BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10484
         (999 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY367058_1602918 Pisum sativum cultivar Alaska SAT5 mRNA, com...   312   8e-84   
gb:AY084973_1570055 Arabidopsis thaliana clone 123128 mRNA, comp...   301   1e-80   
pir|F84788|F84788 hypothetical protein At2g37110 [imported] - Ar...   301   1e-80   Arabidopsis thaliana [mouse-ear cress]
gb:AP002539_1822530 Oryza sativa (japonica cultivar-group) genom...   280   4e-74   
gb:AY239300_1592242 Gossypium barbadense unknown mRNA.                 77   7e-13   
gb:AC002409_1530712 Arabidopsis thaliana chromosome 2 clone T20B...    76   1e-12   
gb:AB026658_1517369 Arabidopsis thaliana genomic DNA, chromosome...    54   4e-06   
gb:AB026658_1517367 Arabidopsis thaliana genomic DNA, chromosome...    52   1e-05   
gb:AB026658_1517368 Arabidopsis thaliana genomic DNA, chromosome...    52   2e-05   
gb:AY097182_1576324 Lycopersicon cheesmanii LA483 fw2.2 gene, co...    50   7e-05   
gb:AF261775_1781561 Lycopersicon pennellii ORFX (ORFX) gene, com...    49   2e-04   
gb:AY097189_1576331 Lycopersicon pennellii LA716 fw2.2 gene, com...    49   2e-04   
gb:AY097183_1576325 Lycopersicon pimpinellifolium LA369 fw2.2 ge...    49   2e-04   
gb:AY097178_1576320 Lycopersicon esculentum M82 fw2.2 gene, comp...    49   2e-04   
gb:AF327424_1786793 Arabidopsis thaliana unknown protein (At2g45...    49   2e-04   
pir|E84885|E84885 hypothetical protein At2g45010 [imported] - Ar...    49   2e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AF049928_1764127 Petunia x hybrida PGPS/D12 (PGPS/D12) mRNA, ...    47   5e-04   
gb:AY485643_1608489 Hordeum vulgare subsp. vulgare BAC 615K1, co...    45   0.002   
gb:AE016959_1023820 Oryza sativa (japonica cultivar-group) chrom...    45   0.003   
gb:AY485644_1608494 Triticum monococcum phosphatidylserine decar...    44   0.004   
gb:AP003575_1831134 Oryza sativa (japonica cultivar-group) genom...    44   0.005   
gb:AC133339_1741402 Oryza sativa chromosome 3 BAC OSJNBa0078D06 ...    43   0.011   
gb:AC133339_1741399 Oryza sativa chromosome 3 BAC OSJNBa0078D06 ...    43   0.011   
gb:AP006161_1861110 Oryza sativa (japonica cultivar-group) genom...    41   0.042   
pir|G96527|G96527 protein F27J15.18 [imported] - Arabidopsis tha...    41   0.042   Arabidopsis thaliana [mouse-ear cress]
gb:AP006161_1861112 Oryza sativa (japonica cultivar-group) genom...    39   0.12    
gb:AY085704_1570771 Arabidopsis thaliana clone 17208 mRNA, compl...    39   0.12    
pir|E96710|E96710 hypothetical protein F24J5.15 [imported] - Ara...    39   0.12    Arabidopsis thaliana [mouse-ear cress]
gb:ATU78866_1557278 Arabidopsis thaliana putative arginine-aspar...    38   0.27    
gb:AB025621_1516432 Arabidopsis thaliana genomic DNA, chromosome...    38   0.27    
gb:AE005172_890484 Arabidopsis thaliana chromosome 1, top arm co...    38   0.27    
gb:AP004817_1845608 Oryza sativa (japonica cultivar-group) genom...    37   0.47    
gb:AE005172_890486 Arabidopsis thaliana chromosome 1, top arm co...    37   0.47    
gb:AY084625_1569713 Arabidopsis thaliana clone 113571 mRNA, comp...    37   0.61    
pir|G96710|G96710 hypothetical protein F24J5.13 [imported] - Ara...    37   0.61    Arabidopsis thaliana [mouse-ear cress]
gb:AP004001_1836189 Oryza sativa (japonica cultivar-group) genom...    36   1.0     
pir|H87268|H87268 hypothetical protein CC0161 [imported] - Caulo...    36   1.0     Caulobacter vibrioides
gb:BC077771_2560425 Xenopus laevis hypothetical protein LOC44588...    35   1.8     
gb:OSJN00239_1697232 Oryza sativa genomic DNA, chromosome 4, BAC...    35   1.8     
gb:BX294150_770569 Pirellula sp. strain 1 complete genome; segme...    35   2.3     
gb:BX569693_776629 Synechococcus sp. WH8102 complete genome; seg...    35   3.0     
gb:BC038827_2098315 Mus musculus myeloid/lymphoid or mixed linea...    34   4.0     
gb:AY050217_2074557 Mus musculus MLLT6 (Mllt6) mRNA, complete cds.     34   4.0     
gb:AE016996_374776 Chlamydophila caviae GPIC section 3 of 4 of t...    34   5.2     
pir|A81463|T02853 hypothetical protein L1439.5 [imported] - Leis...    34   5.2     
gb:BC007237_1970574 Homo sapiens myeloid/lymphoid or mixed-linea...    33   6.8     
gb:AK027133_1910824 Homo sapiens cDNA: FLJ23480 fis, clone KAIA0...    33   6.8     
gb:HSM801474_1186193 Homo sapiens mRNA; cDNA DKFZp434K0227 (from...    33   6.8     
sp|P55198|AF17_HUMAN|AF17_HUMAN AF-17 protein.>pir|I38533|I38533 AF17 prote...    33   6.8     Homo sapiens [man]
gb:AF140345_2056086 Rattus norvegicus N-methyl-D-aspartate recep...    33   8.8     
gb:AK124993_1915785 Homo sapiens cDNA FLJ43003 fis, clone BRTHA2...    33   8.8     
gb:A23049_1448020 B. bovis mRNA for 12D3 antigen.                      33   8.8     
gb:AK008843_1154813 Mus musculus adult male stomach cDNA, RIKEN ...    33   8.8     


>gb:AY367058_1602918 Pisum sativum cultivar Alaska SAT5 mRNA,
           complete cds.
          Length = 235

 Score =  312 bits (799), Expect = 8e-84
 Identities = 142/191 (74%), Positives = 165/191 (86%), Gaps = 2/191 (1%)
 Frame = -1

Query: 771 WTANGLPLRY-SVTGEPVAARAQWDSGLCACLGRNDEFCSSDLEVCLLGSLAPCVLYGTN 595
           WTA+G+P+ + SV G+P+  R+ W+S +CACLG++D FCSSDLEVCLLGS+APCVLYG+N
Sbjct: 44  WTADGVPIAHGSVMGQPIP-RSPWNSSVCACLGQSDHFCSSDLEVCLLGSVAPCVLYGSN 102

Query: 594 VERIGSS-PGAFANHCLPYTGLYLIGNSFFGWNCLAPWFSYPSRTAIRRKFNLEGSCEAL 418
           VER+GS+  G FANHCL Y+GLY+IGNS  GWNCLAPWFSYPSRTAIRR+FNLEGSCEAL
Sbjct: 103 VERLGSNNSGTFANHCLHYSGLYVIGNSCCGWNCLAPWFSYPSRTAIRRRFNLEGSCEAL 162

Query: 417 TRSCGCGGSFVEDDLQREQCESACDLGTHVFCHLCALCQEAREVRRRLPHPGFNAQPVLV 238
            RSCGC GSF+ED+ QREQCE ACD  TH FCH CALCQE RE+RRR+PHPGFNAQ +LV
Sbjct: 163 NRSCGCCGSFLEDEAQREQCELACDFATHFFCHACALCQEGRELRRRVPHPGFNAQQILV 222

Query: 237 MIPPGEQTMGR 205
           MIPP EQ MGR
Sbjct: 223 MIPPAEQAMGR 233



>gb:AY084973_1570055 Arabidopsis thaliana clone 123128 mRNA,
           complete sequence.
          Length = 242

 Score =  301 bits (772), Expect = 1e-80
 Identities = 138/191 (72%), Positives = 159/191 (83%), Gaps = 1/191 (0%)
 Frame = -1

Query: 774 GWTANGLPLRY-SVTGEPVAARAQWDSGLCACLGRNDEFCSSDLEVCLLGSLAPCVLYGT 598
           GWTA+GLP+ + SV GEP+  R QW+SGL  CLGRNDEFCSSDLEVCLLGS+APCVLYGT
Sbjct: 52  GWTADGLPVSHGSVIGEPIR-RNQWNSGLFTCLGRNDEFCSSDLEVCLLGSVAPCVLYGT 110

Query: 597 NVERIGSSPGAFANHCLPYTGLYLIGNSFFGWNCLAPWFSYPSRTAIRRKFNLEGSCEAL 418
           N ER+GS+PG F+NHCL Y GLY IGNS FGWNCLAPWFSY SR+AIRRKFNLEGS EA+
Sbjct: 111 NAERLGSAPGTFSNHCLTYLGLYFIGNSLFGWNCLAPWFSYSSRSAIRRKFNLEGSFEAM 170

Query: 417 TRSCGCGGSFVEDDLQREQCESACDLGTHVFCHLCALCQEAREVRRRLPHPGFNAQPVLV 238
            RSCGC G  +ED++QRE  E+ CD  THV CH CALCQE RE+RR++ HPGFNAQ  +V
Sbjct: 171 NRSCGCCGGCIEDEMQREHLETTCDFVTHVLCHTCALCQEGRELRRKVLHPGFNAQSTVV 230

Query: 237 MIPPGEQTMGR 205
           ++PP EQTMGR
Sbjct: 231 VMPPIEQTMGR 241



>pir|F84788|F84788 hypothetical protein At2g37110 [imported] -
           Arabidopsis thaliana>gb:AC006260_1533891 Arabidopsis
           thaliana chromosome 2 clone T2N18 map ve018, complete
           sequence.
          Length = 242

 Score =  301 bits (771), Expect = 1e-80
 Identities = 137/191 (71%), Positives = 159/191 (83%), Gaps = 1/191 (0%)
 Frame = -1

Query: 774 GWTANGLPLRY-SVTGEPVAARAQWDSGLCACLGRNDEFCSSDLEVCLLGSLAPCVLYGT 598
           GWTA+GLP+ + SV GEP+  R QW+SGL  CLGRNDEFCSSDLEVCLLGS+APCVLYGT
Sbjct: 52  GWTADGLPVSHGSVIGEPIR-RNQWNSGLFTCLGRNDEFCSSDLEVCLLGSVAPCVLYGT 110

Query: 597 NVERIGSSPGAFANHCLPYTGLYLIGNSFFGWNCLAPWFSYPSRTAIRRKFNLEGSCEAL 418
           N ER+GS+PG F+NHCL Y GLY +GNS FGWNCLAPWFSY SR+AIRRKFNLEGS EA+
Sbjct: 111 NAERLGSAPGTFSNHCLTYLGLYFVGNSLFGWNCLAPWFSYSSRSAIRRKFNLEGSFEAM 170

Query: 417 TRSCGCGGSFVEDDLQREQCESACDLGTHVFCHLCALCQEAREVRRRLPHPGFNAQPVLV 238
            RSCGC G  +ED++QRE  E+ CD  THV CH CALCQE RE+RR++ HPGFNAQ  +V
Sbjct: 171 NRSCGCCGGCIEDEMQREHLETTCDFVTHVLCHTCALCQEGRELRRKVLHPGFNAQSTVV 230

Query: 237 MIPPGEQTMGR 205
           ++PP EQTMGR
Sbjct: 231 VMPPIEQTMGR 241



>gb:AP002539_1822530 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0433F09.>gb:AP003225_1825627 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0011G08.
          Length = 235

 Score =  280 bits (715), Expect = 4e-74
 Identities = 128/191 (67%), Positives = 152/191 (79%), Gaps = 4/191 (2%)
 Frame = -1

Query: 765 ANGLPLRYSVTGEPVAA----RAQWDSGLCACLGRNDEFCSSDLEVCLLGSLAPCVLYGT 598
           A+G+P+   V GEP+ A    R  W+SG+ +CLGRNDEFCSSD+EVCLLGS+APCVLYG+
Sbjct: 46  ADGVPV---VMGEPLGAPAPPRESWNSGVLSCLGRNDEFCSSDVEVCLLGSIAPCVLYGS 102

Query: 597 NVERIGSSPGAFANHCLPYTGLYLIGNSFFGWNCLAPWFSYPSRTAIRRKFNLEGSCEAL 418
           NVER  + PG FAN CLPYTGLY++GN+ FGWNC+APWFS+ +RTAIRR++NLEGS EA 
Sbjct: 103 NVERFAARPGTFANSCLPYTGLYMLGNALFGWNCIAPWFSHHTRTAIRRRYNLEGSFEAF 162

Query: 417 TRSCGCGGSFVEDDLQREQCESACDLGTHVFCHLCALCQEAREVRRRLPHPGFNAQPVLV 238
           T+ CGC    VED+  RE  E ACDL TH FCH CALCQE RE+RRR+PHPGFN + VLV
Sbjct: 163 TKQCGCCHGLVEDEGNREHLEVACDLATHYFCHPCALCQEGRELRRRVPHPGFNGRSVLV 222

Query: 237 MIPPGEQTMGR 205
           M PP EQTMGR
Sbjct: 223 MTPPKEQTMGR 233



>gb:AY239300_1592242 Gossypium barbadense unknown mRNA.
          Length = 127

 Score = 76.6 bits (187), Expect = 7e-13
 Identities = 41/65 (63%), Positives = 44/65 (67%)
 Frame = -1

Query: 342 LGTHVFCHLCALCQEAREVRRRLPHPGFNAQPVLVMIPPGEQTMGR*AQ*LSIHRYGSAL 163
           L  +VFC  CALCQE R +RRRLPHPGFNAQPVLV IPPGEQTMGR      +H Y    
Sbjct: 7   LWNNVFCQACALCQEGR-LRRRLPHPGFNAQPVLV-IPPGEQTMGRGVHAGHVHWYAVTT 64

Query: 162 PDCCS 148
              CS
Sbjct: 65  GMVCS 69



>gb:AC002409_1530712 Arabidopsis thaliana chromosome 2 clone T20B5
           map CIC11C08, complete sequence.>gb:AY085101_1570183
           Arabidopsis thaliana clone 1297 mRNA, complete sequence.
          Length = 190

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 48/154 (31%), Positives = 69/154 (44%), Gaps = 10/154 (6%)
 Frame = -1

Query: 708 QWDSGLCACLGRNDEFCSSDLEVCLLGSLAPCVLYGTNVERIGSSPGAFANHCLPYTGLY 529
           QW SG+CAC          D++ C +G   PC ++G N E +GS  G FA  CL +   +
Sbjct: 46  QWSSGICACF--------DDMQSCCVGLFCPCYIFGKNAELLGS--GTFAGPCLTHCISW 95

Query: 528 LIGNSF--FGWN--------CLAPWFSYPSRTAIRRKFNLEGSCEALTRSCGCGGSFVED 379
            + N+   F  N        C    ++   R ++R K+NL+ +       CG        
Sbjct: 96  ALVNTICCFATNGALLGLPGCFVSCYACGYRKSLRAKYNLQEA------PCG-------- 141

Query: 378 DLQREQCESACDLGTHVFCHLCALCQEAREVRRR 277
                      D  TH FCHLCA+CQE RE+R +
Sbjct: 142 -----------DFVTHFFCHLCAICQEYREIREQ 164



>gb:AB026658_1517369 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MYF24.>gb:AY065153_1566307 Arabidopsis
           thaliana unknown protein (At3g18480; MYF24.19) mRNA,
           complete cds.>gb:AY081605_1568865 Arabidopsis thaliana
           unknown protein (At3g18480) mRNA, complete cds.
          Length = 133

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 51/168 (30%), Positives = 60/168 (35%), Gaps = 2/168 (1%)
 Frame = -1

Query: 708 QWDSGLCACLGRNDEFCSSDLEVCLLGSLAPCVLYGTNVERIGSSPGAFANHCLPYTGLY 529
           QW SGL +C+         D E   L    PCV +G  +  I          C  + GL 
Sbjct: 4   QWTSGLFSCM--------EDSETACLTCFCPCVTFG-RIADISDEGRTGCGRCGVFYGLI 54

Query: 528 LIGNSFFGWNCLAPWFSYPSRTAIRRKFNLEGSCEALTRSCGCGGSFVEDDLQREQCESA 349
                  G  CL   FS   RT IR KF L  S                           
Sbjct: 55  CC---VVGLPCL---FSCTYRTKIRSKFGLPES-------------------------PT 83

Query: 348 CDLGTHVFCHLCALCQEAREVRRR--LPHPGFNAQPVLVMIPPGEQTM 211
            D  TH FC  CALCQE RE++ R   P  G++      M PP  Q M
Sbjct: 84  SDCVTHFFCECCALCQEHRELKTRGLDPSIGWSGNMQRTMAPPMSQQM 131



>gb:AB026658_1517367 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MYF24.>gb:BT010855_1640801 Arabidopsis
           thaliana At3g18450 mRNA, complete
           cds.>gb:BT011321_1641071 Arabidopsis thaliana At3g18450
           gene, complete cds.
          Length = 184

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 56/196 (28%), Positives = 75/196 (38%), Gaps = 12/196 (6%)
 Frame = -1

Query: 759 GLPLRYSVTGEPVAARAQWDSGLCACLGRNDEFCSSDLEVCLLGSLAPCVLYGTNVERIG 580
           G+P+ Y  T      + QW S L  C+        +D E  ++  +APCV +G   E + 
Sbjct: 40  GIPVNYQQT------QNQWSSQLFDCM--------NDSENAVITLIAPCVTFGQIAEIVD 85

Query: 579 SSPGAFANHCLPYTGLYLIGNSFFGWNCLAPWFSYPSRTAIRRKFNLEGSCEALTRSCGC 400
                 A   L Y  L+  G SF         +SY  R  IR+KF L  +          
Sbjct: 86  EGATPCATAGLLYGALFFTGASFV--------YSYMFRARIRKKFGLPDA---------- 127

Query: 399 GGSFVEDDLQREQCESACDLGTHVFCHLCALCQEAREVRRRLPHPGFN-----------A 253
                           A D  TH+ C   ALCQE RE    L H GF+           A
Sbjct: 128 ---------------PAPDWITHLVCMPFALCQEYRE----LKHHGFDPILGWAGNVQQA 168

Query: 252 QPVLVMIPP-GEQTMG 208
           Q   +M PP G++ MG
Sbjct: 169 QQQEMMTPPTGQRMMG 184



>gb:AB026658_1517368 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MYF24.
          Length = 184

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 51/184 (27%), Positives = 70/184 (38%), Gaps = 8/184 (4%)
 Frame = -1

Query: 735 TGEPVAARAQ--WDSGLCACLGRNDEFCSSDLEVCLLGSLAPCVLYGTNVERIGSSPGAF 562
           TG PV  + Q  W S L  C+        +D E  ++  LAPCV  G   E +       
Sbjct: 42  TGRPVNNQTQNLWSSDLFDCM--------NDSENAVITCLAPCVTLGQIAEIVDEGATPC 93

Query: 561 ANHCLPYTGLYLIGNSFFGWNCLAPWFSYPSRTAIRRKFNLEGSCEALTRSCGCGGSFVE 382
           A   L Y  ++ IG  F         +S   R  +R K+ L  +                
Sbjct: 94  ATGGLLYGMIFFIGVPFV--------YSCMFRAKMRNKYGLPDA---------------- 129

Query: 381 DDLQREQCESACDLGTHVFCHLCALCQEAREVRRRLPHPGF------NAQPVLVMIPPGE 220
                     A D  TH+FC  CALCQE RE++ R   P         AQ  ++  P G+
Sbjct: 130 ---------PAPDWITHLFCEHCALCQEYRELKHRGFDPNIGWAGNVQAQQPVMSPPTGQ 180

Query: 219 QTMG 208
           + MG
Sbjct: 181 RMMG 184



>gb:AY097182_1576324 Lycopersicon cheesmanii LA483 fw2.2 gene,
           complete cds; and ORF44 gene, complete sequence.
          Length = 163

 Score = 50.1 bits (118), Expect = 7e-05
 Identities = 41/150 (27%), Positives = 55/150 (36%)
 Frame = -1

Query: 726 PVAARAQWDSGLCACLGRNDEFCSSDLEVCLLGSLAPCVLYGTNVERIGSSPGAFANHCL 547
           P    A+W +GLC C          D   CL+ S+ PC+ +G   E +          C 
Sbjct: 25  PGTTTARWSTGLCHCF--------DDPANCLVTSVCPCITFGQISEILNKG----TTSCG 72

Query: 546 PYTGLYLIGNSFFGWNCLAPWFSYPSRTAIRRKFNLEGSCEALTRSCGCGGSFVEDDLQR 367
               LY          CL      PS  +   +F + G                + DL+ 
Sbjct: 73  SRGALY----------CLLGLTGLPSLYSCFYRFKMRG----------------QYDLEE 106

Query: 366 EQCESACDLGTHVFCHLCALCQEAREVRRR 277
             C    D   HVFC  CALCQE RE++ R
Sbjct: 107 APC---VDCLVHVFCEPCALCQEYRELKNR 133



>gb:AF261775_1781561 Lycopersicon pennellii ORFX (ORFX) gene,
           complete cds.
          Length = 163

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 41/151 (27%), Positives = 59/151 (39%), Gaps = 1/151 (0%)
 Frame = -1

Query: 726 PVAARAQWDSGLCACLGRNDEFCSSDLEVCLLGSLAPCVLYGTNVERIGSSPGAFANHCL 547
           P    A+W +GLC C          D   CL+ S+ PC+ +G   E +     +  +   
Sbjct: 25  PGTTTARWSTGLCHCF--------DDPANCLVTSVCPCITFGQISEILNKGTTSCGSRGA 76

Query: 546 PYTGLYLIGNSFFGWNCLAPWFSYPSRTAIRRKFNLEGSCEALTRSCGCGGSFVEDDLQR 367
            Y  L L G        L   +S   R+ +R +++LE                       
Sbjct: 77  LYCLLGLTG--------LPSLYSCFYRSKMRGQYDLE----------------------- 105

Query: 366 EQCESAC-DLGTHVFCHLCALCQEAREVRRR 277
              E+ C D   HVFC  CALCQE RE++ R
Sbjct: 106 ---EAPCVDCLVHVFCEPCALCQEYRELKNR 133



>gb:AY097189_1576331 Lycopersicon pennellii LA716 fw2.2 gene,
           complete cds; and ORF44 gene, complete sequence.
          Length = 163

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 41/151 (27%), Positives = 59/151 (39%), Gaps = 1/151 (0%)
 Frame = -1

Query: 726 PVAARAQWDSGLCACLGRNDEFCSSDLEVCLLGSLAPCVLYGTNVERIGSSPGAFANHCL 547
           P    A+W +GLC C          D   CL+ S+ PC+ +G   E +     +  +   
Sbjct: 25  PGTTTARWSTGLCHCF--------DDPANCLVTSVCPCITFGQISEILNKGTTSCGSRGA 76

Query: 546 PYTGLYLIGNSFFGWNCLAPWFSYPSRTAIRRKFNLEGSCEALTRSCGCGGSFVEDDLQR 367
            Y  L L G        L   +S   R+ +R +++LE                       
Sbjct: 77  LYCLLGLTG--------LPSLYSCFYRSKMRGQYDLE----------------------- 105

Query: 366 EQCESAC-DLGTHVFCHLCALCQEAREVRRR 277
              E+ C D   HVFC  CALCQE RE++ R
Sbjct: 106 ---EAPCVDCLVHVFCEPCALCQEYRELKNR 133



>gb:AY097183_1576325 Lycopersicon pimpinellifolium LA369 fw2.2 gene,
           complete cds; and ORF44 gene, complete
           sequence.>gb:AY097184_1576326 Lycopersicon
           pimpinellifolium LA1589 fw2.2 gene, complete cds; and
           ORF44 gene, complete sequence.>gb:AY097185_1576327
           Lycopersicon pimpinellifolium LA1601 fw2.2 gene,
           complete cds; and ORF44 gene, complete
           sequence.>gb:AY097186_1576328 Lycopersicon parviflorum
           LA2133 fw2.2 gene, complete cds; and ORF44 gene,
           complete sequence.>gb:AY097187_1576329 Lycopersicon
           peruvianum LA1701 fw2.2 gene, complete cds; and ORF44
           gene, complete sequence.>gb:AY097188_1576330
           Lycopersicon hirsutum LA1777 fw2.2 gene, complete cds;
           and ORF44 gene, complete sequence.
          Length = 163

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 41/151 (27%), Positives = 59/151 (39%), Gaps = 1/151 (0%)
 Frame = -1

Query: 726 PVAARAQWDSGLCACLGRNDEFCSSDLEVCLLGSLAPCVLYGTNVERIGSSPGAFANHCL 547
           P    A+W +GLC C          D   CL+ S+ PC+ +G   E +     +  +   
Sbjct: 25  PGTTTARWSTGLCHCF--------DDPANCLVTSVCPCITFGQISEILNKGTTSCGSRGA 76

Query: 546 PYTGLYLIGNSFFGWNCLAPWFSYPSRTAIRRKFNLEGSCEALTRSCGCGGSFVEDDLQR 367
            Y  L L G        L   +S   R+ +R +++LE                       
Sbjct: 77  LYCLLGLTG--------LPSLYSCFYRSKMRGQYDLE----------------------- 105

Query: 366 EQCESAC-DLGTHVFCHLCALCQEAREVRRR 277
              E+ C D   HVFC  CALCQE RE++ R
Sbjct: 106 ---EAPCVDCLVHVFCEPCALCQEYRELKNR 133



>gb:AY097178_1576320 Lycopersicon esculentum M82 fw2.2 gene,
           complete cds; and ORF44 gene, complete
           sequence.>gb:AY097179_1576321 Lycopersicon esculentum
           TA496 fw2.2 gene, complete cds; and ORF44 gene, complete
           sequence.>gb:AY097180_1576322 Lycopersicon esculentum
           TA1496 fw2.2 gene, complete cds; and ORF44 gene,
           complete sequence.>gb:AY097181_1576323 Lycopersicon
           esculentum TA1210 fw2.2 gene, complete cds; and ORF44
           gene, complete sequence.>gb:AF261774_1781560
           Lycopersicon esculentum ORFX (ORFX) gene, complete cds.
          Length = 163

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 41/151 (27%), Positives = 59/151 (39%), Gaps = 1/151 (0%)
 Frame = -1

Query: 726 PVAARAQWDSGLCACLGRNDEFCSSDLEVCLLGSLAPCVLYGTNVERIGSSPGAFANHCL 547
           P    A+W +GLC C          D   CL+ S+ PC+ +G   E +     +  +   
Sbjct: 25  PGTTTARWSTGLCHCF--------DDPANCLVTSVCPCITFGQISEILNKGTTSCGSRGA 76

Query: 546 PYTGLYLIGNSFFGWNCLAPWFSYPSRTAIRRKFNLEGSCEALTRSCGCGGSFVEDDLQR 367
            Y  L L G        L   +S   R+ +R +++LE                       
Sbjct: 77  LYCLLGLTG--------LPSLYSCFYRSKMRGQYDLE----------------------- 105

Query: 366 EQCESAC-DLGTHVFCHLCALCQEAREVRRR 277
              E+ C D   HVFC  CALCQE RE++ R
Sbjct: 106 ---EAPCVDCLVHVFCEPCALCQEYRELKNR 133



>gb:AF327424_1786793 Arabidopsis thaliana unknown protein
           (At2g45010) mRNA, partial cds.
          Length = 238

 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 43/156 (27%), Positives = 60/156 (38%), Gaps = 6/156 (3%)
 Frame = -1

Query: 660 CSSDLEVCLLGSLAPCVLYGTNVERIGSSPGAFANHCLPYTGLYLIGNSFFGWNCLAPWF 481
           C+ D E C  G   PCVL+G N+E +      +   C+ +      G +      L   +
Sbjct: 69  CAEDPESCRTGLFCPCVLFGRNIEAVREEI-PWTQPCVCHAVCVEGGMALAAVTALFSGY 127

Query: 480 SYPSRTAIRRKFNLEGSCEALTRS---CGCGGSFVEDDLQREQ--CESACD-LGTHVFCH 319
             P  T +         CE L  +   CG        +LQ++     + CD    H   H
Sbjct: 128 IDPQTTVV--------ICEGLFFAWWMCGIYSGLFRQELQKKYHLKNAPCDHCMVHCCLH 179

Query: 318 LCALCQEAREVRRRLPHPGFNAQPVLVMIPPGEQTM 211
            CALCQE RE++  L      A     M PP  Q M
Sbjct: 180 WCALCQEHREMKNHLSDT--EASSSTTMDPPPVQEM 213



>pir|E84885|E84885 hypothetical protein At2g45010 [imported] -
           Arabidopsis thaliana>gb:AC007659_1536058 Arabidopsis
           thaliana chromosome II section 241 of 255 of the
           complete sequence. Sequence from clones T13E15,
           T14P1.>gb:AY087375_1572407 Arabidopsis thaliana clone
           34688 mRNA, complete sequence.>gb:AY120733_1579615
           Arabidopsis thaliana unknown protein (At2g45010) mRNA,
           complete cds.>gb:BT000360_1634638 Arabidopsis thaliana
           unknown protein (At2g45010) mRNA, complete
           cds.>gb:BT000899_1635154 Arabidopsis thaliana clone
           C105033 unknown protein (At2g45010) mRNA, complete
           cds.>gb:AK118360_1816343 Arabidopsis thaliana At2g45010
           mRNA for unknown protein, complete cds, clone:
           RAFL19-63-A04.
          Length = 244

 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 43/156 (27%), Positives = 60/156 (38%), Gaps = 6/156 (3%)
 Frame = -1

Query: 660 CSSDLEVCLLGSLAPCVLYGTNVERIGSSPGAFANHCLPYTGLYLIGNSFFGWNCLAPWF 481
           C+ D E C  G   PCVL+G N+E +      +   C+ +      G +      L   +
Sbjct: 69  CAEDPESCRTGLFCPCVLFGRNIEAVREEI-PWTQPCVCHAVCVEGGMALAAVTALFSGY 127

Query: 480 SYPSRTAIRRKFNLEGSCEALTRS---CGCGGSFVEDDLQREQ--CESACD-LGTHVFCH 319
             P  T +         CE L  +   CG        +LQ++     + CD    H   H
Sbjct: 128 IDPQTTVV--------ICEGLFFAWWMCGIYSGLFRQELQKKYHLKNAPCDHCMVHCCLH 179

Query: 318 LCALCQEAREVRRRLPHPGFNAQPVLVMIPPGEQTM 211
            CALCQE RE++  L      A     M PP  Q M
Sbjct: 180 WCALCQEHREMKNHLSDT--EASSSTTMDPPPVQEM 213



>gb:AF049928_1764127 Petunia x hybrida PGPS/D12 (PGPS/D12) mRNA,
           complete cds.
          Length = 145

 Score = 47.4 bits (111), Expect = 5e-04
 Identities = 37/144 (25%), Positives = 56/144 (38%), Gaps = 1/144 (0%)
 Frame = -1

Query: 705 WDSGLCACLGRNDEFCSSDLEVCLLGSLAPCVLYGTNVERIGSSPGAFANHCLPYTGLYL 526
           W SG+C C          D++ C L    PC+ +G   E       +       Y  +YL
Sbjct: 9   WSSGICDCF--------QDVKGCCLTCWCPCITFGRIAEVADQGSTSCVVSGTVYLLVYL 60

Query: 525 IGNSFFGWNCLAPWFSYPSRTAIRRKFNLEGSCEALTRSCGCGGSFVEDDLQREQCESAC 346
           + +   G+ C   W+S   R+ +R ++ L+                          E  C
Sbjct: 61  VTS---GFGCC--WYSCFYRSKLRNQYYLD--------------------------EKPC 89

Query: 345 -DLGTHVFCHLCALCQEAREVRRR 277
            DL TH  C  CALCQE RE++ +
Sbjct: 90  SDLCTHCCCEYCALCQEYRELQNQ 113



>gb:AY485643_1608489 Hordeum vulgare subsp. vulgare BAC 615K1,
           complete sequence.
          Length = 251

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 47/154 (30%), Positives = 60/154 (38%), Gaps = 4/154 (2%)
 Frame = -1

Query: 660 CSSDLEVCLLGSLAPCVLYGTNVERIGSSPGAFANHCLPYTGLYLIGNSFF-GWNCLAPW 484
           C+ D E C  G   PCVL+G NVE +           +P+T   +    F  G   LA  
Sbjct: 69  CTDDPESCRTGLFCPCVLFGRNVEALRED--------IPWTTPCVCHAIFVEGGITLAIL 120

Query: 483 FSYPSRTAIRRKFNLEGSCEALTRSCGCGGSFVEDDLQREQC--ESACD-LGTHVFCHLC 313
            +       R  F +          CG        +LQ+      S CD    H   H C
Sbjct: 121 TAIFHGVDPRSSFLIGEGLVFSWWLCGTYTGIFRQELQKRYHLKNSPCDPCMAHCCLHWC 180

Query: 312 ALCQEAREVRRRLPHPGFNAQPVLVMIPPGEQTM 211
           A CQE RE R RL     +A P+ V+ PP  Q M
Sbjct: 181 ANCQEHRERRGRL--ADHSAVPMTVVNPPPVQEM 212



>gb:AE016959_1023820 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC079874_1732929
           Oryza sativa chromosome 10 BAC OSJNBa0042H09 genomic
           sequence, complete sequence.>gb:AE017119_1753639 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           73 of 77 of the complete sequence.
          Length = 235

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 48/188 (25%), Positives = 68/188 (36%), Gaps = 23/188 (12%)
 Frame = -1

Query: 705 WDSGLCACLGRNDEFCSSDLEVCLLGSLAPCVLYGTNVERI-----GSSPGAFANHCL-- 547
           W +G+C C        + D E C  GS  PCVL+G NVE +      ++P      C+  
Sbjct: 69  WTTGICGC--------AEDTESCWTGSFFPCVLFGHNVEALREDIPWTTPCTCHAVCVEG 120

Query: 546 ---------------PYTGLYLIGNSFFGWNCLAPWFSYPSRTAIRRKFNLEGSCEALTR 412
                          P T + +     F W   A +     R  ++RK++L+        
Sbjct: 121 GIALAILTVIFPGIDPSTSILIGEGLVFSWWLFATYTGI-FRQQLQRKYHLK-------- 171

Query: 411 SCGCGGSFVEDDLQREQCESACD-LGTHVFCHLCALCQEAREVRRRLPHPGFNAQPVLVM 235
                             +S CD    H   H CA CQE RE + RL     NA    ++
Sbjct: 172 ------------------DSPCDPCLVHCCLHWCANCQEHRERKGRLADN--NANRNTIV 211

Query: 234 IPPGEQTM 211
            PP  Q M
Sbjct: 212 NPPPMQEM 219



>gb:AY485644_1608494 Triticum monococcum phosphatidylserine
           decarboxylase, ZCCT2, ZCCT1, and SNF2P genes, complete
           cds; nucellin pseudogene, complete sequence; putative
           transposase, phosphatidylinositol phosphatidylcholine
           transfer protein sec14 cytosolic-like protein, and
           phytochrome P450-like protein genes, complete cds; and
           unknown genes.>gb:AY572536S2_1615739 Triticum monococcum
           cultivar PI355532 unknown gene, exons 3, 4, and complete
           cds.>gb:AY572542S2_1615740 Triticum monococcum cultivar
           PI277133 unknown gene, exons 3, 4, and complete cds.
          Length = 254

 Score = 44.3 bits (103), Expect = 0.004
 Identities = 46/154 (29%), Positives = 59/154 (38%), Gaps = 4/154 (2%)
 Frame = -1

Query: 660 CSSDLEVCLLGSLAPCVLYGTNVERIGSSPGAFANHCLPYTGLYLIGNSFF-GWNCLAPW 484
           C+ D E C  G   PCVL+G NVE +           +P+T   +    F  G   LA  
Sbjct: 69  CTDDPESCRTGLFCPCVLFGRNVEALRED--------IPWTTPCVCHAIFVEGGITLAIL 120

Query: 483 FSYPSRTAIRRKFNLEGSCEALTRSCGCGGSFVEDDLQREQC--ESACD-LGTHVFCHLC 313
            +       R  F +          CG        +LQ+      S CD    H   H C
Sbjct: 121 TAIFHGVDPRSSFLIGEGLVFSWWLCGTYTGIFRQELQKRYHLKNSPCDPCMAHCCLHWC 180

Query: 312 ALCQEAREVRRRLPHPGFNAQPVLVMIPPGEQTM 211
           A CQE RE R  L     +A P+ V+ PP  Q M
Sbjct: 181 ANCQEHRERRGHL--ADHSAMPMTVVNPPPVQEM 212



>gb:AP003575_1831134 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0528B02.>gb:AP005382_1850711 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OJ1001_B06.
          Length = 135

 Score = 43.9 bits (102), Expect = 0.005
 Identities = 34/135 (25%), Positives = 50/135 (37%)
 Frame = -1

Query: 660 CSSDLEVCLLGSLAPCVLYGTNVERIGSSPGAFANHCLPYTGLYLIGNSFFGWNCLAPWF 481
           C  D   C L    PC+ +G   E +     +   H   Y  L  IG  +         +
Sbjct: 12  CFGDSGTCCLTCWCPCITFGRIAEIVDKGSTSCCMHGTLYVLLATIGCQWL--------Y 63

Query: 480 SYPSRTAIRRKFNLEGSCEALTRSCGCGGSFVEDDLQREQCESACDLGTHVFCHLCALCQ 301
           +   R+++R ++NL                      Q+  C   C    H FC  CALCQ
Sbjct: 64  ACTKRSSMRAQYNL----------------------QQSPCLDCC---VHFFCDSCALCQ 98

Query: 300 EAREVRRRLPHPGFN 256
           E +E+ +R    GFN
Sbjct: 99  EYKELEKR----GFN 109



>gb:AC133339_1741402 Oryza sativa chromosome 3 BAC OSJNBa0078D06
           genomic sequence, complete sequence.>gb:AC133778_1741496
           Oryza sativa chromosome 3 BAC OSJNBb0027B08 genomic
           sequence, complete sequence.
          Length = 150

 Score = 42.7 bits (99), Expect = 0.011
 Identities = 42/159 (26%), Positives = 57/159 (35%)
 Frame = -1

Query: 753 PLRYSVTGEPVAARAQWDSGLCACLGRNDEFCSSDLEVCLLGSLAPCVLYGTNVERIGSS 574
           P    VTG PV + A W +GLC C          D  +C L    PC+ +G   E +   
Sbjct: 4   PSAAPVTGVPVGSAA-WSTGLCDCF--------DDCGLCCLTCWCPCITFGRVAEMVDRG 54

Query: 573 PGAFANHCLPYTGLYLIGNSFFGWNCLAPWFSYPSRTAIRRKFNLEGSCEALTRSCGCGG 394
               +  C     LY +  +F G   +   +S   R  +R ++ L           GC  
Sbjct: 55  ----STSCGTGGALYGLLCAFTGCQWI---YSCTYRGKMRTQYGLA--------EAGCA- 98

Query: 393 SFVEDDLQREQCESACDLGTHVFCHLCALCQEAREVRRR 277
                           D   H  C  CALCQE RE+  R
Sbjct: 99  ----------------DCCVHFCCEPCALCQEYRELVAR 121



>gb:AC133339_1741399 Oryza sativa chromosome 3 BAC OSJNBa0078D06
           genomic sequence, complete sequence.>gb:AC133778_1741499
           Oryza sativa chromosome 3 BAC OSJNBb0027B08 genomic
           sequence, complete sequence.
          Length = 136

 Score = 42.7 bits (99), Expect = 0.011
 Identities = 37/142 (26%), Positives = 53/142 (37%), Gaps = 1/142 (0%)
 Frame = -1

Query: 705 WDSGLCACLGRNDEFCSSDLEVCLLGSLAPCVLYGTNVERIGSSPGAFANHCLPYTGLYL 526
           W SGL AC         +D EVC L ++ PC+ +G + E +          C     + +
Sbjct: 9   WSSGLFACF--------NDCEVCCLTTVCPCITFGRSAEIVSRG----ERTCCAAGVMCV 56

Query: 525 IGNSFFGWNCLAPWFSYPSRTAIRRKFNL-EGSCEALTRSCGCGGSFVEDDLQREQCESA 349
           +   F   +CL   +S   R  +R  F+L E  C                          
Sbjct: 57  LLGFFAHCHCL---YSCCYRGKMRDSFHLPEDPC-------------------------- 87

Query: 348 CDLGTHVFCHLCALCQEAREVR 283
           CD   H  C  CALCQE R ++
Sbjct: 88  CDCCVHALCLQCALCQEYRHLK 109



>gb:AP006161_1861110 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:B1267B06.
          Length = 162

 Score = 40.8 bits (94), Expect = 0.042
 Identities = 41/162 (25%), Positives = 62/162 (38%), Gaps = 1/162 (0%)
 Frame = -1

Query: 759 GLPLRYSVTGE-PVAARAQWDSGLCACLGRNDEFCSSDLEVCLLGSLAPCVLYGTNVERI 583
           G+   +++ G+ P+AA   W +GL  C          D   C +  L PC+ +G   E I
Sbjct: 11  GVTTAFAMQGKVPLAA---WSTGLFNCF--------DDCGNCCVTCLCPCITFGQIAEII 59

Query: 582 GSSPGAFANHCLPYTGLYLIGNSFFGWNCLAPWFSYPSRTAIRRKFNLEGSCEALTRSCG 403
                  ++ C     LY +     G NC+   F    R  +R ++ L            
Sbjct: 60  DRG----SSSCGTSGALYALVMLLTGCNCVYSCFY---RAKMRSQYGL------------ 100

Query: 402 CGGSFVEDDLQREQCESACDLGTHVFCHLCALCQEAREVRRR 277
                     Q + C    D   H FC  CAL QE RE+++R
Sbjct: 101 ----------QEKPC---ADCPVHFFCEPCALSQEYRELKKR 129



>pir|G96527|G96527 protein F27J15.18 [imported] - Arabidopsis
           thaliana>gb:AE005173_892845 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC016041_1538081 Genomic sequence for
           Arabidopsis thaliana BAC F27J15 from chromosome I,
           complete sequence.>gb:BT010928_1640874 Arabidopsis
           thaliana At1g49030 gene, complete
           cds.>gb:BT011646_1641168 Arabidopsis thaliana At1g49030
           mRNA, complete cds.
          Length = 224

 Score = 40.8 bits (94), Expect = 0.042
 Identities = 50/193 (25%), Positives = 68/193 (35%), Gaps = 11/193 (5%)
 Frame = -1

Query: 753 PLRYSVTGEPVAARAQWDSGLCACLGRNDEFCSSDLEVCLLGSLAPCVLYGTNVERIGSS 574
           P   S+ G      + W SGL  C+        +D E  L+    P V +G   E I   
Sbjct: 72  PYGVSMAGPVHTQPSNWTSGLFDCM--------NDGENALITCCFPFVTFGQIAEVIDEG 123

Query: 573 PGAFANHCLPYTGLYLIGNSFFGWNCLAPWFSYPSRTAIRRKFNLEGSCEALTRSCGCGG 394
               A  C     LY +    F   C+   ++   RT +R K+ L  +            
Sbjct: 124 ----ATSCGTAGMLYGLICCLFAIPCV---YTCTFRTKLRSKYGLPDA------------ 164

Query: 393 SFVEDDLQREQCESACDLGTHVFCHLCALCQEAREVRRRLPHPGFN----------AQPV 244
                         A D  TH FC  CALCQE RE++ R   P              Q  
Sbjct: 165 -------------PAPDWITHCFCEYCALCQEYRELKNRGLDPSIGWIGNVQKQRMGQQQ 211

Query: 243 LVMIPP-GEQTMG 208
            +M PP G++ MG
Sbjct: 212 EMMAPPMGQRMMG 224



>gb:AP006161_1861112 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:B1267B06.
          Length = 145

 Score = 39.3 bits (90), Expect = 0.12
 Identities = 31/129 (24%), Positives = 52/129 (40%), Gaps = 1/129 (0%)
 Frame = -1

Query: 660 CSSDLEVCLLGSLAPCVLYGTNVERIGSSPGAFANHCLPYTGLYLIGNSFFGWNCLAPWF 481
           C  D   C +  L PC+ +G   E +       ++ C     LY +     G +C+   +
Sbjct: 17  CFDDSSNCFMTWLCPCITFGQIAEIVDRG----SSSCGTSGSLYALVFLVTGCSCI---Y 69

Query: 480 SYPSRTAIRRKFNLEGSCEALTRSCGCGGSFVEDDLQREQCESAC-DLGTHVFCHLCALC 304
           S   R+ +R ++ L+                          E+ C D   H++C  CALC
Sbjct: 70  SCIYRSKLRSQYGLQ--------------------------ETPCPDCLVHLWCEPCALC 103

Query: 303 QEAREVRRR 277
           QE RE+++R
Sbjct: 104 QEYRELKKR 112



>gb:AY085704_1570771 Arabidopsis thaliana clone 17208 mRNA, complete
           sequence.
          Length = 241

 Score = 39.3 bits (90), Expect = 0.12
 Identities = 39/153 (25%), Positives = 61/153 (39%), Gaps = 3/153 (1%)
 Frame = -1

Query: 660 CSSDLEVCLLGSLAPCVLYGTNVERIGSSPGAFANHCLPYTGLYLIGNSFFGWNCLAPWF 481
           C+ D+    LG   P VL+G   E +     ++   C+ ++   ++       + LA   
Sbjct: 69  CTEDMNSFWLGLFCPSVLFGRVYETLSDEETSWKKACICHS--IVVEGGLTAASMLACVP 126

Query: 480 SYPSRTAIRRKFNLEGSCEALTRSCGCGGSFVEDDLQREQC--ESACD-LGTHVFCHLCA 310
                T+    F +      +   CG     V   LQR+     + CD    H   H CA
Sbjct: 127 GIDPHTS----FLIWEGLLFVWWMCGIYTGNVRQTLQRKYHLQNAPCDPCMVHCCLHFCA 182

Query: 309 LCQEAREVRRRLPHPGFNAQPVLVMIPPGEQTM 211
           +CQE RE++ RL        P+ V+ PP  Q M
Sbjct: 183 VCQEHREIKNRLSDN--FVMPMTVINPPPVQEM 213



>pir|E96710|E96710 hypothetical protein F24J5.15 [imported] -
           Arabidopsis thaliana>gb:AE005173_894482 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:F24J5_1678005 Arabidopsis thaliana
           chromosome 1 BAC F24J5 sequence, complete sequence.
          Length = 160

 Score = 39.3 bits (90), Expect = 0.12
 Identities = 36/141 (25%), Positives = 52/141 (36%)
 Frame = -1

Query: 705 WDSGLCACLGRNDEFCSSDLEVCLLGSLAPCVLYGTNVERIGSSPGAFANHCLPYTGLYL 526
           W + LC C          D+  C L    PCV +G    RI       +  C     +Y+
Sbjct: 19  WSTDLCECW--------MDINSCCLTCWCPCVAFG----RIAEVVDRGSTSCGVSGAMYM 66

Query: 525 IGNSFFGWNCLAPWFSYPSRTAIRRKFNLEGSCEALTRSCGCGGSFVEDDLQREQCESAC 346
           I     G+   +  +S   RT +R ++NL+       R C                   C
Sbjct: 67  IIFMLTGYGG-SSLYSCFYRTKLRAQYNLK------ERPC-------------------C 100

Query: 345 DLGTHVFCHLCALCQEAREVR 283
           D   H  C  CALCQE R+++
Sbjct: 101 DCCVHFCCEPCALCQEYRQLQ 121



>gb:ATU78866_1557278 Arabidopsis thaliana putative
           arginine-aspartate-rich RNA binding protein (gene1500),
           (gene1000), and (gene400) genes, complete
           cds.>gb:ATU78870_1557283 Arabidopsis thaliana 27 kDa
           unknown protein mRNA, complete cds.>gb:AY054680_1563334
           Arabidopsis thaliana Unknown protein (At5g51400;
           MFG13.11) mRNA, complete cds.>gb:BT002573_1636176
           Arabidopsis thaliana Unknown protein (At5g51400) mRNA,
           complete cds.
          Length = 241

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 40/153 (26%), Positives = 60/153 (39%), Gaps = 3/153 (1%)
 Frame = -1

Query: 660 CSSDLEVCLLGSLAPCVLYGTNVERIGSSPGAFANHCLPYTGLYLIGNSFFGWNCLAPWF 481
           C+ D+    LG   P VL+G   E +     ++   C+ ++ +   G +        P  
Sbjct: 69  CTEDMNSFWLGLFCPSVLFGRVYETLSDEETSWKKACICHSIVVEGGLTAASMLACVPGI 128

Query: 480 SYPSRTAIRRKFNLEGSCEALTRSCGCGGSFVEDDLQREQC--ESACD-LGTHVFCHLCA 310
              +   I      EG    +   CG     V   LQR+     + CD    H   H CA
Sbjct: 129 DPHTSLLI-----WEGLL-FVWWMCGIYTGNVRQTLQRKYHLQNAPCDPCMVHCCLHFCA 182

Query: 309 LCQEAREVRRRLPHPGFNAQPVLVMIPPGEQTM 211
           +CQE RE++ RL        P+ V+ PP  Q M
Sbjct: 183 VCQEHREMKNRLSDN--FVMPMTVINPPPVQEM 213



>gb:AB025621_1516432 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MFG13.
          Length = 240

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 40/153 (26%), Positives = 60/153 (39%), Gaps = 3/153 (1%)
 Frame = -1

Query: 660 CSSDLEVCLLGSLAPCVLYGTNVERIGSSPGAFANHCLPYTGLYLIGNSFFGWNCLAPWF 481
           C+ D+    LG   P VL+G   E +     ++   C+ ++ +   G +        P  
Sbjct: 68  CTEDMNSFWLGLFCPSVLFGRVYETLSDEETSWKKACICHSIVVEGGLTAASMLACVPGI 127

Query: 480 SYPSRTAIRRKFNLEGSCEALTRSCGCGGSFVEDDLQREQC--ESACD-LGTHVFCHLCA 310
              +   I      EG    +   CG     V   LQR+     + CD    H   H CA
Sbjct: 128 DPHTSLLI-----WEGLL-FVWWMCGIYTGNVRQTLQRKYHLQNAPCDPCMVHCCLHFCA 181

Query: 309 LCQEAREVRRRLPHPGFNAQPVLVMIPPGEQTM 211
           +CQE RE++ RL        P+ V+ PP  Q M
Sbjct: 182 VCQEHREMKNRLSDN--FVMPMTVINPPPVQEM 212



>gb:AE005172_890484 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC006917_1534687 Genomic sequence
           for Arabidopsis thaliana BAC F10B6 from chromosome I,
           complete sequence.>gb:AY072397_1567214 Arabidopsis
           thaliana unknown protein (At1g14870) mRNA, complete
           cds.>gb:AY114701_1578743 Arabidopsis thaliana unknown
           protein (At1g14870) mRNA, complete cds.
          Length = 152

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 32/147 (21%), Positives = 52/147 (35%)
 Frame = -1

Query: 717 ARAQWDSGLCACLGRNDEFCSSDLEVCLLGSLAPCVLYGTNVERIGSSPGAFANHCLPYT 538
           A  +W +G C C         SD + C +    PC+ +G   E +       +  C    
Sbjct: 12  AEGEWSTGFCDCF--------SDCKNCCITFWCPCITFGQVAEIVDRG----STSCGTAG 59

Query: 537 GLYLIGNSFFGWNCLAPWFSYPSRTAIRRKFNLEGSCEALTRSCGCGGSFVEDDLQREQC 358
            LY +     G  C+   F    R  +R ++N++G                         
Sbjct: 60  ALYALIAVVTGCACIYSCFY---RGKMRAQYNIKG------------------------- 91

Query: 357 ESACDLGTHVFCHLCALCQEAREVRRR 277
           +   D   H  C LC+L Q+ RE++ R
Sbjct: 92  DDCTDCLKHFCCELCSLTQQYRELKHR 118



>gb:AP004817_1845608 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0539D10.>gb:AP005002_1847087 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0486G03.
          Length = 181

 Score = 37.4 bits (85), Expect = 0.47
 Identities = 38/147 (25%), Positives = 56/147 (38%), Gaps = 3/147 (2%)
 Frame = -1

Query: 708 QWDSGLCACLGRNDEFCSSDLEVCLLGSLAPCVLYGTNVERI--GSSPGAFANHCLPYTG 535
           +W +GL  C+         D   CL+  + PC+ +G   + +  G+ P      CL    
Sbjct: 43  RWSTGLFHCM--------DDPGNCLITCVCPCITFGQVADIVDKGTCP------CLASGT 88

Query: 534 LYLIGNSFFGWNCLAPWFSYPSRTAIRRKFNL-EGSCEALTRSCGCGGSFVEDDLQREQC 358
            Y +     G  CL   +S   R+ +R +F+L EG C                       
Sbjct: 89  AYAL-LCASGMGCL---YSCFYRSKMRAQFDLDEGDCP---------------------- 122

Query: 357 ESACDLGTHVFCHLCALCQEAREVRRR 277
               D   H  C  CALCQE RE++ R
Sbjct: 123 ----DFLVHFCCEYCALCQEYRELKNR 145



>gb:AE005172_890486 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC006917_1534689 Genomic sequence
           for Arabidopsis thaliana BAC F10B6 from chromosome I,
           complete sequence.>gb:BT005663_1638603 Arabidopsis
           thaliana clone U51353 unknown protein (At1g14880) mRNA,
           complete cds.>gb:AK118861_1816817 Arabidopsis thaliana
           At1g14880 mRNA for unknown protein, complete cds, clone:
           RAFL21-19-D20.
          Length = 151

 Score = 37.4 bits (85), Expect = 0.47
 Identities = 33/147 (22%), Positives = 55/147 (37%)
 Frame = -1

Query: 717 ARAQWDSGLCACLGRNDEFCSSDLEVCLLGSLAPCVLYGTNVERIGSSPGAFANHCLPYT 538
           A+ +W +G C C         SD   C +    PC+ +G   E +       +  C    
Sbjct: 11  AQGEWSTGFCDCF--------SDCRNCCITLCCPCITFGQVAEIVDRG----SKSCCAAG 58

Query: 537 GLYLIGNSFFGWNCLAPWFSYPSRTAIRRKFNLEGSCEALTRSCGCGGSFVEDDLQREQC 358
            LY++ +       +   F Y  +  +R ++N++G         GC              
Sbjct: 59  ALYMLIDLITSCGRMYACF-YSGK--MRAQYNIKGD--------GC-------------- 93

Query: 357 ESACDLGTHVFCHLCALCQEAREVRRR 277
               D   H  C+LCAL Q+ RE++ R
Sbjct: 94  ---TDCLKHFCCNLCALTQQYRELKHR 117



>gb:AY084625_1569713 Arabidopsis thaliana clone 113571 mRNA,
           complete sequence.
          Length = 254

 Score = 37.0 bits (84), Expect = 0.61
 Identities = 37/157 (23%), Positives = 56/157 (35%), Gaps = 24/157 (15%)
 Frame = -1

Query: 660 CSSDLEVCLLGSLAPCVLYGTNVERIG-------------------SSPGAFA---NHCL 547
           C  D  +C+  +  PC  +G N+ R G                    +  AFA    HC 
Sbjct: 93  CFEDRHLCIESACCPCYRFGKNMTRTGFGSCFLQGAVHMILIAGFLFNVVAFAVTKRHCF 152

Query: 546 PYTGL--YLIGNSFFGWNCLAPWFSYPSRTAIRRKFNLEGSCEALTRSCGCGGSFVEDDL 373
            Y  +   L+  S+ G+           R  IRRKFN+ G+            SF++D +
Sbjct: 153 LYLAIAFVLLIGSYLGF----------FRMLIRRKFNIRGT-----------DSFLDDFI 191

Query: 372 QREQCESACDLGTHVFCHLCALCQEAREVRRRLPHPG 262
                        H+ C  C L QE++ +     H G
Sbjct: 192 H------------HLVCPFCTLTQESKTLEMNNVHDG 216



>pir|G96710|G96710 hypothetical protein F24J5.13 [imported] -
           Arabidopsis thaliana>gb:AE005173_894484 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:F24J5_1678003 Arabidopsis thaliana
           chromosome 1 BAC F24J5 sequence, complete sequence.
          Length = 174

 Score = 37.0 bits (84), Expect = 0.61
 Identities = 39/151 (25%), Positives = 58/151 (38%), Gaps = 4/151 (2%)
 Frame = -1

Query: 705 WDSGLCACLGRNDEFCSSD---LEV-CLLGSLAPCVLYGTNVERIGSSPGAFANHCLPYT 538
           W +GLC C   +   C+     L V CL+  L  C+       +     G   N      
Sbjct: 29  WTTGLCDC-HEDAHICTYQNVSLRVFCLIFLLVCCLKTKCKKSKHLDFGG---NAACMNA 84

Query: 537 GLYLIGNSFFGWNCLAPWFSYPSRTAIRRKFNLEGSCEALTRSCGCGGSFVEDDLQREQC 358
           GL  +   F G + L   +++P+R+ +R  F L                        E C
Sbjct: 85  GLIHLALGFIGCSWL---YAFPNRSRLREHFALP----------------------EEPC 119

Query: 357 ESACDLGTHVFCHLCALCQEAREVRRRLPHP 265
               D   H+FC  CA+CQE+RE++ R   P
Sbjct: 120 R---DFLVHLFCTPCAICQESRELKNRGADP 147



>gb:AP004001_1836189 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1115_D03.>gb:AP004168_1838490 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ1756_H07.
          Length = 152

 Score = 36.2 bits (82), Expect = 1.0
 Identities = 40/154 (25%), Positives = 51/154 (33%), Gaps = 5/154 (3%)
 Frame = -1

Query: 723 VAARAQWDSGLCACLGRNDE-FCSSD----LEVCLLGSLAPCVLYGTNVERIGSSPGAFA 559
           V A   W + LC C G   E FC S     L +  +G +                   F 
Sbjct: 19  VPAHQGWQTSLCDCFGDGCESFCLSAWFPWLSISCIGEIVD---------------QGFT 63

Query: 558 NHCLPYTGLYLIGNSFFGWNCLAPWFSYPSRTAIRRKFNLEGSCEALTRSCGCGGSFVED 379
             C     +YLI   F  W   A W+    R  +R ++ L  S                 
Sbjct: 64  EWCC-ICFIYLIAAYFGVWWAYAGWY----RGKLRAQYGLPES----------------- 101

Query: 378 DLQREQCESACDLGTHVFCHLCALCQEAREVRRR 277
                      D  TH+FCH CAL QE RE+  R
Sbjct: 102 --------PLPDCLTHLFCHWCALAQEHRELAAR 127



>pir|H87268|H87268 hypothetical protein CC0161 [imported] -
           Caulobacter crescentus>gb:AE005690_74178 Caulobacter
           crescentus CB15 section 16 of 359 of the complete
           genome.>gb:AE005673_921210 Caulobacter crescentus CB15
           complete genome.
          Length = 379

 Score = 36.2 bits (82), Expect = 1.0
 Identities = 25/67 (37%), Positives = 31/67 (46%), Gaps = 1/67 (1%)
 Frame = -1

Query: 765 ANGLPLRY-SVTGEPVAARAQWDSGLCACLGRNDEFCSSDLEVCLLGSLAPCVLYGTNVE 589
           ANG P RY +V G  VA    +  GL    G  DEF + D+E C +   AP   Y T + 
Sbjct: 204 ANGRPGRYPNVVGRSVADARWFQEGLRTATG--DEFVACDIERCAVLGDAPVATYATAIR 261

Query: 588 RIGSSPG 568
             G   G
Sbjct: 262 AGGEVTG 268



>gb:BC077771_2560425 Xenopus laevis hypothetical protein LOC445881,
           mRNA (cDNA clone IMAGE:4885186), partial cds.
          Length = 734

 Score = 35.4 bits (80), Expect = 1.8
 Identities = 47/168 (27%), Positives = 63/168 (37%), Gaps = 30/168 (17%)
 Frame = +3

Query: 426 RSSPPN*TCGEWRYG*DKRTREPGNSNQ---KTNSRSG----------INQCKASSDWRK 566
           RSS P      WR    +R R+  +S     KT SRS           I + + S   R+
Sbjct: 174 RSSSP------WRRSPVRRERKRSHSRSPRHKTKSRSPSPVIEKKEIVIPEPEPSIKGRE 227

Query: 567 PPGKNQFSQHWFRRAHKGPNFLTNK-------------LQDHCCRIHHSSPDKHRGRNPT 707
           P G+   S     +A K      NK              + H  + H  S  K + R+P+
Sbjct: 228 PSGQEATSTSDLLKAMKPEPVADNKESSPEPNTRKAKERERHRHKSHSRSKSKSKSRSPS 287

Query: 708 AP*PRRAHPSRCISTAGHWRSTP-SE*QPGVASP---CPPEPAEELGR 839
            P PRR H SR  S +   R +P     P   SP    PP P  +  R
Sbjct: 288 HPRPRRRHRSRSRSYSPRRRPSPRRRPSPRRRSPPRRLPPPPRHKRSR 335



>gb:OSJN00239_1697232 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0039G19, complete sequence.
          Length = 714

 Score = 35.4 bits (80), Expect = 1.8
 Identities = 26/88 (29%), Positives = 36/88 (40%), Gaps = 4/88 (4%)
 Frame = +3

Query: 483 TREPGNSNQKTNSRSGINQCKASSDWR---KPPGKNQFSQHWFRRAHKGPNFLTNKLQDH 653
           TR   N   +    +  N+  + +DWR   K   KN  S +            + + +DH
Sbjct: 102 TRRKSNIKPEKQKNNAYNKKPSIADWRRSVKYRSKNGCSDYHQPSLSVASAGSSRRSRDH 161

Query: 654 CCRIHHSSPDKHRGRNPTAP-*PRRAHP 734
             R  HS PD+HR R    P  PRR  P
Sbjct: 162 SERSVHSPPDRHRERQAEQPRSPRRRRP 189



>gb:BX294150_770569 Pirellula sp. strain 1 complete genome; segment
           18/24.
          Length = 834

 Score = 35.0 bits (79), Expect = 2.3
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 9/55 (16%)
 Frame = -2

Query: 512 FLVGIAWLPGSLILAV---------PPFAASSIWRGAARRLPDHVGVVGALWKMI 375
           FLVG AWLP +L+  V         P FA + +  G   +   HVG++  LW +I
Sbjct: 189 FLVGAAWLPFALLPLVHAKEYGWKLPSFALAMMVLGGDPQTALHVGIIAGLWLII 243



>gb:BX569693_776629 Synechococcus sp. WH8102 complete genome;
           segment 5/7.
          Length = 123

 Score = 34.7 bits (78), Expect = 3.0
 Identities = 15/48 (31%), Positives = 27/48 (56%)
 Frame = +2

Query: 611 TQGAKLPNKQTSRSLLQNSSFLPRQAQRPESHCALAATGSPVTLYLNG 754
           T+ ++LPN+ ++ +    ++ + RQ  R E HC+L A  +   L L G
Sbjct: 7   TKSSRLPNQPSAEAAANRAATIQRQLDRQELHCSLIALAAKAALILVG 54



>gb:BC038827_2098315 Mus musculus myeloid/lymphoid or mixed
           lineage-leukemia translocation to 6 homolog
           (Drosophila), mRNA (cDNA clone IMAGE:4481481), partial
           cds.
          Length = 291

 Score = 34.3 bits (77), Expect = 4.0
 Identities = 17/46 (36%), Positives = 22/46 (47%)
 Frame = +3

Query: 789 PGVASPCPPEPAEELGRPERLGSMSCSHFSPGLLVALAGEDSILQN 926
           PG  +P PP+P   LGR      +     + GLL  LAG  S+  N
Sbjct: 220 PGAPAPLPPQPQNGLGRAPGATGLGAMPMAEGLLGGLAGSGSLPLN 265



>gb:AY050217_2074557 Mus musculus MLLT6 (Mllt6) mRNA, complete cds.
          Length = 1079

 Score = 34.3 bits (77), Expect = 4.0
 Identities = 17/46 (36%), Positives = 22/46 (47%)
 Frame = +3

Query: 789 PGVASPCPPEPAEELGRPERLGSMSCSHFSPGLLVALAGEDSILQN 926
           PG  +P PP+P   LGR      +     + GLL  LAG  S+  N
Sbjct: 838 PGAPAPLPPQPQNGLGRAPGATGLGAMPMAEGLLGGLAGSGSLPLN 883



>gb:AE016996_374776 Chlamydophila caviae GPIC section 3 of 4 of the
           complete genome.>gb:AE015925_994455 Chlamydophila caviae
           GPIC complete genome.
          Length = 282

 Score = 33.9 bits (76), Expect = 5.2
 Identities = 35/119 (29%), Positives = 50/119 (42%), Gaps = 18/119 (15%)
 Frame = -2

Query: 512 FLVGIAWLPGSLILA---------VPPFAASSIWRGAARRLPD---HVGVVGALWKMIC- 372
           FL G+  L  +  LA         V   A+  +  G AR L D   H+ +VG     +C 
Sbjct: 14  FLTGLTLLSSTYALATTEENHPCVVLTGASGQLGSGIARYLHDKDYHLLLVGRQNSKLCA 73

Query: 371 ----NANSVNLLVTWELTSF-ATYAPCVRKLVKFVVGFPIPGSTPNPSWS*SLPENRQW 210
               N NS  L + + L  + A Y   +++L + + G  I  STP P WS  L     W
Sbjct: 74  LHQQNPNSSTLAIDYSLPGYLADYKNALKELNRPIHGLII--STPRPIWSGILQSPESW 130



>pir|A81463|T02853 hypothetical protein L1439.5 [imported] -
           Leishmania major  (strain Friedlin)>gb:AE001274_1208534
           Leishmania major chromosome 1, complete sequence.
          Length = 230

 Score = 33.9 bits (76), Expect = 5.2
 Identities = 41/147 (27%), Positives = 59/147 (40%), Gaps = 4/147 (2%)
 Frame = -1

Query: 714 RAQWDSGLCACLGRNDEFCSSDLEVCLLGSLAPCVLYGTNVERIGSSPGAFANHCLPYTG 535
           R  + SG+  C     E C+  L+ CL      C     +   +  + G +   C    G
Sbjct: 72  RHDFTSGILNC----HESCAVCLDACLC---MYCTASAHHNFLMNDTEGLYLPVCW---G 121

Query: 534 LYLIGNSFFGWNCLAP----WFSYPSRTAIRRKFNLEGSCEALTRSCGCGGSFVEDDLQR 367
           L+ +       +   P    + +Y  R+AIRR++NL  S  A   S   G S    D   
Sbjct: 122 LFCVDVGLSAVSSYLPSSLHFHTYFMRSAIRRRYNLH-SAGAPVNSNTHGSSSSGCDCTT 180

Query: 366 EQCESACDLGTHVFCHLCALCQEAREV 286
           E   S  DL T  FC  CA+ Q  RE+
Sbjct: 181 E---SMLDLLTVCFCLPCAIAQHQREI 204



>gb:BC007237_1970574 Homo sapiens myeloid/lymphoid or mixed-lineage
           leukemia (trithorax homolog, Drosophila); translocated
           to, 6, mRNA (cDNA clone IMAGE:2906020), complete cds.
          Length = 462

 Score = 33.5 bits (75), Expect = 6.8
 Identities = 16/46 (34%), Positives = 21/46 (45%)
 Frame = +3

Query: 789 PGVASPCPPEPAEELGRPERLGSMSCSHFSPGLLVALAGEDSILQN 926
           PG  +P PP+P   LGR      +     + GLL  LAG   +  N
Sbjct: 221 PGAPAPLPPQPQNGLGRAPGAAGLGAMPMAEGLLGGLAGSGGLPLN 266



>gb:AK027133_1910824 Homo sapiens cDNA: FLJ23480 fis, clone
           KAIA02915.
          Length = 462

 Score = 33.5 bits (75), Expect = 6.8
 Identities = 16/46 (34%), Positives = 21/46 (45%)
 Frame = +3

Query: 789 PGVASPCPPEPAEELGRPERLGSMSCSHFSPGLLVALAGEDSILQN 926
           PG  +P PP+P   LGR      +     + GLL  LAG   +  N
Sbjct: 221 PGAPAPLPPQPQNGLGRAPGAAGLGAMPMAEGLLGGLAGSGGLPLN 266



>gb:HSM801474_1186193 Homo sapiens mRNA; cDNA DKFZp434K0227 (from
           clone DKFZp434K0227).
          Length = 446

 Score = 33.5 bits (75), Expect = 6.8
 Identities = 16/46 (34%), Positives = 21/46 (45%)
 Frame = +3

Query: 789 PGVASPCPPEPAEELGRPERLGSMSCSHFSPGLLVALAGEDSILQN 926
           PG  +P PP+P   LGR      +     + GLL  LAG   +  N
Sbjct: 205 PGAPAPLPPQPQNGLGRAPGAAGLGAMPMAEGLLGGLAGSGGLPLN 250



>sp|P55198|AF17_HUMAN AF-17 protein.>pir|I38533|I38533 AF17 protein
           - human>gb:HSU07932_2021849 Human AF-17 mRNA, complete
           cds.
          Length = 1093

 Score = 33.5 bits (75), Expect = 6.8
 Identities = 16/46 (34%), Positives = 21/46 (45%)
 Frame = +3

Query: 789 PGVASPCPPEPAEELGRPERLGSMSCSHFSPGLLVALAGEDSILQN 926
           PG  +P PP+P   LGR      +     + GLL  LAG   +  N
Sbjct: 852 PGAPAPLPPQPQNGLGRAPGAAGLGAMPMAEGLLGGLAGSGGLPLN 897



>gb:AF140345_2056086 Rattus norvegicus N-methyl-D-aspartate
           receptor-like subunit mRNA, partial cds.
          Length = 712

 Score = 33.1 bits (74), Expect = 8.8
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 1/57 (1%)
 Frame = +3

Query: 720 RRAHPSRCISTAGHWRSTPSE*QPGVASPCPPEPAEELG-RPERLGSMSCSHFSPGL 887
           +R+   + +S +G WR+  SE +PG A   PP P   +  R  R G     H SP L
Sbjct: 657 KRSGSGKTLSVSGMWRNLQSECRPGRA---PPNPRSRVSFRMSRSGGSGDRHASPDL 710



>gb:AK124993_1915785 Homo sapiens cDNA FLJ43003 fis, clone
           BRTHA2013262.
          Length = 218

 Score = 33.1 bits (74), Expect = 8.8
 Identities = 23/80 (28%), Positives = 30/80 (37%), Gaps = 3/80 (3%)
 Frame = +3

Query: 606 RAHKGPNFLTNKLQDHCCRIHHSSPDKHRGRNPTAP*PRRAHPSRCISTAGHWRSTPSE* 785
           R  +G     N  ++ C R   S   +H  + P AP P          T GH R T    
Sbjct: 53  RGRRGRRKTRNGGRELCARDTGSETQQHSSKRPPAPRPVTPTAGAIHKTTGHPRCTRLSQ 112

Query: 786 QPGVASP---CPPEPAEELG 836
           +P    P   CPP  A  +G
Sbjct: 113 EPFCQRPQAGCPPHWAARVG 132



>gb:A23049_1448020 B. bovis mRNA for 12D3 antigen.
          Length = 346

 Score = 33.1 bits (74), Expect = 8.8
 Identities = 25/100 (25%), Positives = 39/100 (39%), Gaps = 3/100 (3%)
 Frame = -1

Query: 552 CLPYTGLYLIGNSFFGWNCLAPWFSYPSRTAIRRKFNLEGSCEALTRSCGCGGSFVEDDL 373
           C  Y+G Y I + F   +CL  +F  P +   R   + +  C +    C        + +
Sbjct: 94  CAMYSGCYTISDDFRACSCLPDYFGNPYKQCFRH-CDTDLDCPSPYAECRMDAG---ETI 149

Query: 372 QREQCESACDLGTHVFC---HLCALCQEAREVRRRLPHPG 262
           +R +C + C  G  V C    +C    E  E  RR    G
Sbjct: 150 KRCKCRAGCP-GDGVICKPDKICTDLAEDSEAHRRCLQTG 188



>gb:AK008843_1154813 Mus musculus adult male stomach cDNA, RIKEN
           full-length enriched library, clone:2210407G04
           product:nuclear factor of kappa light polypeptide gene
           enhancer in B-cells inhibitor, epsilon, full insert
           sequence.
          Length = 363

 Score = 33.1 bits (74), Expect = 8.8
 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 6/40 (15%)
 Frame = -1

Query: 366 EQCESACDLGTHVFCH------LCALCQEAREVRRRLPHP 265
           E C SACD   HV C        C L +E  E  R+L HP
Sbjct: 184 EFCRSACDTALHVACRRQNLACACCLLEEQPEPGRQLSHP 223


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,155,010,532
Number of Sequences: 1806583
Number of extensions: 26823395
Number of successful extensions: 77202
Number of sequences better than 10.0: 53
Number of HSP's better than 10.0 without gapping: 72356
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 77011
length of database: 581,917,975
effective HSP length: 125
effective length of database: 356,095,100
effective search space used: 73711685700
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)