BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10525
         (1449 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:BT004563_1637597 Arabidopsis thaliana At2g18100 gene, complet...   245   e-105   
pir|C84560|C84560 hypothetical protein At2g18100 [imported] - Ar...   249   e-103   Arabidopsis thaliana [mouse-ear cress]
pir|T04590|T04590 hypothetical protein F23E13.100 - Arabidopsis ...   164   4e-81   Arabidopsis thaliana [mouse-ear cress]
gb:HS1056L3_1996645 Human DNA sequence from clone RP5-1056L3 on ...   134   3e-38   
gb:BC053600_1984996 Homo sapiens hypothetical protein LOC255104,...   134   3e-38   
gb:HSM807148_1187820 Homo sapiens mRNA; cDNA DKFZp686C23231 (fro...   134   3e-38   
gb:HS1056L3_1996644 Human DNA sequence from clone RP5-1056L3 on ...   134   3e-38   
gb:AX775875_1475229 Sequence 145 from Patent WO03048202.              134   3e-38   
gb:BC013471_2091758 Mus musculus RIKEN cDNA 4632413C14 gene, mRN...   132   4e-37   
gb:AK014571_1158035 Mus musculus 0 day neonate skin cDNA, RIKEN ...   132   4e-37   
gb:AX775877_1475230 Sequence 147 from Patent WO03048202.              134   7e-35   
pir|T18244|T18244 conserved hypothetical protein - yeast (Candid...   133   5e-33   Candida albicans
gb:AE016816_1746910 Ashbya gossypii (= Eremothecium gossypii) AT...   122   8e-33   
gb:CR382124_1656553 Kluyveromyces lactis strain NRRL Y-1140 chro...   126   4e-31   
gb:U29381_1402778 Caenorhabditis elegans cosmid F35D11, complete...   114   3e-30   
gb:CR382131_1664553 Yarrowia lipolytica chromosome E of strain C...   118   1e-29   
gb:CR380957_1653052 Candida glabrata strain CBS138 chromosome K ...   119   6e-29   
sp|P43564|YFD4_YEAST|YFD4_YEAST Hypothetical 119.5 kDa protein in MOB2-RIM1...   113   1e-28   Saccharomyces cerevisiae [brewer's yeast]
pir|T16263|T16263 hypothetical protein F35D11.3 - Caenorhabditis...   108   2e-28   Caenorhabditis elegans [roundworm]
gb:NCB1D1_1689544 Neurospora crassa DNA linkage group II BAC clo...   129   2e-28   
pir|T49359|T49359 hypothetical protein B1D1.130 [imported] - Neu...   129   2e-28   Neurospora crassa
gb:AE017343_1755366 Cryptococcus neoformans var. neoformans JEC2...   127   6e-28   
pir|T39047|T39047 hypothetical protein SPAC6F6.13c - fission yea...   125   3e-27   Schizosaccharomyces pombe
pir|T50228|T50228 conserved hypothetical protein SPAC607.08c [im...   123   1e-26   Schizosaccharomyces pombe
gb:AF286010_1783183 Neurospora crassa YFL034W gene, partial cds.      121   4e-26   
gb:AE014188_967869 Plasmodium falciparum 3D7 chromosome 12, comp...   107   6e-22   
gb:AC115612_1205930 Dictyostelium discoideum chromosome 2 map 62...   101   3e-20   
gb:AE017341_1754571 Cryptococcus neoformans var. neoformans JEC2...    99   2e-19   
gb:HS301K231_1997972 Novel human gene mapping to chomosome 1.          59   5e-16   
gb:AK054337_1170785 Mus musculus 2 days pregnant adult female ov...    59   2e-15   
gb:AK127543_1916795 Homo sapiens cDNA FLJ45636 fis, clone COLON2...    82   4e-14   
gb:AX118907_1461511 Sequence 71 from Patent WO0129221.                 82   4e-14   
gb:HS301K23A_1997973 Novel human gene mapping to chomosome 1.          59   1e-12   
gb:AY123055_1579923 Griffithsia japonica heat shock cognate 70 k...    65   5e-09   
gb:AY596296_631458 Haloarcula marismortui ATCC 43049 plasmid pNG...    51   5e-05   
gb:AE016858_350200 Pseudomonas syringae pv. tomato str. DC3000 s...    49   3e-04   
gb:BX294137_766284 Pirellula sp. strain 1 complete genome; segme...    40   0.093   
gb:BX294136_766153 Pirellula sp. strain 1 complete genome; segme...    38   0.60    
gb:BA000016_674587 Clostridium perfringens str. 13 DNA, complete...    37   1.3     
gb:AY765220_1350369 Tetrahymena pyriformis GL metallothionein mR...    35   3.9     
gb:AE016827_343422 Mannheimia succiniciproducens MBEL55E, comple...    35   3.9     


>gb:BT004563_1637597 Arabidopsis thaliana At2g18100 gene, complete
           cds.
          Length = 656

 Score =  245 bits (625), Expect(2) = e-105
 Identities = 117/161 (72%), Positives = 141/161 (87%)
 Frame = -3

Query: 835 FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA 656
           F +S W+IA+DRSDKAG LLAE L+KGLQG+RPVTLVGFSLGARV+FKCLQ LA +  NA
Sbjct: 492 FTNSRWSIAIDRSDKAGKLLAEALRKGLQGNRPVTLVGFSLGARVVFKCLQTLAETEKNA 551

Query: 655 GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP 476
            +VERVVLLGAPI I++ NW  VRK+VAGRFINVY+TNDW LG+ FRASLLSQGLAGIQP
Sbjct: 552 EIVERVVLLGAPISIKNENWRDVRKMVAGRFINVYATNDWTLGVAFRASLLSQGLAGIQP 611

Query: 475 VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF 353
           V +PG+E+VDVT++++GHS+YLW +Q+ILE L+LD  YPVF
Sbjct: 612 VCIPGIEDVDVTDMVEGHSSYLWKTQQILERLELDNSYPVF 652



 Score =  161 bits (407), Expect(2) = e-105
 Identities = 80/191 (41%), Positives = 105/191 (54%)
 Frame = -1

Query: 1443 SSKSRWAKWRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLGTLVPVIXXXXX 1264
            S  S WAKW+R                                   TLGT+VPVI     
Sbjct: 290  SPNSEWAKWKRGGIVGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTIVPVIGASGF 349

Query: 1263 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI 1084
                                         +K+ARR GD++EFEFK IG+NHN+GRLAVEI
Sbjct: 350  AAAAEAAGTVAGSVAVAASFGAAGAGLTGTKMARRTGDIEEFEFKAIGENHNQGRLAVEI 409

Query: 1083 LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM 904
            L+ GFV +E DF +PWEG  +NLERY +QWES++++AVS AI++WLTS +A+ELM++GAM
Sbjct: 410  LVAGFVLKEEDFVKPWEGLTSNLERYTVQWESENIIAVSTAIQDWLTSRVAMELMRQGAM 469

Query: 903  MTVLSSFLTAL 871
             TVL+S L A+
Sbjct: 470  RTVLNSLLAAM 480



>pir|C84560|C84560 hypothetical protein At2g18100 [imported] -
           Arabidopsis thaliana>gb:AC006201_1533584 Arabidopsis
           thaliana chromosome 2 clone T27K22 map c245, complete
           sequence.
          Length = 655

 Score =  249 bits (635), Expect(2) = e-103
 Identities = 119/161 (73%), Positives = 142/161 (88%)
 Frame = -3

Query: 835 FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA 656
           FIDS W+IA+DRSDKAG LLAE L+KGLQG+RPVTLVGFSLGARV+FKCLQ LA +  NA
Sbjct: 491 FIDSRWSIAIDRSDKAGKLLAEALRKGLQGNRPVTLVGFSLGARVVFKCLQTLAETEKNA 550

Query: 655 GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP 476
            +VERVVLLGAPI I++ NW  VRK+VAGRFINVY+TNDW LG+ FRASLLSQGLAGIQP
Sbjct: 551 EIVERVVLLGAPISIKNENWRDVRKMVAGRFINVYATNDWTLGVAFRASLLSQGLAGIQP 610

Query: 475 VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF 353
           V +PG+E+VDVT++++GHS+YLW +Q+ILE L+LD  YPVF
Sbjct: 611 VCIPGIEDVDVTDMVEGHSSYLWKTQQILERLELDNSYPVF 651



 Score =  152 bits (383), Expect(2) = e-103
 Identities = 77/191 (40%), Positives = 103/191 (53%)
 Frame = -1

Query: 1443 SSKSRWAKWRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLGTLVPVIXXXXX 1264
            S  S WAKW+R                                   TLGT+VPVI     
Sbjct: 290  SPNSEWAKWKRGGIVGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTIVPVIGASGF 349

Query: 1263 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI 1084
                                         +K+ARR GD++EFEFK IG+NHN+G + VEI
Sbjct: 350  AAAAEAAGTVAGSVAVAASFGAAGAGLTGTKMARRTGDIEEFEFKAIGENHNQG-VTVEI 408

Query: 1083 LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM 904
            L+ GFV +E DF +PWEG  +NLERY +QWES++++AVS AI++WLTS +A+ELM++GAM
Sbjct: 409  LVAGFVLKEEDFVKPWEGLTSNLERYTVQWESENIIAVSTAIQDWLTSRVAMELMRQGAM 468

Query: 903  MTVLSSFLTAL 871
             TVL+S L A+
Sbjct: 469  RTVLNSLLAAM 479



>pir|T04590|T04590 hypothetical protein F23E13.100 - Arabidopsis
            thaliana>gb:ATCHRIV85_1547581 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 85.>gb:ATF23E13_1549749
            Arabidopsis thaliana DNA chromosome 4, BAC clone F23E13
            (ESSAII project).
          Length = 516

 Score =  164 bits (415), Expect(2) = 4e-81
 Identities = 83/187 (44%), Positives = 104/187 (55%)
 Frame = -1

Query: 1428 WAKWRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLGTLVPVIXXXXXXXXXX 1249
            WAKW+R                                   TLGT++PVI          
Sbjct: 189  WAKWKRGGIIGAAAITGGTLMAITGGLAAPAIAAGFGALAPTLGTIIPVIGAGGFAAAAS 248

Query: 1248 XXXXXXXXXXXXXXXXXXXXXXXXSKVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGF 1069
                                    +K+ARR+GD+DEFEFK IG+NHN+GRLAVE+L+ G 
Sbjct: 249  AAGTVAGSVAVAASFGAAGAGLTGTKMARRIGDLDEFEFKAIGENHNQGRLAVEVLVAGV 308

Query: 1068 VFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLS 889
            VFEE DF +PWEG  +NLERY LQWESK+L+ VS AI++WLTS +A+ELMK+GAM TVL+
Sbjct: 309  VFEEEDFVKPWEGLTSNLERYTLQWESKNLILVSTAIQDWLTSRLAMELMKQGAMHTVLA 368

Query: 888  SFLTALA 868
            S L ALA
Sbjct: 369  SLLMALA 375



 Score =  161 bits (408), Expect(2) = 4e-81
 Identities = 88/163 (53%), Positives = 110/163 (67%), Gaps = 2/163 (1%)
 Frame = -3

Query: 835 FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA 656
           FIDS+W+IA+DRSDKAG LLAEVLQKGLQG+R           R    C           
Sbjct: 386 FIDSKWSIAIDRSDKAGRLLAEVLQKGLQGNR----------YRFHDCC----------- 424

Query: 655 GLVERVVLLGAPIRIRDVNWEAVRK--VVAGRFINVYSTNDWMLGIVFRASLLSQGLAGI 482
                           +VN  ++ K  +VAGRFINVY+TNDW LGI FRASL+SQGLAGI
Sbjct: 425 ---------------NEVNIISIFKSYMVAGRFINVYATNDWTLGIAFRASLISQGLAGI 469

Query: 481 QPVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF 353
           QP+ +PG+ENVDVT++++GHS+YLW +Q+ILE L++DTYYPVF
Sbjct: 470 QPICIPGIENVDVTDMVEGHSSYLWKTQQILERLEIDTYYPVF 512



>gb:HS1056L3_1996645 Human DNA sequence from clone RP5-1056L3 on
           chromosome 1p35.1-36.13 Contains a novel gene, the gene
           for a novel protein (LOC374960), a ribosomal protein S14
           (RPS14) pseudogene, the NBL1 gene for neuroblastoma
           suppression of tumorigenicity 1, the HTR6 gene for
           5-hydroxytryptamine (serotonin) receptor 6, the 3' end
           of the gene for a novel protein (LOC255104) (FLJ45636)
           and two CpG islands, complete
           sequence.>gb:HS301K23_1997971 Human DNA sequence from
           clone RP1-301K23 on chromosome 1p35.1-36.21 Contains
           part of the gene for a novel protein (LOC255104)
           (FLJ45636), complete sequence.
          Length = 634

 Score =  134 bits (336), Expect(2) = 3e-38
 Identities = 71/157 (45%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -3

Query: 832 IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG 653
           ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   +  G
Sbjct: 366 IDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFSLGARVIYFCLQEMAQEKDCQG 425

Query: 652 LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV 473
           ++E V+LLGAP+     +WE  RKVV+GR IN Y   DW+L  V+R S +   +AG+QPV
Sbjct: 426 IIEDVILLGAPVEGEAKHWEPFRKVVSGRIINGYCRGDWLLSFVYRTSSVQLRVAGLQPV 485

Query: 472 DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT 368
            +    VENVD+T ++ GH  Y      IL+ + + T
Sbjct: 486 LLQDRRVENVDLTSVVSGHLDYAKQMDAILKAVGIRT 522



 Score = 48.9 bits (115), Expect(2) = 3e-38
 Identities = 30/103 (29%), Positives = 54/103 (52%), Gaps = 2/103 (1%)
 Frame = -1

Query: 1173 KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEES--DFFRPWEGEYNNLERYAL 1000
            K+ +R+G ++EF F  + +     +L + I +TG++       F  PW    ++ E+Y L
Sbjct: 255  KMKKRVGAIEEFTFLPLTEGR---QLHITIAVTGWLASGKYRTFSAPWAALAHSREQYCL 311

Query: 999  QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL 871
             WE+K+LM +  A+   + S +A  + +     TVLS  + AL
Sbjct: 312  AWEAKYLMELGNALET-ILSGLANMVAQEALKYTVLSGIVAAL 353



>gb:BC053600_1984996 Homo sapiens hypothetical protein LOC255104,
           mRNA (cDNA clone MGC:61808 IMAGE:5744211), complete cds.
          Length = 634

 Score =  134 bits (336), Expect(2) = 3e-38
 Identities = 71/157 (45%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -3

Query: 832 IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG 653
           ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   +  G
Sbjct: 366 IDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFSLGARVIYFCLQEMAQEKDCQG 425

Query: 652 LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV 473
           ++E V+LLGAP+     +WE  RKVV+GR IN Y   DW+L  V+R S +   +AG+QPV
Sbjct: 426 IIEDVILLGAPVEGEAKHWEPFRKVVSGRIINGYCRGDWLLSFVYRTSSVQLHVAGLQPV 485

Query: 472 DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT 368
            +    VENVD+T ++ GH  Y      IL+ + + T
Sbjct: 486 LLQDRRVENVDLTSVVSGHLDYAKQMDAILKAVGIRT 522



 Score = 48.9 bits (115), Expect(2) = 3e-38
 Identities = 30/103 (29%), Positives = 54/103 (52%), Gaps = 2/103 (1%)
 Frame = -1

Query: 1173 KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEES--DFFRPWEGEYNNLERYAL 1000
            K+ +R+G ++EF F  + +     +L + I +TG++       F  PW    ++ E+Y L
Sbjct: 255  KMKKRVGAIEEFTFLPLTEGR---QLHITIAVTGWLASGKYRTFSAPWAALAHSREQYCL 311

Query: 999  QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL 871
             WE+K+LM +  A+   + S +A  + +     TVLS  + AL
Sbjct: 312  AWEAKYLMELGNALET-ILSGLANMVAQEALKYTVLSGIVAAL 353



>gb:HSM807148_1187820 Homo sapiens mRNA; cDNA DKFZp686C23231 (from
           clone DKFZp686C23231).
          Length = 634

 Score =  134 bits (336), Expect(2) = 3e-38
 Identities = 71/157 (45%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -3

Query: 832 IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG 653
           ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   +  G
Sbjct: 366 IDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFSLGARVIYFCLQEMAQEKDCQG 425

Query: 652 LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV 473
           ++E V+LLGAP+     +WE  RKVV+GR IN Y   DW+L  V+R S +   +AG+QPV
Sbjct: 426 IIEDVILLGAPVEGEAKHWEPFRKVVSGRIINGYCRGDWLLSFVYRTSSVQLHVAGLQPV 485

Query: 472 DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT 368
            +    VENVD+T ++ GH  Y      IL+ + + T
Sbjct: 486 LLQDRRVENVDLTSVVSGHLDYAKQMDAILKAVGIRT 522



 Score = 48.9 bits (115), Expect(2) = 3e-38
 Identities = 30/103 (29%), Positives = 54/103 (52%), Gaps = 2/103 (1%)
 Frame = -1

Query: 1173 KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEES--DFFRPWEGEYNNLERYAL 1000
            K+ +R+G ++EF F  + +     +L + I +TG++       F  PW    ++ E+Y L
Sbjct: 255  KMKKRVGAIEEFTFLPLTEGR---QLHITIAVTGWLASGKYRTFSAPWAALAHSREQYCL 311

Query: 999  QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL 871
             WE+K+LM +  A+   + S +A  + +     TVLS  + AL
Sbjct: 312  AWEAKYLMELGNALET-ILSGLANMVAQEALKYTVLSGIVAAL 353



>gb:HS1056L3_1996644 Human DNA sequence from clone RP5-1056L3 on
           chromosome 1p35.1-36.13 Contains a novel gene, the gene
           for a novel protein (LOC374960), a ribosomal protein S14
           (RPS14) pseudogene, the NBL1 gene for neuroblastoma
           suppression of tumorigenicity 1, the HTR6 gene for
           5-hydroxytryptamine (serotonin) receptor 6, the 3' end
           of the gene for a novel protein (LOC255104) (FLJ45636)
           and two CpG islands, complete
           sequence.>gb:HS301K23_1997970 Human DNA sequence from
           clone RP1-301K23 on chromosome 1p35.1-36.21 Contains
           part of the gene for a novel protein (LOC255104)
           (FLJ45636), complete sequence.
          Length = 580

 Score =  134 bits (336), Expect(2) = 3e-38
 Identities = 71/157 (45%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -3

Query: 832 IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG 653
           ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   +  G
Sbjct: 366 IDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFSLGARVIYFCLQEMAQEKDCQG 425

Query: 652 LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV 473
           ++E V+LLGAP+     +WE  RKVV+GR IN Y   DW+L  V+R S +   +AG+QPV
Sbjct: 426 IIEDVILLGAPVEGEAKHWEPFRKVVSGRIINGYCRGDWLLSFVYRTSSVQLRVAGLQPV 485

Query: 472 DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT 368
            +    VENVD+T ++ GH  Y      IL+ + + T
Sbjct: 486 LLQDRRVENVDLTSVVSGHLDYAKQMDAILKAVGIRT 522



 Score = 48.9 bits (115), Expect(2) = 3e-38
 Identities = 30/103 (29%), Positives = 54/103 (52%), Gaps = 2/103 (1%)
 Frame = -1

Query: 1173 KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEES--DFFRPWEGEYNNLERYAL 1000
            K+ +R+G ++EF F  + +     +L + I +TG++       F  PW    ++ E+Y L
Sbjct: 255  KMKKRVGAIEEFTFLPLTEGR---QLHITIAVTGWLASGKYRTFSAPWAALAHSREQYCL 311

Query: 999  QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL 871
             WE+K+LM +  A+   + S +A  + +     TVLS  + AL
Sbjct: 312  AWEAKYLMELGNALET-ILSGLANMVAQEALKYTVLSGIVAAL 353



>gb:AX775875_1475229 Sequence 145 from Patent WO03048202.
          Length = 580

 Score =  134 bits (336), Expect(2) = 3e-38
 Identities = 71/157 (45%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -3

Query: 832 IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG 653
           ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   +  G
Sbjct: 366 IDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFSLGARVIYFCLQEMAQEKDCQG 425

Query: 652 LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV 473
           ++E V+LLGAP+     +WE  RKVV+GR IN Y   DW+L  V+R S +   +AG+QPV
Sbjct: 426 IIEDVILLGAPVEGEAKHWEPFRKVVSGRIINGYCRGDWLLSFVYRTSSVQLHVAGLQPV 485

Query: 472 DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT 368
            +    VENVD+T ++ GH  Y      IL+ + + T
Sbjct: 486 LLQDRRVENVDLTSVVSGHLDYAKQMDAILKAVGIRT 522



 Score = 48.9 bits (115), Expect(2) = 3e-38
 Identities = 30/103 (29%), Positives = 54/103 (52%), Gaps = 2/103 (1%)
 Frame = -1

Query: 1173 KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEES--DFFRPWEGEYNNLERYAL 1000
            K+ +R+G ++EF F  + +     +L + I +TG++       F  PW    ++ E+Y L
Sbjct: 255  KMKKRVGAIEEFTFLPLTEGR---QLHITIAVTGWLASGKYRTFSAPWAALAHSREQYCL 311

Query: 999  QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL 871
             WE+K+LM +  A+   + S +A  + +     TVLS  + AL
Sbjct: 312  AWEAKYLMELGNALET-ILSGLANMVAQEALKYTVLSGIVAAL 353



>gb:BC013471_2091758 Mus musculus RIKEN cDNA 4632413C14 gene, mRNA
           (cDNA clone MGC:18853 IMAGE:4221072), complete cds.
          Length = 631

 Score =  132 bits (331), Expect(2) = 4e-37
 Identities = 70/157 (44%), Positives = 99/157 (63%), Gaps = 2/157 (1%)
 Frame = -3

Query: 832 IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG 653
           ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   +  G
Sbjct: 363 IDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFSLGARVIYFCLQEMAQEQDCQG 422

Query: 652 LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV 473
           ++E VVLLGAP+     +WE  R VV+GR IN Y   DW+L  V+R S +   +AG+QPV
Sbjct: 423 IIEDVVLLGAPVEGDPKHWEPFRNVVSGRIINGYCRGDWLLSFVYRTSSVQLRVAGLQPV 482

Query: 472 DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT 368
            +    +ENVD+T +++GH  Y      IL+++ + T
Sbjct: 483 LLQDRRMENVDLTSVVNGHLDYAKQMDAILKVVGIRT 519



 Score = 47.0 bits (110), Expect(2) = 4e-37
 Identities = 31/103 (30%), Positives = 53/103 (51%), Gaps = 2/103 (1%)
 Frame = -1

Query: 1173 KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEES--DFFRPWEGEYNNLERYAL 1000
            K+ +R+G ++EF F  + +     +L + I ITG++       F  PW     + E+Y L
Sbjct: 252  KMKKRVGAIEEFMFLPLTEGR---QLHITIAITGWLGSGRYRTFNAPWMALARSQEQYCL 308

Query: 999  QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL 871
             WE+K+LM +  A+   + S +A  + +     TVLS  + AL
Sbjct: 309  AWEAKYLMELGNALET-ILSGLANMVAQEALKYTVLSGIVAAL 350



>gb:AK014571_1158035 Mus musculus 0 day neonate skin cDNA, RIKEN
           full-length enriched library, clone:4632413C14
           product:DJ301K23.1 (NOVEL PROTEIN SIMILAR TO PREDICTED
           YEAST AND WORM PROTEINS) (FRAGMENT) homolog [Homo
           sapiens], full insert sequence.>gb:AK029092_1161334 Mus
           musculus 10 days neonate skin cDNA, RIKEN full-length
           enriched library, clone:4732490M16 product:DJ301K23.1
           (NOVEL PROTEIN SIMILAR TO PREDICTED YEAST AND WORM
           PROTEINS) (FRAGMENT) homolog [Homo sapiens], full insert
           sequence.
          Length = 631

 Score =  132 bits (331), Expect(2) = 4e-37
 Identities = 70/157 (44%), Positives = 99/157 (63%), Gaps = 2/157 (1%)
 Frame = -3

Query: 832 IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG 653
           ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   +  G
Sbjct: 363 IDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFSLGARVIYFCLQEMAQEQDCQG 422

Query: 652 LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV 473
           ++E VVLLGAP+     +WE  R VV+GR IN Y   DW+L  V+R S +   +AG+QPV
Sbjct: 423 IIEDVVLLGAPVEGDPKHWEPFRNVVSGRIINGYCRGDWLLSFVYRTSSVQLRVAGLQPV 482

Query: 472 DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT 368
            +    +ENVD+T +++GH  Y      IL+++ + T
Sbjct: 483 LLQDRRMENVDLTSVVNGHLDYAKQMDAILKVVGIRT 519



 Score = 47.0 bits (110), Expect(2) = 4e-37
 Identities = 31/103 (30%), Positives = 53/103 (51%), Gaps = 2/103 (1%)
 Frame = -1

Query: 1173 KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEES--DFFRPWEGEYNNLERYAL 1000
            K+ +R+G ++EF F  + +     +L + I ITG++       F  PW     + E+Y L
Sbjct: 252  KMKKRVGAIEEFMFLPLTEGR---QLHITIAITGWLGSGRYRTFNAPWMALARSQEQYCL 308

Query: 999  QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL 871
             WE+K+LM +  A+   + S +A  + +     TVLS  + AL
Sbjct: 309  AWEAKYLMELGNALET-ILSGLANMVAQEALKYTVLSGIVAAL 350



>gb:AX775877_1475230 Sequence 147 from Patent WO03048202.
          Length = 540

 Score =  134 bits (336), Expect(2) = 7e-35
 Identities = 71/157 (45%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -3

Query: 832 IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG 653
           ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   +  G
Sbjct: 326 IDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFSLGARVIYFCLQEMAQEKDCQG 385

Query: 652 LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV 473
           ++E V+LLGAP+     +WE  RKVV+GR IN Y   DW+L  V+R S +   +AG+QPV
Sbjct: 386 IIEDVILLGAPVEGEAKHWEPFRKVVSGRIINGYCRGDWLLSFVYRTSSVQLHVAGLQPV 445

Query: 472 DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT 368
            +    VENVD+T ++ GH  Y      IL+ + + T
Sbjct: 446 LLQDRRVENVDLTSVVSGHLDYAKQMDAILKAVGIRT 482



 Score = 37.7 bits (86), Expect(2) = 7e-35
 Identities = 20/60 (33%), Positives = 32/60 (53%)
 Frame = -1

Query: 1050 FFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL 871
            F  PW    ++ E+Y L WE+K+LM +  A+   + S +A  + +     TVLS  + AL
Sbjct: 255  FSAPWAALAHSREQYCLAWEAKYLMELGNALET-ILSGLANMVAQEALKYTVLSGIVAAL 313



>pir|T18244|T18244 conserved hypothetical protein - yeast (Candida
            albicans)>gb:CAC49C4_1644832 C.albicans cosmid Ca49C4.
          Length = 906

 Score =  133 bits (335), Expect(2) = 5e-33
 Identities = 69/155 (44%), Positives = 105/155 (67%), Gaps = 2/155 (1%)
 Frame = -3

Query: 838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN 659
            + +D+ W +++DR+ KAG +LAE +  G  G RP+TLVGFSLG+R+I+ CL  +A  G  
Sbjct: 627  YLLDNPWNVSLDRAWKAGKILAETIISGNLGVRPITLVGFSLGSRLIYSCLIEMARRG-G 685

Query: 658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLS-QGLAGI 482
             GL+E V++LG+PI +        R VV+GRF+N YS  DW+LG +FRA+    + +AG+
Sbjct: 686  YGLIENVIILGSPITVDIDQMSEARSVVSGRFVNGYSKKDWILGYLFRATGGGIRAVAGL 745

Query: 481  QPVD-VPGVENVDVTELIDGHSAYLWTSQEILELL 380
             P+D V GVEN+D T+L++GH AY     +I++ +
Sbjct: 746  SPLDNVHGVENIDCTDLVEGHMAYRKAIPKIMKTI 780



 Score = 32.0 bits (71), Expect(2) = 5e-33
 Identities = 25/102 (24%), Positives = 54/102 (52%), Gaps = 3/102 (2%)
 Frame = -1

Query: 1167 ARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNL--ERYALQW 994
            +RR+GDV  FEFK +   HN  R  + + ++G++    D  R      + +  + ++L W
Sbjct: 520  SRRVGDVHTFEFKPL---HNNKRTNLIVTVSGWMNGAMDDVRLPFSTVDPVMGDMFSLLW 576

Query: 993  ESKHLMAVSYAIRNWLTSSIALELMK-RGAMMTVLSSFLTAL 871
            E + L ++   I    + +++  + +  GA  T+L++ ++A+
Sbjct: 577  EPEMLQSMGQTIGILASEALSTSIQQILGA--TILAALMSAI 616



>gb:AE016816_1746910 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome III, complete sequence.
          Length = 949

 Score =  122 bits (306), Expect(2) = 8e-33
 Identities = 66/155 (42%), Positives = 99/155 (63%), Gaps = 2/155 (1%)
 Frame = -3

Query: 838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN 659
            + ID+ W +++DR+  AG++LA+ L     G RP++LVGFSLG+RVI+ CL  L+  G  
Sbjct: 625  YIIDNPWNVSLDRAWAAGLILADTLMAQNLGARPISLVGFSLGSRVIYSCLLELSKQG-A 683

Query: 658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLS-QGLAGI 482
             GLVE V L G+P+          R VV+GRF+N YS  DW+LG +FR +    + +AGI
Sbjct: 684  IGLVEDVYLFGSPLVYNRDEMVMARAVVSGRFVNGYSDKDWILGYLFRVTAGGLKTVAGI 743

Query: 481  QPVD-VPGVENVDVTELIDGHSAYLWTSQEILELL 380
             P++ + G+EN++ TEL++GH AY      +L+ L
Sbjct: 744  SPIEGIEGIENMNCTELVEGHMAYRKNIPSLLKRL 778



 Score = 42.4 bits (98), Expect(2) = 8e-33
 Identities = 31/105 (29%), Positives = 53/105 (50%), Gaps = 7/105 (6%)
 Frame = -1

Query: 1164 RRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFR-------PWEGEYNNLERY 1006
            +RMG V  FEF+ +   HN  RL++ + ++G++  + D  R       P EG+      Y
Sbjct: 519  KRMGSVKTFEFRPL---HNNRRLSLIVSVSGWMIGKEDDVRLPFSPVDPIEGDL-----Y 570

Query: 1005 ALQWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL 871
            +L WE   L +    I N L S I  + +++    TVL++ + A+
Sbjct: 571  SLHWEPDMLKSTGQTI-NILASEIVTQTIQQILGATVLTALMAAI 614



>gb:CR382124_1656553 Kluyveromyces lactis strain NRRL Y-1140
            chromosome D of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 912

 Score =  126 bits (317), Expect(2) = 4e-31
 Identities = 68/157 (43%), Positives = 101/157 (64%), Gaps = 4/157 (2%)
 Frame = -3

Query: 838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN 659
            + ID+ W +++DR+  AG++LA+ L     G RP+TLVGFSLG+RVI+ CL  LA  G  
Sbjct: 634  YLIDNPWNVSLDRAWAAGLVLADTLMAKNLGDRPITLVGFSLGSRVIYSCLVELAKKG-A 692

Query: 658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGL---A 488
             G++E   L G+P+  +       R VV+GRF+N YS  DW+LG +FRA+    GL   A
Sbjct: 693  IGIIENAYLFGSPVVYKRDEMILARSVVSGRFLNGYSNRDWILGYLFRAT--GGGLSTVA 750

Query: 487  GIQPVD-VPGVENVDVTELIDGHSAYLWTSQEILELL 380
            GI P++ VP +ENVD +E++DGH +Y     ++L+ +
Sbjct: 751  GISPINSVPDIENVDCSEIVDGHMSYRKKMPKLLKAI 787



 Score = 32.3 bits (72), Expect(2) = 4e-31
 Identities = 28/100 (28%), Positives = 50/100 (50%), Gaps = 2/100 (2%)
 Frame = -1

Query: 1164 RRMGDVDEFEFKTIGQNHNKGRLAVEILITGFV-FEESDFFRPWEG-EYNNLERYALQWE 991
            RRMG V  FEF+ +    N  RL + + ++G++   E D   P+   +  N + Y+L WE
Sbjct: 528  RRMGSVRTFEFRPL---QNNRRLNLILSVSGWMNGNEDDVRLPFSTVDPINGDLYSLYWE 584

Query: 990  SKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL 871
               L +    +   L S I  + +++    TVL++ + A+
Sbjct: 585  PDMLRSTGQTM-GILASEIVTQTIQQILGATVLTALMAAI 623



>gb:U29381_1402778 Caenorhabditis elegans cosmid F35D11, complete
           sequence.
          Length = 617

 Score =  114 bits (284), Expect(2) = 3e-30
 Identities = 58/151 (38%), Positives = 85/151 (56%), Gaps = 3/151 (1%)
 Frame = -3

Query: 832 IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG 653
           +D+ W + V R+ + G  LAEVL     G RP+TL+GFSLGARVIF CL  ++    + G
Sbjct: 396 LDNPWNVCVSRAAEVGEQLAEVLLSRSHGKRPITLIGFSLGARVIFHCLLTMSKRSESVG 455

Query: 652 LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV 473
           ++E V+LLGAP+      W  V  VV+GR IN Y   DW+L  ++R       +AG  P+
Sbjct: 456 IIEDVILLGAPVTASPKEWSKVCTVVSGRVINGYCETDWLLRFLYRTMSAQFRIAGTGPI 515

Query: 472 D---VPGVENVDVTELIDGHSAYLWTSQEIL 389
           D      + N +++ ++ GH  Y     E+L
Sbjct: 516 DNRNSKKIYNYNLSHIVKGHMDYSKRLTEVL 546



 Score = 42.0 bits (97), Expect(2) = 3e-30
 Identities = 26/108 (24%), Positives = 62/108 (57%), Gaps = 6/108 (5%)
 Frame = -1

Query: 1173 KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESD------FFRPWEGEYNNLE 1012
            K+ +R+G ++EF  +T+ +  +   L+  ++++G++  ESD      F   W    +  E
Sbjct: 283  KMKKRVGAIEEFSVETLSEGVS---LSCSLVVSGWI--ESDTSPDQAFVHQWRHLRHTKE 337

Query: 1011 RYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA 868
            +Y L++ES +LM +  AI   ++ ++++ + ++  + T L+  ++A+A
Sbjct: 338  QYTLRYESNYLMELGNAIEYLMSFAVSVAI-QQTLLETALAGLVSAVA 384



>gb:CR382131_1664553 Yarrowia lipolytica chromosome E of strain CLIB99
            of Yarrowia lipolytica.
          Length = 1314

 Score =  118 bits (295), Expect(2) = 1e-29
 Identities = 65/153 (42%), Positives = 97/153 (63%), Gaps = 2/153 (1%)
 Frame = -3

Query: 838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN 659
            + +D+ W +++DR+   G +LA+ L +   G RP TLVGFSLGARVI+ CL  LA  G  
Sbjct: 850  YLVDNPWNVSLDRAWATGYVLADTLIQRNLGVRPATLVGFSLGARVIYSCLVELARRG-A 908

Query: 658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQG-LAGI 482
             GLV+ V + GAP+ ++       R +V+GRF+N YS  DW+LG +FRA+    G +AG+
Sbjct: 909  YGLVQDVYIFGAPVIVKTDQLCLCRSMVSGRFVNGYSRKDWVLGYLFRATSGGLGRVAGL 968

Query: 481  QPVD-VPGVENVDVTELIDGHSAYLWTSQEILE 386
              ++ V G+EN D T+ +DGH AY     ++L+
Sbjct: 969  TKLESVEGIENYDATDRVDGHMAYRKAMPQMLK 1001



 Score = 35.8 bits (81), Expect(2) = 1e-29
 Identities = 27/100 (27%), Positives = 53/100 (53%), Gaps = 2/100 (2%)
 Frame = -1

Query: 1164 RRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNL--ERYALQWE 991
            RRMG V  FEFK +   HN+ RL + I I+G++  + D  R      + +  +  ++ WE
Sbjct: 744  RRMGSVKTFEFKPL---HNQKRLNLIITISGWMLGKEDDVRLPFSTVDPIMGDLLSVLWE 800

Query: 990  SKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL 871
             + L ++   I N L + +    +++    TVL++ ++++
Sbjct: 801  PEMLQSMGQTI-NILATEVLANSIQQVLGATVLTALMSSI 839



>gb:CR380957_1653052 Candida glabrata strain CBS138 chromosome K
            complete sequence.
          Length = 1112

 Score =  119 bits (297), Expect(2) = 6e-29
 Identities = 63/155 (40%), Positives = 96/155 (61%), Gaps = 2/155 (1%)
 Frame = -3

Query: 838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN 659
            + +D+ W +++DR+  AG++LA+ L     G RPVTL+GFSLGARVI  CL  L    N 
Sbjct: 764  YILDNPWNVSLDRAWSAGLILADTLIGRNLGERPVTLIGFSLGARVILSCLVELCRK-NA 822

Query: 658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLS-QGLAGI 482
             G+VE V + G P+  +       R VV+GRF+N YS  DW+L  +FRA+    + + GI
Sbjct: 823  LGIVENVFIFGTPVVNKKDQLVMARSVVSGRFVNCYSDIDWLLAYLFRATAGGFRSIMGI 882

Query: 481  QPVD-VPGVENVDVTELIDGHSAYLWTSQEILELL 380
             PV+ + G++N + TE++DGH +Y     ++L+ L
Sbjct: 883  SPVEGIEGIDNYNCTEIVDGHLSYRSNMPKLLKKL 917



 Score = 32.7 bits (73), Expect(2) = 6e-29
 Identities = 26/107 (24%), Positives = 53/107 (49%), Gaps = 7/107 (6%)
 Frame = -1

Query: 1170 VARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFR-------PWEGEYNNLE 1012
            +++RMG V  FEF  +   HN  R+ + I ++G++    D  R       P EG+     
Sbjct: 656  MSKRMGSVRTFEFLPL---HNNRRVNLIINVSGWMVGNDDDVRLPFSTVDPVEGDL---- 708

Query: 1011 RYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL 871
             ++L WE + L ++   I   + S +  + +++    T+L+  ++A+
Sbjct: 709  -FSLYWEPEMLKSMGQTI-GIVASEVFTQTIQQVLGATILTGLMSAI 753



>sp|P43564|YFD4_YEAST Hypothetical 119.5 kDa protein in MOB2-RIM15
            intergenic region.>pir|S56220|S56220 probable membrane
            protein YFL034w - yeast (Saccharomyces
            cerevisiae)>gb:YSCCHRVIN_1728475 Saccharomyces cerevisiae
            chromosome VI complete DNA sequence.
          Length = 1073

 Score =  113 bits (283), Expect(2) = 1e-28
 Identities = 62/153 (40%), Positives = 91/153 (59%), Gaps = 2/153 (1%)
 Frame = -3

Query: 838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN 659
            + +D+ W +++DR+  AG +LA+ L     G RP+TLVGFS+GARVIF CL I       
Sbjct: 719  YILDNPWNVSLDRAWSAGKILADTLIARNLGARPITLVGFSIGARVIFSCL-IELCKKKA 777

Query: 658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLS-QGLAGI 482
             GL+E V L G P  ++       R VV+GRF+N YS  DW L  +FRA+      + GI
Sbjct: 778  LGLIENVYLFGTPAVMKKEQLVMARSVVSGRFVNGYSDKDWFLAYLFRAAAGGFSAVMGI 837

Query: 481  QPVD-VPGVENVDVTELIDGHSAYLWTSQEILE 386
              ++ V G+EN++ TE +DGH  Y  +  ++L+
Sbjct: 838  STIENVEGIENINCTEFVDGHLNYRKSMPKLLK 870



 Score = 37.4 bits (85), Expect(2) = 1e-28
 Identities = 29/112 (25%), Positives = 52/112 (46%), Gaps = 7/112 (6%)
 Frame = -1

Query: 1170 VARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFR-------PWEGEYNNLE 1012
            +++RMG V  FEF+ +   HN  R+ + + ++G++    D  R       P EG+     
Sbjct: 611  MSKRMGSVRTFEFRPL---HNNRRVNLILTVSGWMVGNEDDVRLPFSTVDPVEGDL---- 663

Query: 1011 RYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALAXGQQ 856
             Y+L WE + L ++   +     S +A E+        + ++ LTAL    Q
Sbjct: 664  -YSLYWEPEMLKSIGQTV-----SIVATEIFTTSLQQILGATVLTALISSIQ 709



>pir|T16263|T16263 hypothetical protein F35D11.3 - Caenorhabditis
           elegans
          Length = 531

 Score =  108 bits (269), Expect(2) = 2e-28
 Identities = 52/121 (42%), Positives = 72/121 (59%)
 Frame = -3

Query: 832 IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG 653
           +D+ W + V R+ + G  LAEVL     G RP+TL+GFSLGARVIF CL  ++    + G
Sbjct: 393 LDNPWNVCVSRAAEVGEQLAEVLLSRSHGKRPITLIGFSLGARVIFHCLLTMSKRSESVG 452

Query: 652 LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV 473
           ++E V+LLGAP+      W  V  VV+GR IN Y   DW+L  ++R       +AG  P+
Sbjct: 453 IIEDVILLGAPVTASPKEWSKVCTVVSGRVINGYCETDWLLRFLYRTMSAQFRIAGTGPI 512

Query: 472 D 470
           D
Sbjct: 513 D 513



 Score = 42.0 bits (97), Expect(2) = 2e-28
 Identities = 26/108 (24%), Positives = 62/108 (57%), Gaps = 6/108 (5%)
 Frame = -1

Query: 1173 KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESD------FFRPWEGEYNNLE 1012
            K+ +R+G ++EF  +T+ +  +   L+  ++++G++  ESD      F   W    +  E
Sbjct: 280  KMKKRVGAIEEFSVETLSEGVS---LSCSLVVSGWI--ESDTSPDQAFVHQWRHLRHTKE 334

Query: 1011 RYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA 868
            +Y L++ES +LM +  AI   ++ ++++ + ++  + T L+  ++A+A
Sbjct: 335  QYTLRYESNYLMELGNAIEYLMSFAVSVAI-QQTLLETALAGLVSAVA 381



>gb:NCB1D1_1689544 Neurospora crassa DNA linkage group II BAC clone
            B1D1.
          Length = 798

 Score =  129 bits (323), Expect = 2e-28
 Identities = 65/150 (43%), Positives = 97/150 (64%), Gaps = 1/150 (0%)
 Frame = -3

Query: 832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG 653
            ID+ W++ + R+DKAG LLA+ +     G R VTL+G+SLGAR I+ CL +L A     G
Sbjct: 583  IDNPWSVGMVRADKAGTLLADAIMNKAHGERGVTLIGYSLGARAIYVCLMVL-AERRAFG 641

Query: 652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV 473
            LVE  V++G P       W  +R VV+GR +NV+S ND++LG ++R S +  G+AG+Q +
Sbjct: 642  LVENAVMMGTPAPSEARVWCTMRSVVSGRLVNVFSENDYLLGFLYRTSSIQFGVAGLQRI 701

Query: 472  D-VPGVENVDVTELIDGHSAYLWTSQEILE 386
            + + GVENVDV+  + GH  Y + +  IL+
Sbjct: 702  EGIDGVENVDVSAKVSGHLRYQYLAGSILK 731



 Score = 36.6 bits (83), Expect = 1.3
 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 11/83 (13%)
 Frame = -1

Query: 1152 DVDEFEF----KTIGQNHNKG-------RLAVEILITGFVFEESDFFRPWEGEYNNLERY 1006
            ++ +F F     +IGQ+   G       RL V + I+G++ +ESD   PW       E Y
Sbjct: 446  EIQDFAFIPMRGSIGQDGEIGKIQPDARRLRVVLAISGWLTDESDVTNPWRALGQANEVY 505

Query: 1005 ALQWESKHLMAVSYAIRNWLTSS 937
            A++WE   L  +  A+   + SS
Sbjct: 506  AVRWEVDSLSKMGTALETVVRSS 528



>pir|T49359|T49359 hypothetical protein B1D1.130 [imported] -
           Neurospora crassa
          Length = 583

 Score =  129 bits (323), Expect = 2e-28
 Identities = 65/150 (43%), Positives = 97/150 (64%), Gaps = 1/150 (0%)
 Frame = -3

Query: 832 IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG 653
           ID+ W++ + R+DKAG LLA+ +     G R VTL+G+SLGAR I+ CL +L A     G
Sbjct: 368 IDNPWSVGMVRADKAGTLLADAIMNKAHGERGVTLIGYSLGARAIYVCLMVL-AERRAFG 426

Query: 652 LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV 473
           LVE  V++G P       W  +R VV+GR +NV+S ND++LG ++R S +  G+AG+Q +
Sbjct: 427 LVENAVMMGTPAPSEARVWCTMRSVVSGRLVNVFSENDYLLGFLYRTSSIQFGVAGLQRI 486

Query: 472 D-VPGVENVDVTELIDGHSAYLWTSQEILE 386
           + + GVENVDV+  + GH  Y + +  IL+
Sbjct: 487 EGIDGVENVDVSAKVSGHLRYQYLAGSILK 516



 Score = 36.6 bits (83), Expect = 1.3
 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 11/83 (13%)
 Frame = -1

Query: 1152 DVDEFEF----KTIGQNHNKG-------RLAVEILITGFVFEESDFFRPWEGEYNNLERY 1006
            ++ +F F     +IGQ+   G       RL V + I+G++ +ESD   PW       E Y
Sbjct: 231  EIQDFAFIPMRGSIGQDGEIGKIQPDARRLRVVLAISGWLTDESDVTNPWRALGQANEVY 290

Query: 1005 ALQWESKHLMAVSYAIRNWLTSS 937
            A++WE   L  +  A+   + SS
Sbjct: 291  AVRWEVDSLSKMGTALETVVRSS 313



>gb:AE017343_1755366 Cryptococcus neoformans var. neoformans JEC21
            chromosome 3, complete sequence.
          Length = 1121

 Score =  127 bits (319), Expect = 6e-28
 Identities = 73/146 (50%), Positives = 99/146 (67%), Gaps = 4/146 (2%)
 Frame = -3

Query: 838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN 659
            + ID+ W+ A+DR+  AG++LA+V+ +   G RP++L+GFSLGAR IF  L  LA     
Sbjct: 763  YLIDNPWSNALDRARAAGLVLADVIIQRHAGVRPISLIGFSLGARAIFYALIELARQ-KA 821

Query: 658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGL---A 488
             GLV+ V + G  +      W  VR VVAGRF+N Y+TNDWMLG +FRA+  S GL   A
Sbjct: 822  YGLVQEVFIFGTTVTASRDTWLDVRSVVAGRFVNGYATNDWMLGYLFRAT--SGGLNTVA 879

Query: 487  GIQPVD-VPGVENVDVTELIDGHSAY 413
            G++PV+ V G+ENVDVTE+I GH +Y
Sbjct: 880  GLRPVETVWGLENVDVTEIITGHMSY 905



>pir|T39047|T39047 hypothetical protein SPAC6F6.13c - fission yeast 
           (Schizosaccharomyces pombe)>gb:SPAC6F6_1718285 S.pombe
           chromosome I cosmid c6F6.
          Length = 778

 Score =  125 bits (313), Expect = 3e-27
 Identities = 65/144 (45%), Positives = 93/144 (64%), Gaps = 2/144 (1%)
 Frame = -3

Query: 838 HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN 659
           + ID+ W  ++DR+   G LLA++L     G RPVTLVG+SLGARVI+ CL+ L      
Sbjct: 536 YLIDNPWNNSLDRAKATGQLLADMLCYRSLGVRPVTLVGYSLGARVIYYCLRELEKK-KE 594

Query: 658 AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQG-LAGI 482
             ++E V L G P+  +  +W     VV+GRF+N Y  NDW+LG +FRA+    G +AG+
Sbjct: 595 FSIIENVYLFGTPVIFKRTSWLKAASVVSGRFVNGYKKNDWILGYLFRATSGGIGRVAGL 654

Query: 481 QPVD-VPGVENVDVTELIDGHSAY 413
           + +D +PG+EN+DVT L+ GH AY
Sbjct: 655 RQIDCIPGIENIDVTNLVSGHLAY 678



>pir|T50228|T50228 conserved hypothetical protein SPAC607.08c
           [imported] - fission yeast (Schizosaccharomyces
           pombe)>gb:SPAC607_1718135 S.pombe chromosome I cosmid
           c607.
          Length = 579

 Score =  123 bits (308), Expect = 1e-26
 Identities = 70/153 (45%), Positives = 95/153 (62%), Gaps = 2/153 (1%)
 Frame = -3

Query: 838 HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN 659
           + + + W IA + S KAG  LA  L    QG RPVTL+GFSLGAR I +CL  LA  G  
Sbjct: 357 NILGNSWRIAFNLSIKAGEALANALCVRAQGMRPVTLIGFSLGARTILECLLHLADRGET 416

Query: 658 AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ 479
             LVE V+++GAP+      W  +R VVAGRF+NVYS +D++L +V+R +      AG+ 
Sbjct: 417 -NLVENVIVMGAPMPTDAKLWLKMRCVVAGRFVNVYSASDYVLQLVYRVNSAQSTAAGLG 475

Query: 478 PV--DVPGVENVDVTELIDGHSAYLWTSQEILE 386
           PV  D   +ENVDV +L++GH  Y W   +IL+
Sbjct: 476 PVSLDSNTLENVDVGDLVEGHLQYRWLVAKILK 508



>gb:AF286010_1783183 Neurospora crassa YFL034W gene, partial cds.
          Length = 214

 Score =  121 bits (303), Expect = 4e-26
 Identities = 66/145 (45%), Positives = 95/145 (65%), Gaps = 5/145 (3%)
 Frame = -3

Query: 832 IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG 653
           ID+ W +++DR+  AG++LA+ L     G RPVTLVG+SLG+RVI+ CLQ LA  G   G
Sbjct: 65  IDNPWAVSLDRATAAGLILADSLIDRNLGTRPVTLVGYSLGSRVIYSCLQELARKG-AFG 123

Query: 652 LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQG----LAG 485
           LV+ V L G+PI ++   +     VV+GRF+N Y+ NDW+LG +FR   L+ G    + G
Sbjct: 124 LVQNVYLFGSPIVVKTDEYLRACAVVSGRFVNGYNRNDWILGYLFR---LTNGGIRRIGG 180

Query: 484 IQPVD-VPGVENVDVTELIDGHSAY 413
           + P++ + G+EN DVTE + GH  Y
Sbjct: 181 LAPIEGIAGIENFDVTEFVVGHMDY 205



>gb:AE014188_967869 Plasmodium falciparum 3D7 chromosome 12, complete
            sequence.>gb:AE014845_1229261 Plasmodium falciparum 3D7
            chromosome 12, section 2 of 9 of the complete sequence.
          Length = 1082

 Score =  107 bits (267), Expect = 6e-22
 Identities = 59/155 (38%), Positives = 87/155 (56%), Gaps = 1/155 (0%)
 Frame = -3

Query: 832  IDSEWTIAVDRSDKAGILLAEVLQ-KGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA 656
            +D+ + +  +R+ +AG +LA+ L  +   G RPV L+G+S+GARVIF CL+ L  S    
Sbjct: 928  LDNVYLLIRERAQQAGRILADALSDRNTVGQRPVILIGYSVGARVIFYCLKYLY-SKKLY 986

Query: 655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP 476
             +V   + +G P       WE +R VV  R INVYS NDW+LG ++R       +AG+  
Sbjct: 987  NIVSNAIFIGLPATTSTKVWEKIRMVVTNRVINVYSKNDWLLGFLYRYMEWKINVAGLIA 1046

Query: 475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLD 371
            V VP VEN D + +I  H  Y    ++I  L+  D
Sbjct: 1047 VKVPNVENYDASGIIHSHLDYKRKLKDIFHLINFD 1081



>gb:AC115612_1205930 Dictyostelium discoideum chromosome 2 map
            6245135-6357017 strain AX4, complete sequence.
          Length = 1135

 Score =  101 bits (252), Expect = 3e-20
 Identities = 58/160 (36%), Positives = 96/160 (60%), Gaps = 12/160 (7%)
 Frame = -3

Query: 832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQIL----AASG 665
            +D+ W++  DRS+KAG +LA+ +  G  G+RP+TLV  S+G+R++F  L+ L      + 
Sbjct: 948  LDNPWSLLKDRSEKAGKVLAQQIIDGYFGNRPLTLVSTSMGSRMVFYALEELYNQSLTNP 1007

Query: 664  NNAGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRA-SLLSQGL- 491
                L+E VV +G+PI      W  + ++++GR +N Y+ ND +L  V R+ + LS G+ 
Sbjct: 1008 KIYSLIESVVFIGSPITSDQKRWSKILRLISGRMVNCYTPNDLLLKYVCRSINCLSDGIL 1067

Query: 490  --AGIQPVDVPG----VENVDVTELIDGHSAYLWTSQEIL 389
              AG+ P+ +PG    +ENVD++ L+  H  Y    +EIL
Sbjct: 1068 PAAGVAPIHIPGSSLVIENVDLSNLVKSHLDY--EKEEIL 1105



>gb:AE017341_1754571 Cryptococcus neoformans var. neoformans JEC21
            chromosome 1, complete sequence.
          Length = 683

 Score = 99.4 bits (246), Expect = 2e-19
 Identities = 63/170 (37%), Positives = 93/170 (54%), Gaps = 16/170 (9%)
 Frame = -3

Query: 832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAA----SG 665
            +D+ W  A DR+ KAG LL EV++K +QG RPV L+G S+GA  I   L  LA+    S 
Sbjct: 513  LDNTWMHAQDRAKKAGRLLGEVIEKRVQGERPVVLIGSSVGALTIQHALLYLASLPPPSN 572

Query: 664  NNA---GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLG-------IVFR 515
            + +     VE   L+  P       W+  R VV+ R +N +S  D +L        +V R
Sbjct: 573  SKSPVPAYVESAYLISLPAAPSTEEWDKCRSVVSRRLVNAWSDADLVLAGVVRLHEVVSR 632

Query: 514  ASLLSQGL--AGIQPVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLD 371
            A+++S G+  AG+ PV+ P VENVDV+  + GH        EIL+++ +D
Sbjct: 633  AAVMSNGIRVAGLGPVECPSVENVDVSSALRGHMELQAKMPEILKIINVD 682



>gb:HS301K231_1997972 Novel human gene mapping to chomosome 1.
          Length = 423

 Score = 59.3 bits (142), Expect(2) = 5e-16
 Identities = 29/53 (54%), Positives = 37/53 (69%)
 Frame = -3

Query: 832 IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILA 674
           ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A
Sbjct: 368 IDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFSLGARVIYFCLQEMA 420



 Score = 48.9 bits (115), Expect(2) = 5e-16
 Identities = 30/103 (29%), Positives = 54/103 (52%), Gaps = 2/103 (1%)
 Frame = -1

Query: 1173 KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEES--DFFRPWEGEYNNLERYAL 1000
            K+ +R+G ++EF F  + +     +L + I +TG++       F  PW    ++ E+Y L
Sbjct: 257  KMKKRVGAIEEFTFLPLTEGR---QLHITIAVTGWLASGKYRTFSAPWAALAHSREQYCL 313

Query: 999  QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL 871
             WE+K+LM +  A+   + S +A  + +     TVLS  + AL
Sbjct: 314  AWEAKYLMELGNALET-ILSGLANMVAQEALKYTVLSGIVAAL 355



>gb:AK054337_1170785 Mus musculus 2 days pregnant adult female ovary
           cDNA, RIKEN full-length enriched library,
           clone:E330017C12 product:DJ301K23.1 (NOVEL PROTEIN
           SIMILAR TO PREDICTED YEAST AND WORM PROTEINS) (FRAGMENT)
           homolog [Homo sapiens], full insert sequence.
          Length = 365

 Score = 59.3 bits (142), Expect(2) = 2e-15
 Identities = 29/53 (54%), Positives = 37/53 (69%)
 Frame = -3

Query: 832 IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILA 674
           ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A
Sbjct: 307 IDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFSLGARVIYFCLQEMA 359



 Score = 47.0 bits (110), Expect(2) = 2e-15
 Identities = 31/103 (30%), Positives = 53/103 (51%), Gaps = 2/103 (1%)
 Frame = -1

Query: 1173 KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEES--DFFRPWEGEYNNLERYAL 1000
            K+ +R+G ++EF F  + +     +L + I ITG++       F  PW     + E+Y L
Sbjct: 196  KMKKRVGAIEEFMFLPLTEGR---QLHITIAITGWLGSGRYRTFNAPWMALARSQEQYCL 252

Query: 999  QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL 871
             WE+K+LM +  A+   + S +A  + +     TVLS  + AL
Sbjct: 253  AWEAKYLMELGNALET-ILSGLANMVAQEALKYTVLSGIVAAL 294



>gb:AK127543_1916795 Homo sapiens cDNA FLJ45636 fis, clone
           COLON2001866.
          Length = 218

 Score = 81.6 bits (200), Expect = 4e-14
 Identities = 42/98 (42%), Positives = 60/98 (61%), Gaps = 2/98 (2%)
 Frame = -3

Query: 655 GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP 476
           G++E V+LLGAP+     +WE  RKVV+GR IN Y   DW+L  V+R S +   +AG+QP
Sbjct: 9   GIIEDVILLGAPVEGEAKHWEPFRKVVSGRIINGYCRGDWLLSFVYRTSSVQLRVAGLQP 68

Query: 475 VDVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT 368
           V +    VENVD+T ++ GH  Y      IL+ + + T
Sbjct: 69  VLLQDRRVENVDLTSVVSGHLDYAKQMDAILKAVGIRT 106



>gb:AX118907_1461511 Sequence 71 from Patent WO0129221.
          Length = 218

 Score = 81.6 bits (200), Expect = 4e-14
 Identities = 42/98 (42%), Positives = 60/98 (61%), Gaps = 2/98 (2%)
 Frame = -3

Query: 655 GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP 476
           G++E V+LLGAP+     +WE  RKVV+GR IN Y   DW+L  V+R S +   +AG+QP
Sbjct: 9   GIIEDVILLGAPVEGEAKHWEPFRKVVSGRIINGYCRGDWLLSFVYRTSSVQLHVAGLQP 68

Query: 475 VDVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT 368
           V +    VENVD+T ++ GH  Y      IL+ + + T
Sbjct: 69  VLLQDRRVENVDLTSVVSGHLDYAKQMDAILKAVGIRT 106



>gb:HS301K23A_1997973 Novel human gene mapping to chomosome 1.
          Length = 383

 Score = 59.3 bits (142), Expect(2) = 1e-12
 Identities = 29/53 (54%), Positives = 37/53 (69%)
 Frame = -3

Query: 832 IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILA 674
           ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A
Sbjct: 328 IDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFSLGARVIYFCLQEMA 380



 Score = 37.7 bits (86), Expect(2) = 1e-12
 Identities = 20/60 (33%), Positives = 32/60 (53%)
 Frame = -1

Query: 1050 FFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL 871
            F  PW    ++ E+Y L WE+K+LM +  A+   + S +A  + +     TVLS  + AL
Sbjct: 257  FSAPWAALAHSREQYCLAWEAKYLMELGNALET-ILSGLANMVAQEALKYTVLSGIVAAL 315



>gb:AY123055_1579923 Griffithsia japonica heat shock cognate 70 kDa
           protein mRNA, partial cds.
          Length = 225

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 32/85 (37%), Positives = 50/85 (58%), Gaps = 1/85 (1%)
 Frame = -3

Query: 673 ASGNNAGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQG 494
           AS +  G+V+ V L+GAP+      W  +R VVAGR +N Y  +DW L    R       
Sbjct: 5   ASRSALGIVDNVYLVGAPVTADPERWRKIRSVVAGRIVNAYGPHDWALAFFHRGCGHGVY 64

Query: 493 LAGIQPVDVPGVENVDVTEL-IDGH 422
           +AG++ V++ G+EN+++  L I+GH
Sbjct: 65  VAGLRKVELEGLENMNMAYLGIEGH 89



>gb:AY596296_631458 Haloarcula marismortui ATCC 43049 plasmid
           pNG700, complete sequence.
          Length = 281

 Score = 51.2 bits (121), Expect = 5e-05
 Identities = 49/148 (33%), Positives = 72/148 (48%), Gaps = 9/148 (6%)
 Frame = -3

Query: 829 DSEWTIAVDRSDKAGILLAEVLQKGLQGH-RPVTLVGFSLGARVIFKCLQILAASGNNAG 653
           D EW  A D +     LLA+ L +  +   RPV ++  SLGARV  + L++LA  G    
Sbjct: 119 DVEWEQAKDNAVANRTLLAQWLMEWAETDGRPVHVLAHSLGARVTGETLRVLAEQG-ATD 177

Query: 652 LVERVVLLGAPIRIRDV----NWEAVRKVVAGRFINVYSTNDWMLGIVFRAS--LLSQGL 491
           ++  V LLG  I    V     +    + V     N YS ND +L  V+RAS    + G 
Sbjct: 178 VLASVSLLGGAIPYDSVVQGGRYGDAIEAVDAPVSNFYSQNDKVLSWVYRASDRTHAVGH 237

Query: 490 AGIQPVD--VPGVENVDVTELIDGHSAY 413
           AG +       G ++V+VT+L+  H +Y
Sbjct: 238 AGTRDAGPLPDGYQDVNVTDLVADHYSY 265



>gb:AE016858_350200 Pseudomonas syringae pv. tomato str. DC3000
           section 3 of 21 of the complete
           genome.>gb:AE016853_1035375 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 465

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 41/143 (28%), Positives = 66/143 (46%), Gaps = 4/143 (2%)
 Frame = -3

Query: 805 DRSDKAGILLAEVLQKGLQGHRP----VTLVGFSLGARVIFKCLQILAASGNNAGLVERV 638
           +R+   G +L   L + L  H P    V L+G SLG R++   L+       +  +V  V
Sbjct: 99  NRARDMGKVLLTQLDRYLFEHHPQVKRVNLIGHSLGGRLLVSALKNAEQPLEHGLVVGDV 158

Query: 637 VLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPVDVPGV 458
           +L+ A +R+     E +++ ++GR IN YS+ D +L       LL+ G   +    V   
Sbjct: 159 LLMAAAVRLNATEAEQLKQSISGRLINAYSSEDHVL-------LLNLGEKSLGRTPVEHF 211

Query: 457 ENVDVTELIDGHSAYLWTSQEIL 389
           ENV +      H  Y    QE+L
Sbjct: 212 ENVRMAGY--RHHHYWRRLQEVL 232



>gb:BX294137_766284 Pirellula sp. strain 1 complete genome; segment
           5/24.
          Length = 277

 Score = 40.4 bits (93), Expect = 0.093
 Identities = 32/89 (35%), Positives = 45/89 (50%), Gaps = 1/89 (1%)
 Frame = -3

Query: 787 GILLAE-VLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAGLVERVVLLGAPIRI 611
           GI LA+ +L+    G RP+ LVG SLG  VI   L+ LA        V+ ++L+G     
Sbjct: 140 GIRLADKILELPGVGKRPLHLVGHSLGTVVIRSALEKLAERDCR---VDDLLLMGG--MT 194

Query: 610 RDVNWEAVRKVVAGRFINVYSTNDWMLGI 524
             +NW        GR IN+YS  D +L +
Sbjct: 195 SRLNWNEQADAFRGRLINLYSPRDRILNM 223



>gb:BX294136_766153 Pirellula sp. strain 1 complete genome; segment
           4/24.
          Length = 491

 Score = 37.7 bits (86), Expect = 0.60
 Identities = 18/54 (33%), Positives = 30/54 (55%)
 Frame = -3

Query: 835 FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILA 674
           F  ++  I  +R+D  G+ LA +L + +   +P  L+GFS G R++   L  LA
Sbjct: 304 FAITDARIKAERTDAQGLYLAWLLHRHVDAAQPTALIGFSFGGRIVTGSLHALA 357



>gb:BA000016_674587 Clostridium perfringens str. 13 DNA, complete
           genome.
          Length = 1145

 Score = 36.6 bits (83), Expect = 1.3
 Identities = 39/189 (20%), Positives = 77/189 (40%), Gaps = 8/189 (4%)
 Frame = -3

Query: 835 FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHR---PVTLVGFSLGARVIFKCLQILAASG 665
           FID  +++  D +DKAG  + + L KG++ +R    V L G+           Q L +  
Sbjct: 442 FIDEAYSLCTDENDKAGREIVDALLKGIEDNRDNITVILAGYEKDMETFLSFNQGLKSRF 501

Query: 664 NNAGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLL-----S 500
            N             I+  D N   + ++     +N+  +  + +    +A L+     +
Sbjct: 502 PNV------------IKFEDYNPSEMYEIA----VNIAKSKGYRIAKSAKAGLIELFTKN 545

Query: 499 QGLAGIQPVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRASR*DLRHI 320
           Q +      +   V N+    ++D    YL   +  ++LL+ D +   F  +++ DL   
Sbjct: 546 QMVGKSDLGNARFVRNIVENAIMDASKKYLVNKERAIDLLEKDNFN--FKVSAKFDLEEK 603

Query: 319 LPLIFSLQD 293
           L  I  L++
Sbjct: 604 LKEIIGLEE 612



>gb:AY765220_1350369 Tetrahymena pyriformis GL metallothionein mRNA,
            complete cds.
          Length = 181

 Score = 35.0 bits (79), Expect = 3.9
 Identities = 20/63 (31%), Positives = 26/63 (41%), Gaps = 5/63 (7%)
 Frame = +1

Query: 1219 CDRANNTSCSSGNRSEPTCSN-----HRNKSSQCWS*STKPCSNGWSS*TTSNRH*CSSC 1383
            C   NNT C S +  E  C+N        KS+ C S +   C  G +   T     C +C
Sbjct: 75   CCSQNNTKCCSNSNEECKCTNCQCCKTETKSNCCCSQNKNECCKGKNQGCT-----CQNC 129

Query: 1384 QCC 1392
             CC
Sbjct: 130  NCC 132



>gb:AE016827_343422 Mannheimia succiniciproducens MBEL55E, complete
           genome.
          Length = 254

 Score = 35.0 bits (79), Expect = 3.9
 Identities = 30/86 (34%), Positives = 40/86 (46%), Gaps = 5/86 (5%)
 Frame = -3

Query: 760 KGLQGHRPVTLVGFSLGARV-IFKCLQILAASGNNAGLVERVVLLGAPI-RIRDVNWEAV 587
           K   G++P  LVG+SLG R+ ++  LQ     GN  GL+     LG      R V W+  
Sbjct: 62  KSAVGNQPYFLVGYSLGGRIALYYALQSQCEKGNLQGLILEGANLGLTCDEARKVRWKN- 120

Query: 586 RKVVAGRFINVYS---TNDWMLGIVF 518
            +  A RFI   +    NDW    VF
Sbjct: 121 DEFWAQRFITESAESVLNDWYQQPVF 146


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,307,555,881
Number of Sequences: 1806583
Number of extensions: 25570824
Number of successful extensions: 69171
Number of sequences better than 10.0: 41
Number of HSP's better than 10.0 without gapping: 64648
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 69053
length of database: 581,917,975
effective HSP length: 128
effective length of database: 350,675,351
effective search space used: 124139074254
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)