complete cds.
          Length = 466

 Score = 37.4 bits (85), Expect = 0.18
 Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRPACSPTFSSQLHSNN 406
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P    T ++ L   N
Sbjct: 293 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKPKRRLTTTTTLWRRN 349



>gb:YSCGLN3_1728967 S.cerevisiae nitrogen regulatory protein (GLN3)
           gene, complete cds.
          Length = 730

 Score = 37.4 bits (85), Expect = 0.18
 Identities = 16/29 (55%), Positives = 19/29 (65%)
 Frame = -3

Query: 573 RCSHCGVQKTPQWRAGPLGAKTLCNACGV 487
           +C +C   KTP WR  P G  TLCNACG+
Sbjct: 305 QCFNCKTFKTPLWRRSPEG-NTLCNACGL 332



>gb:CR382126_1659472 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 692

 Score = 37.4 bits (85), Expect = 0.18
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = -3

Query: 573 RCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           +CS+C  + TP WR  P G   LCNACG+  K
Sbjct: 470 QCSNCHTKTTPLWRRDPQG-NPLCNACGLFLK 500



>gb:AY699608_1623564 Glomerella cingulata global nitrogen regulator
           protein (AreA) gene, partial cds.
          Length = 47

 Score = 37.4 bits (85), Expect = 0.18
 Identities = 16/31 (51%), Positives = 20/31 (64%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           C++C  Q TP WR  P G + LCNACG+  K
Sbjct: 1   CTNCFTQTTPLWRRNPEG-QPLCNACGLFLK 30



>gb:AB043467_1519976 Schizophyllum commune gene for transcription
            factor ScGATA-6, complete cds.
          Length = 1075

 Score = 37.4 bits (85), Expect = 0.18
 Identities = 16/34 (47%), Positives = 21/34 (61%)
 Frame = -3

Query: 579  PRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
            P  C++C    TP WR  P G + LCNACG+ +K
Sbjct: 954  PILCTNCQTTNTPLWRRDPEG-QPLCNACGLFYK 986



>pir|S51493|S51493 major nitrogen regulation protein - Penicillium
           chrysogenum  (strain Q176)
          Length = 862

 Score = 37.4 bits (85), Expect = 0.18
 Identities = 16/31 (51%), Positives = 20/31 (64%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           C++C  Q TP WR  P G + LCNACG+  K
Sbjct: 662 CTNCFTQTTPLWRRNPEG-QPLCNACGLFLK 691



>sp|P18494|GLN3_YEAST Nitrogen regulatory protein
           GLN3.>pir|S50543|S50543 GLN3 protein - yeast
           (Saccharomyces cerevisiae)>gb:SCE9379_1708088
           Saccharomyces cerevisiae chromosome V cosmids 9379,
           9581, and lambda clone 4678.
          Length = 730

 Score = 37.4 bits (85), Expect = 0.18
 Identities = 16/29 (55%), Positives = 19/29 (65%)
 Frame = -3

Query: 573 RCSHCGVQKTPQWRAGPLGAKTLCNACGV 487
           +C +C   KTP WR  P G  TLCNACG+
Sbjct: 305 QCFNCKTFKTPLWRRSPEG-NTLCNACGL 332



>sp|Q01582|AREA_PENCH Nitrogen regulatory protein areA (Nitrogen
           regulator nre).>gb:PCU02612_1699361 Penicillium
           chrysogenum major nitrogen regulation protein (areA)
           gene, complete cds.
          Length = 725

 Score = 37.4 bits (85), Expect = 0.18
 Identities = 16/31 (51%), Positives = 20/31 (64%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           C++C  Q TP WR  P G + LCNACG+  K
Sbjct: 525 CTNCFTQTTPLWRRNPEG-QPLCNACGLFLK 554



>gb:AB183298_2467103 Oryzias latipes gata-2 mRNA for transcription
           factor GATA-2, complete cds.
          Length = 455

 Score = 37.0 bits (84), Expect = 0.23
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 273 RECVNCGATSTPLWRRDSTG-HYLCNACGLYHKMNGQNRPLIKP 315



>gb:AE016819_1748904 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 308

 Score = 37.0 bits (84), Expect = 0.23
 Identities = 23/73 (31%), Positives = 32/73 (43%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRKVL 391
           C +C    TP WR    GA  LCNACG+  K        RP      +  + S N +   
Sbjct: 42  CQNCHTSTTPLWRRDEHGA-VLCNACGLFLKL-----HGRPRPISLKTDVIKSRNRKAGH 95

Query: 390 EMRRKKESEDSPG 352
           E +R++E  +  G
Sbjct: 96  EEKRRREGGEGSG 108



>gb:AC007858_1536265 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone BAC 10A19I, complete sequence.
          Length = 319

 Score = 37.0 bits (84), Expect = 0.23
 Identities = 21/73 (28%), Positives = 26/73 (35%), Gaps = 40/73 (54%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAK-------------------------------------- 511
           RRC++CG   TP WR GP G K                                      
Sbjct: 152 RRCANCGTASTPLWRNGPRGPKVRRRRRSLSPSLFSISAVHFAVSPTYVVSLTLPPSYVS 211

Query: 510 --TLCNACGVRFK 478
             +LCNACG+R+K
Sbjct: 212 LQSLCNACGIRYK 224



>pir|I50701|I50701 transcription factor GATA-4 - chicken (fragment)
          Length = 380

 Score = 37.0 bits (84), Expect = 0.23
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G   P ++P
Sbjct: 155 RECVNCGAMSTPLWRRDGTG-HYLCNACGLYHKMNGINRPLFKP 197



>sp|P43691|GAT4_CHICK Transcription factor GATA-4 (GATA binding
           factor-4) (Fragment).>gb:GGU11887_2573486 Gallus gallus
           GATA-4 transcription factor (GATA-4) mRNA, partial cds.
          Length = 380

 Score = 37.0 bits (84), Expect = 0.23
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G   P ++P
Sbjct: 155 RECVNCGAMSTPLWRRDGTG-HYLCNACGLYHKMNGINRPLFKP 197



>sp|P43574|GAT1_YEAST Transcriptional regulatory protein
           GAT1.>pir|S56233|S56233 probable membrane protein
           YFL021w - yeast (Saccharomyces
           cerevisiae)>gb:SCU27344_1710086 Saccharomyces cerevisiae
           GATA-type transcriptional factor (GAT1) gene, complete
           cds.>gb:YSCCHRVIN_1728488 Saccharomyces cerevisiae
           chromosome VI complete DNA sequence.
          Length = 510

 Score = 37.0 bits (84), Expect = 0.23
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = -3

Query: 573 RCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           +CS+C    TP WR  P G   LCNACG+  K
Sbjct: 309 KCSNCTTSTTPLWRKDPKGL-PLCNACGLFLK 339



>gb:BC075479_2558582 Xenopus tropicalis MGC89310 protein, mRNA (cDNA
           clone MGC:89310 IMAGE:6986505), complete cds.
          Length = 437

 Score = 36.6 bits (83), Expect = 0.30
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 255 RECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 297



>gb:BC053131_2550524 Danio rerio GATA-binding protein 2, mRNA (cDNA
           clone MGC:63885 IMAGE:6789690), complete cds.
          Length = 456

 Score = 36.6 bits (83), Expect = 0.30
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 269 RECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 311



>gb:AY079198_2510963 Raja eglanteria GATA-3 mRNA, complete cds.
          Length = 444

 Score = 36.6 bits (83), Expect = 0.30
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 257 RECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 299



>gb:AB111059_2465528 Eptatretus burgeri Gata 2/3 mRNA for
           transcription factor Gata-binding protein 2/3, complete
           cds.
          Length = 491

 Score = 36.6 bits (83), Expect = 0.30
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 299 RECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 341



>gb:BT007897_2150829 Synthetic construct Homo sapiens GATA binding
           protein 3 mRNA, partial cds.
          Length = 444

 Score = 36.6 bits (83), Expect = 0.30
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 261 RECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 303



>gb:AY024364_2073974 Rattus norvegicus GATA-3 mRNA, complete cds.
          Length = 444

 Score = 36.6 bits (83), Expect = 0.30
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 262 RECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 304



>gb:HSGATA3_2013386 H.sapiens GATA-3 mRNA.
          Length = 443

 Score = 36.6 bits (83), Expect = 0.30
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 261 RECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 303



>pir|A39794|A39794 transcription factor GATA-3 -
           human>gb:AL390294_1926586 Human DNA sequence from clone
           RP11-379F12 on chromosome 10 Contains the 3' end of the
           TAF3 gene for TAF3 RNA polymerase II, TATA box binding
           protein (TBP)-associated factor, 140kDa
           (TAF140,TAFII140), the GATA3 gene for GATA binding
           protein 3 (HDR,MGC5445), two novel genes and 3 CpG
           islands, complete sequence.>gb:BC006793_1970406 Homo
           sapiens GATA binding protein 3, transcript variant 1,
           mRNA (cDNA clone MGC:5199 IMAGE:2985843), complete
           cds.>gb:HSGATA3M_2013387 Human mRNA for GATA-3
           transcription factor.
          Length = 444

 Score = 36.6 bits (83), Expect = 0.30
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 262 RECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 304



>sp|P97489|GAT5_MOUSE Transcription factor GATA-5 (GATA binding
           factor-5).>gb:MMU84725_2123673 Mus musculus GATA-5
           cardiac transcription factor mRNA, complete cds.
          Length = 404

 Score = 36.6 bits (83), Expect = 0.30
 Identities = 29/76 (38%), Positives = 33/76 (43%), Gaps = 5/76 (6%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP---ACSPTFSSQLHSN 409
           R C +CG   TP WR    G   LCNACG+  K +G   P  RP     S   S    SN
Sbjct: 194 RECVNCGALSTPLWRRDGTG-HYLCNACGLYHKMNGVNRPLVRPQKRLSSSRRSGLCCSN 252

Query: 408 NHRKVLEM-RRKKESE 364
            H     + RR  E E
Sbjct: 253 CHTATTTLWRRNSEGE 268



>sp|P23773|GAT3_XENLA Transcription factor xGATA-3 (GATA binding
           factor-3).>pir|D41602|D41602 transcription factor GATA-3
           - African clawed frog>gb:XELGATAD_2581866 X.laevis
           GATA-binding protein (XGATA-3) gene, complete cds.
          Length = 435

 Score = 36.6 bits (83), Expect = 0.30
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 254 RECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 296



>sp|P23772|GAT3_MOUSE Trans-acting T-cell specific transcription
           factor GATA-3.>pir|B39794|B39794 transcription factor
           GATA-3 - mouse>gb:BC062915_2105065 Mus musculus GATA
           binding protein 3, mRNA (cDNA clone MGC:85992
           IMAGE:6826352), complete cds.>gb:MMGATA3M_2115010 Mouse
           mRNA for GATA-3 transcription factor.
          Length = 443

 Score = 36.6 bits (83), Expect = 0.30
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 261 RECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 303



>sp|P23771|GAT3_HUMAN Trans-acting T-cell specific transcription
           factor GATA-3.>gb:AL390294_1926587 Human DNA sequence
           from clone RP11-379F12 on chromosome 10 Contains the 3'
           end of the TAF3 gene for TAF3 RNA polymerase II, TATA
           box binding protein (TBP)-associated factor, 140kDa
           (TAF140,TAFII140), the GATA3 gene for GATA binding
           protein 3 (HDR,MGC5445), two novel genes and 3 CpG
           islands, complete sequence.>gb:AY497006_1954844 Homo
           sapiens GATA binding protein 3 (GATA3) gene, complete
           cds.>gb:BC003070_1968661 Homo sapiens GATA binding
           protein 3, mRNA (cDNA clone MGC:2346 IMAGE:3504200),
           complete cds.>gb:HSGATA3R_2013388 Human hGATA3 mRNA for
           trans-acting T-cell specific transcription factor.
          Length = 443

 Score = 36.6 bits (83), Expect = 0.30
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 261 RECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 303



>sp|P23825|GAT3_CHICK GATA binding factor-3 (Transcription factor
           NF-E1C) (GATA-3).>pir|B36389|B36389 transcription factor
           GATA-3 - chicken>gb:GDNFE1C_2572579 Gallus domesticus
           mRNA (NF-E1c cDNA) for NF-E1 DNA binding protein.
          Length = 444

 Score = 36.6 bits (83), Expect = 0.30
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 262 RECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 304



>sp|Q91428|GAT3_BRARE Transcription factor GATA-3 (GATA binding
           factor-3).>gb:BX901908_2568039 Zebrafish DNA sequence
           from clone DKEY-268B12 in linkage group 4 Contains the
           gata3 gene for GATA-binding protein 3 and two CpG
           islands, complete sequence.>gb:S80425_2579445
           gta3=transcription factor [zebrafishes, neurula-stage
           embryos, mRNA, 2576 nt].
          Length = 438

 Score = 36.6 bits (83), Expect = 0.30
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 254 RECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 296



>sp|P17678|GAT1_CHICK Erythroid transcription factor (GATA-1)
           (Eryf1) (NF-E1 DNA-binding protein)
           (NF-E1A).>pir|A32993|A32993 transcription factor GATA-1
           - chicken>gb:CHKRERYF1_2569512 Chicken
           erythroid-specific transcription factor eryf1 mRNA,
           complete cds.
          Length = 304

 Score = 36.6 bits (83), Expect = 0.30
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           + R C +CG   TP WR    G   LCNACG+  + +G+  P  RP
Sbjct: 106 EARECVNCGATATPLWRRDGTG-HYLCNACGLYHRLNGQNRPLIRP 150



 Score = 35.4 bits (80), Expect = 0.68
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           CS+C    T  WR  P+G   +CNACG+ +K
Sbjct: 164 CSNCQTSTTTLWRRSPMG-DPVCNACGLYYK 193



>gb:BT007859_2150791 Synthetic construct Homo sapiens hypothetical
           protein MGC2306 mRNA, partial cds.
          Length = 481

 Score = 36.2 bits (82), Expect = 0.40
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 293 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 335



>gb:BC085855_2109414 Rattus norvegicus cDNA clone MGC:94578
           IMAGE:7190097, complete cds.
          Length = 404

 Score = 36.2 bits (82), Expect = 0.40
 Identities = 29/76 (38%), Positives = 33/76 (43%), Gaps = 5/76 (6%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP---ACSPTFSSQLHSN 409
           R C +CG   TP WR    G   LCNACG+  K +G   P  RP     S   S    SN
Sbjct: 194 RECVNCGALSTPLWRRDGTG-HYLCNACGLYHKMNGVNRPLVRPQKRLSSSRRSGLCCSN 252

Query: 408 NHRKVLEM-RRKKESE 364
            H     + RR  E E
Sbjct: 253 CHTATTTLWRRNAEGE 268



>gb:AY032734_2074120 Rattus norvegicus GATA2 (Gata2) mRNA, complete
           cds.>gb:BC061745_2104607 Rattus norvegicus GATA binding
           protein 2, mRNA (cDNA clone MGC:72369 IMAGE:5599740),
           complete cds.
          Length = 480

 Score = 36.2 bits (82), Expect = 0.40
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 293 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 335



>gb:AF345897_2063788 Rattus norvegicus transcription factor GATA-2
           mRNA, complete cds.
          Length = 480

 Score = 36.2 bits (82), Expect = 0.40
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 293 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 335



>gb:BC015613_1975205 Homo sapiens GATA binding protein 2, mRNA (cDNA
           clone MGC:23183 IMAGE:4811349), complete
           cds.>gb:BC051342_1984589 Homo sapiens GATA binding
           protein 2, mRNA (cDNA clone MGC:59669 IMAGE:6341380),
           complete cds.
          Length = 480

 Score = 36.2 bits (82), Expect = 0.40
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 293 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 335



>gb:BC002557_1968209 Homo sapiens GATA binding protein 2, mRNA (cDNA
           clone MGC:2306 IMAGE:3139044), complete
           cds.>gb:BT006671_1990109 Homo sapiens hypothetical
           protein MGC2306 mRNA, complete cds.
          Length = 480

 Score = 36.2 bits (82), Expect = 0.40
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 293 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 335



>gb:CR382138_1671147 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 475

 Score = 36.2 bits (82), Expect = 0.40
 Identities = 23/69 (33%), Positives = 34/69 (49%)
 Frame = -3

Query: 573 RCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFSSQLHSNNHRKV 394
           +C++C  + TP WR    G   LCNACG+ +K   +L   RP   P   S + ++     
Sbjct: 226 QCTNCNTKTTPLWRKSNKG-DLLCNACGLFYKLHGVL---RPLSQPDRKSSVLND----T 277

Query: 393 LEMRRKKES 367
           L +  K ES
Sbjct: 278 LTLTNKTES 286



>gb:AY251012_1428021 Sus scrofa transcription factor GATA-2 mRNA,
           complete cds.
          Length = 480

 Score = 36.2 bits (82), Expect = 0.40
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 293 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 335



>gb:AK004675_1152500 Mus musculus adult male lung cDNA, RIKEN
           full-length enriched library, clone:1200009I20
           product:GATA binding protein 2, full insert sequence.
          Length = 480

 Score = 36.2 bits (82), Expect = 0.40
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 293 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 335



>gb:AK004551_1152408 Mus musculus adult male lung cDNA, RIKEN
           full-length enriched library, clone:1200002M12
           product:GATA binding protein 2, full insert sequence.
          Length = 480

 Score = 36.2 bits (82), Expect = 0.40
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 293 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 335



>pir|A40815|A40815 transcription factor GATA-2 (version 1) -
           human>gb:HUMGATA_2031396 Human GATA-binding protein
           (GATA2) mRNA, complete cds.
          Length = 480

 Score = 36.2 bits (82), Expect = 0.40
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 293 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 335



>pir|B48099|B48099 transcription factor GATA-2, retinoic
           acid-inducible - mouse (fragment)
          Length = 118

 Score = 36.2 bits (82), Expect = 0.40
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 3   RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 45



>sp|P43692|GAT5_CHICK Transcription factor GATA-5 (GATA binding
           factor-5).>pir|I50702|I50702 transcription factor GATA-5
           - chicken>gb:GGU11888_2573487 Gallus gallus GATA-5
           transcription factor (GATA-5) mRNA, complete cds.
          Length = 391

 Score = 36.2 bits (82), Expect = 0.40
 Identities = 17/43 (39%), Positives = 21/43 (48%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K   +    +P
Sbjct: 184 RECVNCGAMSTPLWRKDGTG-HYLCNACGLYHKMNGINRPLKP 225



>sp|P23770|GAT2_XENLA Transcription factor xGATA-2 (GATA binding
           factor-2).>pir|C41602|C41602 transcription factor GATA-2
           - African clawed frog>gb:XELGATAC_2581865 X.laevis
           GATA-binding protein (XGATA-2) gene, complete cds.
          Length = 452

 Score = 36.2 bits (82), Expect = 0.40
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 265 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 307



>sp|O09100|GAT2_MOUSE Endothelial transcription factor
           GATA-2.>gb:AB000096_2042979 Mus musculus mRNA for GATA-2
           protein, complete cds.
          Length = 480

 Score = 36.2 bits (82), Expect = 0.40
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 293 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 335



>sp|P23769|GAT2_HUMAN Endothelial transcription factor GATA-2.
          Length = 480

 Score = 36.2 bits (82), Expect = 0.40
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 293 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 335



>sp|P23824|GAT2_CHICK GATA binding factor-2 (Transcription factor
           NF-E1B) (GATA-2).>pir|A36389|A36389 transcription factor
           NF-E1b - chicken>gb:GDNFE1B_2572578 Gallus domesticus
           mRNA (NF-E1b cDNA) for NF-E1 DNA binding protein.
          Length = 466

 Score = 36.2 bits (82), Expect = 0.40
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 279 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 321



>sp|P43695|GA5A_XENLA Transcription factor xGATA-5A (GATA binding
           factor-5A).>pir|I51419|I51419 transcription factor
           xGATA-4a - African clawed frog>gb:BC084985_2564218
           Xenopus laevis transcription factor xGATA-5a, mRNA (cDNA
           clone MGC:86553 IMAGE:3400525), complete
           cds.>gb:L13701_2574603 Xenopus laevis transcription
           factor xGATA-5a (GATA-5a) mRNA, complete cds.
          Length = 390

 Score = 36.2 bits (82), Expect = 0.40
 Identities = 19/44 (43%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G   P  +P
Sbjct: 181 RECVNCGAMSTPLWRRDGTG-HYLCNACGLYHKMNGMNRPLIKP 223



>gb:BC088567_2565697 Xenopus tropicalis hypothetical LOC496852, mRNA
           (cDNA clone MGC:97755 IMAGE:6988214), complete cds.
          Length = 389

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 16/33 (48%), Positives = 18/33 (54%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           R C +CG   TP WR    G   LCNACG+  K
Sbjct: 182 RECVNCGAMSTPLWRRDGTG-HYLCNACGLYHK 213



>gb:BC071122_2555984 Xenopus laevis MGC81427 protein, mRNA (cDNA
           clone MGC:81427 IMAGE:6635517), complete cds.
          Length = 394

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 16/33 (48%), Positives = 18/33 (54%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           R C +CG   TP WR    G   LCNACG+  K
Sbjct: 184 RECVNCGAMSTPLWRRDGTG-HYLCNACGLYHK 215



>gb:BC071107_2555969 Xenopus laevis transcription factor xGATA-4,
           mRNA (cDNA clone MGC:81270 IMAGE:6631611), complete cds.
          Length = 392

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 16/33 (48%), Positives = 18/33 (54%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           R C +CG   TP WR    G   LCNACG+  K
Sbjct: 182 RECVNCGAMSTPLWRRDGTG-HYLCNACGLYHK 213



>gb:BC067710_2554877 Danio rerio GATA-binding protein 6, mRNA (cDNA
           clone MGC:85943 IMAGE:6963479), complete cds.
          Length = 390

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 20/49 (40%), Positives = 23/49 (46%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSP 436
           + R C +CG   TP WR    G   LCNACG+  K   L    RP   P
Sbjct: 182 ESRECVNCGSMSTPLWRRDGTG-HFLCNACGLYSKMNGL---SRPLIKP 226



>gb:BC055963_2551547 Xenopus laevis transcription factor xGATA-5b,
           mRNA (cDNA clone MGC:68439 IMAGE:5571176), complete cds.
          Length = 388

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 16/33 (48%), Positives = 18/33 (54%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           R C +CG   TP WR    G   LCNACG+  K
Sbjct: 182 RECVNCGAMSTPLWRRDGTG-HYLCNACGLYHK 213



>gb:AY395731_2531758 Danio rerio Gata6 protein mRNA, complete cds.
          Length = 501

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 20/49 (40%), Positives = 23/49 (46%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSP 436
           + R C +CG   TP WR    G   LCNACG+  K   L    RP   P
Sbjct: 293 ESRECVNCGSMSTPLWRRDGTG-HFLCNACGLYSKMNGL---SRPLIKP 337



>gb:AF191578_2479243 Danio rerio zinc finger transcription factor
           Gata6 (gata6) mRNA, complete cds.
          Length = 383

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 20/49 (40%), Positives = 23/49 (46%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGRLLPEYRPACSP 436
           + R C +CG   TP WR    G   LCNACG+  K   L    RP   P
Sbjct: 180 ESRECVNCGSMSTPLWRRDGTG-HFLCNACGLYSKMNGL---SRPLIKP 224



>gb:AF191577_2479242 Danio rerio zinc finger transcription factor
           Gata4 (gata4) mRNA, complete cds.
          Length = 338

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 16/33 (48%), Positives = 18/33 (54%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           R C +CG   TP WR    G   LCNACG+  K
Sbjct: 165 RECVNCGAMSTPLWRRDGTG-HYLCNACGLYHK 196



>gb:AF179424_2058024 Mus musculus transcription factor GATA-4
           (Gata4) mRNA, complete cds.
          Length = 441

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 16/33 (48%), Positives = 18/33 (54%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           R C +CG   TP WR    G   LCNACG+  K
Sbjct: 214 RECVNCGAMSTPLWRRDGTG-HYLCNACGLYHK 245



>gb:AB075549_2047574 Mus musculus mRNA for transcription factor
           GATA-4, complete cds.
          Length = 442

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 16/33 (48%), Positives = 18/33 (54%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           R C +CG   TP WR    G   LCNACG+  K
Sbjct: 215 RECVNCGAMSTPLWRRDGTG-HYLCNACGLYHK 246



>gb:BC047790_1984023 Homo sapiens GATA binding protein 5, mRNA (cDNA
           clone IMAGE:6464800), partial cds.
          Length = 417

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 20/44 (45%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G   P  RP
Sbjct: 207 RECVNCGALSTPLWRRDGTG-HYLCNACGLYHKMNGVNRPLVRP 249



>gb:AY740706_1961599 Homo sapiens GATA binding protein 4 (GATA4)
           mRNA, complete cds.
          Length = 442

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 16/33 (48%), Positives = 18/33 (54%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           R C +CG   TP WR    G   LCNACG+  K
Sbjct: 215 RECVNCGAMSTPLWRRDGTG-HYLCNACGLYHK 246



>gb:AF237674_1779678 Candida albicans zinc-finger transcription
           factor (ASH1) gene, complete cds.
          Length = 449

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWR-AGPLGAKTLCNACGVRFK 478
           PR C  CG  ++P WR +  +    LCN+CG+R+K
Sbjct: 362 PRVCISCGSDQSPCWRPSWSIKQGQLCNSCGLRYK 396



>gb:YSPGAF1H_1731106 Schizosaccharomyces pombe gene homologous to
           GATA-binding transcription factor family (gaf-1) gene,
           complete cds.
          Length = 290

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 15/31 (48%), Positives = 20/31 (64%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           C++C  + TP WR  P G + LCNACG+  K
Sbjct: 70  CTNCQTRTTPLWRRSPDG-QPLCNACGLFMK 99



>gb:SPCC1902_1721142 S.pombe chromosome III cosmid c1902.
          Length = 727

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 15/31 (48%), Positives = 20/31 (64%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           C++C  + TP WR  P G + LCNACG+  K
Sbjct: 507 CTNCQTRTTPLWRRSPDG-QPLCNACGLFMK 536



>gb:CR382138_1670808 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 519

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWR-AGPLGAKTLCNACGVRFK 478
           PR C  CG  ++P WR +  +    LCN+CG+R+K
Sbjct: 434 PRVCISCGSDQSPCWRPSWSIKEGQLCNSCGLRYK 468



>gb:CAL320271_1644969 Candida albicans ASH1 gene.
          Length = 452

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
 Frame = -3

Query: 579 PRRCSHCGVQKTPQWR-AGPLGAKTLCNACGVRFK 478
           PR C  CG  ++P WR +  +    LCN+CG+R+K
Sbjct: 365 PRVCISCGSDQSPCWRPSWSIKQGQLCNSCGLRYK 399



>gb:OCU291310_1442555 Oryctolagus cuniculus partial mRNA for GATA-4
           zinc-finger transcription factor (gata-4 gene).
          Length = 116

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 16/33 (48%), Positives = 18/33 (54%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           R C +CG   TP WR    G   LCNACG+  K
Sbjct: 5   RECVNCGAMSTPLWRRDGTG-HYLCNACGLYHK 36



>gb:BTA316283_1436617 Bos taurus partial mRNA for gata4 protein.
          Length = 266

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 16/33 (48%), Positives = 18/33 (54%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           R C +CG   TP WR    G   LCNACG+  K
Sbjct: 39  RECVNCGAMSTPLWRRDGTG-HYLCNACGLYHK 70



>gb:AY115491_1425093 Sus scrofa transcription factor GATA-4 mRNA,
           complete cds.
          Length = 442

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 16/33 (48%), Positives = 18/33 (54%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           R C +CG   TP WR    G   LCNACG+  K
Sbjct: 215 RECVNCGAMSTPLWRRDGTG-HYLCNACGLYHK 246



>gb:AF295687_1417756 Sus scrofa transcription factor GATA-6 (GATA-6)
           mRNA, complete cds.
          Length = 446

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 26/78 (33%), Positives = 34/78 (43%), Gaps = 5/78 (6%)
 Frame = -3

Query: 582 QPRRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK----SGRLLPEYRPACSPTFSSQLH 415
           + R C +CG  +TP WR    G   LCN CG+  K    SG L+   +P  S        
Sbjct: 237 ESRECVNCGSIQTPLWRRDGTG-HYLCNRCGLYSKMNGLSGPLIKPQKPVPSSRRLGLSC 295

Query: 414 SNNHRKVLEM-RRKKESE 364
           +N H     + RR  E E
Sbjct: 296 ANCHTTTTTLWRRNAEGE 313



>gb:AY496948_1330965 Nematostella vectensis GATA factor (GATA 1/2/3)
           mRNA, partial cds.
          Length = 208

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 19/44 (43%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G   P  +P
Sbjct: 1   RECVNCGATSTPLWRRDGSG-HYLCNACGLYHKMNGSSRPLIKP 43



>gb:AY465174_1329752 Nematostella vectensis GATA transcription
           factor (Gata) mRNA, complete cds.
          Length = 422

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 19/44 (43%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G   P  +P
Sbjct: 215 RECVNCGATSTPLWRRDGSG-HYLCNACGLYHKMNGSSRPLIKP 257



>gb:AF184154_1248537 Ceratitis capitata zinc finger DNA binding
           protein pannier (pnr) mRNA, complete cds.
          Length = 324

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 1/54 (1%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRPACSPTFSSQL 418
           R C +CG   TP WR    G   LCNACG+  K +G   P  +P+   T + +L
Sbjct: 109 RECVNCGAISTPLWRRDGTG-HYLCNACGLYHKMNGMNRPLIKPSKRLTATRRL 161



 Score = 34.3 bits (77), Expect = 1.5
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           C++CG + T  WR    G + +CNACG+ FK
Sbjct: 165 CTNCGTRTTTLWRRNNEG-EPVCNACGLYFK 194



>gb:AF077674_1239295 Strongylocentrotus purpuratus cell-type
           coelomocyte GATA transcription factor (GATA) mRNA,
           complete cds.
          Length = 431

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK-SGRLLPEYRP 448
           R C +CG   TP WR    G   LCNACG+  K +G+  P  +P
Sbjct: 219 RECVNCGATSTPLWRRDGNG-HYLCNACGLYHKMNGQNRPLIKP 261



 Score = 32.0 bits (71), Expect = 7.5
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = -3

Query: 570 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           C++C    T  WR  P G   +CNACG+ +K
Sbjct: 274 CANCQATATTLWRRNPNG-DPVCNACGLYYK 303



>pir|I57561|I57561 transcription factor GATA-4 -
           human>gb:HUMGATABP_2031400 Homo sapiens mRNA for GATA-4
           transcription factor, complete cds.
          Length = 439

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 16/33 (48%), Positives = 18/33 (54%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           R C +CG   TP WR    G   LCNACG+  K
Sbjct: 212 RECVNCGAMSTPLWRRDGTG-HYLCNACGLYHK 243



>pir|A48099|A48099 transcription factor GATA-4, retinoic
           acid-inducible - mouse>gb:MUSGATABTF_2125947 Mouse
           GATA-binding transcription factor (GATA-4) mRNA,
           complete cds.
          Length = 439

 Score = 35.8 bits (81), Expect = 0.52
 Identities = 16/33 (48%), Positives = 18/33 (54%)
 Frame = -3

Query: 576 RRCSHCGVQKTPQWRAGPLGAKTLCNACGVRFK 478
           R C +CG   TP WR    G   LCNACG+  K
Sbjct: 213 RECVNCGAMSTPLWRRDGTG-HYLCNACGLYHK 244


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 512,132,141
Number of Sequences: 1806583
Number of extensions: 8954533
Number of successful extensions: 26175
Number of sequences better than 10.0: 350
Number of HSP's better than 10.0 without gapping: 24922
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25979
length of database: 581,917,975
effective HSP length: 118
effective length of database: 368,741,181
effective search space used: 28024329756
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)