BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10565
         (799 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AF538716_1280198 Brugia malayi mitochondrion, complete genome.      35   2.1     
gb:DIM537512_1377721 Dirofilaria immitis complete mitochondrial ...    33   8.1     


>gb:AF538716_1280198 Brugia malayi mitochondrion, complete genome.
          Length = 193

 Score = 34.7 bits (78), Expect = 2.1
 Identities = 27/85 (31%), Positives = 39/85 (45%), Gaps = 11/85 (12%)
 Frame = -3

Query: 338 SWKWDRLVGEVMLTSHKY*IMMSGYSY-IGFGRLFI---FNMMTDFVLGF-------LFI 192
           SW+W  +   VM  SH    +MSG +  +    +F+   F M T   LGF       LFI
Sbjct: 109 SWEW--VSSLVMFFSHWLSFLMSGVALTLRISIIFLIGHFLMFTILDLGFFFSFFSLLFI 166

Query: 191 LPYECYFICRGFYLHFEKVCFYLCN 117
           +P E +F     Y+    +C +L N
Sbjct: 167 MPVELFFAFLQSYIFLTLICMFLLN 191



>gb:DIM537512_1377721 Dirofilaria immitis complete mitochondrial
           genome.
          Length = 191

 Score = 32.7 bits (73), Expect = 8.1
 Identities = 24/82 (29%), Positives = 35/82 (42%), Gaps = 11/82 (13%)
 Frame = -3

Query: 329 WDRLVGEVMLTSHKY*IMMSGYSY-IGFGRLFI---FNMMTDFVLGF-------LFILPY 183
           WD +   VM  SH     MSG +  +    +F+   F M T    GF       L ++P 
Sbjct: 108 WDWVSSLVMFFSHFLSFFMSGVALTLRISIIFLIGHFLMFTFLDFGFFCSFFSLLLLVPV 167

Query: 182 ECYFICRGFYLHFEKVCFYLCN 117
           E +F     Y+    +C +LCN
Sbjct: 168 ELFFAFLQSYIFLTLICMFLCN 189


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 765,905,438
Number of Sequences: 1806583
Number of extensions: 16397935
Number of successful extensions: 32015
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 31271
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32003
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 51696623407
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)