BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10459
         (1442 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|A84649|A84649 probable glucose regulated repressor protein [...   404   e-111   Arabidopsis thaliana [mouse-ear cress]
gb:AY485830_1608507 Arabidopsis thaliana EIN3-binding F-box prot...   380   e-104   
pir|T08604|T08604 hypothetical protein GRR1 - soybean>gb:AF01991...   351   2e-95   Glycine max [soybeans]
gb:AP003629_1831741 Oryza sativa (japonica cultivar-group) genom...   337   3e-91   
gb:AP004869_1846301 Oryza sativa (japonica cultivar-group) genom...   331   2e-89   
gb:AP004869_1846300 Oryza sativa (japonica cultivar-group) genom...   331   2e-89   
gb:BC077969_2560613 Xenopus laevis MGC81000 protein, mRNA (cDNA ...   113   9e-24   
gb:AB007648_1510210 Arabidopsis thaliana genomic DNA, chromosome...   109   1e-22   
gb:L14745_1386893 Caenorhabditis elegans cosmid C02F5, complete ...   109   2e-22   
pir|S44609|S44609 hypothetical protein C02F5.7 - Caenorhabditis ...   109   2e-22   Caenorhabditis elegans [roundworm]
sp|P34284|YKK7_CAEEL|YKK7_CAEEL Hypothetical F-box/LRR-repeat protein C02F5...   109   2e-22   Caenorhabditis elegans [roundworm]
sp|Q96IG2|FL2L_HUMAN|FL2L_HUMAN F-box/LRR-repeat protein 2-like.>gb:BC00755...   109   2e-22   Homo sapiens [man]
gb:AK012109_1156775 Mus musculus 10 days embryo whole body cDNA,...   106   1e-21   
gb:AE013599_1131302 Drosophila melanogaster chromosome 2R, compl...   106   1e-21   
sp|Q9CZV8|FL2L_MOUSE|FL2L_MOUSE F-box/LRR-repeat protein 2-like.                 106   1e-21   Mus musculus [mouse]
gb:AY084229_1569322 Arabidopsis thaliana clone 100411 mRNA, comp...   106   1e-21   
gb:BC059683_2552655 Danio rerio F-box and leucine-rich repeat pr...   105   2e-21   
gb:AY056338_1563648 Arabidopsis thaliana putative F-box protein ...   105   2e-21   
gb:AF174589_1887907 Homo sapiens F-box protein Fbl2 (FBL2) mRNA,...   104   4e-21   
gb:AY091103_1574327 Arabidopsis thaliana putative F-box protein ...   104   4e-21   
gb:AF467462_2496360 Danio rerio PpaB (ppaB) mRNA, partial cds.        103   7e-21   
gb:BC021329_2093374 Mus musculus F-box and leucine-rich repeat p...   103   7e-21   
gb:BC006913_2090478 Mus musculus F-box and leucine-rich repeat p...   103   7e-21   
gb:AP004067_1837165 Oryza sativa (japonica cultivar-group) genom...   103   7e-21   
sp|Q8BID8|FXLE_MOUSE|FXLE_MOUSE F-box/LRR-repeat protein 14 (F-box and leuc...   103   7e-21   Mus musculus [mouse]
sp|Q8N1E6|FXLE_HUMAN|FXLE_HUMAN F-box/LRR-repeat protein 14 (F-box and leuc...   103   7e-21   Homo sapiens [man]
gb:BX649324_2567750 Zebrafish DNA sequence from clone DKEY-85M15...   103   1e-20   
gb:BT005940_1638862 Arabidopsis thaliana At5g27920 gene, complet...   103   1e-20   
sp|Q8BH16|FL2_MOUSE|FL2_MOUSE F-box/LRR-repeat protein 2 (F-box and leucin...   102   2e-20   Mus musculus [mouse]
gb:AK044693_1167082 Mus musculus adult retina cDNA, RIKEN full-l...   102   3e-20   
gb:BC077430_2560140 Xenopus laevis F-box leucine-rich repeat pro...   101   3e-20   
gb:AY463017_1607670 Musa acuminata putative F-box protein family...   101   4e-20   
gb:CR457121_1993328 Homo sapiens full open reading frame cDNA cl...   100   8e-20   
gb:AX876382_1476504 Sequence 11287 from Patent EP1074617.             100   8e-20   
gb:AE014297_1139799 Drosophila melanogaster chromosome 3R, compl...   100   8e-20   
gb:AF186273_1888623 Homo sapiens leucine-rich repeats containing...   100   1e-19   
gb:AF176518_1888019 Homo sapiens leucine-rich repeat-containing ...   100   1e-19   
gb:AX876746_1476674 Sequence 11651 from Patent EP1074617.>gb:AK0...   100   1e-19   
gb:CR861462_1185457 Pongo pygmaeus mRNA; cDNA DKFZp459E062 (from...   100   1e-19   
sp|Q9UKC9|FL2_HUMAN|FL2_HUMAN F-box/LRR-repeat protein 2 (F-box and leucin...   100   1e-19   Homo sapiens [man]
gb:CR861354_1185354 Pongo pygmaeus mRNA; cDNA DKFZp459A1011 (fro...   100   1e-19   
gb:AF467461_2496359 Danio rerio PpaA (ppaA) mRNA, partial cds.         99   2e-19   
gb:AY398381_2531911 Danio rerio clone RK131A2B02 hypothetical pr...    99   3e-19   
gb:BX908798_830589 Parachlamydia-related symbiont UWE25, complet...    99   3e-19   
gb:AK129227_2069458 Mus musculus mRNA for mKIAA0840 protein.           97   6e-19   
gb:AP005398_1851132 Oryza sativa (japonica cultivar-group) genom...    97   6e-19   
gb:AF174593_1887911 Homo sapiens F-box protein Fbl7 (FBL7) mRNA,...    97   1e-18   
gb:AB020647_1865245 Homo sapiens mRNA for KIAA0840 protein, part...    97   1e-18   
sp|Q9UJT9|FXL7_HUMAN|FXL7_HUMAN F-box/LRR-repeat protein 7 (F-box and leuci...    97   1e-18   Homo sapiens [man]
gb:BC031285_1980114 Homo sapiens F-box and leucine-rich repeat p...    94   5e-18   
gb:BC020572_1977069 Homo sapiens F-box and leucine-rich repeat p...    93   1e-17   
gb:AK097537_1914904 Homo sapiens cDNA FLJ40218 fis, clone TESTI2...    93   1e-17   
gb:AK029566_1161558 Mus musculus adult male testis cDNA, RIKEN f...    93   1e-17   
gb:AE013599_1133354 Drosophila melanogaster chromosome 2R, compl...    92   2e-17   
gb:BX908798_831121 Parachlamydia-related symbiont UWE25, complet...    92   2e-17   
gb:AY359239_1948008 Homo sapiens F-box and leucine-rich repeat p...    92   3e-17   
gb:AY089649_1297305 Drosophila melanogaster RH06780 full insert ...    91   5e-17   
gb:AE014296_1135872 Drosophila melanogaster chromosome 3L, compl...    91   5e-17   
gb:BX908798_831066 Parachlamydia-related symbiont UWE25, complet...    91   6e-17   
gb:BX908798_831512 Parachlamydia-related symbiont UWE25, complet...    91   8e-17   
gb:BX908798_831063 Parachlamydia-related symbiont UWE25, complet...    90   1e-16   
gb:BX908798_831510 Parachlamydia-related symbiont UWE25, complet...    90   1e-16   
gb:BX908798_831018 Parachlamydia-related symbiont UWE25, complet...    90   1e-16   
gb:AY087448_1572479 Arabidopsis thaliana clone 35534 mRNA, compl...    89   2e-16   
gb:HSM803079_1186896 Homo sapiens mRNA; cDNA DKFZp434L2422 (from...    89   2e-16   
gb:BX908798_831482 Parachlamydia-related symbiont UWE25, complet...    89   3e-16   
gb:BX908798_831575 Parachlamydia-related symbiont UWE25, complet...    88   4e-16   
gb:BX908798_831484 Parachlamydia-related symbiont UWE25, complet...    88   4e-16   
pir|T48193|T48193 hypothetical protein F7A7.240 - Arabidopsis th...    88   4e-16   Arabidopsis thaliana [mouse-ear cress]
gb:BX908798_830828 Parachlamydia-related symbiont UWE25, complet...    88   5e-16   
gb:AC114261_1205586 Dictyostelium discoideum chromosome 2 map 12...    87   1e-15   
gb:HSM800297_2017131 Homo sapiens mRNA; cDNA DKFZp564P0622 (from...    86   1e-15   
gb:AY054560_1563214 Arabidopsis thaliana putative protein (At3g5...    86   1e-15   
gb:AE016959_1020937 Oryza sativa (japonica cultivar-group) chrom...    86   1e-15   
pir|T08680|T08680 hypothetical protein DKFZp564P0622.1 - human (...    86   1e-15   Homo sapiens [man]
gb:BX908798_829892 Parachlamydia-related symbiont UWE25, complet...    86   3e-15   
gb:AC005250_1874894 Homo sapiens BAC clone CTA-318M5 from 7, com...    85   3e-15   
gb:NC18F11_1688417 Neurospora crassa DNA linkage group V Cosmid ...    85   3e-15   
gb:CR382129_1661907 Yarrowia lipolytica chromosome C of strain C...    85   3e-15   
gb:BX908798_831222 Parachlamydia-related symbiont UWE25, complet...    85   3e-15   
gb:BX908798_830548 Parachlamydia-related symbiont UWE25, complet...    85   4e-15   
pir|C71419|C71419 hypothetical protein - Arabidopsis thaliana>gb...    85   4e-15   Arabidopsis thaliana [mouse-ear cress]
gb:BX908798_831511 Parachlamydia-related symbiont UWE25, complet...    84   7e-15   
gb:BX908798_830299 Parachlamydia-related symbiont UWE25, complet...    83   1e-14   
gb:BX908798_831470 Parachlamydia-related symbiont UWE25, complet...    83   2e-14   
gb:BX908798_830581 Parachlamydia-related symbiont UWE25, complet...    82   2e-14   
gb:BX908798_830588 Parachlamydia-related symbiont UWE25, complet...    82   3e-14   
gb:BX908798_830838 Parachlamydia-related symbiont UWE25, complet...    82   4e-14   
gb:BT002473_1636076 Arabidopsis thaliana SKP1 interacting partne...    80   8e-14   
gb:BX908798_831474 Parachlamydia-related symbiont UWE25, complet...    80   8e-14   
gb:BX908798_831471 Parachlamydia-related symbiont UWE25, complet...    80   8e-14   
gb:BX908798_830834 Parachlamydia-related symbiont UWE25, complet...    80   1e-13   
gb:BX908798_831476 Parachlamydia-related symbiont UWE25, complet...    79   2e-13   
gb:BX908798_831064 Parachlamydia-related symbiont UWE25, complet...    79   3e-13   
gb:BX908798_830698 Parachlamydia-related symbiont UWE25, complet...    78   4e-13   
pir|G96837|G96837 unknown protein T21F11.10 [imported] - Arabido...    78   4e-13   Arabidopsis thaliana [mouse-ear cress]
gb:BX908798_830753 Parachlamydia-related symbiont UWE25, complet...    78   5e-13   
gb:BX908798_829604 Parachlamydia-related symbiont UWE25, complet...    78   5e-13   
gb:BX908798_831548 Parachlamydia-related symbiont UWE25, complet...    77   7e-13   
gb:BX908798_831051 Parachlamydia-related symbiont UWE25, complet...    77   7e-13   
gb:BC087158_2110046 Rattus norvegicus cDNA clone MGC:95282 IMAGE...    77   9e-13   
gb:BX908798_831490 Parachlamydia-related symbiont UWE25, complet...    77   9e-13   
sp|Q9QZH7|FL2L_RAT|FL2L_RAT F-box/LRR-repeat protein 2-like.>pir|T52349|T...    77   9e-13   Rattus norvegicus [brown rat]
gb:CR382139_1673111 Debaryomyces hansenii chromosome G of strain...    77   1e-12   
gb:BX908798_830587 Parachlamydia-related symbiont UWE25, complet...    77   1e-12   
gb:BX908798_830444 Parachlamydia-related symbiont UWE25, complet...    77   1e-12   
gb:BX908798_831472 Parachlamydia-related symbiont UWE25, complet...    76   2e-12   
gb:AY823669_2088564 Rattus norvegicus spinal cord injury and reg...    75   3e-12   
gb:BX908798_829891 Parachlamydia-related symbiont UWE25, complet...    75   3e-12   
pir|T45673|T45673 hypothetical protein F14P22.120 - Arabidopsis ...    75   3e-12   Arabidopsis thaliana [mouse-ear cress]
gb:AP003227_1825684 Oryza sativa (japonica cultivar-group) genom...    75   4e-12   
gb:BX908798_831172 Parachlamydia-related symbiont UWE25, complet...    75   4e-12   
gb:CRU303349_1673663 Capsella rubella ORF1, ORF2, ORF3, ORF4, OR...    74   1e-11   
gb:ATH303346_1552436 Arabidopsis thaliana partial mRNA for hypot...    74   1e-11   
gb:CR859619_1183726 Pongo pygmaeus mRNA; cDNA DKFZp459G1413 (fro...    74   1e-11   
pir|E96598|E96598 protein F20N2.2 [imported] - Arabidopsis thali...    74   1e-11   Arabidopsis thaliana [mouse-ear cress]
gb:BC086357_2109548 Rattus norvegicus similar to F-box protein F...    73   1e-11   
gb:AC135419_1742238 Oryza sativa (japonica cultivar-group) chrom...    73   1e-11   
gb:BX908798_829755 Parachlamydia-related symbiont UWE25, complet...    73   1e-11   
pir|T45861|T45861 hypothetical protein F3A4.160 - Arabidopsis th...    73   1e-11   Arabidopsis thaliana [mouse-ear cress]
sp|O74783|POF2_SCHPO|POF2_SCHPO F-box/LRR-repeat protein 2 (F-box and leuci...    73   1e-11   Schizosaccharomyces pombe
gb:AF467464_2496361 Gallus gallus PPA (PPA) gene, partial cds.         72   2e-11   
gb:BX908798_830832 Parachlamydia-related symbiont UWE25, complet...    72   2e-11   
gb:BC067906_1987553 Homo sapiens hypothetical protein LOC196394,...    72   3e-11   
gb:BC045831_1983645 Homo sapiens, clone IMAGE:5265088, mRNA, par...    72   3e-11   
gb:BC037897_1982248 Homo sapiens hypothetical protein LOC196394,...    72   3e-11   
gb:BC036680_1982003 Homo sapiens F-box and leucine-rich repeat p...    72   3e-11   
gb:AK175307_1817295 Arabidopsis thaliana mRNA for hypothetical p...    72   3e-11   
gb:AY085898_1570961 Arabidopsis thaliana clone 19486 mRNA, compl...    72   3e-11   
gb:AK095387_1914352 Homo sapiens cDNA FLJ38068 fis, clone CTONG2...    72   4e-11   
gb:AF176701_1888028 Homo sapiens F-box protein FBL9 mRNA, partia...    72   4e-11   
gb:BX908798_831388 Parachlamydia-related symbiont UWE25, complet...    72   4e-11   
pir|B86347|B86347 hypothetical protein F24J8.5 [imported] - Arab...    72   4e-11   Arabidopsis thaliana [mouse-ear cress]
gb:CR382132_1665004 Yarrowia lipolytica chromosome F of strain C...    71   5e-11   
pir|D96512|D96512 hypothetical protein F2G19.16 [imported] - Ara...    71   6e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AF467463_2066642 Mus musculus PPA (Ppa) mRNA, partial cds.          70   1e-10   
gb:AE017348_1758146 Cryptococcus neoformans var. neoformans JEC2...    70   1e-10   
gb:BX908798_831119 Parachlamydia-related symbiont UWE25, complet...    70   1e-10   
pir|A96799|A96799 hypothetical protein F22K20.10 [imported] - Ar...    69   2e-10   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00271_1697717 Oryza sativa genomic DNA, chromosome 4, BAC...    69   2e-10   
gb:LES303342_1684552 Lycopersicon esculentum mRNA for hypothetic...    69   3e-10   
gb:AE006464_1875628 Homo sapiens 16p13.3 sequence section 3 of 8.      68   4e-10   
pir|T41312|T41312 probable DNA excision repair protein - fission...    68   4e-10   Schizosaccharomyces pombe
gb:AF459405_1801710 Narcissus pseudonarcissus DAFSAG10 putative ...    68   5e-10   
gb:BX908798_830549 Parachlamydia-related symbiont UWE25, complet...    67   9e-10   
pir|T48752|T48752 GRR1 related protein [imported] - Neurospora c...    67   9e-10   Neurospora crassa
gb:AE014297_1139487 Drosophila melanogaster chromosome 3R, compl...    67   1e-09   
gb:BC016499_2092332 Mus musculus F-box and leucine-rich repeat p...    66   2e-09   
gb:BC020575_1977070 Homo sapiens F-box and leucine-rich repeat p...    65   5e-09   
gb:AE017150_1029536 Trypanosoma brucei chromosome 2, complete se...    65   5e-09   
gb:AK030172_1161864 Mus musculus adult male testis cDNA, RIKEN f...    64   6e-09   
gb:AE016959_1022420 Oryza sativa (japonica cultivar-group) chrom...    64   6e-09   
pir|E96838|E96838 hypothetical protein T21F11.4 [imported] - Ara...    64   6e-09   Arabidopsis thaliana [mouse-ear cress]
gb:TBBCHR1A1_1398482 Trypanosoma brucei DNA chromosome 1, segmen...    64   1e-08   
gb:AP005709_1856455 Oryza sativa (japonica cultivar-group) genom...    63   1e-08   
gb:TBH25N7_1399044 Trypanosoma brucei 221 VSG expression site BAC.     63   1e-08   
gb:TBBCHR1A3_1398818 Trypanosoma brucei DNA chromosome 1, segmen...    63   1e-08   
gb:CR382125_1657482 Kluyveromyces lactis strain NRRL Y-1140 chro...    63   2e-08   
gb:CR382122_1655008 Kluyveromyces lactis strain NRRL Y-1140 chro...    62   2e-08   
gb:BX908798_829890 Parachlamydia-related symbiont UWE25, complet...    62   2e-08   
pir|B84547|B84547 hypothetical protein At2g17020 [imported] - Ar...    62   3e-08   Arabidopsis thaliana [mouse-ear cress]
sp|Q9UF56|FX13_HUMAN|FX13_HUMAN F-box only protein 13 (Fragment).                 62   3e-08   Homo sapiens [man]
gb:AF176529_2057845 Mus musculus F-box protein FBX13 mRNA, parti...    62   4e-08   
gb:AY220479_1590513 Nicotiana tabacum Avr9/Cf-9 rapidly elicited...    62   4e-08   
sp|Q9QZN1|FX13_MOUSE|FX13_MOUSE F-box only protein 13 (Fragment).                 62   4e-08   Mus musculus [mouse]
gb:TBN19B2_1399113 Trypanosoma brucei VO2 VSG expression site BAC.     61   5e-08   
gb:CR382134_1667309 Debaryomyces hansenii chromosome B of strain...    61   7e-08   
gb:AY142631_1583047 Arabidopsis thaliana unknown protein (At1g15...    61   7e-08   
gb:AC099399_1737109 Oryza sativa (japonica cultivar-group) chrom...    60   9e-08   
gb:ATAC009853_1543062 Arabidopsis thaliana chromosome III BAC F2...    60   9e-08   
gb:TBBCHR1A1_1398490 Trypanosoma brucei DNA chromosome 1, segmen...    60   9e-08   
gb:BX908798_831205 Parachlamydia-related symbiont UWE25, complet...    60   9e-08   
gb:AF360339_1791285 Arabidopsis thaliana unknown protein (At1g15...    60   1e-07   
gb:AE016816_1746604 Ashbya gossypii (= Eremothecium gossypii) AT...    60   1e-07   
gb:CR382130_1663187 Yarrowia lipolytica chromosome D of strain C...    60   1e-07   
gb:BT010706_1640652 Arabidopsis thaliana At2g06030 mRNA, complet...    60   1e-07   
gb:TBBCHR1A1_1398501 Trypanosoma brucei DNA chromosome 1, segmen...    59   2e-07   
sp|P24814|GRR1_YEAST|GRR1_YEAST Ubiquitin ligase complex F-box protein GRR1...    59   2e-07   Saccharomyces cerevisiae [brewer's yeast]
gb:AK126722_1916426 Homo sapiens cDNA FLJ44768 fis, clone BRACE3...    59   3e-07   
gb:AC084884_1733896 Oryza sativa chromosome 10 clone OSJNBa0031A...    59   3e-07   
gb:AY484589_1608337 Musa acuminata clone MuH9, genomic sequence.       59   3e-07   
gb:HSM801456_1186185 Homo sapiens mRNA; cDNA DKFZp434C1715 (from...    59   3e-07   
gb:AE017150_1029600 Trypanosoma brucei chromosome 2, complete se...    59   3e-07   
pir|T43444|T43444 hypothetical protein DKFZp434C1715.1 - human (...    59   3e-07   Homo sapiens [man]
gb:BC067674_2554845 Danio rerio zgc:85882, mRNA (cDNA clone MGC:...    58   4e-07   
gb:AP004586_1841932 Oryza sativa (japonica cultivar-group) genom...    58   4e-07   
gb:AE013599_1130713 Drosophila melanogaster chromosome 2R, compl...    58   4e-07   
gb:AE017150_1029578 Trypanosoma brucei chromosome 2, complete se...    58   6e-07   
gb:BC053821_2550768 Xenopus laevis hypothetical protein MGC64561...    57   7e-07   
gb:AP005295_1850048 Oryza sativa (japonica cultivar-group) genom...    57   7e-07   
gb:AK175607_1817595 Arabidopsis thaliana mRNA, partial cds, clon...    57   7e-07   
gb:BX908798_829754 Parachlamydia-related symbiont UWE25, complet...    57   7e-07   
gb:AB025621_1516430 Arabidopsis thaliana genomic DNA, chromosome...    57   1e-06   
gb:AC116305_1206202 Dictyostelium discoideum chromosome 2 map 10...    57   1e-06   
gb:OSJN00216_1696873 Oryza sativa genomic DNA, chromosome 4, BAC...    56   2e-06   
pir|T05201|T05201 hypothetical protein F4I10.140 - Arabidopsis t...    56   2e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AE014134_1127557 Drosophila melanogaster chromosome 2L, compl...    56   2e-06   
gb:BC084522_2563893 Xenopus tropicalis hypothetical LOC496536, m...    55   3e-06   
gb:AY359238_1948007 Homo sapiens F-box and leucine-rich repeat p...    55   3e-06   
gb:AE016818_1748292 Ashbya gossypii (= Eremothecium gossypii) AT...    55   4e-06   
gb:CR382139_1672396 Debaryomyces hansenii chromosome G of strain...    55   4e-06   
gb:AE016818_1748541 Ashbya gossypii (= Eremothecium gossypii) AT...    55   5e-06   
pir|B85072|B85072 hypothetical protein AT4g07400 [imported] - Ar...    55   5e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AE017352_1759671 Cryptococcus neoformans var. neoformans JEC2...    54   8e-06   
gb:AB050981_1867876 Homo sapiens skp2-gamma mRNA for SKP2-like p...    54   1e-05   
gb:CR380959_1654044 Candida glabrata strain CBS138 chromosome M ...    54   1e-05   
gb:AY069367_1294097 Drosophila melanogaster LD07444 full length ...    53   1e-05   
gb:AY653733_2371392 Mimivirus, complete genome.                        53   2e-05   
gb:AB025621_1516429 Arabidopsis thaliana genomic DNA, chromosome...    53   2e-05   
pir|H84779|H84779 hypothetical protein At2g36370 [imported] - Ar...    53   2e-05   Arabidopsis thaliana [mouse-ear cress]
gb:HSBA18I14_2010886 Human DNA sequence from clone RP11-18I14 on...    52   2e-05   
gb:HSBA18I14_2010882 Human DNA sequence from clone RP11-18I14 on...    52   2e-05   
gb:OSJN00275_1697800 Oryza sativa genomic DNA, chromosome 4, BAC...    52   2e-05   
gb:AK085980_1174634 Mus musculus 16 days neonate heart cDNA, RIK...    52   2e-05   
gb:AK084845_1174342 Mus musculus 13 days embryo heart cDNA, RIKE...    52   2e-05   
gb:AK052175_1169918 Mus musculus 13 days embryo heart cDNA, RIKE...    52   2e-05   
gb:BX908798_831491 Parachlamydia-related symbiont UWE25, complet...    52   2e-05   
gb:OSJN00038_1693705 Oryza sativa genomic DNA, chromosome 4, BAC...    52   3e-05   
gb:BX908798_831549 Parachlamydia-related symbiont UWE25, complet...    52   3e-05   
gb:CR382121_1654617 Kluyveromyces lactis strain NRRL Y-1140 chro...    52   4e-05   
gb:AY056152_1563483 Arabidopsis thaliana putative SKP1 interacti...    52   4e-05   
gb:BC085657_2564534 Danio rerio zgc:92297, mRNA (cDNA clone MGC:...    51   7e-05   
sp|P38285|YB08_YEAST|YB08_YEAST Hypothetical 62.7 kDa protein in CNS1-CDC28...    51   7e-05   Saccharomyces cerevisiae [brewer's yeast]
gb:OSJN00054_1693991 Oryza sativa genomic DNA, chromosome 4, BAC...    50   9e-05   
gb:CR382131_1663636 Yarrowia lipolytica chromosome E of strain C...    50   9e-05   
sp|Q8WV35|FXL9_HUMAN|FXL9_HUMAN F-box/LRR-repeat protein 9 (F-box and leuci...    50   9e-05   Homo sapiens [man]
gb:AF199355_1889695 Homo sapiens F-box protein FBL5 (FBL5) mRNA,...    50   1e-04   
gb:AF176699_1888026 Homo sapiens F-box protein FBL4 mRNA, comple...    50   1e-04   
sp|Q9UKA2|FXL4_HUMAN|FXL4_HUMAN F-box/LRR-repeat protein 4 (F-box and leuci...    50   1e-04   Homo sapiens [man]
gb:AE016817_1747445 Ashbya gossypii (= Eremothecium gossypii) AT...    50   2e-04   
gb:CR382122_1655229 Kluyveromyces lactis strain NRRL Y-1140 chro...    50   2e-04   
gb:AY045799_1561315 Arabidopsis thaliana putative F-box protein ...    50   2e-04   
gb:AX057148_1458353 Sequence 24 from Patent WO0075184.                 50   2e-04   
gb:TBH25N7_1399057 Trypanosoma brucei 221 VSG expression site BAC.     50   2e-04   
gb:BX908798_830555 Parachlamydia-related symbiont UWE25, complet...    50   2e-04   
pir|I39171|I39171 cyclin A/CDK2-associated p45 - human>gb:HSU337...    50   2e-04   Homo sapiens [man]
gb:OSJN00275_1697802 Oryza sativa genomic DNA, chromosome 4, BAC...    49   2e-04   
gb:TBH25N7_1399062 Trypanosoma brucei 221 VSG expression site BAC.     49   2e-04   
gb:AK032391_1162894 Mus musculus adult male olfactory brain cDNA...    49   2e-04   
gb:BX908798_830310 Parachlamydia-related symbiont UWE25, complet...    49   2e-04   
gb:FRU90880_2572188 Takifugu rubripes isotocin and vasotocin locus.    49   3e-04   
gb:ATT6G21_1556302 Arabidopsis thaliana DNA chromosome 5, BAC cl...    49   3e-04   
pir|E85040|E85040 hypothetical protein AT4g03190 [imported] - Ar...    49   3e-04   Arabidopsis thaliana [mouse-ear cress]
pir|S13724|S13724 ESAG 8 protein - Trypanosoma brucei>gb:TBESAG8...    49   3e-04   Trypanosoma brucei brucei
gb:AF291816_1783718 Arabidopsis thaliana GRR1-like protein 1 (GR...    48   4e-04   
gb:BX908798_831011 Parachlamydia-related symbiont UWE25, complet...    48   4e-04   
gb:AP005286_1849872 Oryza sativa (japonica cultivar-group) genom...    48   6e-04   
gb:AB178014_16275 Ralstonia solanacearum lrpF gene for leucine-r...    48   6e-04   
gb:BC088595_2565725 Xenopus tropicalis cDNA clone IMAGE:6992156,...    47   8e-04   
gb:BC082636_2562784 Xenopus laevis MGC80880 protein, mRNA (cDNA ...    47   8e-04   
gb:BC076965_2559704 Xenopus tropicalis MGC89425 protein, mRNA (c...    47   8e-04   
gb:BC073414_2557255 Xenopus laevis MGC80880 protein, mRNA (cDNA ...    47   8e-04   
gb:AP003873_1834620 Oryza sativa (japonica cultivar-group) genom...    47   8e-04   
gb:TB13J3_1398436 Trypanosoma brucei Bn-2 VSG expression site BA...    47   8e-04   
gb:BT009941_1357307 Drosophila melanogaster SD04170 full insert ...    47   8e-04   
gb:AE014297_1138595 Drosophila melanogaster chromosome 3R, compl...    47   8e-04   
gb:AL646080_549042 Ralstonia solanacearum GMI1000 megaplasmid, c...    47   8e-04   
gb:AP005072_1847571 Oryza sativa (japonica cultivar-group) genom...    47   0.001   
gb:AP006533_1862341 Oryza sativa (japonica cultivar-group) genom...    47   0.001   
gb:AP005441_1851793 Oryza sativa (japonica cultivar-group) genom...    47   0.001   
gb:CR382134_1667128 Debaryomyces hansenii chromosome B of strain...    47   0.001   
gb:BC033265_2097424 Mus musculus F-box and leucine-rich repeat p...    46   0.002   
gb:CR380954_1651382 Candida glabrata strain CBS138 chromosome H ...    46   0.002   
gb:AY089368_1297024 Drosophila melanogaster AT19096 full insert ...    46   0.002   
gb:AE014134_1129919 Drosophila melanogaster chromosome 2L, compl...    46   0.002   
gb:HSBA18I14_2010883 Human DNA sequence from clone RP11-18I14 on...    45   0.004   
gb:HSA459424_2007430 Homo sapiens mRNA for JEMMA protein (PCCX2 ...    45   0.005   
gb:BC008735_1971541 Homo sapiens F-box and leucine-rich repeat p...    45   0.005   
gb:OSJN00216_1696884 Oryza sativa genomic DNA, chromosome 4, BAC...    45   0.005   
gb:AC073178_1541009 Arabidopsis thaliana chromosome 1 BAC F10D13...    45   0.005   
gb:AX877234_1476901 Sequence 12139 from Patent EP1074617.>gb:AK0...    45   0.005   
gb:AX876196_1476415 Sequence 11101 from Patent EP1074617.>gb:AK0...    45   0.005   
gb:AK044212_1166865 Mus musculus adult retina cDNA, RIKEN full-l...    45   0.005   
gb:AK032979_1163153 Mus musculus 12 days embryo male wolffian du...    45   0.005   
sp|Q9Z0Z3|SKP2_MOUSE|SKP2_MOUSE S-phase kinase-associated protein 2 (F-box ...    45   0.005   Mus musculus [mouse]
gb:BC082040_2108271 Rattus norvegicus F-box and leucine-rich rep...    44   0.006   
gb:AC006921_1534747 Arabidopsis thaliana chromosome 2 clone F2H1...    44   0.006   
pir|E85358|E85358 hypothetical protein AT4g30640 [imported] - Ar...    44   0.006   Arabidopsis thaliana [mouse-ear cress]
gb:AK024505_1910070 Homo sapiens mRNA for FLJ00115 protein, part...    44   0.008   
gb:AF179221_1888219 Homo sapiens F-box protein Lilina (LILINA) m...    44   0.008   
gb:AB023221_1865543 Homo sapiens mRNA for KIAA1004 protein, part...    44   0.008   
gb:AY070039_1566682 Arabidopsis thaliana unknown protein (At5g07...    44   0.008   
gb:AF262948_1257068 Leishmania tarentolae cysteine-leucine rich ...    44   0.008   
gb:HSM801422_1186169 Homo sapiens mRNA; cDNA DKFZp434I0535 (from...    44   0.008   
gb:BX908798_831372 Parachlamydia-related symbiont UWE25, complet...    44   0.008   
gb:BX908798_831065 Parachlamydia-related symbiont UWE25, complet...    44   0.008   
sp|Q9Y2K7|FXLB_HUMAN|FXLB_HUMAN F-box/LRR-repeat protein 11 (F-box and leuc...    44   0.008   
gb:AK173084_2070018 Mus musculus mRNA for mKIAA1004 protein.           44   0.011   
gb:AF454544_1801103 Pichia angusta strain DL-1 GTP-binding prote...    44   0.011   
gb:AF098963_1767941 Arabidopsis thaliana disease resistance prot...    44   0.011   
pir|T52347|T52347 disease resistance protein RPP1-WsB [imported]...    44   0.011   
sp|P59997|FXLB_MOUSE|FXLB_MOUSE F-box/LRR-repeat protein 11 (F-box and leuc...    44   0.011   
gb:HS380A1_1998371 Human DNA sequence from clone LA16-380A1 on c...    43   0.014   
gb:CR380950_1649906 Candida glabrata strain CBS138 chromosome D ...    43   0.014   
gb:AY099739_1576764 Arabidopsis thaliana unknown protein (At4g23...    43   0.014   
gb:AY081507_1568767 Arabidopsis thaliana unknown protein (At1g15...    43   0.014   
pir|F86291|F86291 hypothetical protein F7H2.8 [imported] - Arabi...    43   0.014   
gb:BC073127_2557030 Xenopus laevis hypothetical protein LOC44362...    43   0.019   
gb:AC007087_1535212 Arabidopsis thaliana chromosome 2 clone F14N...    43   0.019   
gb:HSBA18I14_2010884 Human DNA sequence from clone RP11-18I14 on...    42   0.024   
gb:LES303345_1684557 Lycopersicon esculentum lateral suppressor ...    42   0.024   
gb:AB016889_1513188 Arabidopsis thaliana genomic DNA, chromosome...    42   0.024   
gb:TBH25N7_1399063 Trypanosoma brucei 221 VSG expression site BAC.     42   0.024   
gb:BX908798_829820 Parachlamydia-related symbiont UWE25, complet...    42   0.024   
gb:AK117866_1815876 Arabidopsis thaliana At1g77000 mRNA for unkn...    42   0.032   
gb:CQ782648_1452078 Sequence 2788 from Patent EP1396543.>gb:AK07...    42   0.032   
gb:AE017150_1029629 Trypanosoma brucei chromosome 2, complete se...    42   0.032   
sp|P06779|RAD7_YEAST|RAD7_YEAST DNA repair protein RAD7.>pir|A25226|A25226 ...    42   0.032   
gb:YSCCORA_1728599 Yeast COR gene cluster encoding iso-1-cytochr...    42   0.042   
gb:TBBCHR1A4_1398954 Trypanosoma brucei DNA chromosome 1, segmen...    42   0.042   
gb:BT001595_1356368 Drosophila melanogaster RE28319 full insert ...    42   0.042   
gb:AE014297_1141973 Drosophila melanogaster chromosome 3R, compl...    42   0.042   
gb:AE014297_1141972 Drosophila melanogaster chromosome 3R, compl...    42   0.042   
pir|D84474|D84474 hypothetical protein At2g06030 [imported] - Ar...    42   0.042   
gb:AJ720646_2502833 Gallus gallus mRNA for hypothetical protein,...    41   0.054   
gb:BC047214_2099485 Mus musculus F-box and leucine-rich repeat p...    41   0.054   
gb:BT001563_1356336 Drosophila melanogaster RE15215 full insert ...    41   0.054   
gb:AK088067_1175177 Mus musculus 2 days neonate thymus thymic ce...    41   0.054   
gb:AE014297_1137806 Drosophila melanogaster chromosome 3R, compl...    41   0.054   
gb:AE014297_1137805 Drosophila melanogaster chromosome 3R, compl...    41   0.054   
sp|Q8C2S5|FXL5_MOUSE|FXL5_MOUSE F-box/LRR-repeat protein 5 (F-box and leuci...    41   0.054   
gb:BC084456_2563830 Xenopus tropicalis hypothetical LOC496483, m...    41   0.071   
gb:TRBKPLEUM_1400712 Trypanosoma brucei leucine repeat protein (...    41   0.071   
pir|F86261|F86261 F13K23.7 protein - Arabidopsis thaliana>gb:AE0...    41   0.071   
sp|Q86W25|NA13_HUMAN|NA13_HUMAN NACHT-, LRR- and PYD-containing protein 13 ...    41   0.071   
sp|P26337|ESA8_TRYEQ|ESA8_TRYEQ Putative adenylate cyclase regulatory prote...    41   0.071   
sp|P23799|ESA8_TRYBB|ESA8_TRYBB Putative adenylate cyclase regulatory prote...    41   0.071   
gb:BX936384_2568080 Zebrafish DNA sequence from clone CH211-76M1...    40   0.092   
gb:BX936384_2568078 Zebrafish DNA sequence from clone CH211-76M1...    40   0.092   
gb:BC065090_2105516 Mus musculus F-box and leucine-rich repeat p...    40   0.092   
gb:BC057622_2102836 Mus musculus F-box and leucine-rich repeat p...    40   0.092   
gb:AK129479_2069710 Mus musculus mRNA for mKIAA3014 protein.           40   0.092   
gb:AF176524_2057840 Mus musculus F-box protein FBL10 mRNA, parti...    40   0.092   
gb:AP004159_1838374 Oryza sativa (japonica cultivar-group) genom...    40   0.16    
gb:BC082853_2562929 Xenopus laevis cDNA clone MGC:81676 IMAGE:68...    39   0.21    
gb:BC082108_2108335 Rattus norvegicus F-box and leucine-rich rep...    39   0.21    
gb:LMFL7276_1388369 Leishmania major Friedlin chromosome 23 cosm...    39   0.21    
gb:AE014297_1137911 Drosophila melanogaster chromosome 3R, compl...    39   0.21    
pir|T47430|T47430 disease resistence-like protein - Arabidopsis ...    39   0.21    
pir|T48087|T48087 transport inhibitor response protein TIR1 [imp...    39   0.21    
gb:OSJN00253_1697441 Oryza sativa genomic DNA, chromosome 4, BAC...    39   0.27    
gb:AY060566_1564873 Arabidopsis thaliana AT3g27290/K17E12_11 mRN...    39   0.27    
gb:BX908798_831475 Parachlamydia-related symbiont UWE25, complet...    39   0.27    
pir|G88523|G88523 truncated hypothetical protein C02F5.7 - Caeno...    39   0.27    
pir|T52346|T52346 disease resistance protein RPP1-WsA [imported]...    39   0.27    
sp|O95626|A32D_HUMAN|A32D_HUMAN Acidic leucine-rich nuclear phosphoprotein ...    39   0.27    
gb:AF176522_2057838 Mus musculus leucine-rich repeat-containing ...    39   0.35    
gb:AP003898_1834962 Oryza sativa (japonica cultivar-group) genom...    39   0.35    
gb:AB006706_1510012 Arabidopsis thaliana genomic DNA, chromosome...    39   0.35    
gb:U23484_1402266 Caenorhabditis elegans cosmid EEED8, complete ...    39   0.35    
gb:AE014186_938206 Plasmodium falciparum 3D7 chromosome 11 compl...    39   0.35    
gb:BX908798_831167 Parachlamydia-related symbiont UWE25, complet...    39   0.35    
gb:CP000033_89967 Lactobacillus acidophilus NCFM, complete genome.     39   0.35    
sp|Q09299|YQOA_CAEEL|YQOA_CAEEL Hypothetical RNA-binding protein EEED8.10 i...    39   0.35    
sp|Q9QXW0|FXL6_MOUSE|FXL6_MOUSE F-box/LRR-repeat protein 6 (F-box and leuci...    39   0.35    
gb:BC088283_2110470 Rattus norvegicus similar to hypothetical pr...    38   0.46    
gb:AY702092_2088084 Mus musculus acidic leucine-rich nuclear pho...    38   0.46    
gb:HSM806084_2018169 Homo sapiens mRNA; cDNA DKFZp686A101 (from ...    38   0.46    
gb:BC030656_1979900 Homo sapiens F-box and leucine-rich repeat p...    38   0.46    
gb:BC001198_1967378 Homo sapiens cDNA clone IMAGE:3355871, parti...    38   0.46    
gb:AK000153_1907725 Homo sapiens cDNA FLJ20146 fis, clone COL07877.    38   0.46    
gb:AF199420_1889705 Homo sapiens F-box protein FBL4 (FBL4) mRNA,...    38   0.46    
gb:AF176700_1888027 Homo sapiens F-box protein FBL5 mRNA, partia...    38   0.46    
gb:AF174591_1887909 Homo sapiens F-box protein Fbl5 (FBL5) mRNA,...    38   0.46    
gb:AF157323_1886729 Homo sapiens p45SKP2-like protein mRNA, comp...    38   0.46    
gb:AK117894_1815902 Arabidopsis thaliana At4g33210 mRNA for unkn...    38   0.46    
gb:A60534_1449918 Sequence 13 from Patent WO9706259.>gb:AX033281...    38   0.46    
pir|T00020|T00020 bacterial blight-resistance protein Xa1 - rice...    38   0.46    
sp|Q9UKA1|FXL5_HUMAN|FXL5_HUMAN F-box/LRR-repeat protein 5 (F-box and leuci...    38   0.46    
gb:AP004126_1837989 Oryza sativa (japonica cultivar-group) genom...    38   0.60    
gb:AF536527_1809667 Glycine max putative coronatine-insensitive ...    38   0.60    
gb:AX876011_1476336 Sequence 10916 from Patent EP1074617.>gb:AK0...    38   0.60    
gb:AY721594_1433281 Bos taurus maternal antigen that embryo requ...    38   0.60    
gb:AK039669_1165458 Mus musculus adult male spinal cord cDNA, RI...    38   0.60    
gb:AK009150_1154972 Mus musculus adult male tongue cDNA, RIKEN f...    38   0.60    
gb:AK002370_1151154 Mus musculus adult male kidney cDNA, RIKEN f...    38   0.60    
gb:AE016959_1020769 Oryza sativa (japonica cultivar-group) chrom...    38   0.60    
gb:BX908798_830697 Parachlamydia-related symbiont UWE25, complet...    38   0.60    
gb:AB178025_16286 Ralstonia solanacearum lrpH gene for leucine-r...    38   0.60    
pir|B85069|B85069 hypothetical protein AT4g05500 [imported] - Ar...    38   0.60    
gb:AJ720498_2502685 Gallus gallus mRNA for hypothetical protein,...    37   0.78    
gb:BC087686_2110156 Rattus norvegicus acidic (leucine-rich) nucl...    37   0.78    
gb:HSBA18I14_2010885 Human DNA sequence from clone RP11-18I14 on...    37   0.78    
gb:BC069122_1987812 Homo sapiens acidic (leucine-rich) nuclear p...    37   0.78    
gb:AP003914_1835140 Oryza sativa (japonica cultivar-group) genom...    37   0.78    
gb:AB020742_1514567 Arabidopsis thaliana genomic DNA, chromosome...    37   0.78    
gb:BX538351_1358871 Cryptosporidium parvum chromosome 6, complet...    37   0.78    
gb:CR860550_1184614 Pongo pygmaeus mRNA; cDNA DKFZp459A167 (from...    37   0.78    
gb:AK011081_1156186 Mus musculus 13 days embryo liver cDNA, RIKE...    37   0.78    
gb:AL646081_549284 Ralstonia solanacearum GMI1000 megaplasmid, c...    37   0.78    
sp|Q9EPX5|FXLC_MOUSE|FXLC_MOUSE F-box/LRR-repeat protein 12 (F-box and leuc...    37   0.78    
sp|P49911|A32A_RAT|A32A_RAT Acidic leucine-rich nuclear phosphoprotein 32...    37   0.78    
gb:MMU73478_2123366 Mus musculus acidic nuclear phosphoprotein p...    37   1.0     
gb:BC001203_1967383 Homo sapiens, Similar to f-box and leucine-r...    37   1.0     
gb:AY154460_1937260 Homo sapiens NALP5 (NALP5) mRNA, complete cds.     37   1.0     
gb:AK026541_1910654 Homo sapiens cDNA: FLJ22888 fis, clone KAT03...    37   1.0     
gb:AC145780_1744491 Oryza sativa chromosome 3 BAC OSJNBb0069P02 ...    37   1.0     
gb:AK012952_1157247 Mus musculus 10, 11 days embryo whole body c...    37   1.0     
gb:AF370422_1150927 Homo sapiens PP14630 mRNA, complete cds.           37   1.0     
gb:AB167956_16069 Ralstonia solanacearum lrpE gene for leucine-r...    37   1.0     
sp|Q13309|SKP2_HUMAN|SKP2_HUMAN S-phase kinase-associated protein 2 (F-box ...    37   1.0     
sp|Q8N531|FXL6_HUMAN|FXL6_HUMAN F-box/LRR-repeat protein 6 (F-box and leuci...    37   1.0     
sp|Q8L899|BRI1_LYCPE|BRI1_LYCPE Systemin receptor SR160 precursor (EC 2.7.1...    37   1.0     
sp|O35381|A32A_MOUSE|A32A_MOUSE Acidic leucine-rich nuclear phosphoprotein ...    37   1.0     
gb:BC059812_2103772 Mus musculus F-box and leucine-rich repeat p...    37   1.3     
gb:BC053109_2101459 Mus musculus F-box and leucine-rich repeat p...    37   1.3     
gb:BC059173_1985597 Homo sapiens F-box and leucine-rich repeat p...    37   1.3     
gb:BC000608_1966876 Homo sapiens acidic (leucine-rich) nuclear p...    37   1.3     
gb:OSJN00079_1694482 Oryza sativa genomic DNA, chromosome 4, BAC...    37   1.3     
gb:CER05H5_1366508 Caenorhabditis elegans cosmid R05H5, complete...    37   1.3     
gb:HSM802344_1186685 Homo sapiens mRNA; cDNA DKFZp434K0410 (from...    37   1.3     
gb:AK031431_1162443 Mus musculus 13 days embryo male testis cDNA...    37   1.3     
gb:AE014297_1140115 Drosophila melanogaster chromosome 3R, compl...    37   1.3     
pir|T46301|T46301 hypothetical protein DKFZp434K0410.1 - human (...    37   1.3     
pir|T23945|T23945 hypothetical protein T01E8.1 - Caenorhabditis ...    37   1.3     
pir|T52139|T52139 LRR-containing F-box protein [imported] - Arab...    37   1.3     
sp|P39687|A32A_HUMAN|A32A_HUMAN Acidic leucine-rich nuclear phosphoprotein ...    37   1.3     
gb:AF231021_1891711 Homo sapiens leucine-rich-repeat protein RNO...    36   1.7     
gb:AF174592_1887910 Homo sapiens F-box protein Fbl6 (FBL6) mRNA,...    36   1.7     
gb:AP006533_1862342 Oryza sativa (japonica cultivar-group) genom...    36   1.7     
gb:AP005305_1850214 Oryza sativa (japonica cultivar-group) genom...    36   1.7     
gb:AE017344_1756364 Cryptococcus neoformans var. neoformans JEC2...    36   1.7     
gb:AB017062_1513327 Arabidopsis thaliana genomic DNA, chromosome...    36   1.7     
gb:AY162293_1425937 Canis familiaris inhibitor-1 of protein phos...    36   1.7     
gb:BX908798_830526 Parachlamydia-related symbiont UWE25, complet...    36   1.7     
pir|T06608|T06608 disease resistance protein homolog F16J13.80 -...    36   1.7     
sp|P59047|NAL5_HUMAN|NAL5_HUMAN NACHT-, LRR- and PYD-containing protein 5 (...    36   1.7     
gb:AP005295_1850049 Oryza sativa (japonica cultivar-group) genom...    36   2.3     
gb:NCB2F7_1689986 Neurospora crassa DNA linkage group V BAC clon...    36   2.3     
gb:BC086002_2564595 Xenopus laevis hypothetical LOC495550, mRNA ...    35   3.0     
gb:BC083744_2108815 Rattus norvegicus cDNA clone MGC:94666 IMAGE...    35   3.0     
gb:AL606804_1930924 Human DNA sequence from clone RP11-978I15 on...    35   3.0     
gb:AF468522_1904049 Homo sapiens NALP3 long isoform (NALP3) mRNA...    35   3.0     
gb:AP005764_1857464 Oryza sativa (japonica cultivar-group) genom...    35   3.0     
gb:AC130602_1740771 Oryza sativa (japonica cultivar-group) chrom...    35   3.0     
gb:AC092559_1735540 Oryza sativa chromosome 3 BAC OSJNBb0096M04 ...    35   3.0     
gb:AC084218_1733375 Oryza sativa (japonica cultivar-group) chrom...    35   3.0     
gb:AB023482_1515588 Oryza sativa (japonica cultivar-group) genom...    35   3.0     
gb:AK088401_1175382 Mus musculus 2 days neonate thymus thymic ce...    35   3.0     
gb:AK076049_1171196 Mus musculus 11 days embryo whole body cDNA,...    35   3.0     
gb:AK049647_1168906 Mus musculus 12 days embryo spinal cord cDNA...    35   3.0     
gb:AL646066_546728 Ralstonia solanacearum GMI1000 chromosome, co...    35   3.0     
gb:AL646064_546284 Ralstonia solanacearum GMI1000 chromosome, co...    35   3.0     
sp|Q96P20|CIS1_HUMAN|CIS1_HUMAN Cold autoinflammatory syndrome 1 protein (C...    35   3.0     
sp|Q8GUQ5|BRI1_LYCES|BRI1_LYCES Brassinosteroid LRR receptor kinase precurs...    35   3.0     
sp|P97822|A32E_MOUSE|A32E_MOUSE Acidic leucine-rich nuclear phosphoprotein ...    35   3.0     
gb:BC086264_2564837 Xenopus tropicalis hypothetical LOC496596, m...    35   3.9     
gb:BC048047_2550008 Danio rerio zgc:55516, mRNA (cDNA clone MGC:...    35   3.9     
gb:AF176525_2057841 Mus musculus F-box protein FBL12 mRNA, compl...    35   3.9     
gb:AB050980_1867875 Homo sapiens skp2-beta mRNA for SKP2-like pr...    35   3.9     
gb:OSJN00216_1696875 Oryza sativa genomic DNA, chromosome 4, BAC...    35   3.9     
gb:AB013396_1512190 Arabidopsis thaliana genomic DNA, chromosome...    35   3.9     
pir|T23427|T23427 hypothetical protein K07G5.1 - Caenorhabditis ...    35   3.9     
sp|Q9FKZ0|DR43_ARATH|DR43_ARATH Probable disease resistance protein At5g669...    35   3.9     
sp|Q8R4B8|CIS1_MOUSE|CIS1_MOUSE Cold autoinflammatory syndrome 1 protein ho...    35   3.9     
gb:BC060336_2552819 Xenopus laevis hypothetical protein MGC68731...    35   5.1     
gb:AY653733_2371603 Mimivirus, complete genome.                        35   5.1     
gb:AY057381_1935427 Homo sapiens lecuine-rich acidic protein-lik...    35   5.1     
gb:AL606804_1930925 Human DNA sequence from clone RP11-978I15 on...    35   5.1     
gb:AL138795_1919940 Human DNA sequence from clone RP4-790G17 on ...    35   5.1     
gb:AK095228_1914317 Homo sapiens cDNA FLJ37909 fis, clone CTONG1...    35   5.1     
gb:AP004746_1844284 Oryza sativa (japonica cultivar-group) genom...    35   5.1     
gb:AP003275_1827009 Oryza sativa (japonica cultivar-group) genom...    35   5.1     
gb:AP003237_1825947 Oryza sativa (japonica cultivar-group) genom...    35   5.1     
gb:AP002817_1822854 Oryza sativa (japonica cultivar-group) genom...    35   5.1     
gb:AF154916_1772937 Chlamydomonas reinhardtii variable flagellar...    35   5.1     
gb:AE016959_1023848 Oryza sativa (japonica cultivar-group) chrom...    35   5.1     
gb:AE017248_415626 Treponema denticola ATCC 35405, section 3 of ...    35   5.1     
gb:AB178010_16270 Ralstonia solanacearum lrpC, lrpD gene for leu...    35   5.1     
pir|T00403|T00403 hypothetical protein At2g44900 [imported] - Ar...    35   5.1     
sp|Q9BTT0|A32E_HUMAN|A32E_HUMAN Acidic leucine-rich nuclear phosphoprotein ...    35   5.1     
gb:BX005238_2566992 Zebrafish DNA sequence from clone DKEY-61P9 ...    34   6.6     
gb:BC072202_2556461 Xenopus laevis hypothetical protein MGC81139...    34   6.6     
gb:OSJN00053_1693973 Oryza sativa genomic DNA, chromosome 4, BAC...    34   6.6     
gb:AY428737_1605824 Nicotiana tabacum coronatine-insensitive 1 (...    34   6.6     
gb:AY128385_1580684 Arabidopsis thaliana putative disease resist...    34   6.6     
gb:AY091565_1574670 Pinus taeda NBS/LRR mRNA, partial cds.             34   6.6     
gb:AB019223_1514024 Arabidopsis thaliana genomic DNA, chromosome...    34   6.6     
gb:AF118397_1242768 Entamoeba histolytica actin-binding protein ...    34   6.6     
gb:AC114263_1205611 Dictyostelium discoideum chromosome 2 map 21...    34   6.6     
gb:BX908798_830897 Parachlamydia-related symbiont UWE25, complet...    34   6.6     
pir|G84524|G84524 probable disease resistance protein [imported]...    34   6.6     
pir|T34456|T34456 hypothetical protein T19H12.2 - Caenorhabditis...    34   6.6     
sp|Q8VZC7|DR36_ARATH|DR36_ARATH Probable disease resistance protein At5g455...    34   6.6     
gb:AY313452_2526543 Coturnix japonica lectin associated matrix p...    34   8.7     
gb:AJ719485_2501672 Gallus gallus mRNA for hypothetical protein,...    34   8.7     
gb:AJ719354_2501541 Gallus gallus mRNA for hypothetical protein,...    34   8.7     
gb:AY490797_1608693 Helianthus annuus clone Ha-NTIR3B CC-NBS-LRR...    34   8.7     
gb:AY196151_1588912 Solanum tuberosum nematode resistance protei...    34   8.7     
gb:AY087774_1572801 Arabidopsis thaliana clone 38347 mRNA, compl...    34   8.7     
gb:AB104529_1526474 Pisum sativum LKA mRNA for brassinosteroid r...    34   8.7     
gb:AB010070_1510876 Arabidopsis thaliana genomic DNA, chromosome...    34   8.7     
gb:AC024809_1204738 Caenorhabditis elegans cosmid Y53G8AR, compl...    34   8.7     
gb:AK012759_1157145 Mus musculus 10, 11 days embryo whole body c...    34   8.7     
pir|A85046|A85046 probable nodulin [imported] - Arabidopsis thal...    34   8.7     
pir|F85068|F85068 N7 like-protein [imported] - Arabidopsis thali...    34   8.7     


>pir|A84649|A84649 probable glucose regulated repressor protein
            [imported] - Arabidopsis thaliana>gb:AC006300_1534039
            Arabidopsis thaliana chromosome 2 clone F13B15 map mi238,
            complete sequence.>gb:AY072205_1567093 Arabidopsis
            thaliana putative F-box protein family, AtFBL6
            (At2g25490) mRNA, complete cds.>gb:AY091333_1574537
            Arabidopsis thaliana unknown protein (At2g25490) mRNA,
            complete cds.>gb:AJ609238_1811998 Arabidopsis thaliana
            mRNA for F-box protein (ebf1 gene).
          Length = 628

 Score =  404 bits (1037), Expect = e-111
 Identities = 203/361 (56%), Positives = 268/361 (74%)
 Frame = -3

Query: 1440 IASLFSSAGNHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQ 1261
            IASL S+    L K+KLQ LN++D+SLAV+GHYG+++TDL L  L +++E+GFWVMG+G 
Sbjct: 273  IASLLSNTTCSLAKLKLQMLNVTDVSLAVVGHYGLSITDLVLAGLSHVSEKGFWVMGNGV 332

Query: 1260 GLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESL 1081
            GL KL SL ITACQGVTD+G+E+V KGCPN+K+  + K  LLSDNG+VSF KA+ S+ESL
Sbjct: 333  GLQKLNSLTITACQGVTDMGLESVGKGCPNMKKAIISKSPLLSDNGLVSFAKASLSLESL 392

Query: 1080 QLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCT 901
            QLEECHR++Q G FG L++   KLKA +  NC  ++DL  G+PA   C++LRSLSI NC 
Sbjct: 393  QLEECHRVTQFGFFGSLLNCGEKLKAFSLVNCLSIRDLTTGLPASSHCSALRSLSIRNCP 452

Query: 900  GFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTI 721
            GFGDA+L  + +LCP L  ++L GL G+T+ G L  +QS    LVK+N SGC N+TD+ I
Sbjct: 453  GFGDANLAAIGKLCPQLEDIDLCGLKGITESGFLHLIQS---SLVKINFSGCSNLTDRVI 509

Query: 720  SAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSA 541
            SAI   +G TLE+LN++GC  +TDASL +IA  C +L DLDISK  +SD GI ALA  S+
Sbjct: 510  SAITARNGWTLEVLNIDGCSNITDASLVSIAANCQILSDLDISKCAISDSGIQALA--SS 567

Query: 540  IQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL 361
             +  LQILS++GC + +DK LP +  LG++L GLN+Q C  IS+  VD LVERL++CDIL
Sbjct: 568  DKLKLQILSVAGCSMVTDKSLPAIVGLGSTLLGLNLQQCRSISNSTVDFLVERLYKCDIL 627

Query: 360  S 358
            S
Sbjct: 628  S 628



 Score =  120 bits (300), Expect = 9e-26
 Identities = 102/396 (25%), Positives = 166/396 (41%), Gaps = 53/396 (13%)
 Frame = -3

Query: 1386 SLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTD 1207
            S  +SD+ L  IG    +L  L+L N+  I + G  ++   +G  +L  L +  C  +TD
Sbjct: 161  SAKVSDLGLRSIGRSCPSLGSLSLWNVSTITDNG--LLEIAEGCAQLEKLELNRCSTITD 218

Query: 1206 LGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILV 1027
             G+ A++K CPN+ +L L  C+ + D G+++  ++   ++S+ ++ C  +   G+  +L 
Sbjct: 219  KGLVAIAKSCPNLTELTLEACSRIGDEGLLAIARSCSKLKSVSIKNCPLVRDQGIASLLS 278

Query: 1026 H---SAGKLK---------ALAFENCFGMKDLAFGVPALPPCN--------------SLR 925
            +   S  KLK         +LA    +G+      +  L   +               L 
Sbjct: 279  NTTCSLAKLKLQMLNVTDVSLAVVGHYGLSITDLVLAGLSHVSEKGFWVMGNGVGLQKLN 338

Query: 924  SLSICNCTGFGDASLVVLSRLCPN--------------------------LVHLNLSGLN 823
            SL+I  C G  D  L  + + CPN                          L  L L   +
Sbjct: 339  SLTITACQGVTDMGLESVGKGCPNMKKAIISKSPLLSDNGLVSFAKASLSLESLQLEECH 398

Query: 822  GVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDAS 643
             VT +G    + +C   L   +L  C+++ D T    A  H   L  L++  C    DA+
Sbjct: 399  RVTQFGFFGSLLNCGEKLKAFSLVNCLSIRDLTTGLPASSHCSALRSLSIRNCPGFGDAN 458

Query: 642  LAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYL-H 466
            LAAI   C  L D+D+   +    GI        IQ SL  ++ SGC   +D+ +  +  
Sbjct: 459  LAAIGKLCPQLEDIDLCGLK----GITESGFLHLIQSSLVKINFSGCSNLTDRVISAITA 514

Query: 465  KLGNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS 358
            + G +L  LNI  C  I+      LV     C ILS
Sbjct: 515  RNGWTLEVLNIDGCSNITDAS---LVSIAANCQILS 547



 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 57/173 (32%), Positives = 82/173 (47%), Gaps = 4/173 (2%)
 Frame = -3

Query: 909 NCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTD 730
           N     D  L  + R CP+L  L+L  ++ +TD GLL   + C A L K+ L+ C  +TD
Sbjct: 160 NSAKVSDLGLRSIGRSCPSLGSLSLWNVSTITDNGLLEIAEGC-AQLEKLELNRCSTITD 218

Query: 729 KTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALA 553
           K + AIAK      E L L  C  + D  L AIA  CS L+ + I     V D GIA+L 
Sbjct: 219 KGLVAIAKSCPNLTE-LTLEACSRIGDEGLLAIARSCSKLKSVSIKNCPLVRDQGIASLL 277

Query: 552 GG---SAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG 403
                S  +  LQ+L++      +D  L  +   G S+  L +     +S +G
Sbjct: 278 SNTTCSLAKLKLQMLNV------TDVSLAVVGHYGLSITDLVLAGLSHVSEKG 324



>gb:AY485830_1608507 Arabidopsis thaliana EIN3-binding F-box protein 2
            (EBF2) mRNA, complete cds.>gb:AJ609239_1811999
            Arabidopsis thaliana mRNA for F-box protein (ebf2 gene).
          Length = 623

 Score =  380 bits (976), Expect = e-104
 Identities = 198/362 (54%), Positives = 255/362 (70%), Gaps = 2/362 (0%)
 Frame = -3

Query: 1440 IASLFSSAGNHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQ 1261
            +A L + AG++L KVKLQ LN+S +SLAVIGHYG A+TDL L  LQ +NE+GFWVMG+ +
Sbjct: 263  VAFLLAQAGSYLTKVKLQMLNVSGLSLAVIGHYGAAVTDLVLHGLQGVNEKGFWVMGNAK 322

Query: 1260 GLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESL 1081
            GL KL+SL + +C+G+TD+G+EAV  GCP++K + L KC L+S  G+V+  K+A S+ESL
Sbjct: 323  GLKKLKSLSVMSCRGMTDVGLEAVGNGCPDLKHVSLNKCLLVSGKGLVALAKSALSLESL 382

Query: 1080 QLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDL--AFGVPALPPCNSLRSLSICN 907
            +LEECHRI+Q G+ G L++   KLKA +  NC G+ D      +P+ P C+SLRSLSI  
Sbjct: 383  KLEECHRINQFGLMGFLMNCGSKLKAFSLANCLGISDFNSESSLPS-PSCSSLRSLSIRC 441

Query: 906  CTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDK 727
            C GFGDASL  L + C  L  + L GLNGVTD G+   +QS + GLVKVNLS CINV+D 
Sbjct: 442  CPGFGDASLAFLGKFCHQLQDVELCGLNGVTDAGVRELLQSNNVGLVKVNLSECINVSDN 501

Query: 726  TISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGG 547
            T+SAI+  HG TLE LNL+GC  +T+ASL A+A  C  + DLDIS + VSD GI ALA  
Sbjct: 502  TVSAISVCHGRTLESLNLDGCKNITNASLVAVAKNCYSVNDLDISNTLVSDHGIKALA-S 560

Query: 546  SAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVERLWRCD 367
            S    +LQ+LS+ GC   +DK    + KLG +L GLNIQ C  IS   VD L+E LWRCD
Sbjct: 561  SPNHLNLQVLSIGGCSSITDKSKACIQKLGRTLLGLNIQRCGRISSSTVDTLLENLWRCD 620

Query: 366  IL 361
            IL
Sbjct: 621  IL 622



 Score =  105 bits (262), Expect = 2e-21
 Identities = 82/378 (21%), Positives = 165/378 (43%), Gaps = 55/378 (14%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGI 1198
            ++D+ L  + H   +L  ++L NL  +++ G   +   +    +  L ++ C G+TD G+
Sbjct: 154  VTDVGLGAVAHGCPSLRIVSLWNLPAVSDLGLSEIA--RSCPMIEKLDLSRCPGITDSGL 211

Query: 1197 EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV-------- 1042
             A+++ C N+  L +  C+ + + G+ +  +   ++ S+ +  C RI   GV        
Sbjct: 212  VAIAENCVNLSDLTIDSCSGVGNEGLRAIARRCVNLRSISIRSCPRIGDQGVAFLLAQAG 271

Query: 1041 -----------------FGILVHSAGKLKALAFENCFGMKDLAFGVPA-LPPCNSLRSLS 916
                               ++ H    +  L      G+ +  F V         L+SLS
Sbjct: 272  SYLTKVKLQMLNVSGLSLAVIGHYGAAVTDLVLHGLQGVNEKGFWVMGNAKGLKKLKSLS 331

Query: 915  ICNCTGFGDASLVVLSRLCPNLVHLNLS--------GL------------------NGVT 814
            + +C G  D  L  +   CP+L H++L+        GL                  + + 
Sbjct: 332  VMSCRGMTDVGLEAVGNGCPDLKHVSLNKCLLVSGKGLVALAKSALSLESLKLEECHRIN 391

Query: 813  DYGLLPFVQSCDAGLVKVNLSGCINVTD-KTISAIAKLHGETLELLNLNGCGCVTDASLA 637
             +GL+ F+ +C + L   +L+ C+ ++D  + S++      +L  L++  C    DASLA
Sbjct: 392  QFGLMGFLMNCGSKLKAFSLANCLGISDFNSESSLPSPSCSSLRSLSIRCCPGFGDASLA 451

Query: 636  AIADYCSVLRDLDI-SKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL 460
             +  +C  L+D+++   + V+D G+  L   + +   L  ++LS C+  SD  +  +   
Sbjct: 452  FLGKFCHQLQDVELCGLNGVTDAGVRELLQSNNV--GLVKVNLSECINVSDNTVSAISVC 509

Query: 459  -GNSLAGLNIQNCVGISH 409
             G +L  LN+  C  I++
Sbjct: 510  HGRTLESLNLDGCKNITN 527



>pir|T08604|T08604 hypothetical protein GRR1 -
            soybean>gb:AF019910_1761610 Glycine max grr1 (grr1) mRNA,
            complete cds.
          Length = 690

 Score =  351 bits (900), Expect = 2e-95
 Identities = 174/316 (55%), Positives = 234/316 (74%), Gaps = 1/316 (0%)
 Frame = -3

Query: 1440 IASLFSSAGNHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQ 1261
            +A L SSA   L KVKL+SL +SD+SLAVIGHYGVA+TDL LI L N++E+GFWVMG+  
Sbjct: 321  VAGLLSSASFALTKVKLESLTVSDLSLAVIGHYGVAVTDLVLICLPNVSEKGFWVMGNAH 380

Query: 1260 GLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESL 1081
            GL KL S+ I  CQGVTD+G+E + +GCPNV+ L LRK   LSD G+VSF +AA S+ESL
Sbjct: 381  GLQKLTSITINCCQGVTDVGLEPIGRGCPNVQNLKLRKSAFLSDKGLVSFARAAPSVESL 440

Query: 1080 QL-EECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNC 904
            QL +  HRI+Q G+FG+  +   KLK L   +C+G+KDL   +PA+ P  S+ SL+I +C
Sbjct: 441  QLAKSAHRITQIGLFGVFFNCGAKLKVLTLISCYGIKDLNMDLPAISPSESIWSLTIHDC 500

Query: 903  TGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKT 724
             GFG+A+L +L +LCP L H+ LSGL GVTD G LP ++S +AGLVKVNL+GC+N++D+ 
Sbjct: 501  PGFGNANLALLGKLCPRLQHVELSGLQGVTDAGFLPLLESSEAGLVKVNLNGCVNLSDRV 560

Query: 723  ISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGS 544
            + ++   HG TLE+L+L+GC  V DASL AIA  C +L DLD+S+  ++D GIAALA G 
Sbjct: 561  VLSMVNSHGWTLEVLSLDGCKRVGDASLMAIAGSCPLLADLDVSRCAITDTGIAALARGK 620

Query: 543  AIQFSLQILSLSGCVL 496
              Q +L++LSL+GC +
Sbjct: 621  --QINLEVLSLAGCAI 634



 Score = 94.0 bits (232), Expect = 7e-18
 Identities = 82/292 (28%), Positives = 135/292 (46%), Gaps = 3/292 (1%)
 Frame = -3

Query: 1260 GLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESL 1081
            GL KL      + +GVT++G++A++ GCP++K   L     + D G++        +E L
Sbjct: 198  GLGKLTIRGCNSDRGVTNVGLKAIAHGCPSLKVCSLWDVATVGDVGLIEIASGCHQLEKL 257

Query: 1080 QLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCT 901
             L +C  IS   +  +   +   L  L+ E+C  + +   G+ A+  C +LRS+SI NC+
Sbjct: 258  DLCKCPNISDKTLIAV-AKNCPNLAELSIESCPNIGN--EGLQAIGKCPNLRSISIKNCS 314

Query: 900  GFGDASLV-VLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKT 724
            G GD  +  +LS     L  + L  L  V+D   L  +      +  + L    NV++K 
Sbjct: 315  GVGDQGVAGLLSSASFALTKVKLESLT-VSDLS-LAVIGHYGVAVTDLVLICLPNVSEKG 372

Query: 723  ISAIAKLHG-ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSDFGIAALAG 550
               +   HG + L  + +N C  VTD  L  I   C  +++L + KS  +SD G+ + A 
Sbjct: 373  FWVMGNAHGLQKLTSITINCCQGVTDVGLEPIGRGCPNVQNLKLRKSAFLSDKGLVSFAR 432

Query: 549  GSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDL 394
             +    SLQ L+ S   +            G  L  L + +C GI    +DL
Sbjct: 433  AAPSVESLQ-LAKSAHRITQIGLFGVFFNCGAKLKVLTLISCYGIKDLNMDL 483



 Score = 44.7 bits (104), Expect = 0.005
 Identities = 50/178 (28%), Positives = 75/178 (42%), Gaps = 6/178 (3%)
 Frame = -3

Query: 906 CTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDK 727
           C       L++LS +C   +H   S  N   +          D G +  +L G    TD 
Sbjct: 134 CASVSKRWLMLLSSICKTEIHSYGSTGNENQEIS--------DEGYLSRSLEGK-KATDV 184

Query: 726 TISAIAKLHGET--LELLNLNGCGC---VTDASLAAIADYCSVLRDLDI-SKSRVSDFGI 565
            ++AIA        L  L + GC     VT+  L AIA  C  L+   +   + V D G+
Sbjct: 185 RLAAIAVGTASRGGLGKLTIRGCNSDRGVTNVGLKAIAHGCPSLKVCSLWDVATVGDVGL 244

Query: 564 AALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
             +A G      L+ L L  C   SDK L  + K   +LA L+I++C  I + G+  +
Sbjct: 245 IEIASGC---HQLEKLDLCKCPNISDKTLIAVAKNCPNLAELSIESCPNIGNEGLQAI 299



>gb:AP003629_1831741 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC clone:P0481H08.
          Length = 627

 Score =  337 bits (865), Expect = 3e-91
 Identities = 172/362 (47%), Positives = 251/362 (69%), Gaps = 1/362 (0%)
 Frame = -3

Query: 1440 IASLFSSAGNHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQ 1261
            ++ L  SA   L KV+LQ L+I+D SL+VIG+YG A+TDL L  L  + ERGFWVM +  
Sbjct: 270  VSGLVCSAAASLAKVRLQGLSITDASLSVIGYYGKAITDLTLARLPAVGERGFWVMANAL 329

Query: 1260 GLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESL 1081
            GL KLR + +++C GVTDL + +++K CP++KQL L+KC  +SD  +  F ++A+ +ESL
Sbjct: 330  GLQKLRFMSVSSCPGVTDLALASIAKFCPSLKQLNLKKCGQVSDGRLKDFAESAKVLESL 389

Query: 1080 QLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCT 901
            Q+EEC++++  G+   L++ + K KAL+   C G+KD+      LP C SLRSL+I +C 
Sbjct: 390  QIEECNKVTLMGILAFLLNCSPKFKALSLVKCNGIKDICSAPAQLPLCKSLRSLTIKDCP 449

Query: 900  GFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTI 721
            GF DASL V+  +CP L +++LSGL  VTD GLLP ++S ++GLV V+L+GC N+TD T+
Sbjct: 450  GFTDASLAVVGMICPQLENVDLSGLGAVTDNGLLPLIKSSESGLVHVDLNGCENLTDATV 509

Query: 720  SAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSA 541
            SA+ K HG +L  L+L GC  +TDASL AI++ C+ L +LD+S   VSD+G+A LA  SA
Sbjct: 510  SALVKAHGSSLARLSLEGCSRITDASLFAISEGCTDLAELDLSNCMVSDYGVAVLA--SA 567

Query: 540  IQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQ-NCVGISHRGVDLLVERLWRCDI 364
             Q  L++LSLSGC+  + K +P+L  +  SL GLN+Q N +G  +  +  L ++LW CDI
Sbjct: 568  RQLKLRVLSLSGCLKVTQKSVPFLGSMSASLEGLNLQFNFIG--NHNIASLEKQLWWCDI 625

Query: 363  LS 358
            L+
Sbjct: 626  LA 627



 Score = 95.9 bits (237), Expect = 2e-18
 Identities = 86/315 (27%), Positives = 144/315 (45%), Gaps = 31/315 (9%)
 Frame = -3

Query: 1263 QGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAA----- 1099
            QG   L+ + + AC GV D G++A+ + C  ++ + ++ C  + D GV   V +A     
Sbjct: 223  QGCPDLKVVTVEACPGVADEGLKAIGRCCAKLQSVNIKNCAHVGDQGVSGLVCSAAASLA 282

Query: 1098 ---------------------ESIESLQLEECHRISQAGVFGILVHSAG--KLKALAFEN 988
                                 ++I  L L     + + G F ++ ++ G  KL+ ++  +
Sbjct: 283  KVRLQGLSITDASLSVIGYYGKAITDLTLARLPAVGERG-FWVMANALGLQKLRFMSVSS 341

Query: 987  CFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDY 808
            C G+ DLA    A   C SL+ L++  C    D  L   +     L  L +   N VT  
Sbjct: 342  CPGVTDLALASIA-KFCPSLKQLNLKKCGQVSDGRLKDFAESAKVLESLQIEECNKVTLM 400

Query: 807  GLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLH-GETLELLNLNGCGCVTDASLAAI 631
            G+L F+ +C      ++L  C  + D   SA A+L   ++L  L +  C   TDASLA +
Sbjct: 401  GILAFLLNCSPKFKALSLVKCNGIKD-ICSAPAQLPLCKSLRSLTIKDCPGFTDASLAVV 459

Query: 630  ADYCSVLRDLDIS-KSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL-G 457
               C  L ++D+S    V+D G+  L   S  +  L  + L+GC   +D  +  L K  G
Sbjct: 460  GMICPQLENVDLSGLGAVTDNGLLPLIKSS--ESGLVHVDLNGCENLTDATVSALVKAHG 517

Query: 456  NSLAGLNIQNCVGIS 412
            +SLA L+++ C  I+
Sbjct: 518  SSLARLSLEGCSRIT 532



>gb:AP004869_1846301 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC clone:P0419A09.
          Length = 660

 Score =  331 bits (849), Expect = 2e-89
 Identities = 169/361 (46%), Positives = 243/361 (67%)
 Frame = -3

Query: 1440 IASLFSSAGNHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQ 1261
            I+SL  SA   L K++LQ LNI+D SLA+IG+YG A+TDL L+ L  + ERGFWVM +  
Sbjct: 302  ISSLVCSATASLTKIRLQGLNITDASLALIGYYGKAVTDLTLVRLPVVAERGFWVMANAA 361

Query: 1260 GLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESL 1081
            GL  LR + +T+C GVT+L + A++K CP+++QL  RKC  ++D G+ +F ++A  +ESL
Sbjct: 362  GLQNLRCMSVTSCPGVTNLALAAIAKFCPSLRQLSFRKCGHMTDAGLKAFTESARLLESL 421

Query: 1080 QLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCT 901
            QLEEC+ ++  G+   LV+   K ++L+   C G+KD+      LP C SL+ L+I +C 
Sbjct: 422  QLEECNGVTLVGILDFLVNCGPKFRSLSLVKCMGIKDICSTPAQLPLCKSLQFLTIKDCP 481

Query: 900  GFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTI 721
             F DASL V+  +CP L  ++LSGL  VTD GLLP + S + GLVKV+LSGC N+TD  +
Sbjct: 482  DFTDASLAVVGMVCPYLEQVDLSGLREVTDRGLLPLINSSEGGLVKVDLSGCKNITDAAV 541

Query: 720  SAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSA 541
            S + K HG++L+ ++L GC  +TDASL AI++ C+ L +LD+SK  VSD G+A LA  SA
Sbjct: 542  STLVKGHGKSLKQVSLEGCSKITDASLFAISENCTELAELDLSKCMVSDNGVATLA--SA 599

Query: 540  IQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL 361
                L++LSLSGC   + K + +L  +G SL GLN+Q C  I +  +  L ++LW CDIL
Sbjct: 600  KHLKLRVLSLSGCSKVTPKSVSFLGNMGQSLEGLNLQFCNMIGNHNIASLEKQLWWCDIL 659

Query: 360  S 358
            +
Sbjct: 660  A 660



 Score =  110 bits (274), Expect = 1e-22
 Identities = 96/377 (25%), Positives = 160/377 (42%), Gaps = 55/377 (14%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGI 1198
            ++D  L  +      L  LAL ++  + + G   + +G     L  L IT C  +TD G+
Sbjct: 193  VTDRGLLAVARGSPNLCSLALWDVPLVTDAGLAEIAAG--CPSLERLDITRCPLITDKGL 250

Query: 1197 EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV-------- 1042
             AV+ GCPN+  L +  C+ + ++G+ +  ++   I++L ++ C RI   G+        
Sbjct: 251  AAVAHGCPNLLSLTVESCSGVGNDGLRAIGRSCSKIQALNIKNCARIGDQGISSLVCSAT 310

Query: 1041 -------------------------------------------FGILVHSAG--KLKALA 997
                                                       F ++ ++AG   L+ ++
Sbjct: 311  ASLTKIRLQGLNITDASLALIGYYGKAVTDLTLVRLPVVAERGFWVMANAAGLQNLRCMS 370

Query: 996  FENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGV 817
              +C G+ +LA    A   C SLR LS   C    DA L   +     L  L L   NGV
Sbjct: 371  VTSCPGVTNLALAAIA-KFCPSLRQLSFRKCGHMTDAGLKAFTESARLLESLQLEECNGV 429

Query: 816  TDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLA 637
            T  G+L F+ +C      ++L  C+ + D   +       ++L+ L +  C   TDASLA
Sbjct: 430  TLVGILDFLVNCGPKFRSLSLVKCMGIKDICSTPAQLPLCKSLQFLTIKDCPDFTDASLA 489

Query: 636  AIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK- 463
             +   C  L  +D+S  R V+D G+  L   S  +  L  + LSGC   +D  +  L K 
Sbjct: 490  VVGMVCPYLEQVDLSGLREVTDRGLLPLINSS--EGGLVKVDLSGCKNITDAAVSTLVKG 547

Query: 462  LGNSLAGLNIQNCVGIS 412
             G SL  ++++ C  I+
Sbjct: 548  HGKSLKQVSLEGCSKIT 564



 Score =  104 bits (260), Expect = 4e-21
 Identities = 84/292 (28%), Positives = 139/292 (47%), Gaps = 4/292 (1%)
 Frame = -3

Query: 1278 VMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAA 1099
            V GS +GL KL        +GVTD G+ AV++G PN+  L L    L++D G+       
Sbjct: 172  VAGSRRGLEKLAVRGSHPTRGVTDRGLLAVARGSPNLCSLALWDVPLVTDAGLAEIAAGC 231

Query: 1098 ESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPAL-PPCNSLRS 922
             S+E L +  C  I+  G+  +  H    L +L  E+C G+ +   G+ A+   C+ +++
Sbjct: 232  PSLERLDITRCPLITDKGLAAV-AHGCPNLLSLTVESCSGVGN--DGLRAIGRSCSKIQA 288

Query: 921  LSICNCTGFGDASL-VVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGC 745
            L+I NC   GD  +  ++     +L  + L GLN +TD   L  +      +  + L   
Sbjct: 289  LNIKNCARIGDQGISSLVCSATASLTKIRLQGLN-ITD-ASLALIGYYGKAVTDLTLVRL 346

Query: 744  INVTDKTISAIAKLHG-ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDF 571
              V ++    +A   G + L  +++  C  VT+ +LAAIA +C  LR L   K   ++D 
Sbjct: 347  PVVAERGFWVMANAAGLQNLRCMSVTSCPGVTNLALAAIAKFCPSLRQLSFRKCGHMTDA 406

Query: 570  GIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGI 415
            G+ A    + +  SLQ+   +G  L     L +L   G     L++  C+GI
Sbjct: 407  GLKAFTESARLLESLQLEECNGVTLVG--ILDFLVNCGPKFRSLSLVKCMGI 456



 Score = 51.2 bits (121), Expect = 5e-05
 Identities = 42/118 (35%), Positives = 61/118 (51%), Gaps = 1/118 (0%)
 Frame = -3

Query: 738 VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSDFGIA 562
           VTD+ + A+A+     L  L L     VTDA LA IA  C  L  LDI++   ++D G+A
Sbjct: 193 VTDRGLLAVAR-GSPNLCSLALWDVPLVTDAGLAEIAAGCPSLERLDITRCPLITDKGLA 251

Query: 561 ALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLV 388
           A+A G     SL + S SG     +  L  + +  + +  LNI+NC  I  +G+  LV
Sbjct: 252 AVAHGCPNLLSLTVESCSG---VGNDGLRAIGRSCSKIQALNIKNCARIGDQGISSLV 306



 Score = 38.1 bits (87), Expect = 0.46
 Identities = 38/122 (31%), Positives = 63/122 (51%), Gaps = 10/122 (8%)
 Frame = -3

Query: 735 TDKTISAIAKLHGET--LELLNLNGCGC---VTDASLAAIA----DYCSV-LRDLDISKS 586
           TD  ++A+A + G    LE L + G      VTD  L A+A    + CS+ L D+ +   
Sbjct: 162 TDVRLAAMAVVAGSRRGLEKLAVRGSHPTRGVTDRGLLAVARGSPNLCSLALWDVPL--- 218

Query: 585 RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHR 406
            V+D G+A +A G     SL+ L ++ C L +DK L  +     +L  L +++C G+ + 
Sbjct: 219 -VTDAGLAEIAAGCP---SLERLDITRCPLITDKGLAAVAHGCPNLLSLTVESCSGVGND 274

Query: 405 GV 400
           G+
Sbjct: 275 GL 276



>gb:AP004869_1846300 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC clone:P0419A09.
          Length = 511

 Score =  331 bits (849), Expect = 2e-89
 Identities = 169/361 (46%), Positives = 243/361 (67%)
 Frame = -3

Query: 1440 IASLFSSAGNHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQ 1261
            I+SL  SA   L K++LQ LNI+D SLA+IG+YG A+TDL L+ L  + ERGFWVM +  
Sbjct: 153  ISSLVCSATASLTKIRLQGLNITDASLALIGYYGKAVTDLTLVRLPVVAERGFWVMANAA 212

Query: 1260 GLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESL 1081
            GL  LR + +T+C GVT+L + A++K CP+++QL  RKC  ++D G+ +F ++A  +ESL
Sbjct: 213  GLQNLRCMSVTSCPGVTNLALAAIAKFCPSLRQLSFRKCGHMTDAGLKAFTESARLLESL 272

Query: 1080 QLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCT 901
            QLEEC+ ++  G+   LV+   K ++L+   C G+KD+      LP C SL+ L+I +C 
Sbjct: 273  QLEECNGVTLVGILDFLVNCGPKFRSLSLVKCMGIKDICSTPAQLPLCKSLQFLTIKDCP 332

Query: 900  GFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTI 721
             F DASL V+  +CP L  ++LSGL  VTD GLLP + S + GLVKV+LSGC N+TD  +
Sbjct: 333  DFTDASLAVVGMVCPYLEQVDLSGLREVTDRGLLPLINSSEGGLVKVDLSGCKNITDAAV 392

Query: 720  SAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSA 541
            S + K HG++L+ ++L GC  +TDASL AI++ C+ L +LD+SK  VSD G+A LA  SA
Sbjct: 393  STLVKGHGKSLKQVSLEGCSKITDASLFAISENCTELAELDLSKCMVSDNGVATLA--SA 450

Query: 540  IQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL 361
                L++LSLSGC   + K + +L  +G SL GLN+Q C  I +  +  L ++LW CDIL
Sbjct: 451  KHLKLRVLSLSGCSKVTPKSVSFLGNMGQSLEGLNLQFCNMIGNHNIASLEKQLWWCDIL 510

Query: 360  S 358
            +
Sbjct: 511  A 511



 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 77/286 (26%), Positives = 130/286 (45%), Gaps = 3/286 (1%)
 Frame = -3

Query: 1263 QGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIES 1084
            +G   L SL +     VTD G+  ++ GCP++++L + +C L++D G+ +      ++ S
Sbjct: 54   RGSPNLCSLALWDVPLVTDAGLAEIAAGCPSLERLDITRCPLITDKGLAAVAHGCPNLLS 113

Query: 1083 LQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNC 904
            L +E C  +   G+  I   S  K++AL  +NC  + D   G+ +L  C++  SL+    
Sbjct: 114  LTVESCSGVGNDGLRAI-GRSCSKIQALNIKNCARIGDQ--GISSL-VCSATASLTKIRL 169

Query: 903  TGFG--DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTD 730
             G    DASL ++      +  L L  L  V + G   +V +  AGL             
Sbjct: 170  QGLNITDASLALIGYYGKAVTDLTLVRLPVVAERGF--WVMANAAGL------------- 214

Query: 729  KTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALA 553
                       + L  +++  C  VT+ +LAAIA +C  LR L   K   ++D G+ A  
Sbjct: 215  -----------QNLRCMSVTSCPGVTNLALAAIAKFCPSLRQLSFRKCGHMTDAGLKAFT 263

Query: 552  GGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGI 415
              + +  SLQ+   +G  L     L +L   G     L++  C+GI
Sbjct: 264  ESARLLESLQLEECNGVTLVG--ILDFLVNCGPKFRSLSLVKCMGI 307



 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 48/162 (29%), Positives = 80/162 (49%), Gaps = 5/162 (3%)
 Frame = -3

Query: 873 LSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG- 697
           ++R  PNL  L L  +  VTD GL      C + L +++++ C  +TDK ++A+A  HG 
Sbjct: 52  VARGSPNLCSLALWDVPLVTDAGLAEIAAGCPS-LERLDITRCPLITDKGLAAVA--HGC 108

Query: 696 ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAAL---AGGSAIQFS 529
             L  L +  C  V +  L AI   CS ++ L+I   +R+ D GI++L   A  S  +  
Sbjct: 109 PNLLSLTVESCSGVGNDGLRAIGRSCSKIQALNIKNCARIGDQGISSLVCSATASLTKIR 168

Query: 528 LQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG 403
           LQ L++      +D  L  +   G ++  L +     ++ RG
Sbjct: 169 LQGLNI------TDASLALIGYYGKAVTDLTLVRLPVVAERG 204



 Score = 48.1 bits (113), Expect = 4e-04
 Identities = 34/91 (37%), Positives = 49/91 (53%), Gaps = 1/91 (1%)
 Frame = -3

Query: 657 VTDASLAAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKC 481
           VTDA LA IA  C  L  LDI++   ++D G+AA+A G     SL + S SG     +  
Sbjct: 70  VTDAGLAEIAAGCPSLERLDITRCPLITDKGLAAVAHGCPNLLSLTVESCSG---VGNDG 126

Query: 480 LPYLHKLGNSLAGLNIQNCVGISHRGVDLLV 388
           L  + +  + +  LNI+NC  I  +G+  LV
Sbjct: 127 LRAIGRSCSKIQALNIKNCARIGDQGISSLV 157



>gb:BC077969_2560613 Xenopus laevis MGC81000 protein, mRNA (cDNA clone
            MGC:81000 IMAGE:5543149), complete cds.
          Length = 436

 Score =  113 bits (283), Expect = 9e-24
 Identities = 90/314 (28%), Positives = 140/314 (44%), Gaps = 28/314 (8%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            LR L +  C GV D  +   ++ C N++ L L  CT ++D    S  K    +  L L  
Sbjct: 93   LRKLSLRGCLGVGDNALRTFAQNCRNIEVLNLNGCTKITDTTSTSLSKFCSKLRQLDLAS 152

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGM-KDLAFGVPAL-PPCNSLRSLSICNCTGF 895
            C  I+   +  I      +L+ L    C  + KD   GV AL   C  LR LS+  CT  
Sbjct: 153  CTSITNLSLKAI-SEGCPQLEQLNISWCDQISKD---GVQALVKGCGGLRLLSLKGCTQL 208

Query: 894  GDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISA 715
             D +L  +   CP LV LNL   + +TD GL+   + C   L  +  SGC N+TD  ++A
Sbjct: 209  EDEALKFIGSHCPELVTLNLQACSQITDDGLITICRGCHK-LQSLCASGCANITDSILNA 267

Query: 714  IAK-------------------------LHGETLELLNLNGCGCVTDASLAAIADYCSVL 610
            + +                          +   LE ++L  C  +TD++L  ++ +C  L
Sbjct: 268  LGQNCPRLRILEVARCSQLTDLGFTTLAKNCHELEKMDLEECVQITDSTLIQLSIHCPRL 327

Query: 609  RDLDISKSR-VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNI 433
            + L +S    ++D GI  L  G+     L+++ L  C L +D  L +L K   SL  + +
Sbjct: 328  QVLSLSHCELITDDGIRHLGNGACAHDRLEVIELDNCPLITDASLEHL-KSCQSLERIEL 386

Query: 432  QNCVGISHRGVDLL 391
             +C  IS  G+  L
Sbjct: 387  YDCQQISRAGIKRL 400



 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 53/197 (26%), Positives = 95/197 (48%), Gaps = 5/197 (2%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGI 1198
            + D +L  IG +   L  L L     I + G   +   +G HKL+SL  + C  +TD  +
Sbjct: 208  LEDEALKFIGSHCPELVTLNLQACSQITDDGLITIC--RGCHKLQSLCASGCANITDSIL 265

Query: 1197 EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSA 1018
             A+ + CP ++ L + +C+ L+D G  +  K    +E + LEEC +I+ + +  + +H  
Sbjct: 266  NALGQNCPRLRILEVARCSQLTDLGFTTLAKNCHELEKMDLEECVQITDSTLIQLSIH-C 324

Query: 1017 GKLKALAFENC-----FGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPN 853
             +L+ L+  +C      G++ L  G  A    + L  + + NC    DASL  L + C +
Sbjct: 325  PRLQVLSLSHCELITDDGIRHLGNGACA---HDRLEVIELDNCPLITDASLEHL-KSCQS 380

Query: 852  LVHLNLSGLNGVTDYGL 802
            L  + L     ++  G+
Sbjct: 381  LERIELYDCQQISRAGI 397



>gb:AB007648_1510210 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MKD15.>gb:AY054268_1563088 Arabidopsis thaliana
            AT5g23340/MKD15_20 mRNA, complete
            cds.>gb:AY133522_1581345 Arabidopsis thaliana
            At5g23340/MKD15_20 mRNA, complete cds.
          Length = 405

 Score =  109 bits (273), Expect = 1e-22
 Identities = 83/327 (25%), Positives = 158/327 (48%), Gaps = 2/327 (0%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGI 1198
            I+D  LA IG     L  L +   + ++++G   +   +G H LR+L +  C+ +TD  +
Sbjct: 111  ITDTGLASIGRCLSLLQFLDVSYCRKLSDKGLSAVA--EGCHDLRALHLAGCRFITDESL 168

Query: 1197 EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSA 1018
            +++S+ C +++ L L+ CT ++D+G+   VK    I+SL + +C  +  AGV  +     
Sbjct: 169  KSLSERCRDLEALGLQGCTNITDSGLADLVKGCRKIKSLDINKCSNVGDAGVSSV----- 223

Query: 1017 GKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN 838
               KA A                    +SL++L + +C   G+ S+  L++ C NL  L 
Sbjct: 224  --AKACA--------------------SSLKTLKLLDCYKVGNESISSLAQFCKNLETLI 261

Query: 837  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGC 658
            + G   ++D  ++    SC   L  + +  C+N++D ++S I K   + LE L++  C  
Sbjct: 262  IGGCRDISDESIMLLADSCKDSLKNLRMDWCLNISDSSLSCILK-QCKNLEALDIGCCEE 320

Query: 657  VTDASLAAI-ADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDK 484
            VTD +   + +D    L+ L +S  ++++  GI  L    +   SL+ + +        +
Sbjct: 321  VTDTAFRDLGSDDVLGLKVLKVSNCTKITVTGIGKLLDKCS---SLEYIDV--------R 369

Query: 483  CLPYLHKLGNSLAGLNIQNCVGISHRG 403
             LP++ ++  S AGL    C  ++  G
Sbjct: 370  SLPHVTEVRCSEAGLEFPKCCKVNFSG 396



 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 46/136 (33%), Positives = 76/136 (55%), Gaps = 7/136 (5%)
 Frame = -3

Query: 771 LVKVNLSGCIN------VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVL 610
           +V+++LS  I+      VTD  ++ I++   + L +LNL+ C  +TD  LA+I    S+L
Sbjct: 68  IVELDLSQSISRSFYPGVTDSDLAVISEGF-KFLRVLNLHNCKGITDTGLASIGRCLSLL 126

Query: 609 RDLDISKSR-VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNI 433
           + LD+S  R +SD G++A+A G      L+ L L+GC   +D+ L  L +    L  L +
Sbjct: 127 QFLDVSYCRKLSDKGLSAVAEGC---HDLRALHLAGCRFITDESLKSLSERCRDLEALGL 183

Query: 432 QNCVGISHRGVDLLVE 385
           Q C  I+  G+  LV+
Sbjct: 184 QGCTNITDSGLADLVK 199



>gb:L14745_1386893 Caenorhabditis elegans cosmid C02F5, complete
            sequence.
          Length = 466

 Score =  109 bits (272), Expect = 2e-22
 Identities = 81/308 (26%), Positives = 144/308 (46%), Gaps = 26/308 (8%)
 Frame = -3

Query: 1440 IASLFSSAGNHLMKVKLQSL-NISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSG 1264
            + +L    G  L ++ L+   N+ D +L         L  L+L   + + +        G
Sbjct: 114  VENLARRCGGFLKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTDAS--CENLG 171

Query: 1263 QGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIES 1084
            +  HKL  L +  C  +TD  ++ +  GCPN+  L +  C  + D GV   +   +S+++
Sbjct: 172  RYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDT 231

Query: 1083 LQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKD-----LAFGVPAL-----PPCN 934
            L L  C  +++  VFG +    G +K L    CF + D     +A G  AL       CN
Sbjct: 232  LILRGCEGLTE-NVFGSVEAHMGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCN 290

Query: 933  ---------------SLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLL 799
                           +L+ L +  CT  GD   + L+R C  L  L++   + ++D+ + 
Sbjct: 291  QISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTIN 350

Query: 798  PFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYC 619
                +C A L +++LS C  +TD++I  +A  H ETL +L L+ C  +TD++L+ +  +C
Sbjct: 351  SLANNCTA-LRELSLSHCELITDESIQNLASKHRETLNVLELDNCPQLTDSTLSHLR-HC 408

Query: 618  SVLRDLDI 595
              L+ +D+
Sbjct: 409  KALKRIDL 416



 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 72/299 (24%), Positives = 138/299 (46%), Gaps = 2/299 (0%)
 Frame = -3

Query: 1281 WVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPN-VKQLCLRKCTLLSDNGVVSFVK 1105
            W + +  G +  R  + T  + V    +E +++ C   +K+L L+ C  + D+ + +F  
Sbjct: 87   WSILALDGSNWQRVDLFTFQRDVKTAVVENLARRCGGFLKELSLKGCENVHDSALRTFTS 146

Query: 1104 AAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLR 925
               ++E L L  C R++ A        + G+                        C+ L 
Sbjct: 147  RCPNLEHLSLYRCKRVTDASC-----ENLGRY-----------------------CHKLN 178

Query: 924  SLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGC 745
             L++ NC+   D ++  +   CPNL +LN+S  + + D G+   + +C + L  + L GC
Sbjct: 179  YLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKS-LDTLILRGC 237

Query: 744  INVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFG 568
              +T+    ++ + H   ++ LNL  C  +TD ++  IA+  + L  L +S  +++SD  
Sbjct: 238  EGLTENVFGSV-EAHMGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRS 296

Query: 567  IAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
            + +L   S    +L++L LSGC L  D     L +    L  L++++C  IS   ++ L
Sbjct: 297  LVSLGQHS---HNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINSL 352



 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 50/213 (23%), Positives = 98/213 (46%), Gaps = 5/213 (2%)
 Frame = -3

Query: 1434 SLFSSAGNHLMKVK----LQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGS 1267
            ++F S   H+  +K    LQ   ++DI++  I +   AL  L + N   I++R   ++  
Sbjct: 243  NVFGSVEAHMGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRS--LVSL 300

Query: 1266 GQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIE 1087
            GQ  H L+ L ++ C  + D G   +++GC  +++L +  C+L+SD+ + S      ++ 
Sbjct: 301  GQHSHNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINSLANNCTALR 360

Query: 1086 SLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICN 907
             L L  C  I+   +  +       L  L  +NC  + D    +  L  C +L+ + + +
Sbjct: 361  ELSLSHCELITDESIQNLASKHRETLNVLELDNCPQLTDST--LSHLRHCKALKRIDLYD 418

Query: 906  CTGFGDASLVVLSRLCPNL-VHLNLSGLNGVTD 811
            C      ++V      PN+ +H   + +   TD
Sbjct: 419  CQNVSKEAIVRFQHHRPNIEIHAYFAPVTPPTD 451



 Score = 45.1 bits (105), Expect = 0.004
 Identities = 35/128 (27%), Positives = 57/128 (44%), Gaps = 1/128 (0%)
 Frame = -3

Query: 741 NVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGI 565
           +V    +  +A+  G  L+ L+L GC  V D++L      C  L  L + +  RV+D   
Sbjct: 108 DVKTAVVENLARRCGGFLKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTD--- 164

Query: 564 AALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVE 385
           A+          L  L+L  C   +D+ + Y+     +L+ LNI  C  I  RGV +++ 
Sbjct: 165 ASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILS 224

Query: 384 RLWRCDIL 361
                D L
Sbjct: 225 NCKSLDTL 232



>pir|S44609|S44609 hypothetical protein C02F5.7 - Caenorhabditis
            elegans
          Length = 489

 Score =  109 bits (272), Expect = 2e-22
 Identities = 81/308 (26%), Positives = 144/308 (46%), Gaps = 26/308 (8%)
 Frame = -3

Query: 1440 IASLFSSAGNHLMKVKLQSL-NISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSG 1264
            + +L    G  L ++ L+   N+ D +L         L  L+L   + + +        G
Sbjct: 114  VENLARRCGGFLKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTDAS--CENLG 171

Query: 1263 QGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIES 1084
            +  HKL  L +  C  +TD  ++ +  GCPN+  L +  C  + D GV   +   +S+++
Sbjct: 172  RYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDT 231

Query: 1083 LQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKD-----LAFGVPAL-----PPCN 934
            L L  C  +++  VFG +    G +K L    CF + D     +A G  AL       CN
Sbjct: 232  LILRGCEGLTE-NVFGSVEAHMGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCN 290

Query: 933  ---------------SLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLL 799
                           +L+ L +  CT  GD   + L+R C  L  L++   + ++D+ + 
Sbjct: 291  QISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTIN 350

Query: 798  PFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYC 619
                +C A L +++LS C  +TD++I  +A  H ETL +L L+ C  +TD++L+ +  +C
Sbjct: 351  SLANNCTA-LRELSLSHCELITDESIQNLASKHRETLNVLELDNCPQLTDSTLSHLR-HC 408

Query: 618  SVLRDLDI 595
              L+ +D+
Sbjct: 409  KALKRIDL 416



 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 72/299 (24%), Positives = 138/299 (46%), Gaps = 2/299 (0%)
 Frame = -3

Query: 1281 WVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPN-VKQLCLRKCTLLSDNGVVSFVK 1105
            W + +  G +  R  + T  + V    +E +++ C   +K+L L+ C  + D+ + +F  
Sbjct: 87   WSILALDGSNWQRVDLFTFQRDVKTAVVENLARRCGGFLKELSLKGCENVHDSALRTFTS 146

Query: 1104 AAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLR 925
               ++E L L  C R++ A        + G+                        C+ L 
Sbjct: 147  RCPNLEHLSLYRCKRVTDASC-----ENLGRY-----------------------CHKLN 178

Query: 924  SLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGC 745
             L++ NC+   D ++  +   CPNL +LN+S  + + D G+   + +C + L  + L GC
Sbjct: 179  YLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKS-LDTLILRGC 237

Query: 744  INVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFG 568
              +T+    ++ + H   ++ LNL  C  +TD ++  IA+  + L  L +S  +++SD  
Sbjct: 238  EGLTENVFGSV-EAHMGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRS 296

Query: 567  IAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
            + +L   S    +L++L LSGC L  D     L +    L  L++++C  IS   ++ L
Sbjct: 297  LVSLGQHS---HNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINSL 352



 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 45/190 (23%), Positives = 89/190 (46%), Gaps = 4/190 (2%)
 Frame = -3

Query: 1434 SLFSSAGNHLMKVK----LQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGS 1267
            ++F S   H+  +K    LQ   ++DI++  I +   AL  L + N   I++R   ++  
Sbjct: 243  NVFGSVEAHMGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRS--LVSL 300

Query: 1266 GQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIE 1087
            GQ  H L+ L ++ C  + D G   +++GC  +++L +  C+L+SD+ + S      ++ 
Sbjct: 301  GQHSHNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINSLANNCTALR 360

Query: 1086 SLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICN 907
             L L  C  I+   +  +       L  L  +NC  + D    +  L  C +L+ + + +
Sbjct: 361  ELSLSHCELITDESIQNLASKHRETLNVLELDNCPQLTDST--LSHLRHCKALKRIDLYD 418

Query: 906  CTGFGDASLV 877
            C      ++V
Sbjct: 419  CQNVSKEAIV 428



 Score = 45.1 bits (105), Expect = 0.004
 Identities = 35/128 (27%), Positives = 57/128 (44%), Gaps = 1/128 (0%)
 Frame = -3

Query: 741 NVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGI 565
           +V    +  +A+  G  L+ L+L GC  V D++L      C  L  L + +  RV+D   
Sbjct: 108 DVKTAVVENLARRCGGFLKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTD--- 164

Query: 564 AALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVE 385
           A+          L  L+L  C   +D+ + Y+     +L+ LNI  C  I  RGV +++ 
Sbjct: 165 ASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILS 224

Query: 384 RLWRCDIL 361
                D L
Sbjct: 225 NCKSLDTL 232



>sp|P34284|YKK7_CAEEL Hypothetical F-box/LRR-repeat protein C02F5.7 in
            chromosome III.>gb:L14745_1386894 Caenorhabditis elegans
            cosmid C02F5, complete sequence.
          Length = 461

 Score =  109 bits (272), Expect = 2e-22
 Identities = 81/308 (26%), Positives = 144/308 (46%), Gaps = 26/308 (8%)
 Frame = -3

Query: 1440 IASLFSSAGNHLMKVKLQSL-NISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSG 1264
            + +L    G  L ++ L+   N+ D +L         L  L+L   + + +        G
Sbjct: 114  VENLARRCGGFLKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTDAS--CENLG 171

Query: 1263 QGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIES 1084
            +  HKL  L +  C  +TD  ++ +  GCPN+  L +  C  + D GV   +   +S+++
Sbjct: 172  RYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDT 231

Query: 1083 LQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKD-----LAFGVPAL-----PPCN 934
            L L  C  +++  VFG +    G +K L    CF + D     +A G  AL       CN
Sbjct: 232  LILRGCEGLTE-NVFGSVEAHMGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCN 290

Query: 933  ---------------SLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLL 799
                           +L+ L +  CT  GD   + L+R C  L  L++   + ++D+ + 
Sbjct: 291  QISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTIN 350

Query: 798  PFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYC 619
                +C A L +++LS C  +TD++I  +A  H ETL +L L+ C  +TD++L+ +  +C
Sbjct: 351  SLANNCTA-LRELSLSHCELITDESIQNLASKHRETLNVLELDNCPQLTDSTLSHLR-HC 408

Query: 618  SVLRDLDI 595
              L+ +D+
Sbjct: 409  KALKRIDL 416



 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 72/299 (24%), Positives = 138/299 (46%), Gaps = 2/299 (0%)
 Frame = -3

Query: 1281 WVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPN-VKQLCLRKCTLLSDNGVVSFVK 1105
            W + +  G +  R  + T  + V    +E +++ C   +K+L L+ C  + D+ + +F  
Sbjct: 87   WSILALDGSNWQRVDLFTFQRDVKTAVVENLARRCGGFLKELSLKGCENVHDSALRTFTS 146

Query: 1104 AAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLR 925
               ++E L L  C R++ A        + G+                        C+ L 
Sbjct: 147  RCPNLEHLSLYRCKRVTDASC-----ENLGRY-----------------------CHKLN 178

Query: 924  SLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGC 745
             L++ NC+   D ++  +   CPNL +LN+S  + + D G+   + +C + L  + L GC
Sbjct: 179  YLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKS-LDTLILRGC 237

Query: 744  INVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFG 568
              +T+    ++ + H   ++ LNL  C  +TD ++  IA+  + L  L +S  +++SD  
Sbjct: 238  EGLTENVFGSV-EAHMGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRS 296

Query: 567  IAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
            + +L   S    +L++L LSGC L  D     L +    L  L++++C  IS   ++ L
Sbjct: 297  LVSLGQHS---HNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINSL 352



 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 50/213 (23%), Positives = 98/213 (46%), Gaps = 5/213 (2%)
 Frame = -3

Query: 1434 SLFSSAGNHLMKVK----LQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGS 1267
            ++F S   H+  +K    LQ   ++DI++  I +   AL  L + N   I++R   ++  
Sbjct: 243  NVFGSVEAHMGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRS--LVSL 300

Query: 1266 GQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIE 1087
            GQ  H L+ L ++ C  + D G   +++GC  +++L +  C+L+SD+ + S      ++ 
Sbjct: 301  GQHSHNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINSLANNCTALR 360

Query: 1086 SLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICN 907
             L L  C  I+   +  +       L  L  +NC  + D    +  L  C +L+ + + +
Sbjct: 361  ELSLSHCELITDESIQNLASKHRETLNVLELDNCPQLTDST--LSHLRHCKALKRIDLYD 418

Query: 906  CTGFGDASLVVLSRLCPNL-VHLNLSGLNGVTD 811
            C      ++V      PN+ +H   + +   TD
Sbjct: 419  CQNVSKEAIVRFQHHRPNIEIHAYFAPVTPPTD 451



 Score = 45.1 bits (105), Expect = 0.004
 Identities = 35/128 (27%), Positives = 57/128 (44%), Gaps = 1/128 (0%)
 Frame = -3

Query: 741 NVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGI 565
           +V    +  +A+  G  L+ L+L GC  V D++L      C  L  L + +  RV+D   
Sbjct: 108 DVKTAVVENLARRCGGFLKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTD--- 164

Query: 564 AALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVE 385
           A+          L  L+L  C   +D+ + Y+     +L+ LNI  C  I  RGV +++ 
Sbjct: 165 ASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILS 224

Query: 384 RLWRCDIL 361
                D L
Sbjct: 225 NCKSLDTL 232



>sp|Q96IG2|FL2L_HUMAN F-box/LRR-repeat protein
            2-like.>gb:BC007557_1970809 Homo sapiens F-box and
            leucine-rich repeat protein 20, mRNA (cDNA clone
            MGC:15482 IMAGE:2987858), complete cds.
          Length = 436

 Score =  109 bits (272), Expect = 2e-22
 Identities = 74/287 (25%), Positives = 138/287 (48%)
 Frame = -3

Query: 1251 KLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLE 1072
            KLR L + +C  +T++ ++A+S+GCP ++QL +  C  ++ +G+ + V+    +++L L+
Sbjct: 144  KLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLK 203

Query: 1071 ECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG 892
             C ++    +  I  H   +L  L  + C  + D    +     C+ L+SL    C+   
Sbjct: 204  GCTQLEDEALKYIGAH-CPELVTLNLQTCLQITDEGL-ITICRGCHKLQSLCASGCSNIT 261

Query: 891  DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI 712
            DA L  L + CP L  L ++  + +TD G     ++C   L K++L  C+ +TD T+  +
Sbjct: 262  DAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHE-LEKMDLEECVQITDSTLIQL 320

Query: 711  AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQF 532
            + +H   L++L+L+ C  +TD                          GI  L  G+    
Sbjct: 321  S-IHCPRLQVLSLSHCELITDD-------------------------GIRHLGNGACAHD 354

Query: 531  SLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
             L+++ L  C L +D  L +L K  +SL  + + +C  I+  G+  L
Sbjct: 355  QLEVIELDNCPLITDASLEHL-KSCHSLERIELYDCQQITRAGIKRL 400



 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 77/294 (26%), Positives = 123/294 (41%), Gaps = 27/294 (9%)
 Frame = -3

Query: 1200 IEAVSKGCPN-VKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVH 1024
            +E +SK C   +++L LR C  + DN + +F +   +IE L L  C + + A        
Sbjct: 82   VENISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRNIEVLNLNGCTKTTDA-------- 133

Query: 1023 SAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVH 844
                        C  +            C+ LR L + +CT   + SL  LS  CP L  
Sbjct: 134  -----------TCTSLSKF---------CSKLRHLDLASCTSITNMSLKALSEGCPLLEQ 173

Query: 843  LNLSGLNGVTDYGLLPFVQSCDA-------------------------GLVKVNLSGCIN 739
            LN+S  + VT  G+   V+ C                            LV +NL  C+ 
Sbjct: 174  LNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQ 233

Query: 738  VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIA 562
            +TD+ +  I +     L+ L  +GC  +TDA L A+   C  LR L++++ S+++D G  
Sbjct: 234  ITDEGLITICR-GCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFT 292

Query: 561  ALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
             LA        L+ + L  CV  +D  L  L      L  L++ +C  I+  G+
Sbjct: 293  TLARNC---HELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGI 343



 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 53/197 (26%), Positives = 95/197 (48%), Gaps = 5/197 (2%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGI 1198
            + D +L  IG +   L  L L     I + G   +   +G HKL+SL  + C  +TD  +
Sbjct: 208  LEDEALKYIGAHCPELVTLNLQTCLQITDEGLITIC--RGCHKLQSLCASGCSNITDAIL 265

Query: 1197 EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSA 1018
             A+ + CP ++ L + +C+ L+D G  +  +    +E + LEEC +I+ + +  + +H  
Sbjct: 266  NALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKMDLEECVQITDSTLIQLSIH-C 324

Query: 1017 GKLKALAFENC-----FGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPN 853
             +L+ L+  +C      G++ L  G  A    + L  + + NC    DASL  L + C +
Sbjct: 325  PRLQVLSLSHCELITDDGIRHLGNGACA---HDQLEVIELDNCPLITDASLEHL-KSCHS 380

Query: 852  LVHLNLSGLNGVTDYGL 802
            L  + L     +T  G+
Sbjct: 381  LERIELYDCQQITRAGI 397



>gb:AK012109_1156775 Mus musculus 10 days embryo whole body cDNA,
            RIKEN full-length enriched library, clone:2610511F20
            product:F-BOX PROTEIN FBL2 homolog [Rattus norvegicus],
            full insert sequence.
          Length = 422

 Score =  106 bits (265), Expect = 1e-21
 Identities = 73/287 (25%), Positives = 136/287 (47%)
 Frame = -3

Query: 1251 KLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLE 1072
            KLR L + +C  +T++ ++A+S+GCP ++QL +  C  ++ +G+ + V+    +++L L+
Sbjct: 130  KLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLK 189

Query: 1071 ECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG 892
             C ++    +  I  H   +L  L  + C  + D    +     C+ L+SL    C+   
Sbjct: 190  GCTQLEDEALKYIGAH-CPELVTLNLQTCLQITDEGL-ITICRGCHKLQSLCASGCSNIT 247

Query: 891  DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI 712
            DA L  L + CP L  L ++  + +TD G     ++C   L K++L  C+ +TD T+  +
Sbjct: 248  DAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHE-LEKMDLEECVQITDSTLIQL 306

Query: 711  AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQF 532
            + +H   L++L+L+ C  +TD                          GI  L  G+    
Sbjct: 307  S-IHCPRLQVLSLSHCELITDD-------------------------GIRHLGNGACAHD 340

Query: 531  SLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
             L+++ L  C L +D  L +L K   S   + + +C  I+  G+  L
Sbjct: 341  QLEVIELDNCPLITDASLEHL-KSCPSFERIELYDCQQITRAGIKRL 386



 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 53/197 (26%), Positives = 95/197 (48%), Gaps = 5/197 (2%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGI 1198
            + D +L  IG +   L  L L     I + G   +   +G HKL+SL  + C  +TD  +
Sbjct: 194  LEDEALKYIGAHCPELVTLNLQTCLQITDEGLITIC--RGCHKLQSLCASGCSNITDAIL 251

Query: 1197 EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSA 1018
             A+ + CP ++ L + +C+ L+D G  +  +    +E + LEEC +I+ + +  + +H  
Sbjct: 252  NALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKMDLEECVQITDSTLIQLSIH-C 310

Query: 1017 GKLKALAFENC-----FGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPN 853
             +L+ L+  +C      G++ L  G  A    + L  + + NC    DASL  L + CP+
Sbjct: 311  PRLQVLSLSHCELITDDGIRHLGNGACA---HDQLEVIELDNCPLITDASLEHL-KSCPS 366

Query: 852  LVHLNLSGLNGVTDYGL 802
               + L     +T  G+
Sbjct: 367  FERIELYDCQQITRAGI 383



>gb:AE013599_1131302 Drosophila melanogaster chromosome 2R, complete
            sequence.>gb:AE003825_1226396 Drosophila melanogaster
            chromosome 2R, section 25 of 74 of the complete sequence.
          Length = 464

 Score =  106 bits (265), Expect = 1e-21
 Identities = 81/319 (25%), Positives = 149/319 (46%), Gaps = 4/319 (1%)
 Frame = -3

Query: 1332 LTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCL 1153
            L  L+L   Q++ ++    + +    H +  L ++ C+ +TD+  +++S+ C  +  + L
Sbjct: 121  LKSLSLRGCQSVGDQSVRTLANH--CHNIEHLDLSDCKKITDISTQSISRYCSKLTAINL 178

Query: 1152 RKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMK 973
              C+ ++DN +        ++  + +  CH IS+ GV                      +
Sbjct: 179  HSCSNITDNSLKYLSDGCPNLMEINVSWCHLISENGV----------------------E 216

Query: 972  DLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPF 793
             LA G      C  LR  S   C    D +++ L++ CP+L+ LNL     +TD  +   
Sbjct: 217  ALARG------CVKLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQL 270

Query: 792  VQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSV 613
              +C   L K+ +S C ++TD T+ ++++ H   L  L ++GC   TD    A+   C  
Sbjct: 271  AANCHK-LQKLCVSKCADLTDLTLLSLSQ-HNHLLNTLEVSGCRNFTDIGFQALGRNCKY 328

Query: 612  LRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK---LGNSLA 445
            L  +D+ + S+++D  +A LA G     SL+ L+LS C L +D  + +L         L+
Sbjct: 329  LERMDLEECSQITDLTLAHLATGCP---SLEKLTLSHCELITDDGIRHLTTGSCAAEILS 385

Query: 444  GLNIQNCVGISHRGVDLLV 388
             L + NC  I+ R ++ LV
Sbjct: 386  VLELDNCPLITDRTLEHLV 404



 Score = 52.8 bits (125), Expect = 2e-05
 Identities = 41/153 (26%), Positives = 76/153 (49%), Gaps = 9/153 (5%)
 Frame = -3

Query: 789 QSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVL 610
           Q C   L  ++L GC +V D+++  +A  H   +E L+L+ C  +TD S  +I+ YCS L
Sbjct: 115 QRCRGFLKSLSLRGCQSVGDQSVRTLAN-HCHNIEHLDLSDCKKITDISTQSISRYCSKL 173

Query: 609 RDLDI-SKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNI 433
             +++ S S ++D  +  L+ G     +L  +++S C L S+  +  L +    L   + 
Sbjct: 174 TAINLHSCSNITDNSLKYLSDGCP---NLMEINVSWCHLISENGVEALARGCVKLRKFSS 230

Query: 432 QNCVGISHRGV--------DLLVERLWRCDILS 358
           + C  I+   +        DL+V  L  C+ ++
Sbjct: 231 KGCKQINDNAIMCLAKYCPDLMVLNLHSCETIT 263



>sp|Q9CZV8|FL2L_MOUSE F-box/LRR-repeat protein 2-like.
          Length = 436

 Score =  106 bits (265), Expect = 1e-21
 Identities = 73/287 (25%), Positives = 136/287 (47%)
 Frame = -3

Query: 1251 KLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLE 1072
            KLR L + +C  +T++ ++A+S+GCP ++QL +  C  ++ +G+ + V+    +++L L+
Sbjct: 144  KLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLK 203

Query: 1071 ECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG 892
             C ++    +  I  H   +L  L  + C  + D    +     C+ L+SL    C+   
Sbjct: 204  GCTQLEDEALKYIGAH-CPELVTLNLQTCLQITDEGL-ITICRGCHKLQSLCASGCSNIT 261

Query: 891  DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI 712
            DA L  L + CP L  L ++  + +TD G     ++C   L K++L  C+ +TD T+  +
Sbjct: 262  DAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHE-LEKMDLEECVQITDSTLIQL 320

Query: 711  AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQF 532
            + +H   L++L+L+ C  +TD                          GI  L  G+    
Sbjct: 321  S-IHCPRLQVLSLSHCELITDD-------------------------GIRHLGNGACAHD 354

Query: 531  SLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
             L+++ L  C L +D  L +L K   S   + + +C  I+  G+  L
Sbjct: 355  QLEVIELDNCPLITDASLEHL-KSCPSFERIELYDCQQITRAGIKRL 400



 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 53/197 (26%), Positives = 95/197 (48%), Gaps = 5/197 (2%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGI 1198
            + D +L  IG +   L  L L     I + G   +   +G HKL+SL  + C  +TD  +
Sbjct: 208  LEDEALKYIGAHCPELVTLNLQTCLQITDEGLITIC--RGCHKLQSLCASGCSNITDAIL 265

Query: 1197 EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSA 1018
             A+ + CP ++ L + +C+ L+D G  +  +    +E + LEEC +I+ + +  + +H  
Sbjct: 266  NALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKMDLEECVQITDSTLIQLSIH-C 324

Query: 1017 GKLKALAFENC-----FGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPN 853
             +L+ L+  +C      G++ L  G  A    + L  + + NC    DASL  L + CP+
Sbjct: 325  PRLQVLSLSHCELITDDGIRHLGNGACA---HDQLEVIELDNCPLITDASLEHL-KSCPS 380

Query: 852  LVHLNLSGLNGVTDYGL 802
               + L     +T  G+
Sbjct: 381  FERIELYDCQQITRAGI 397



>gb:AY084229_1569322 Arabidopsis thaliana clone 100411 mRNA, complete
            sequence.
          Length = 610

 Score =  106 bits (264), Expect = 1e-21
 Identities = 78/328 (23%), Positives = 142/328 (43%), Gaps = 48/328 (14%)
 Frame = -3

Query: 1413 NHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQ--------- 1261
            N L  +KLQ ++++D++ A +G    +L  LAL + Q+  ++G   +G G          
Sbjct: 269  NRLKNLKLQCVSVTDVAFAAVGELCTSLERLALYSFQHFTDKGMRAIGKGSKKLKDLTLS 328

Query: 1260 ---------------GLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDN 1126
                           G  +L  + I  C  +   GIEA+ K CP +K+L L  C  + ++
Sbjct: 329  DCYFVSCKGLEAIAHGCKELERVEINGCHNIGTRGIEAIGKSCPRLKELALLYCQRIGNS 388

Query: 1125 GVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAF---------------E 991
             +    K  +S+E L L +C  I    +  I       LK L                 +
Sbjct: 389  ALQEIGKGCKSLEILHLVDCSGIGDIAMCSI-AKGCRNLKKLHIRRXYEIGNKGIISIGK 447

Query: 990  NCFGMKDLAF---------GVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN 838
            +C  + +L+           + A+    SL+ L++  C    DA +  ++R CP L HL+
Sbjct: 448  HCKSLTELSLRFCDKIGNKALIAIGKGCSLQQLNVSGCNQISDAGITAIARGCPQLTHLD 507

Query: 837  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGC 658
            +S L  + D  L    + C   L  + LS C ++TD  ++ + +   + LE  ++  C  
Sbjct: 508  ISVLQNIGDMPLAELGEGCPM-LKDLVLSHCHHITDNGLNHLVQ-KCKLLETCHMVYCPG 565

Query: 657  VTDASLAAIADYCSVLRDLDISKSRVSD 574
            +T A +A +   C  ++ + I K +V++
Sbjct: 566  ITSAGVATVVSSCPHIKKVLIEKWKVTE 593



 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 67/274 (24%), Positives = 106/274 (38%), Gaps = 25/274 (9%)
 Frame = -3

Query: 1137 LSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFG 958
            L+D G+ +       IE+L L  C  +S  G+  +                         
Sbjct: 127  LTDTGLTALADGFPRIENLSLIWCPNVSSVGLCSLA------------------------ 162

Query: 957  VPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCD 778
                  C SL+SL +  C   GD  L  + + C  L  LNL    G+TD G++     C 
Sbjct: 163  ----QKCTSLKSLDLQGCY-VGDQGLAAVGKFCKQLEELNLRFCEGLTDVGVIDLAVGCS 217

Query: 777  AGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNG----------------------- 667
              L  + ++    +TD ++ A+   H + LE+L L+                        
Sbjct: 218  KSLKSIGVAASAKITDLSLEAVGS-HCKLLEVLYLDSEYIHDKGLIAVAQGCNRLKNLKL 276

Query: 666  -CGCVTDASLAAIADYCSVLRDLDI-SKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLA 493
             C  VTD + AA+ + C+ L  L + S    +D G+ A+  GS     L+ L+LS C   
Sbjct: 277  QCVSVTDVAFAAVGELCTSLERLALYSFQHFTDKGMRAIGKGSK---KLKDLTLSDCYFV 333

Query: 492  SDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
            S K L  +      L  + I  C  I  RG++ +
Sbjct: 334  SCKGLEAIAHGCKELERVEINGCHNIGTRGIEAI 367



 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 86/354 (24%), Positives = 148/354 (41%), Gaps = 27/354 (7%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLG 1201
            N+S + L  +       T L  ++LQ        +   G+   +L  L +  C+G+TD+G
Sbjct: 152  NVSSVGLCSLAQ---KCTSLKSLDLQGCYVGDQGLAAVGKFCKQLEELNLRFCEGLTDVG 208

Query: 1200 IEAVSKGC-PNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVH 1024
            +  ++ GC  ++K + +     ++D  + +     + +E L L+    I   G+  +   
Sbjct: 209  VIDLAVGCSKSLKSIGVAASAKITDLSLEAVGSHCKLLEVLYLDS-EYIHDKGLIAV-AQ 266

Query: 1023 SAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVH 844
               +LK L  + C  + D+AF       C SL  L++ +   F D  +  + +    L  
Sbjct: 267  GCNRLKNLKLQ-CVSVTDVAFAAVG-ELCTSLERLALYSFQHFTDKGMRAIGKGSKKLKD 324

Query: 843  LNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAK-------------- 706
            L LS    V+  GL      C   L +V ++GC N+  + I AI K              
Sbjct: 325  LTLSDCYFVSCKGLEAIAHGCKE-LERVEINGCHNIGTRGIEAIGKSCPRLKELALLYCQ 383

Query: 705  -----------LHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKS-RVSDFGIA 562
                          ++LE+L+L  C  + D ++ +IA  C  L+ L I +   + + GI 
Sbjct: 384  RIGNSALQEIGKGCKSLEILHLVDCSGIGDIAMCSIAKGCRNLKKLHIRRXYEIGNKGII 443

Query: 561  ALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
            ++        SL  LSL  C    +K L  + K G SL  LN+  C  IS  G+
Sbjct: 444  SIGKHCK---SLTELSLRFCDKIGNKALIAIGK-GCSLQQLNVSGCNQISDAGI 493



>gb:BC059683_2552655 Danio rerio F-box and leucine-rich repeat protein
            20, mRNA (cDNA clone MGC:73374 IMAGE:4199271), complete
            cds.
          Length = 432

 Score =  105 bits (263), Expect = 2e-21
 Identities = 84/320 (26%), Positives = 141/320 (44%), Gaps = 37/320 (11%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            LR L +  C  V D  ++  ++ C N++ L L  CT ++D+  +S  K    +  L L  
Sbjct: 89   LRQLSLRGCLSVGDASMKTFAQNCRNIEHLNLNGCTKITDSTCISLSKFCFKLRHLDLTS 148

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGMKDL---------AFGVPALP-PCNSLRSL 919
            C  I+              LKAL+ E C  +++L         + G+ AL   C +LR+L
Sbjct: 149  CVSITNHA-----------LKALS-EGCRMLENLNLSWCDQITSDGIEALSRGCTALRAL 196

Query: 918  SICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCIN 739
             +  CT   D +L  L + CP L+ +N+     +TD G +   + C   L  V +SGC N
Sbjct: 197  FLRGCTQLDDTALKHLQKHCPELMTINMQSCTQITDDGFVSLCRGCHK-LQMVCISGCSN 255

Query: 738  VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK---------- 589
            +TD +++A+  L+ + L++L    C  VTDA    +A  C  +  +D+ +          
Sbjct: 256  ITDASLTALG-LNCQRLKILEAARCSHVTDAGFTVLARNCHEMEKMDLEECILVTDNTLV 314

Query: 588  -----------------SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKL 460
                               ++D GI  L+     Q  LQ++ L  C L +D  L +L K 
Sbjct: 315  QLSIHCPRLQALSLSHCELITDDGIRHLSSSVCGQERLQVVELDNCPLITDITLEHL-KN 373

Query: 459  GNSLAGLNIQNCVGISHRGV 400
               L  + + +C  +S  G+
Sbjct: 374  CQRLERIELYDCQQVSRAGI 393



 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 45/180 (25%), Positives = 83/180 (46%), Gaps = 5/180 (2%)
 Frame = -3

Query: 1326 DLALINLQN---INERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLC 1156
            +L  IN+Q+   I + GF  +   +G HKL+ + I+ C  +TD  + A+   C  +K L 
Sbjct: 218  ELMTINMQSCTQITDDGF--VSLCRGCHKLQMVCISGCSNITDASLTALGLNCQRLKILE 275

Query: 1155 LRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGM 976
              +C+ ++D G     +    +E + LEEC  ++   +  + +H   +L+AL+  +C  +
Sbjct: 276  AARCSHVTDAGFTVLARNCHEMEKMDLEECILVTDNTLVQLSIH-CPRLQALSLSHCELI 334

Query: 975  KDLAFGVPALPPCNS--LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGL 802
             D      +   C    L+ + + NC    D +L  L   C  L  + L     V+  G+
Sbjct: 335  TDDGIRHLSSSVCGQERLQVVELDNCPLITDITLEHLKN-CQRLERIELYDCQQVSRAGI 393



 Score = 45.4 bits (106), Expect = 0.003
 Identities = 33/118 (27%), Positives = 58/118 (49%), Gaps = 1/118 (0%)
 Frame = -3

Query: 741 NVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGI 565
           ++  + +  I+K  G  L  L+L GC  V DAS+   A  C  +  L+++  ++++D   
Sbjct: 72  DIEGRVVENISKRCGGFLRQLSLRGCLSVGDASMKTFAQNCRNIEHLNLNGCTKITDSTC 131

Query: 564 AALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
            +L   S   F L+ L L+ CV  ++  L  L +    L  LN+  C  I+  G++ L
Sbjct: 132 ISL---SKFCFKLRHLDLTSCVSITNHALKALSEGCRMLENLNLSWCDQITSDGIEAL 186



>gb:AY056338_1563648 Arabidopsis thaliana putative F-box protein
            family protein FBL4 (At4g15475) mRNA, complete
            cds.>gb:AF360328_1791274 Arabidopsis thaliana putative
            F-box protein family, AtFBL4 (At4g15475) mRNA, complete
            cds.>gb:AF361808_1791400 Arabidopsis thaliana
            AT4g15470/dl3775w mRNA, complete cds.
          Length = 610

 Score =  105 bits (263), Expect = 2e-21
 Identities = 77/328 (23%), Positives = 141/328 (42%), Gaps = 48/328 (14%)
 Frame = -3

Query: 1413 NHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQ--------- 1261
            + L  +KLQ ++++D++ A +G    +L  LAL + Q+  ++G   +G G          
Sbjct: 269  HRLKNLKLQCVSVTDVAFAAVGELCTSLERLALYSFQHFTDKGMRAIGKGSKKLKDLTLS 328

Query: 1260 ---------------GLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDN 1126
                           G  +L  + I  C  +   GIEA+ K CP +K+L L  C  + ++
Sbjct: 329  DCYFVSCKGLEAIAHGCKELERVEINGCHNIGTRGIEAIGKSCPRLKELALLYCQRIGNS 388

Query: 1125 GVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCF------------ 982
             +    K  +S+E L L +C  I    +  I       LK L    C+            
Sbjct: 389  ALQEIGKGCKSLEILHLVDCSGIGDIAMCSI-AKGCRNLKKLHIRRCYEIGNKGIISIGK 447

Query: 981  ---GMKDLAF---------GVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN 838
                + +L+           + A+    SL+ L++  C    DA +  ++R CP L HL+
Sbjct: 448  HCKSLTELSLRFCDKVGNKALIAIGKGCSLQQLNVSGCNQISDAGITAIARGCPQLTHLD 507

Query: 837  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGC 658
            +S L  + D  L    + C   L  + LS C ++TD  ++ + +   + LE  ++  C  
Sbjct: 508  ISVLQNIGDMPLAELGEGCPM-LKDLVLSHCHHITDNGLNHLVQ-KCKLLETCHMVYCPG 565

Query: 657  VTDASLAAIADYCSVLRDLDISKSRVSD 574
            +T A +A +   C  ++ + I K +V++
Sbjct: 566  ITSAGVATVVSSCPHIKKVLIEKWKVTE 593



 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 68/274 (24%), Positives = 107/274 (39%), Gaps = 25/274 (9%)
 Frame = -3

Query: 1137 LSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFG 958
            L+D G+ +       IE+L L  C  +S  G+  +                         
Sbjct: 127  LTDTGLTALANGFPRIENLSLIWCPNVSSVGLCSLA------------------------ 162

Query: 957  VPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCD 778
                  C SL+SL +  C   GD  L  + + C  L  LNL    G+TD G++  V  C 
Sbjct: 163  ----QKCTSLKSLDLQGCY-VGDQGLAAVGKFCKQLEELNLRFCEGLTDVGVIDLVVGCS 217

Query: 777  AGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNG----------------------- 667
              L  + ++    +TD ++ A+   H + LE+L L+                        
Sbjct: 218  KSLKSIGVAASAKITDLSLEAVGS-HCKLLEVLYLDSEYIHDKGLIAVAQGCHRLKNLKL 276

Query: 666  -CGCVTDASLAAIADYCSVLRDLDI-SKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLA 493
             C  VTD + AA+ + C+ L  L + S    +D G+ A+  GS     L+ L+LS C   
Sbjct: 277  QCVSVTDVAFAAVGELCTSLERLALYSFQHFTDKGMRAIGKGSK---KLKDLTLSDCYFV 333

Query: 492  SDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
            S K L  +      L  + I  C  I  RG++ +
Sbjct: 334  SCKGLEAIAHGCKELERVEINGCHNIGTRGIEAI 367



 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 86/354 (24%), Positives = 147/354 (41%), Gaps = 27/354 (7%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLG 1201
            N+S + L  +       T L  ++LQ        +   G+   +L  L +  C+G+TD+G
Sbjct: 152  NVSSVGLCSLAQ---KCTSLKSLDLQGCYVGDQGLAAVGKFCKQLEELNLRFCEGLTDVG 208

Query: 1200 IEAVSKGC-PNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVH 1024
            +  +  GC  ++K + +     ++D  + +     + +E L L+    I   G+  +   
Sbjct: 209  VIDLVVGCSKSLKSIGVAASAKITDLSLEAVGSHCKLLEVLYLDS-EYIHDKGLIAV-AQ 266

Query: 1023 SAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVH 844
               +LK L  + C  + D+AF       C SL  L++ +   F D  +  + +    L  
Sbjct: 267  GCHRLKNLKLQ-CVSVTDVAFAAVG-ELCTSLERLALYSFQHFTDKGMRAIGKGSKKLKD 324

Query: 843  LNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAK-------------- 706
            L LS    V+  GL      C   L +V ++GC N+  + I AI K              
Sbjct: 325  LTLSDCYFVSCKGLEAIAHGCKE-LERVEINGCHNIGTRGIEAIGKSCPRLKELALLYCQ 383

Query: 705  -----------LHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKS-RVSDFGIA 562
                          ++LE+L+L  C  + D ++ +IA  C  L+ L I +   + + GI 
Sbjct: 384  RIGNSALQEIGKGCKSLEILHLVDCSGIGDIAMCSIAKGCRNLKKLHIRRCYEIGNKGII 443

Query: 561  ALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
            ++        SL  LSL  C    +K L  + K G SL  LN+  C  IS  G+
Sbjct: 444  SIGKHCK---SLTELSLRFCDKVGNKALIAIGK-GCSLQQLNVSGCNQISDAGI 493



>gb:AF174589_1887907 Homo sapiens F-box protein Fbl2 (FBL2) mRNA,
            complete cds.
          Length = 423

 Score =  104 bits (260), Expect = 4e-21
 Identities = 82/311 (26%), Positives = 141/311 (45%), Gaps = 28/311 (9%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            LR L +  C GV D  ++  ++ C N++ L L  CT ++D+   S  +    ++ L L  
Sbjct: 80   LRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLXLTS 139

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGM-KDLAFGVPAL-PPCNSLRSLSICNCTGF 895
            C  I+ + + GI       L+ L    C  + KD   G+ AL   C  L++L +  CT  
Sbjct: 140  CVSITNSSLKGI-SEGCRNLEYLNLSWCDQITKD---GIEALVRGCRGLKALLLRGCTQL 195

Query: 894  GDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISA 715
             D +L  +   C  LV LNL   + +TD G++   + C   L  + LSGC N+TD +++A
Sbjct: 196  EDEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCHR-LQALCLSGCSNLTDASLTA 254

Query: 714  IA-------------------------KLHGETLELLNLNGCGCVTDASLAAIADYCSVL 610
            +                            +   LE ++L  C  +TD++L  ++ +C  L
Sbjct: 255  LGLNCPRLQILEAARCSHLTDAGFTLLARNCHELEKMDLEXCILITDSTLIQLSIHCPKL 314

Query: 609  RDLDISKSR-VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNI 433
            + L +S    + D GI  L+  +     L++L L  C+L +D  L +L      L  L +
Sbjct: 315  QALSLSHCELIXDDGILHLSNSTCGHERLRVLELDNCLLITDVALXHLENC-RGLERLEL 373

Query: 432  QNCVGISHRGV 400
             +C  ++  G+
Sbjct: 374  YDCQQVTRAGI 384



>gb:AY091103_1574327 Arabidopsis thaliana putative F-box protein
            family, AtFBL3 (At5g01720) mRNA, complete
            cds.>gb:AY122938_1579816 Arabidopsis thaliana putative
            F-box family protein AtFBL3 (At5g01720) mRNA, complete
            cds.
          Length = 665

 Score =  104 bits (260), Expect = 4e-21
 Identities = 89/335 (26%), Positives = 147/335 (43%), Gaps = 49/335 (14%)
 Frame = -3

Query: 1410 HLMKVKLQS-LNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQG-------- 1258
            HL ++ L+    + D SL  + H   +L  L   + QN+  RG   + SG G        
Sbjct: 227  HLEELLLEGCFGVDDDSLKSLRHDCKSLKKLDASSCQNLTHRGLTSLLSGAGYLQRLDLS 286

Query: 1257 ----------------LHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDN 1126
                            +  L+S+ +  C  VT  G++A+   C ++K++ L KC  ++D 
Sbjct: 287  HCSSVISLDFASSLKKVSALQSIRLDGCS-VTPDGLKAIGTLCNSLKEVSLSKCVSVTDE 345

Query: 1125 GVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAF----- 961
            G+ S V   + +  L +  C ++S+  +  I  +S   L +L  E+C  +   AF     
Sbjct: 346  GLSSLVMKLKDLRKLDITCCRKLSRVSITQI-ANSCPLLVSLKMESCSLVSREAFWLIGQ 404

Query: 960  ------------------GVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL 835
                              G+ ++  C SL SL +  C    D  L  +   C NL  L+L
Sbjct: 405  KCRLLEELDLTDNEIDDEGLKSISSCLSLSSLKLGICLNITDKGLSYIGMGCSNLRELDL 464

Query: 834  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV 655
                G+TD G+    Q C   L  +N+S C ++TDK++ +++K     L+     GC  +
Sbjct: 465  YRSVGITDVGISTIAQGC-IHLETINISYCQDITDKSLVSLSKC--SLLQTFESRGCPNI 521

Query: 654  TDASLAAIADYCSVLRDLDISK-SRVSDFGIAALA 553
            T   LAAIA  C  L  +D+ K   ++D G+ ALA
Sbjct: 522  TSQGLAAIAVRCKRLAKVDLKKCPSINDAGLLALA 556



 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 88/397 (22%), Positives = 166/397 (41%), Gaps = 49/397 (12%)
 Frame = -3

Query: 1428 FSSAGNHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHK 1249
            FS+AG  L+++ L+ +N+ +I L+               N   + +    V+   + L +
Sbjct: 112  FSAAG--LLRLALKCVNLVEIDLS---------------NATEMRDADAAVVAEARSLER 154

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIES----- 1084
            L+   +  C+ +TD+GI  ++ GC  +  + L+ C  + D GV       + I +     
Sbjct: 155  LK---LGRCKMLTDMGIGCIAVGCKKLNTVSLKWCVGVGDLGVGLLAVKCKDIRTLDLSY 211

Query: 1083 -----------LQLEECHRISQAGVFGI-------------------------------- 1033
                       L+L+    +   G FG+                                
Sbjct: 212  LPITGKCLHDILKLQHLEELLLEGCFGVDDDSLKSLRHDCKSLKKLDASSCQNLTHRGLT 271

Query: 1032 -LVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCP 856
             L+  AG L+ L   +C  +  L F   +L   ++L+S+ +  C+   D  L  +  LC 
Sbjct: 272  SLLSGAGYLQRLDLSHCSSVISLDF-ASSLKKVSALQSIRLDGCSVTPD-GLKAIGTLCN 329

Query: 855  NLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLN 676
            +L  ++LS    VTD GL   V      L K++++ C  ++  +I+ IA      L  L 
Sbjct: 330  SLKEVSLSKCVSVTDEGLSSLVMKL-KDLRKLDITCCRKLSRVSITQIAN-SCPLLVSLK 387

Query: 675  LNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVL 496
            +  C  V+  +   I   C +L +LD++ + + D G+ +++       SL  L L  C+ 
Sbjct: 388  MESCSLVSREAFWLIGQKCRLLEELDLTDNEIDDEGLKSISS----CLSLSSLKLGICLN 443

Query: 495  ASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVE 385
             +DK L Y+    ++L  L++   VGI+  G+  + +
Sbjct: 444  ITDKGLSYIGMGCSNLRELDLYRSVGITDVGISTIAQ 480



 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 98/376 (26%), Positives = 163/376 (43%), Gaps = 10/376 (2%)
 Frame = -3

Query: 1329 TDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLR 1150
            TDL L     + +    V+G   G   LRSL ++     +  G+  ++  C N+ ++ L 
Sbjct: 75   TDLDLTFCPRVTDYALSVVGCLSG-PTLRSLDLSRSGSFSAAGLLRLALKCVNLVEIDLS 133

Query: 1149 KCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKD 970
              T + D    + V  A S+E L+L  C  ++  G+ G +     KL  ++ + C G+ D
Sbjct: 134  NATEMRDADA-AVVAEARSLERLKLGRCKMLTDMGI-GCIAVGCKKLNTVSLKWCVGVGD 191

Query: 969  LAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFV 790
            L  G+ A+  C  +R+L +      G     +L     +L  L L G  GV D  L    
Sbjct: 192  LGVGLLAVK-CKDIRTLDLSYLPITGKCLHDILK--LQHLEELLLEGCFGVDDDSLKSLR 248

Query: 789  QSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVL 610
              C + L K++ S C N+T + ++++            L+G G +    L+    +CS +
Sbjct: 249  HDCKS-LKKLDASSCQNLTHRGLTSL------------LSGAGYLQRLDLS----HCSSV 291

Query: 609  RDLDISKS--RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLN 436
              LD + S  +VS               +LQ + L GC +  D  L  +  L NSL  ++
Sbjct: 292  ISLDFASSLKKVS---------------ALQSIRLDGCSVTPDG-LKAIGTLCNSLKEVS 335

Query: 435  IQNCVGISHRGVDLLVERLWRCDILS*T----*SAVRVWGI*SSVCCPVMFSV----CSL 280
            +  CV ++  G+  LV +L     L  T     S V +  I +S  CP++ S+    CSL
Sbjct: 336  LSKCVSVTDEGLSSLVMKLKDLRKLDITCCRKLSRVSITQIANS--CPLLVSLKMESCSL 393

Query: 279  LFGSIVGSRGLVCQLL 232
            +        G  C+LL
Sbjct: 394  VSREAFWLIGQKCRLL 409



 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 51/233 (21%), Positives = 94/233 (40%), Gaps = 23/233 (9%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGS----------------GQGLHK- 1249
            +S +S+  I +    L  L + +   ++   FW++G                  +GL   
Sbjct: 368  LSRVSITQIANSCPLLVSLKMESCSLVSREAFWLIGQKCRLLEELDLTDNEIDDEGLKSI 427

Query: 1248 -----LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIES 1084
                 L SL +  C  +TD G+  +  GC N+++L L +   ++D G+ +  +    +E+
Sbjct: 428  SSCLSLSSLKLGICLNITDKGLSYIGMGCSNLRELDLYRSVGITDVGISTIAQGCIHLET 487

Query: 1083 LQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNC 904
            + +  C  I+   +  + +     L+      C  +        A+  C  L  + +  C
Sbjct: 488  INISYCQDITDKSL--VSLSKCSLLQTFESRGCPNITSQGLAAIAV-RCKRLAKVDLKKC 544

Query: 903  TGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQ-SCDAGLVKVNLSG 748
                DA L+ L+    NL  +N+S    VT+ GLL      C   +  VN SG
Sbjct: 545  PSINDAGLLALAHFSQNLKQINVSD-TAVTEVGLLSLANIGCLQNIAVVNSSG 596



>gb:AF467462_2496360 Danio rerio PpaB (ppaB) mRNA, partial cds.
          Length = 392

 Score =  103 bits (258), Expect = 7e-21
 Identities = 83/302 (27%), Positives = 145/302 (48%), Gaps = 9/302 (2%)
 Frame = -3

Query: 1263 QGLHKLRSLVITACQGVTDLGI-EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIE 1087
            QG+  + SL ++ C  +TD G+  A  +  P+++ L L  C  ++D+ +    +  +++E
Sbjct: 85   QGMPNIESLNLSGCYNLTDNGLGHAFVQEIPSLRVLNLSLCKQITDSSLGRIAQYLKNLE 144

Query: 1086 SLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGV------PALPPCNSLR 925
             L+L  C  I+  G+  ++     +LK+L   +C  + D+  G        A   C SL 
Sbjct: 145  VLELGGCSNITNTGLL-LIAWGLHRLKSLNLRSCRHVSDVGIGHLAGMTRSAAEGCLSLE 203

Query: 924  SLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGC 745
             L++ +C    D SL  +S+    L  LNLS   G++D G++    S    L  +NL  C
Sbjct: 204  YLTLQDCQKLTDLSLKHISKGLTKLKVLNLSFCGGISDAGMIHL--SHMTSLWSLNLRSC 261

Query: 744  INVTDKTISAIAKLHGETLEL--LNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDF 571
             N++D  I  +A     TL L  L+++ C  + D SLA IA     L+ L +    +SD 
Sbjct: 262  DNISDTGIMHLAM---GTLRLSGLDVSFCDKIGDQSLACIAQGLYQLKSLSLCSCHISDD 318

Query: 570  GIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
            GI  +         L+ L++  CV  +DK L  +      L G+++  C  I+ RG++ +
Sbjct: 319  GINRMVRQ---MHELRTLNIGQCVRITDKGLELIADHLTQLTGIDLYGCTKITKRGLERI 375

Query: 390  VE 385
             +
Sbjct: 376  TQ 377



 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 64/253 (25%), Positives = 113/253 (44%), Gaps = 7/253 (2%)
 Frame = -3

Query: 1095 SIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLS 916
            S+++  +     +S       ++     +++L    C+ + D   G   +    SLR L+
Sbjct: 62   SLQARGIRRVQTLSLRRSLSYVIQGMPNIESLNLSGCYNLTDNGLGHAFVQEIPSLRVLN 121

Query: 915  ICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINV 736
            +  C    D+SL  +++   NL  L L G + +T+ GLL         L  +NL  C +V
Sbjct: 122  LSLCKQITDSSLGRIAQYLKNLEVLELGGCSNITNTGLLLIAWGLHR-LKSLNLRSCRHV 180

Query: 735  TDKTISAIAKLHGE------TLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS-KSRVS 577
            +D  I  +A +         +LE L L  C  +TD SL  I+   + L+ L++S    +S
Sbjct: 181  SDVGIGHLAGMTRSAAEGCLSLEYLTLQDCQKLTDLSLKHISKGLTKLKVLNLSFCGGIS 240

Query: 576  DFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVD 397
            D G+  L+       SL  L+L  C   SD  + +L      L+GL++  C  I  + + 
Sbjct: 241  DAGMIHLSH----MTSLWSLNLRSCDNISDTGIMHLAMGTLRLSGLDVSFCDKIGDQSLA 296

Query: 396  LLVERLWRCDILS 358
             + + L++   LS
Sbjct: 297  CIAQGLYQLKSLS 309



 Score = 67.0 bits (162), Expect = 9e-10
 Identities = 64/241 (26%), Positives = 109/241 (45%), Gaps = 5/241 (2%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVALTDLALINLQNINERGF-----WVMGSGQGLHKLRSLVITACQG 1216
            NI++  L +I      L  L L + +++++ G          + +G   L  L +  CQ 
Sbjct: 153  NITNTGLLLIAWGLHRLKSLNLRSCRHVSDVGIGHLAGMTRSAAEGCLSLEYLTLQDCQK 212

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TDL ++ +SKG   +K L L  C  +SD G++  +    S+ SL L  C  IS  G+  
Sbjct: 213  LTDLSLKHISKGLTKLKVLNLSFCGGISDAGMI-HLSHMTSLWSLNLRSCDNISDTGIMH 271

Query: 1035 ILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCP 856
            + + +  +L  L    C  + D +    A      L+SLS+C+C    D  +  + R   
Sbjct: 272  LAMGTL-RLSGLDVSFCDKIGDQSLACIA-QGLYQLKSLSLCSC-HISDDGINRMVRQMH 328

Query: 855  NLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLN 676
             L  LN+     +TD G L  +      L  ++L GC  +T + +  I +L    L++ N
Sbjct: 329  ELRTLNIGQCVRITDKG-LELIADHLTQLTGIDLYGCTKITKRGLERITQL--PCLKVFN 385

Query: 675  L 673
            L
Sbjct: 386  L 386



 Score = 60.5 bits (145), Expect = 9e-08
 Identities = 77/275 (28%), Positives = 108/275 (39%), Gaps = 42/275 (15%)
 Frame = -3

Query: 939 CNSLRSLSICNCTGFGDASLVVLSRLCPNLV-HLNLSGLNGVTDYGL---LPFVQSCDAG 772
           C + R  S       G  + + L R  P+L   L   G+  V    L   L +V      
Sbjct: 30  CTAWRDASYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQTLSLRRSLSYVIQGMPN 89

Query: 771 LVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI- 595
           +  +NLSGC N+TD  +         +L +LNL+ C  +TD+SL  IA Y   L  L++ 
Sbjct: 90  IESLNLSGCYNLTDNGLGHAFVQEIPSLRVLNLSLCKQITDSSLGRIAQYLKNLEVLELG 149

Query: 594 --------------------------SKSRVSDFGIAALAG--GSAIQ--FSLQILSLSG 505
                                     S   VSD GI  LAG   SA +   SL+ L+L  
Sbjct: 150 GCSNITNTGLLLIAWGLHRLKSLNLRSCRHVSDVGIGHLAGMTRSAAEGCLSLEYLTLQD 209

Query: 504 CVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL--VERLW-----RCDILS*T*S 346
           C   +D  L ++ K    L  LN+  C GIS  G+  L  +  LW      CD +S T  
Sbjct: 210 CQKLTDLSLKHISKGLTKLKVLNLSFCGGISDAGMIHLSHMTSLWSLNLRSCDNISDT-- 267

Query: 345 AVRVWGI*SSVCCPVMFSVCSLLFGSIVGSRGLVC 241
                GI       +  S   + F   +G + L C
Sbjct: 268 -----GIMHLAMGTLRLSGLDVSFCDKIGDQSLAC 297



>gb:BC021329_2093374 Mus musculus F-box and leucine-rich repeat
            protein 14, mRNA (cDNA clone MGC:29433 IMAGE:3710945),
            complete cds.
          Length = 400

 Score =  103 bits (258), Expect = 7e-21
 Identities = 83/300 (27%), Positives = 143/300 (47%), Gaps = 7/300 (2%)
 Frame = -3

Query: 1263 QGLHKLRSLVITACQGVTDLGI-EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIE 1087
            QG+  + SL ++ C  +TD G+  A  +   +++ L L  C  ++D+ +    +  + +E
Sbjct: 87   QGMANIESLNLSGCYNLTDNGLGHAFVQEIGSLRALNLSLCKQITDSSLGRIAQYLKGLE 146

Query: 1086 SLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGV------PALPPCNSLR 925
             L+L  C  I+  G+  ++     +LK+L   +C  + D+  G        A   C  L 
Sbjct: 147  VLELGGCSNITNTGLL-LIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLE 205

Query: 924  SLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGC 745
             L++ +C    D SL  +SR    L  LNLS   G++D GLL    S    L  +NL  C
Sbjct: 206  QLTLQDCQKLTDLSLKHISRGLTGLRLLNLSFCGGISDAGLLHL--SHMGSLRSLNLRSC 263

Query: 744  INVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGI 565
             N++D  I  +A +    L  L+++ C  V D SLA IA     L+ L +    +SD GI
Sbjct: 264  DNISDTGIMHLA-MGSLRLSGLDVSFCDKVGDQSLAYIAQGLDGLKSLSLCSCHISDDGI 322

Query: 564  AALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVE 385
              +         L+ L++  CV  +DK L  + +  + L G+++  C  I+ RG++ + +
Sbjct: 323  NRMVRQ---MHGLRTLNIGQCVRITDKGLELIAEHLSQLTGIDLYGCTRITKRGLERITQ 379



 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 79/278 (28%), Positives = 128/278 (46%), Gaps = 12/278 (4%)
 Frame = -3

Query: 1392 LQSLNIS---DISLAVIGHYGVA-LTDLALINLQNINERGFWVMGS-GQGLHKLRSLVIT 1228
            ++SLN+S   +++   +GH  V  +  L  +NL    +     +G   Q L  L  L + 
Sbjct: 92   IESLNLSGCYNLTDNGLGHAFVQEIGSLRALNLSLCKQITDSSLGRIAQYLKGLEVLELG 151

Query: 1227 ACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFV----KAAE---SIESLQLEE 1069
             C  +T+ G+  ++ G   +K L LR C  LSD G+         AAE    +E L L++
Sbjct: 152  GCSNITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLEQLTLQD 211

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGD 889
            C +++   +  I     G L+ L    C G+ D   G+  L    SLRSL++ +C    D
Sbjct: 212  CQKLTDLSLKHISRGLTG-LRLLNLSFCGGISDA--GLLHLSHMGSLRSLNLRSCDNISD 268

Query: 888  ASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIA 709
              ++ L+     L  L++S  + V D  L    Q  D GL  ++L  C    D     + 
Sbjct: 269  TGIMHLAMGSLRLSGLDVSFCDKVGDQSLAYIAQGLD-GLKSLSLCSCHISDDGINRMVR 327

Query: 708  KLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI 595
            ++HG  L  LN+  C  +TD  L  IA++ S L  +D+
Sbjct: 328  QMHG--LRTLNIGQCVRITDKGLELIAEHLSQLTGIDL 363



 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 69/271 (25%), Positives = 121/271 (44%), Gaps = 32/271 (11%)
 Frame = -3

Query: 1095 SIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLS 916
            S+++  +     +S       ++     +++L    C+ + D   G   +    SLR+L+
Sbjct: 64   SLQARGIRRVQILSLRRSLSYVIQGMANIESLNLSGCYNLTDNGLGHAFVQEIGSLRALN 123

Query: 915  ICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPF-----------VQSCD--- 778
            +  C    D+SL  +++    L  L L G + +T+ GLL             ++SC    
Sbjct: 124  LSLCKQITDSSLGRIAQYLKGLEVLELGGCSNITNTGLLLIAWGLQRLKSLNLRSCRHLS 183

Query: 777  -------AGLVKVNLSGCINVTDKTISAIAKL---------HGET-LELLNLNGCGCVTD 649
                   AG+ +    GC+ +   T+    KL          G T L LLNL+ CG ++D
Sbjct: 184  DVGIGHLAGMTRSAAEGCLGLEQLTLQDCQKLTDLSLKHISRGLTGLRLLNLSFCGGISD 243

Query: 648  ASLAAIADYCSVLRDLDI-SKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPY 472
            A L  ++ +   LR L++ S   +SD GI  LA GS     L  L +S C    D+ L Y
Sbjct: 244  AGLLHLS-HMGSLRSLNLRSCDNISDTGIMHLAMGS---LRLSGLDVSFCDKVGDQSLAY 299

Query: 471  LHKLGNSLAGLNIQNCVGISHRGVDLLVERL 379
            + +  + L  L++ +C  IS  G++ +V ++
Sbjct: 300  IAQGLDGLKSLSLCSC-HISDDGINRMVRQM 329



 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 69/252 (27%), Positives = 119/252 (47%), Gaps = 7/252 (2%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVALTDLALINLQNINERGF-----WVMGSGQGLHKLRSLVITACQG 1216
            NI++  L +I      L  L L + +++++ G          + +G   L  L +  CQ 
Sbjct: 155  NITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLEQLTLQDCQK 214

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TDL ++ +S+G   ++ L L  C  +SD G++  +    S+ SL L  C  IS  G+  
Sbjct: 215  LTDLSLKHISRGLTGLRLLNLSFCGGISDAGLL-HLSHMGSLRSLNLRSCDNISDTGIMH 273

Query: 1035 ILVHSAGKLKALAFENC--FGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRL 862
            + + S  +L  L    C   G + LA+    L   + L+SLS+C+C    D  +  + R 
Sbjct: 274  LAMGSL-RLSGLDVSFCDKVGDQSLAYIAQGL---DGLKSLSLCSC-HISDDGINRMVRQ 328

Query: 861  CPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLEL 682
               L  LN+     +TD G L  +    + L  ++L GC  +T + +  I +L    L++
Sbjct: 329  MHGLRTLNIGQCVRITDKG-LELIAEHLSQLTGIDLYGCTRITKRGLERITQL--PCLKV 385

Query: 681  LNLNGCGCVTDA 646
            LNL G   +TD+
Sbjct: 386  LNL-GLWQMTDS 396



 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 64/230 (27%), Positives = 91/230 (39%), Gaps = 35/230 (15%)
 Frame = -3

Query: 984 FGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLV-HLNLSGLNGVTDY 808
           FG  D      A   C + R  +       G  + + L R  P+L   L   G+  V   
Sbjct: 17  FGYLDFRDKGRAAQVCTAWRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQIL 76

Query: 807 GL---LPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLA 637
            L   L +V    A +  +NLSGC N+TD  +         +L  LNL+ C  +TD+SL 
Sbjct: 77  SLRRSLSYVIQGMANIESLNLSGCYNLTDNGLGHAFVQEIGSLRALNLSLCKQITDSSLG 136

Query: 636 AIADYCSVLRDLDI---------------------------SKSRVSDFGIAALAG--GS 544
            IA Y   L  L++                           S   +SD GI  LAG   S
Sbjct: 137 RIAQYLKGLEVLELGGCSNITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRS 196

Query: 543 AIQ--FSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
           A +    L+ L+L  C   +D  L ++ +    L  LN+  C GIS  G+
Sbjct: 197 AAEGCLGLEQLTLQDCQKLTDLSLKHISRGLTGLRLLNLSFCGGISDAGL 246



>gb:BC006913_2090478 Mus musculus F-box and leucine-rich repeat
            protein 14, mRNA (cDNA clone IMAGE:3601186), partial cds.
          Length = 327

 Score =  103 bits (258), Expect = 7e-21
 Identities = 83/300 (27%), Positives = 143/300 (47%), Gaps = 7/300 (2%)
 Frame = -3

Query: 1263 QGLHKLRSLVITACQGVTDLGI-EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIE 1087
            QG+  + SL ++ C  +TD G+  A  +   +++ L L  C  ++D+ +    +  + +E
Sbjct: 14   QGMANIESLNLSGCYNLTDNGLGHAFVQEIGSLRALNLSLCKQITDSSLGRIAQYLKGLE 73

Query: 1086 SLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGV------PALPPCNSLR 925
             L+L  C  I+  G+  ++     +LK+L   +C  + D+  G        A   C  L 
Sbjct: 74   VLELGGCSNITNTGLL-LIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLE 132

Query: 924  SLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGC 745
             L++ +C    D SL  +SR    L  LNLS   G++D GLL    S    L  +NL  C
Sbjct: 133  QLTLQDCQKLTDLSLKHISRGLTGLRLLNLSFCGGISDAGLLHL--SHMGSLRSLNLRSC 190

Query: 744  INVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGI 565
             N++D  I  +A +    L  L+++ C  V D SLA IA     L+ L +    +SD GI
Sbjct: 191  DNISDTGIMHLA-MGSLRLSGLDVSFCDKVGDQSLAYIAQGLDGLKSLSLCSCHISDDGI 249

Query: 564  AALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVE 385
              +         L+ L++  CV  +DK L  + +  + L G+++  C  I+ RG++ + +
Sbjct: 250  NRMVRQ---MHGLRTLNIGQCVRITDKGLELIAEHLSQLTGIDLYGCTRITKRGLERITQ 306



 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 79/278 (28%), Positives = 128/278 (46%), Gaps = 12/278 (4%)
 Frame = -3

Query: 1392 LQSLNIS---DISLAVIGHYGVA-LTDLALINLQNINERGFWVMGS-GQGLHKLRSLVIT 1228
            ++SLN+S   +++   +GH  V  +  L  +NL    +     +G   Q L  L  L + 
Sbjct: 19   IESLNLSGCYNLTDNGLGHAFVQEIGSLRALNLSLCKQITDSSLGRIAQYLKGLEVLELG 78

Query: 1227 ACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFV----KAAE---SIESLQLEE 1069
             C  +T+ G+  ++ G   +K L LR C  LSD G+         AAE    +E L L++
Sbjct: 79   GCSNITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLEQLTLQD 138

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGD 889
            C +++   +  I     G L+ L    C G+ D   G+  L    SLRSL++ +C    D
Sbjct: 139  CQKLTDLSLKHISRGLTG-LRLLNLSFCGGISDA--GLLHLSHMGSLRSLNLRSCDNISD 195

Query: 888  ASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIA 709
              ++ L+     L  L++S  + V D  L    Q  D GL  ++L  C    D     + 
Sbjct: 196  TGIMHLAMGSLRLSGLDVSFCDKVGDQSLAYIAQGLD-GLKSLSLCSCHISDDGINRMVR 254

Query: 708  KLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI 595
            ++HG  L  LN+  C  +TD  L  IA++ S L  +D+
Sbjct: 255  QMHG--LRTLNIGQCVRITDKGLELIAEHLSQLTGIDL 290



 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 67/250 (26%), Positives = 114/250 (45%), Gaps = 32/250 (12%)
 Frame = -3

Query: 1032 LVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPN 853
            ++     +++L    C+ + D   G   +    SLR+L++  C    D+SL  +++    
Sbjct: 12   VIQGMANIESLNLSGCYNLTDNGLGHAFVQEIGSLRALNLSLCKQITDSSLGRIAQYLKG 71

Query: 852  LVHLNLSGLNGVTDYGLLPF-----------VQSCD----------AGLVKVNLSGCINV 736
            L  L L G + +T+ GLL             ++SC           AG+ +    GC+ +
Sbjct: 72   LEVLELGGCSNITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGL 131

Query: 735  TDKTISAIAKL---------HGET-LELLNLNGCGCVTDASLAAIADYCSVLRDLDI-SK 589
               T+    KL          G T L LLNL+ CG ++DA L  ++ +   LR L++ S 
Sbjct: 132  EQLTLQDCQKLTDLSLKHISRGLTGLRLLNLSFCGGISDAGLLHLS-HMGSLRSLNLRSC 190

Query: 588  SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISH 409
              +SD GI  LA GS     L  L +S C    D+ L Y+ +  + L  L++ +C  IS 
Sbjct: 191  DNISDTGIMHLAMGS---LRLSGLDVSFCDKVGDQSLAYIAQGLDGLKSLSLCSC-HISD 246

Query: 408  RGVDLLVERL 379
             G++ +V ++
Sbjct: 247  DGINRMVRQM 256



 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 69/252 (27%), Positives = 119/252 (47%), Gaps = 7/252 (2%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVALTDLALINLQNINERGF-----WVMGSGQGLHKLRSLVITACQG 1216
            NI++  L +I      L  L L + +++++ G          + +G   L  L +  CQ 
Sbjct: 82   NITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLEQLTLQDCQK 141

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TDL ++ +S+G   ++ L L  C  +SD G++  +    S+ SL L  C  IS  G+  
Sbjct: 142  LTDLSLKHISRGLTGLRLLNLSFCGGISDAGLL-HLSHMGSLRSLNLRSCDNISDTGIMH 200

Query: 1035 ILVHSAGKLKALAFENC--FGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRL 862
            + + S  +L  L    C   G + LA+    L   + L+SLS+C+C    D  +  + R 
Sbjct: 201  LAMGSL-RLSGLDVSFCDKVGDQSLAYIAQGL---DGLKSLSLCSC-HISDDGINRMVRQ 255

Query: 861  CPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLEL 682
               L  LN+     +TD G L  +    + L  ++L GC  +T + +  I +L    L++
Sbjct: 256  MHGLRTLNIGQCVRITDKG-LELIAEHLSQLTGIDLYGCTRITKRGLERITQL--PCLKV 312

Query: 681  LNLNGCGCVTDA 646
            LNL G   +TD+
Sbjct: 313  LNL-GLWQMTDS 323



 Score = 52.8 bits (125), Expect = 2e-05
 Identities = 49/165 (29%), Positives = 70/165 (42%), Gaps = 31/165 (18%)
 Frame = -3

Query: 801 LPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADY 622
           L +V    A +  +NLSGC N+TD  +         +L  LNL+ C  +TD+SL  IA Y
Sbjct: 9   LSYVIQGMANIESLNLSGCYNLTDNGLGHAFVQEIGSLRALNLSLCKQITDSSLGRIAQY 68

Query: 621 CSVLRDLDI---------------------------SKSRVSDFGIAALAG--GSAIQ-- 535
              L  L++                           S   +SD GI  LAG   SA +  
Sbjct: 69  LKGLEVLELGGCSNITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGC 128

Query: 534 FSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
             L+ L+L  C   +D  L ++ +    L  LN+  C GIS  G+
Sbjct: 129 LGLEQLTLQDCQKLTDLSLKHISRGLTGLRLLNLSFCGGISDAGL 173



>gb:AP004067_1837165 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC
            clone:OJ1581_H09.>gb:AP005513_1853182 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, BAC
            clone:OSJNBa0014E22.
          Length = 316

 Score =  103 bits (258), Expect = 7e-21
 Identities = 74/291 (25%), Positives = 141/291 (48%), Gaps = 1/291 (0%)
 Frame = -3

Query: 1266 GQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIE 1087
            G  L  L+S+ ++ C+ ++D G++AV  GC N++QL +  C L++DN +++  K+   +E
Sbjct: 26   GDRLPSLQSIDVSHCRKLSDKGLKAVLLGCQNLRQLVIAGCRLITDNLLIALSKSCIHLE 85

Query: 1086 SLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICN 907
             L    C+ I+ AG+ G L     K+K+L    C  + D      A    +SL SL + +
Sbjct: 86   DLVAAGCNNITDAGISG-LADGCHKMKSLDMSKCNKVGDPGVCKFAEVSSSSLVSLKLLD 144

Query: 906  CTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDK 727
            C   GD S+  L++ C NL  L                            + GC +VTD 
Sbjct: 145  CNKVGDKSIHALAKFCHNLETL---------------------------VIGGCRDVTDA 177

Query: 726  TISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS-KSRVSDFGIAALAG 550
            +I A+A      L+ L ++ C  +TD+SL ++   C +L  +D+    +++D     +  
Sbjct: 178  SIEALAFACYSRLKCLRMDWCLKITDSSLRSLLSNCKLLVAIDVGCCDQITDAAFQDM-D 236

Query: 549  GSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVD 397
             +  Q +L++L +S CV  +   +  + +   +L  L++++C  ++ +  +
Sbjct: 237  ANGFQSALRLLKISSCVRITVAGVRNVIESCMALEHLDVRSCPQVTRQSCE 287



>sp|Q8BID8|FXLE_MOUSE F-box/LRR-repeat protein 14 (F-box and
            leucine-rich repeat protein 14).>gb:AK084506_1174252 Mus
            musculus 13 days embryo heart cDNA, RIKEN full-length
            enriched library, clone:D330009L09 product:similar to
            F-BOX LEUCINE-RICH REPEAT PROTEIN 13 (FRAGMENT) [Xenopus
            laevis], full insert sequence.
          Length = 400

 Score =  103 bits (258), Expect = 7e-21
 Identities = 83/300 (27%), Positives = 143/300 (47%), Gaps = 7/300 (2%)
 Frame = -3

Query: 1263 QGLHKLRSLVITACQGVTDLGI-EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIE 1087
            QG+  + SL ++ C  +TD G+  A  +   +++ L L  C  ++D+ +    +  + +E
Sbjct: 87   QGMANIESLNLSGCYNLTDNGLGHAFVQEIGSLRALNLSLCKQITDSSLGRIAQYLKGLE 146

Query: 1086 SLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGV------PALPPCNSLR 925
             L+L  C  I+  G+  ++     +LK+L   +C  + D+  G        A   C  L 
Sbjct: 147  VLELGGCSNITNTGLL-LIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLE 205

Query: 924  SLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGC 745
             L++ +C    D SL  +SR    L  LNLS   G++D GLL    S    L  +NL  C
Sbjct: 206  QLTLQDCQKLTDLSLKHISRGLTGLRLLNLSFCGGISDAGLLHL--SHMGSLRSLNLRSC 263

Query: 744  INVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGI 565
             N++D  I  +A +    L  L+++ C  V D SLA IA     L+ L +    +SD GI
Sbjct: 264  DNISDTGIMHLA-MGSLRLSGLDVSFCDKVGDQSLAYIAQGLDGLKSLSLCSCHISDDGI 322

Query: 564  AALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVE 385
              +         L+ L++  CV  +DK L  + +  + L G+++  C  I+ RG++ + +
Sbjct: 323  NRMVRQ---MHGLRTLNIGQCVRITDKGLELIAEHLSQLTGIDLYGCTRITKRGLERITQ 379



 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 79/278 (28%), Positives = 128/278 (46%), Gaps = 12/278 (4%)
 Frame = -3

Query: 1392 LQSLNIS---DISLAVIGHYGVA-LTDLALINLQNINERGFWVMGS-GQGLHKLRSLVIT 1228
            ++SLN+S   +++   +GH  V  +  L  +NL    +     +G   Q L  L  L + 
Sbjct: 92   IESLNLSGCYNLTDNGLGHAFVQEIGSLRALNLSLCKQITDSSLGRIAQYLKGLEVLELG 151

Query: 1227 ACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFV----KAAE---SIESLQLEE 1069
             C  +T+ G+  ++ G   +K L LR C  LSD G+         AAE    +E L L++
Sbjct: 152  GCSNITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLEQLTLQD 211

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGD 889
            C +++   +  I     G L+ L    C G+ D   G+  L    SLRSL++ +C    D
Sbjct: 212  CQKLTDLSLKHISRGLTG-LRLLNLSFCGGISDA--GLLHLSHMGSLRSLNLRSCDNISD 268

Query: 888  ASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIA 709
              ++ L+     L  L++S  + V D  L    Q  D GL  ++L  C    D     + 
Sbjct: 269  TGIMHLAMGSLRLSGLDVSFCDKVGDQSLAYIAQGLD-GLKSLSLCSCHISDDGINRMVR 327

Query: 708  KLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI 595
            ++HG  L  LN+  C  +TD  L  IA++ S L  +D+
Sbjct: 328  QMHG--LRTLNIGQCVRITDKGLELIAEHLSQLTGIDL 363



 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 69/271 (25%), Positives = 121/271 (44%), Gaps = 32/271 (11%)
 Frame = -3

Query: 1095 SIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLS 916
            S+++  +     +S       ++     +++L    C+ + D   G   +    SLR+L+
Sbjct: 64   SLQARGIRRVQILSLRRSLSYVIQGMANIESLNLSGCYNLTDNGLGHAFVQEIGSLRALN 123

Query: 915  ICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPF-----------VQSCD--- 778
            +  C    D+SL  +++    L  L L G + +T+ GLL             ++SC    
Sbjct: 124  LSLCKQITDSSLGRIAQYLKGLEVLELGGCSNITNTGLLLIAWGLQRLKSLNLRSCRHLS 183

Query: 777  -------AGLVKVNLSGCINVTDKTISAIAKL---------HGET-LELLNLNGCGCVTD 649
                   AG+ +    GC+ +   T+    KL          G T L LLNL+ CG ++D
Sbjct: 184  DVGIGHLAGMTRSAAEGCLGLEQLTLQDCQKLTDLSLKHISRGLTGLRLLNLSFCGGISD 243

Query: 648  ASLAAIADYCSVLRDLDI-SKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPY 472
            A L  ++ +   LR L++ S   +SD GI  LA GS     L  L +S C    D+ L Y
Sbjct: 244  AGLLHLS-HMGSLRSLNLRSCDNISDTGIMHLAMGS---LRLSGLDVSFCDKVGDQSLAY 299

Query: 471  LHKLGNSLAGLNIQNCVGISHRGVDLLVERL 379
            + +  + L  L++ +C  IS  G++ +V ++
Sbjct: 300  IAQGLDGLKSLSLCSC-HISDDGINRMVRQM 329



 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 69/252 (27%), Positives = 119/252 (47%), Gaps = 7/252 (2%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVALTDLALINLQNINERGF-----WVMGSGQGLHKLRSLVITACQG 1216
            NI++  L +I      L  L L + +++++ G          + +G   L  L +  CQ 
Sbjct: 155  NITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLEQLTLQDCQK 214

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TDL ++ +S+G   ++ L L  C  +SD G++  +    S+ SL L  C  IS  G+  
Sbjct: 215  LTDLSLKHISRGLTGLRLLNLSFCGGISDAGLL-HLSHMGSLRSLNLRSCDNISDTGIMH 273

Query: 1035 ILVHSAGKLKALAFENC--FGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRL 862
            + + S  +L  L    C   G + LA+    L   + L+SLS+C+C    D  +  + R 
Sbjct: 274  LAMGSL-RLSGLDVSFCDKVGDQSLAYIAQGL---DGLKSLSLCSC-HISDDGINRMVRQ 328

Query: 861  CPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLEL 682
               L  LN+     +TD G L  +    + L  ++L GC  +T + +  I +L    L++
Sbjct: 329  MHGLRTLNIGQCVRITDKG-LELIAEHLSQLTGIDLYGCTRITKRGLERITQL--PCLKV 385

Query: 681  LNLNGCGCVTDA 646
            LNL G   +TD+
Sbjct: 386  LNL-GLWQMTDS 396



 Score = 55.1 bits (131), Expect = 4e-06
 Identities = 64/230 (27%), Positives = 92/230 (40%), Gaps = 35/230 (15%)
 Frame = -3

Query: 984 FGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLV-HLNLSGLNGVTDY 808
           FG  D+     A   C + R  +       G  + + L R  P+L   L   G+  V   
Sbjct: 17  FGYLDVRDKGRAAQVCTAWRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQIL 76

Query: 807 GL---LPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLA 637
            L   L +V    A +  +NLSGC N+TD  +         +L  LNL+ C  +TD+SL 
Sbjct: 77  SLRRSLSYVIQGMANIESLNLSGCYNLTDNGLGHAFVQEIGSLRALNLSLCKQITDSSLG 136

Query: 636 AIADYCSVLRDLDI---------------------------SKSRVSDFGIAALAG--GS 544
            IA Y   L  L++                           S   +SD GI  LAG   S
Sbjct: 137 RIAQYLKGLEVLELGGCSNITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRS 196

Query: 543 AIQ--FSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
           A +    L+ L+L  C   +D  L ++ +    L  LN+  C GIS  G+
Sbjct: 197 AAEGCLGLEQLTLQDCQKLTDLSLKHISRGLTGLRLLNLSFCGGISDAGL 246



>sp|Q8N1E6|FXLE_HUMAN F-box/LRR-repeat protein 14 (F-box and
            leucine-rich repeat protein 14).>gb:BC028132_1979129 Homo
            sapiens F-box and leucine-rich repeat protein 14, mRNA
            (cDNA clone MGC:40195 IMAGE:5205284), complete cds.
          Length = 418

 Score =  103 bits (258), Expect = 7e-21
 Identities = 83/300 (27%), Positives = 143/300 (47%), Gaps = 7/300 (2%)
 Frame = -3

Query: 1263 QGLHKLRSLVITACQGVTDLGI-EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIE 1087
            QG+  + SL ++ C  +TD G+  A  +   +++ L L  C  ++D+ +    +  + +E
Sbjct: 87   QGMANIESLNLSGCYNLTDNGLGHAFVQEIGSLRALNLSLCKQITDSSLGRIAQYLKGLE 146

Query: 1086 SLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGV------PALPPCNSLR 925
             L+L  C  I+  G+  ++     +LK+L   +C  + D+  G        A   C  L 
Sbjct: 147  VLELGGCSNITNTGLL-LIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLE 205

Query: 924  SLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGC 745
             L++ +C    D SL  +SR    L  LNLS   G++D GLL    S    L  +NL  C
Sbjct: 206  QLTLQDCQKLTDLSLKHISRGLTGLRLLNLSFCGGISDAGLLHL--SHMGSLRSLNLRSC 263

Query: 744  INVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGI 565
             N++D  I  +A +    L  L+++ C  V D SLA IA     L+ L +    +SD GI
Sbjct: 264  DNISDTGIMHLA-MGSLRLSGLDVSFCDKVGDQSLAYIAQGLDGLKSLSLCSCHISDDGI 322

Query: 564  AALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVE 385
              +         L+ L++  CV  +DK L  + +  + L G+++  C  I+ RG++ + +
Sbjct: 323  NRMVRQ---MHGLRTLNIGQCVRITDKGLELIAEHLSQLTGIDLYGCTRITKRGLERITQ 379



 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 79/278 (28%), Positives = 128/278 (46%), Gaps = 12/278 (4%)
 Frame = -3

Query: 1392 LQSLNIS---DISLAVIGHYGVA-LTDLALINLQNINERGFWVMGS-GQGLHKLRSLVIT 1228
            ++SLN+S   +++   +GH  V  +  L  +NL    +     +G   Q L  L  L + 
Sbjct: 92   IESLNLSGCYNLTDNGLGHAFVQEIGSLRALNLSLCKQITDSSLGRIAQYLKGLEVLELG 151

Query: 1227 ACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFV----KAAE---SIESLQLEE 1069
             C  +T+ G+  ++ G   +K L LR C  LSD G+         AAE    +E L L++
Sbjct: 152  GCSNITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLEQLTLQD 211

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGD 889
            C +++   +  I     G L+ L    C G+ D   G+  L    SLRSL++ +C    D
Sbjct: 212  CQKLTDLSLKHISRGLTG-LRLLNLSFCGGISDA--GLLHLSHMGSLRSLNLRSCDNISD 268

Query: 888  ASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIA 709
              ++ L+     L  L++S  + V D  L    Q  D GL  ++L  C    D     + 
Sbjct: 269  TGIMHLAMGSLRLSGLDVSFCDKVGDQSLAYIAQGLD-GLKSLSLCSCHISDDGINRMVR 327

Query: 708  KLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI 595
            ++HG  L  LN+  C  +TD  L  IA++ S L  +D+
Sbjct: 328  QMHG--LRTLNIGQCVRITDKGLELIAEHLSQLTGIDL 363



 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 71/260 (27%), Positives = 122/260 (46%), Gaps = 7/260 (2%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVALTDLALINLQNINERGF-----WVMGSGQGLHKLRSLVITACQG 1216
            NI++  L +I      L  L L + +++++ G          + +G   L  L +  CQ 
Sbjct: 155  NITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLEQLTLQDCQK 214

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TDL ++ +S+G   ++ L L  C  +SD G++  +    S+ SL L  C  IS  G+  
Sbjct: 215  LTDLSLKHISRGLTGLRLLNLSFCGGISDAGLL-HLSHMGSLRSLNLRSCDNISDTGIMH 273

Query: 1035 ILVHSAGKLKALAFENC--FGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRL 862
            + + S  +L  L    C   G + LA+    L   + L+SLS+C+C    D  +  + R 
Sbjct: 274  LAMGSL-RLSGLDVSFCDKVGDQSLAYIAQGL---DGLKSLSLCSC-HISDDGINRMVRQ 328

Query: 861  CPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLEL 682
               L  LN+     +TD G L  +    + L  ++L GC  +T + +  I +L    L++
Sbjct: 329  MHGLRTLNIGQCVRITDKG-LELIAEHLSQLTGIDLYGCTRITKRGLERITQL--PCLKV 385

Query: 681  LNLNGCGCVTDASLAAIADY 622
            LNL G   +TD+   A  D+
Sbjct: 386  LNL-GLWQMTDSEKEARGDF 404



 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 69/271 (25%), Positives = 121/271 (44%), Gaps = 32/271 (11%)
 Frame = -3

Query: 1095 SIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLS 916
            S+++  +     +S       ++     +++L    C+ + D   G   +    SLR+L+
Sbjct: 64   SLQARGIRRVQILSLRRSLSYVIQGMANIESLNLSGCYNLTDNGLGHAFVQEIGSLRALN 123

Query: 915  ICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPF-----------VQSCD--- 778
            +  C    D+SL  +++    L  L L G + +T+ GLL             ++SC    
Sbjct: 124  LSLCKQITDSSLGRIAQYLKGLEVLELGGCSNITNTGLLLIAWGLQRLKSLNLRSCRHLS 183

Query: 777  -------AGLVKVNLSGCINVTDKTISAIAKL---------HGET-LELLNLNGCGCVTD 649
                   AG+ +    GC+ +   T+    KL          G T L LLNL+ CG ++D
Sbjct: 184  DVGIGHLAGMTRSAAEGCLGLEQLTLQDCQKLTDLSLKHISRGLTGLRLLNLSFCGGISD 243

Query: 648  ASLAAIADYCSVLRDLDI-SKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPY 472
            A L  ++ +   LR L++ S   +SD GI  LA GS     L  L +S C    D+ L Y
Sbjct: 244  AGLLHLS-HMGSLRSLNLRSCDNISDTGIMHLAMGS---LRLSGLDVSFCDKVGDQSLAY 299

Query: 471  LHKLGNSLAGLNIQNCVGISHRGVDLLVERL 379
            + +  + L  L++ +C  IS  G++ +V ++
Sbjct: 300  IAQGLDGLKSLSLCSC-HISDDGINRMVRQM 329



 Score = 55.1 bits (131), Expect = 4e-06
 Identities = 64/230 (27%), Positives = 92/230 (40%), Gaps = 35/230 (15%)
 Frame = -3

Query: 984 FGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLV-HLNLSGLNGVTDY 808
           FG  D+     A   C + R  +       G  + + L R  P+L   L   G+  V   
Sbjct: 17  FGYLDVRDKGRAAQVCTAWRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQIL 76

Query: 807 GL---LPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLA 637
            L   L +V    A +  +NLSGC N+TD  +         +L  LNL+ C  +TD+SL 
Sbjct: 77  SLRRSLSYVIQGMANIESLNLSGCYNLTDNGLGHAFVQEIGSLRALNLSLCKQITDSSLG 136

Query: 636 AIADYCSVLRDLDI---------------------------SKSRVSDFGIAALAG--GS 544
            IA Y   L  L++                           S   +SD GI  LAG   S
Sbjct: 137 RIAQYLKGLEVLELGGCSNITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRS 196

Query: 543 AIQ--FSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
           A +    L+ L+L  C   +D  L ++ +    L  LN+  C GIS  G+
Sbjct: 197 AAEGCLGLEQLTLQDCQKLTDLSLKHISRGLTGLRLLNLSFCGGISDAGL 246



>gb:BX649324_2567750 Zebrafish DNA sequence from clone DKEY-85M15 in
            linkage group 4 Contains the 5' end of the wnt5a gene for
            wingless-type MMTV integration site family member 5a, the
            ppab gene for partner of paired b, the 3' end of the gene
            for a novel protein similar to vertebrate
            Rab6-interacting protein 2 (ELKS) and a CpG island,
            complete sequence.
          Length = 400

 Score =  103 bits (256), Expect = 1e-20
 Identities = 83/302 (27%), Positives = 145/302 (48%), Gaps = 9/302 (2%)
 Frame = -3

Query: 1263 QGLHKLRSLVITACQGVTDLGI-EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIE 1087
            QG+  + SL ++ C  +TD G+  A  +  P+++ L L  C  ++D+ +    +  +++E
Sbjct: 87   QGMPNIESLNLSGCYNLTDNGLGHAFVQEIPSLRVLNLSLCKQITDSSLGRIAQYLKNLE 146

Query: 1086 SLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGV------PALPPCNSLR 925
             L+L  C  I+  G+  ++     +LK+L   +C  + D+  G        A   C SL 
Sbjct: 147  VLELGGCSNITNTGLL-LIAWGLHRLKSLNLRSCRHVSDVGIGHLAGMTRSAAEGCLSLE 205

Query: 924  SLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGC 745
             L++ +C    D SL  +S+    L  LNLS   G++D G++    S    L  +NL  C
Sbjct: 206  YLTLQDCQKLTDLSLKHISKGLTKLKVLNLSFCGGISDAGMIHL--SHMTSLWSLNLRSC 263

Query: 744  INVTDKTISAIAKLHGETLEL--LNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDF 571
             N++D  I  +A     TL L  L+++ C  + D SLA IA     L+ L +    +SD 
Sbjct: 264  DNISDTGIMHLAM---GTLRLSGLDVSFCDKIGDQSLAYIAQGLYQLKSLSLCSCHISDD 320

Query: 570  GIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
            GI  +         L+ L++  CV  +DK L  +      L G+++  C  I+ RG++ +
Sbjct: 321  GINRMVRQ---MHELRTLNIGQCVRITDKGLELIADHLTQLTGIDLYGCTKITKRGLERI 377

Query: 390  VE 385
             +
Sbjct: 378  TQ 379



 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 67/243 (27%), Positives = 112/243 (46%), Gaps = 7/243 (2%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVALTDLALINLQNINERGF-----WVMGSGQGLHKLRSLVITACQG 1216
            NI++  L +I      L  L L + +++++ G          + +G   L  L +  CQ 
Sbjct: 155  NITNTGLLLIAWGLHRLKSLNLRSCRHVSDVGIGHLAGMTRSAAEGCLSLEYLTLQDCQK 214

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TDL ++ +SKG   +K L L  C  +SD G++  +    S+ SL L  C  IS  G+  
Sbjct: 215  LTDLSLKHISKGLTKLKVLNLSFCGGISDAGMI-HLSHMTSLWSLNLRSCDNISDTGIMH 273

Query: 1035 ILVHSAGKLKALAFENC--FGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRL 862
            + + +  +L  L    C   G + LA+    L     L+SLS+C+C    D  +  + R 
Sbjct: 274  LAMGTL-RLSGLDVSFCDKIGDQSLAYIAQGL---YQLKSLSLCSC-HISDDGINRMVRQ 328

Query: 861  CPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLEL 682
               L  LN+     +TD G L  +      L  ++L GC  +T + +  I +L    L++
Sbjct: 329  MHELRTLNIGQCVRITDKG-LELIADHLTQLTGIDLYGCTKITKRGLERITQL--PCLKV 385

Query: 681  LNL 673
            LNL
Sbjct: 386  LNL 388



 Score = 67.0 bits (162), Expect = 9e-10
 Identities = 64/253 (25%), Positives = 113/253 (44%), Gaps = 7/253 (2%)
 Frame = -3

Query: 1095 SIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLS 916
            S+++  +     +S       ++     +++L    C+ + D   G   +    SLR L+
Sbjct: 64   SLQARGIRRVQILSLRRSLSYVIQGMPNIESLNLSGCYNLTDNGLGHAFVQEIPSLRVLN 123

Query: 915  ICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINV 736
            +  C    D+SL  +++   NL  L L G + +T+ GLL         L  +NL  C +V
Sbjct: 124  LSLCKQITDSSLGRIAQYLKNLEVLELGGCSNITNTGLLLIAWGLHR-LKSLNLRSCRHV 182

Query: 735  TDKTISAIAKLHGE------TLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS-KSRVS 577
            +D  I  +A +         +LE L L  C  +TD SL  I+   + L+ L++S    +S
Sbjct: 183  SDVGIGHLAGMTRSAAEGCLSLEYLTLQDCQKLTDLSLKHISKGLTKLKVLNLSFCGGIS 242

Query: 576  DFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVD 397
            D G+  L+       SL  L+L  C   SD  + +L      L+GL++  C  I  + + 
Sbjct: 243  DAGMIHLSH----MTSLWSLNLRSCDNISDTGIMHLAMGTLRLSGLDVSFCDKIGDQSLA 298

Query: 396  LLVERLWRCDILS 358
             + + L++   LS
Sbjct: 299  YIAQGLYQLKSLS 311



 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 67/231 (29%), Positives = 95/231 (41%), Gaps = 37/231 (16%)
 Frame = -3

Query: 939 CNSLRSLSICNCTGFGDASLVVLSRLCPNLV-HLNLSGLNGVTDYGL---LPFVQSCDAG 772
           C + R  S       G  + + L R  P+L   L   G+  V    L   L +V      
Sbjct: 32  CTAWRDASYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQILSLRRSLSYVIQGMPN 91

Query: 771 LVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI- 595
           +  +NLSGC N+TD  +         +L +LNL+ C  +TD+SL  IA Y   L  L++ 
Sbjct: 92  IESLNLSGCYNLTDNGLGHAFVQEIPSLRVLNLSLCKQITDSSLGRIAQYLKNLEVLELG 151

Query: 594 --------------------------SKSRVSDFGIAALAG--GSAIQ--FSLQILSLSG 505
                                     S   VSD GI  LAG   SA +   SL+ L+L  
Sbjct: 152 GCSNITNTGLLLIAWGLHRLKSLNLRSCRHVSDVGIGHLAGMTRSAAEGCLSLEYLTLQD 211

Query: 504 CVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL--VERLWRCDILS 358
           C   +D  L ++ K    L  LN+  C GIS  G+  L  +  LW  ++ S
Sbjct: 212 CQKLTDLSLKHISKGLTKLKVLNLSFCGGISDAGMIHLSHMTSLWSLNLRS 262



>gb:BT005940_1638862 Arabidopsis thaliana At5g27920 gene, complete
            cds.>gb:AK117239_1815284 Arabidopsis thaliana At5g27920
            mRNA for unknown protein, complete cds, clone:
            RAFL16-79-B21.
          Length = 642

 Score =  103 bits (256), Expect = 1e-20
 Identities = 73/250 (29%), Positives = 127/250 (50%), Gaps = 1/250 (0%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            L  + ++ C  VTD+G+ ++++ C N+K L L  C  ++D  + +  ++  ++ +L+LE 
Sbjct: 327  LMEIGLSRCVDVTDIGMISLARNCLNLKTLNLACCGFVTDVAISAVAQSCRNLGTLKLES 386

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGD 889
            CH I++ G+  +  +S   ++ L   +C+G+ D   G+  +  C++L+ L +  CT   D
Sbjct: 387  CHLITEKGLQSLGCYSM-LVQELDLTDCYGVNDR--GLEYISKCSNLQRLKLGLCTNISD 443

Query: 888  ASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIA 709
              +  +   C  L+ L+L    G  D GL    + C + L ++ LS C  +TD  +  I 
Sbjct: 444  KGIFHIGSKCSKLLELDLYRCAGFGDDGLAALSRGCKS-LNRLILSYCCELTDTGVEQIR 502

Query: 708  KLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQF 532
            +L  E L  L L G   +T   LAAIA  C  L  LD+     + D G  ALA  S    
Sbjct: 503  QL--ELLSHLELRGLKNITGVGLAAIASGCKKLGYLDVKLCENIDDSGFWALAYFSK--- 557

Query: 531  SLQILSLSGC 502
            +L+ ++L  C
Sbjct: 558  NLRQINLCNC 567



 Score = 92.0 bits (227), Expect = 3e-17
 Identities = 82/317 (25%), Positives = 139/317 (43%), Gaps = 27/317 (8%)
 Frame = -3

Query: 1260 GLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLR----------------------- 1150
            G   L  + +  C  ++DLGI+ + K C  +K L +                        
Sbjct: 170  GCSNLNKISLKWCMEISDLGIDLLCKICKGLKSLDVSYLKITNDSIRSIALLVKLEVLDM 229

Query: 1149 -KCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMK 973
              C L+ D G+      + S++ + +  C R+S +G+  I V     ++ L   +C    
Sbjct: 230  VSCPLIDDGGLQFLENGSPSLQEVDVTRCDRVSLSGLISI-VRGHPDIQLLKASHCVSEV 288

Query: 972  DLAFGVPALPPCNSLRSLSICNCTG--FGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLL 799
              +F    L     L+ L      G    D+SLV LS  C +L+ + LS    VTD G++
Sbjct: 289  SGSF----LKYIKGLKHLKTIWIDGAHVSDSSLVSLSSSCRSLMEIGLSRCVDVTDIGMI 344

Query: 798  PFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYC 619
               ++C   L  +NL+ C  VTD  ISA+A+     L  L L  C  +T+  L ++  Y 
Sbjct: 345  SLARNC-LNLKTLNLACCGFVTDVAISAVAQ-SCRNLGTLKLESCHLITEKGLQSLGCYS 402

Query: 618  SVLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAG 442
             ++++LD++    V+D G+  ++  S    +LQ L L  C   SDK + ++    + L  
Sbjct: 403  MLVQELDLTDCYGVNDRGLEYISKCS----NLQRLKLGLCTNISDKGIFHIGSKCSKLLE 458

Query: 441  LNIQNCVGISHRGVDLL 391
            L++  C G    G+  L
Sbjct: 459  LDLYRCAGFGDDGLAAL 475



 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 91/326 (27%), Positives = 154/326 (47%), Gaps = 33/326 (10%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            LR L +  C  ++D+G+  +  GC N+ ++ L+ C  +SD G+    K  + ++SL +  
Sbjct: 148  LRELKMDKCLSLSDVGLARIVVGCSNLNKISLKWCMEISDLGIDLLCKICKGLKSLDVSY 207

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENC-----FGMKDLAFGVPALPPCNSLR----SLS 916
              +I+   +  I +    KL+ L   +C      G++ L  G P+L   +  R    SLS
Sbjct: 208  L-KITNDSIRSIAL--LVKLEVLDMVSCPLIDDGGLQFLENGSPSLQEVDVTRCDRVSLS 264

Query: 915  --ICNCTGFGDASLVVLS-----------RLCPNLVHLNLSGLNG--VTDYGLLPFVQSC 781
              I    G  D  L+  S           +    L HL    ++G  V+D  L+    SC
Sbjct: 265  GLISIVRGHPDIQLLKASHCVSEVSGSFLKYIKGLKHLKTIWIDGAHVSDSSLVSLSSSC 324

Query: 780  DAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDL 601
               L+++ LS C++VTD  + ++A+ +   L+ LNL  CG VTD +++A+A  C  L  L
Sbjct: 325  -RSLMEIGLSRCVDVTDIGMISLAR-NCLNLKTLNLACCGFVTDVAISAVAQSCRNLGTL 382

Query: 600  DISKSR-VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC 424
             +     +++ G+ +L   S +   +Q L L+ C   +D+ L Y+ K  N L  L +  C
Sbjct: 383  KLESCHLITEKGLQSLGCYSML---VQELDLTDCYGVNDRGLEYISKCSN-LQRLKLGLC 438

Query: 423  VGISHRGV--------DLLVERLWRC 370
              IS +G+         LL   L+RC
Sbjct: 439  TNISDKGIFHIGSKCSKLLELDLYRC 464



 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 70/281 (24%), Positives = 120/281 (42%), Gaps = 24/281 (8%)
 Frame = -3

Query: 1434 SLFSSAGNHLMKVKLQSLN-ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQG 1258
            S  + +  +L  +KL+S + I++  L  +G Y + + +L L +   +N+RG   +     
Sbjct: 370  SAVAQSCRNLGTLKLESCHLITEKGLQSLGCYSMLVQELDLTDCYGVNDRGLEYISKCSN 429

Query: 1257 LHKLR-----------------------SLVITACQGVTDLGIEAVSKGCPNVKQLCLRK 1147
            L +L+                        L +  C G  D G+ A+S+GC ++ +L L  
Sbjct: 430  LQRLKLGLCTNISDKGIFHIGSKCSKLLELDLYRCAGFGDDGLAALSRGCKSLNRLILSY 489

Query: 1146 CTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDL 967
            C  L+D GV   ++  E +  L+L     I+  G+  I      KL  L  + C  + D 
Sbjct: 490  CCELTDTGVEQ-IRQLELLSHLELRGLKNITGVGLAAI-ASGCKKLGYLDVKLCENIDDS 547

Query: 966  AFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQ 787
             F   A    N LR +++CNC+   D +L +L      +  ++L  L+ VT  G    ++
Sbjct: 548  GFWALAYFSKN-LRQINLCNCS-VSDTALCMLMSNLSRVQDVDLVHLSRVTVEGFEFALR 605

Query: 786  SCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGC 664
            +C   L K+ L   +            L  E LE L+  GC
Sbjct: 606  ACCNRLKKLKLLAPLRFL---------LSSELLETLHARGC 637



 Score = 57.8 bits (138), Expect = 6e-07
 Identities = 59/263 (22%), Positives = 103/263 (39%)
 Frame = -3

Query: 1176 PNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALA 997
            PN+  L L  C  L D+ V            L+L     IS  G+  + +  +  ++A  
Sbjct: 65   PNLSSLDLSVCPKLDDDVV------------LRLALDGAISTLGIKSLNLSRSTAVRARG 112

Query: 996  FENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGV 817
             E    M            C++L  + + +C GFGD     LS     L  L +     +
Sbjct: 113  LETLARM------------CHALERVDVSHCWGFGDREAAALSS-ATGLRELKMDKCLSL 159

Query: 816  TDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLA 637
            +D GL   V  C + L K++L  C+ ++D  I  + K+                      
Sbjct: 160  SDVGLARIVVGC-SNLNKISLKWCMEISDLGIDLLCKI---------------------- 196

Query: 636  AIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLG 457
                 C  L+ LD+S  ++++  I ++    A+   L++L +  C L  D  L +L    
Sbjct: 197  -----CKGLKSLDVSYLKITNDSIRSI----ALLVKLEVLDMVSCPLIDDGGLQFLENGS 247

Query: 456  NSLAGLNIQNCVGISHRGVDLLV 388
             SL  +++  C  +S  G+  +V
Sbjct: 248  PSLQEVDVTRCDRVSLSGLISIV 270



>sp|Q8BH16|FL2_MOUSE F-box/LRR-repeat protein 2 (F-box and
            leucine-rich repeat protein 2).>gb:AK039010_1165248 Mus
            musculus adult male hypothalamus cDNA, RIKEN full-length
            enriched library, clone:A230084N13 product:LEUCINE-RICH
            REPEATS CONTAINING F-BOX PROTEIN FBL3 homolog [Homo
            sapiens], full insert sequence.>gb:AK045742_1167524 Mus
            musculus adult male corpora quadrigemina cDNA, RIKEN
            full-length enriched library, clone:B230309A05
            product:LEUCINE-RICH REPEATS CONTAINING F-BOX PROTEIN
            FBL3 homolog [Homo sapiens], full insert
            sequence.>gb:AK089994_1176084 Mus musculus CRL-1751 WEHI
            164 cDNA, RIKEN full-length enriched library,
            clone:G430047M01 product:LEUCINE-RICH REPEATS CONTAINING
            F-BOX PROTEIN FBL3 homolog [Homo sapiens], full insert
            sequence.
          Length = 423

 Score =  102 bits (254), Expect = 2e-20
 Identities = 82/348 (23%), Positives = 154/348 (44%), Gaps = 1/348 (0%)
 Frame = -3

Query: 1440 IASLFSSAGNHLMKVKLQS-LNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSG 1264
            + ++    G  L K+ L+  + + D SL         +  L L     I +   + +   
Sbjct: 69   VENISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLS-- 126

Query: 1263 QGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIES 1084
            +   KL+ L +T+C  VT+  ++ +S+GC N++ L L  C  ++  G+ + V+    +++
Sbjct: 127  RFCSKLKHLDLTSCVSVTNSSLKGISEGCRNLEYLNLSWCDQITKEGIEALVRGCRGLKA 186

Query: 1083 LQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNC 904
            L L  C ++    +  I  H   +L +L  ++C  + D    V     C+ L++L +  C
Sbjct: 187  LLLRGCTQLEDEALKHIQNH-CHELVSLNLQSCSRITDDGV-VQICRGCHRLQALCLSGC 244

Query: 903  TGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKT 724
            +   DASL  L   CP L  L  +  + +TD G     ++C   L K++L  C+ +TD T
Sbjct: 245  SNLTDASLTALGLNCPRLQVLEAARCSHLTDAGFTLLARNCHE-LEKMDLEECVLITDST 303

Query: 723  ISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGS 544
            +  ++ +H   L+ L+L+ C  +TD                          GI  L+  +
Sbjct: 304  LVQLS-IHCPKLQALSLSHCELITDE-------------------------GILHLSSST 337

Query: 543  AIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
                 L++L L  C+L +D  L +L      L  L + +C  ++  G+
Sbjct: 338  CGHERLRVLELDNCLLVTDASLEHLENC-RGLERLELYDCQQVTRAGI 384



 Score = 52.0 bits (123), Expect = 3e-05
 Identities = 36/132 (27%), Positives = 61/132 (46%)
 Frame = -3

Query: 783 CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRD 604
           C   L K++L GCI V D ++   A+ +   +E LNLNGC  +TD++  +++ +CS L+ 
Sbjct: 76  CGGFLRKLSLRGCIGVGDSSLKTFAQ-NCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKH 134

Query: 603 LDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC 424
           LD                            L+ CV  ++  L  + +   +L  LN+  C
Sbjct: 135 LD----------------------------LTSCVSVTNSSLKGISEGCRNLEYLNLSWC 166

Query: 423 VGISHRGVDLLV 388
             I+  G++ LV
Sbjct: 167 DQITKEGIEALV 178



>gb:AK044693_1167082 Mus musculus adult retina cDNA, RIKEN full-length
            enriched library, clone:A930033P03 product:LEUCINE-RICH
            REPEATS CONTAINING F-BOX PROTEIN FBL3 homolog [Homo
            sapiens], full insert sequence.
          Length = 423

 Score =  102 bits (253), Expect = 3e-20
 Identities = 81/349 (23%), Positives = 157/349 (44%), Gaps = 2/349 (0%)
 Frame = -3

Query: 1440 IASLFSSAGNHLMKVKLQS-LNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSG 1264
            + ++    G  L K+ L+  + + D SL         +  L L     I +   + +   
Sbjct: 69   VENISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLS-- 126

Query: 1263 QGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIES 1084
            +   KL+ L +T+C  VT+  ++ +S+GC N++ L L  C  ++  G+ + V+    +++
Sbjct: 127  RFCSKLKHLDLTSCVSVTNSSLKGISEGCRNLEYLNLSWCDQITKEGIEALVRGCRGLKA 186

Query: 1083 LQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNC 904
            L L  C ++    +  I  H                            C+ L SL++ +C
Sbjct: 187  LLLRGCTQLEDEALKHIQNH----------------------------CHELVSLNLQSC 218

Query: 903  TGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKT 724
            +   D  +V + R C  L  L LSG + +TD  L     +C   L  +  + C ++TD +
Sbjct: 219  SRITDDGVVQICRGCHRLQALCLSGCSNLTDASLTALGLNCPR-LQVLEAARCSHLTDAS 277

Query: 723  ISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSDFGIAALAGG 547
             + +A+ +   LE ++L  C  +TD++L  ++ +C  L+ L +S    ++D GI  L+  
Sbjct: 278  FTLLAR-NCHELEKMDLEECVLITDSTLVQLSIHCPKLQALSLSHCELITDEGILHLSSS 336

Query: 546  SAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
            +     L++L L  C+L +D  L +L      L  L + +C  ++  G+
Sbjct: 337  TCGHERLRVLELDNCLLVTDASLEHLENC-RGLERLELYDCQQVTRAGI 384



 Score = 52.0 bits (123), Expect = 3e-05
 Identities = 36/132 (27%), Positives = 61/132 (46%)
 Frame = -3

Query: 783 CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRD 604
           C   L K++L GCI V D ++   A+ +   +E LNLNGC  +TD++  +++ +CS L+ 
Sbjct: 76  CGGFLRKLSLRGCIGVGDSSLKTFAQ-NCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKH 134

Query: 603 LDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC 424
           LD                            L+ CV  ++  L  + +   +L  LN+  C
Sbjct: 135 LD----------------------------LTSCVSVTNSSLKGISEGCRNLEYLNLSWC 166

Query: 423 VGISHRGVDLLV 388
             I+  G++ LV
Sbjct: 167 DQITKEGIEALV 178



>gb:BC077430_2560140 Xenopus laevis F-box leucine-rich repeat protein
            13, mRNA (cDNA clone MGC:82207 IMAGE:3402730), complete
            cds.
          Length = 400

 Score =  101 bits (252), Expect = 3e-20
 Identities = 83/300 (27%), Positives = 144/300 (48%), Gaps = 7/300 (2%)
 Frame = -3

Query: 1263 QGLHKLRSLVITACQGVTDLGI-EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIE 1087
            QGL  + SL ++ C  +TD G+  A  +   +++ L L  C  ++D+ +    +  + ++
Sbjct: 87   QGLPNIESLNLSGCYNLTDNGLGHAFVQEIGSLRTLNLSLCKQVTDSSLGRIAQYLKGLQ 146

Query: 1086 SLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFG------VPALPPCNSLR 925
             L+L  C  I+  G+  ++      LK+L   +C  + D+  G        A   C SL 
Sbjct: 147  VLELGGCTNITNTGLL-LIAWGLHGLKSLNLRSCRHVSDVGIGHLAGMTRSAAEGCLSLE 205

Query: 924  SLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGC 745
             L++ +C    D +L  +SR    L  LNLS   G++D GLL    S   GL  +NL  C
Sbjct: 206  QLTLQDCQKLTDLALKHISRGLQGLRVLNLSFCGGISDAGLLHL--SHMGGLRSLNLRSC 263

Query: 744  INVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGI 565
             N++D  I  +A +    L  L+++ C  V D SLA IA     L+ L +    +SD GI
Sbjct: 264  DNISDTGIMHLA-MGSLRLSGLDVSFCDKVGDQSLAYIAQGLYGLKSLSLCSCHISDDGI 322

Query: 564  AALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVE 385
              +         L+ L++  CV  +DK L  + +  + L G+++  C  I+ +G++ + +
Sbjct: 323  NRMV---RQMHGLRTLNIGQCVRITDKGLELIAEHLSQLTGIDLYGCTRITKKGLERITQ 379



 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 69/294 (23%), Positives = 124/294 (42%), Gaps = 55/294 (18%)
 Frame = -3

Query: 1095 SIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLS 916
            S+++  + +   +S       ++     +++L    C+ + D   G   +    SLR+L+
Sbjct: 64   SLQARGIRKVQILSLRRSLSYVIQGLPNIESLNLSGCYNLTDNGLGHAFVQEIGSLRTLN 123

Query: 915  ICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPF-----------VQSCD--- 778
            +  C    D+SL  +++    L  L L G   +T+ GLL             ++SC    
Sbjct: 124  LSLCKQVTDSSLGRIAQYLKGLQVLELGGCTNITNTGLLLIAWGLHGLKSLNLRSCRHVS 183

Query: 777  -------AGLVKVNLSGCINVTDKTISAIAKLHG----------ETLELLNLNGCGCVTD 649
                   AG+ +    GC+++   T+    KL            + L +LNL+ CG ++D
Sbjct: 184  DVGIGHLAGMTRSAAEGCLSLEQLTLQDCQKLTDLALKHISRGLQGLRVLNLSFCGGISD 243

Query: 648  ASLAAIADYCSVLRDLDI-SKSRVSDFGIAALAGGSAI---------------------- 538
            A L  ++ +   LR L++ S   +SD GI  LA GS                        
Sbjct: 244  AGLLHLS-HMGGLRSLNLRSCDNISDTGIMHLAMGSLRLSGLDVSFCDKVGDQSLAYIAQ 302

Query: 537  -QFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVERL 379
              + L+ LSL  C ++ D     + ++ + L  LNI  CV I+ +G++L+ E L
Sbjct: 303  GLYGLKSLSLCSCHISDDGINRMVRQM-HGLRTLNIGQCVRITDKGLELIAEHL 355



>gb:AY463017_1607670 Musa acuminata putative F-box protein family
            mRNA, partial cds.
          Length = 164

 Score =  101 bits (251), Expect = 4e-20
 Identities = 50/83 (60%), Positives = 62/83 (74%)
 Frame = -3

Query: 1440 IASLFSSAGNHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQ 1261
            I SL SSA + L ++KLQ+LNIS I LAVIGHYG  L DL+L  LQN+ E+GFWVMG+  
Sbjct: 82   IVSLVSSASSCLERIKLQALNISGIVLAVIGHYGKNLIDLSLNGLQNVGEKGFWVMGNAL 141

Query: 1260 GLHKLRSLVITACQGVTDLGIEA 1192
            GL KLRS+ I  C G+TD G++A
Sbjct: 142  GLQKLRSITINCCNGLTDKGLQA 164



 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 49/170 (28%), Positives = 84/170 (49%), Gaps = 5/170 (2%)
 Frame = -3

Query: 1209 DLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGIL 1030
            D G+  ++ GCP +++L L +C L++D  +V+  K   ++ SL +E C  I   G+  ++
Sbjct: 1    DAGLSEIADGCPLLEKLDLCQCPLITDKVLVAVAKKCPNLTSLTIESCANICNEGL-QVI 59

Query: 1029 VHSAGKLKALAFENCF--GMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCP 856
              S  KLK+L  ++C   G + +   V +   C     L   N +G     L V+     
Sbjct: 60   GRSCPKLKSLTIKDCLHVGDQGIVSLVSSASSCLERIKLQALNISGI---VLAVIGHYGK 116

Query: 855  NLVHLNLSGLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISA 715
            NL+ L+L+GL  V + G   +V     GL K   + ++ C  +TDK + A
Sbjct: 117  NLIDLSLNGLQNVGEKGF--WVMGNALGLQKLRSITINCCNGLTDKGLQA 164



 Score = 52.0 bits (123), Expect = 3e-05
 Identities = 34/125 (27%), Positives = 59/125 (47%), Gaps = 2/125 (1%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAES-IESLQLE 1072
            L SL I +C  + + G++ + + CP +K L ++ C  + D G+VS V +A S +E ++L+
Sbjct: 40   LTSLTIESCANICNEGLQVIGRSCPKLKSLTIKDCLHVGDQGIVSLVSSASSCLERIKLQ 99

Query: 1071 ECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPA-LPPCNSLRSLSICNCTGF 895
              +      V  ++ H    L  L+      + +  F V         LRS++I  C G 
Sbjct: 100  ALN--ISGIVLAVIGHYGKNLIDLSLNGLQNVGEKGFWVMGNALGLQKLRSITINCCNGL 157

Query: 894  GDASL 880
             D  L
Sbjct: 158  TDKGL 162



 Score = 46.6 bits (109), Expect = 0.001
 Identities = 40/141 (28%), Positives = 61/141 (43%), Gaps = 4/141 (2%)
 Frame = -3

Query: 813 DYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAA 634
           D GL      C   L K++L  C  +TDK + A+AK     L  L +  C  + +  L  
Sbjct: 1   DAGLSEIADGCPL-LEKLDLCQCPLITDKVLVAVAK-KCPNLTSLTIESCANICNEGLQV 58

Query: 633 IADYCSVLRDLDISKS-RVSDFGIAALAGGSAI---QFSLQILSLSGCVLASDKCLPYLH 466
           I   C  L+ L I     V D GI +L   ++    +  LQ L++SG VLA       + 
Sbjct: 59  IGRSCPKLKSLTIKDCLHVGDQGIVSLVSSASSCLERIKLQALNISGIVLA------VIG 112

Query: 465 KLGNSLAGLNIQNCVGISHRG 403
             G +L  L++     +  +G
Sbjct: 113 HYGKNLIDLSLNGLQNVGEKG 133



 Score = 34.3 bits (77), Expect = 6.6
 Identities = 25/95 (26%), Positives = 46/95 (48%), Gaps = 1/95 (1%)
 Frame = -3

Query: 651 DASLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLP 475
           DA L+ IAD C +L  LD+ +   ++D  + A+A       +L  L++  C    ++ L 
Sbjct: 1   DAGLSEIADGCPLLEKLDLCQCPLITDKVLVAVAKKCP---NLTSLTIESCANICNEGLQ 57

Query: 474 YLHKLGNSLAGLNIQNCVGISHRGVDLLVERLWRC 370
            + +    L  L I++C+ +  +G+  LV     C
Sbjct: 58  VIGRSCPKLKSLTIKDCLHVGDQGIVSLVSSASSC 92



>gb:CR457121_1993328 Homo sapiens full open reading frame cDNA clone
            RZPDo834A0312D for gene FBXL2, F-box and leucine-rich
            repeat protein 2; complete cds, incl. stopcodon.
          Length = 423

 Score =  100 bits (249), Expect = 8e-20
 Identities = 81/348 (23%), Positives = 155/348 (44%), Gaps = 1/348 (0%)
 Frame = -3

Query: 1440 IASLFSSAGNHLMKVKLQS-LNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSG 1264
            + ++    G  L K+ L+  + + D SL         +  L L     I +   + +   
Sbjct: 69   VENISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLS-- 126

Query: 1263 QGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIES 1084
            +   KL+ L +T+C  +T+  ++ +S+GC N++ L L  C  ++ +G+ + V+    +++
Sbjct: 127  RFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKA 186

Query: 1083 LQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNC 904
            L L  C ++    +  I  +   +L +L  ++C  + D    V     C+ L++L +  C
Sbjct: 187  LLLRGCTQLEDEALKHI-QNYCHELVSLNLQSCSRITDEGV-VQICRGCHRLQALCLSGC 244

Query: 903  TGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKT 724
            +   DASL  L   CP L  L  +  + +TD G     ++C   L K++L  CI +TD T
Sbjct: 245  SNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHE-LEKMDLEECILITDST 303

Query: 723  ISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGS 544
            +  ++ +H   L+ L+L+ C  +TD                          GI  L+  +
Sbjct: 304  LIQLS-IHCPKLQALSLSHCELITDD-------------------------GILHLSNST 337

Query: 543  AIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
                 L++L L  C+L +D  L +L      L  L + +C  ++  G+
Sbjct: 338  CGHEGLRVLELDNCLLITDVALEHLENC-RGLERLELYDCQQVTRAGI 384



 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 36/132 (27%), Positives = 61/132 (46%)
 Frame = -3

Query: 783 CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRD 604
           C   L K++L GCI V D ++   A+ +   +E LNLNGC  +TD++  +++ +CS L+ 
Sbjct: 76  CGGFLRKLSLRGCIGVGDSSLKTFAQ-NCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKH 134

Query: 603 LDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC 424
           LD                            L+ CV  ++  L  + +   +L  LN+  C
Sbjct: 135 LD----------------------------LTSCVSITNSSLKGISEGCRNLEYLNLSWC 166

Query: 423 VGISHRGVDLLV 388
             I+  G++ LV
Sbjct: 167 DQITKDGIEALV 178



>gb:AX876382_1476504 Sequence 11287 from Patent EP1074617.
          Length = 423

 Score =  100 bits (249), Expect = 8e-20
 Identities = 81/348 (23%), Positives = 155/348 (44%), Gaps = 1/348 (0%)
 Frame = -3

Query: 1440 IASLFSSAGNHLMKVKLQS-LNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSG 1264
            + ++    G  L K+ L+  + + D SL         +  L L     I +   + +   
Sbjct: 69   VENISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLS-- 126

Query: 1263 QGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIES 1084
            +   KL+ L +T+C  +T+  ++ +S+GC N++ L L  C  ++ +G+ + V+    +++
Sbjct: 127  RFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKA 186

Query: 1083 LQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNC 904
            L L  C ++    +  I  +   +L +L  ++C  + D    V     C+ L++L +  C
Sbjct: 187  LPLRGCTQLEDEALKHI-QNYCHELVSLNLQSCSRITDEGV-VQICRGCHRLQALCLSGC 244

Query: 903  TGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKT 724
            +   DASL  L   CP L  L  +  + +TD G     ++C   L K++L  CI +TD T
Sbjct: 245  SNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHE-LEKMDLEECILITDST 303

Query: 723  ISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGS 544
            +  ++ +H   L+ L+L+ C  +TD                          GI  L+  +
Sbjct: 304  LIQLS-IHCPKLQALSLSHCELITDD-------------------------GILHLSNST 337

Query: 543  AIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
                 L++L L  C+L +D  L +L      L  L + +C  ++  G+
Sbjct: 338  CGHERLRVLELDNCLLITDVALEHLENC-RGLERLELYDCQQVTRAGI 384



 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 36/132 (27%), Positives = 61/132 (46%)
 Frame = -3

Query: 783 CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRD 604
           C   L K++L GCI V D ++   A+ +   +E LNLNGC  +TD++  +++ +CS L+ 
Sbjct: 76  CGGFLRKLSLRGCIGVGDSSLKTFAQ-NCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKH 134

Query: 603 LDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC 424
           LD                            L+ CV  ++  L  + +   +L  LN+  C
Sbjct: 135 LD----------------------------LTSCVSITNSSLKGISEGCRNLEYLNLSWC 166

Query: 423 VGISHRGVDLLV 388
             I+  G++ LV
Sbjct: 167 DQITKDGIEALV 178



>gb:AE014297_1139799 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003711_1221792 Drosophila melanogaster
            chromosome 3R, section 49 of 118 of the complete
            sequence.>gb:AY058675_1291829 Drosophila melanogaster
            LD38495 full length cDNA.
          Length = 772

 Score =  100 bits (249), Expect = 8e-20
 Identities = 86/304 (28%), Positives = 133/304 (43%), Gaps = 26/304 (8%)
 Frame = -3

Query: 1197 EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSA 1018
            ++ +  CP V+++ L     +SD G+    +    +  LQL+ C  I+   +   L    
Sbjct: 467  QSCNGACPEVERVMLADGCRISDKGLQLLTRRCPELTHLQLQTCVDITNQALVEALT-KC 525

Query: 1017 GKLKALAFENCFGMKDLAFGVPALPPCNSL-RSLSICNCTGFGDASLVVLSRLCPNLVHL 841
              L+ L    C  +  ++      PP   L + L + +C    D  L ++ + CP LV+L
Sbjct: 526  SNLQHLDVTGCSQVSSISPNPHMEPPRRLLLQYLDLTDCMAIDDMGLKIVVKNCPQLVYL 585

Query: 840  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGET---------- 691
             L     VTD GL  FV S    L ++++S C+N+TD  +  +AKL              
Sbjct: 586  YLRRCIQVTDAGL-KFVPSFCVSLKELSVSDCLNITDFGLYELAKLGAALRYLSVAKCER 644

Query: 690  ---------------LELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAAL 556
                           L  LN  GC  V+D S+  +A  C  LR LDI K  VSD G+ AL
Sbjct: 645  VSDAGLKVIARRCYKLRYLNARGCEAVSDDSITVLARSCPRLRALDIGKCDVSDAGLRAL 704

Query: 555  AGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVERLW 376
            A       +L+ LSL  C + +D+ +  +      L  LNIQ+C  +S  G   + +   
Sbjct: 705  AESCP---NLKKLSLRSCDMITDRGVQCIAYYCRGLQQLNIQDC-PVSIEGYRAVKKYCK 760

Query: 375  RCDI 364
            RC I
Sbjct: 761  RCII 764



 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 65/210 (30%), Positives = 103/210 (49%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            L+ L +T C  + D+G++ V K CP +  L LR+C  ++D G+        S++ L + +
Sbjct: 556  LQYLDLTDCMAIDDMGLKIVVKNCPQLVYLYLRRCIQVTDAGLKFVPSFCVSLKELSVSD 615

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGD 889
            C  I+  G++  L      L+ L+   C  + D    V A   C  LR L+   C    D
Sbjct: 616  CLNITDFGLYE-LAKLGAALRYLSVAKCERVSDAGLKVIA-RRCYKLRYLNARGCEAVSD 673

Query: 888  ASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIA 709
             S+ VL+R CP L  L++ G   V+D GL    +SC   L K++L  C  +TD+ +  IA
Sbjct: 674  DSITVLARSCPRLRALDI-GKCDVSDAGLRALAESC-PNLKKLSLRSCDMITDRGVQCIA 731

Query: 708  KLHGETLELLNLNGCGCVTDASLAAIADYC 619
              +   L+ LN+  C  V+     A+  YC
Sbjct: 732  -YYCRGLQQLNIQDCP-VSIEGYRAVKKYC 759



 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 52/200 (26%), Positives = 93/200 (46%), Gaps = 6/200 (3%)
 Frame = -3

Query: 939  CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKV 760
            C  +  + + +     D  L +L+R CP L HL L     +T+  L+  +  C + L  +
Sbjct: 473  CPEVERVMLADGCRISDKGLQLLTRRCPELTHLQLQTCVDITNQALVEALTKC-SNLQHL 531

Query: 759  NLSGCINVTDKTISAIAKLHGET-----LELLNLNGCGCVTDASLAAIADYCSVLRDLDI 595
            +++GC  V+    S     H E      L+ L+L  C  + D  L  +   C  L  L +
Sbjct: 532  DVTGCSQVS----SISPNPHMEPPRRLLLQYLDLTDCMAIDDMGLKIVVKNCPQLVYLYL 587

Query: 594  SKS-RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVG 418
             +  +V+D G+  +    +   SL+ LS+S C+  +D  L  L KLG +L  L++  C  
Sbjct: 588  RRCIQVTDAGLKFVP---SFCVSLKELSVSDCLNITDFGLYELAKLGAALRYLSVAKCER 644

Query: 417  ISHRGVDLLVERLWRCDILS 358
            +S  G+ ++  R ++   L+
Sbjct: 645  VSDAGLKVIARRCYKLRYLN 664



 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 33/130 (25%), Positives = 60/130 (46%), Gaps = 24/130 (18%)
 Frame = -3

Query: 1383 LNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGS--------------------- 1267
            LNI+D  L  +   G AL  L++   + +++ G  V+                       
Sbjct: 617  LNITDFGLYELAKLGAALRYLSVAKCERVSDAGLKVIARRCYKLRYLNARGCEAVSDDSI 676

Query: 1266 ---GQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAE 1096
                +   +LR+L I  C  V+D G+ A+++ CPN+K+L LR C +++D GV        
Sbjct: 677  TVLARSCPRLRALDIGKCD-VSDAGLRALAESCPNLKKLSLRSCDMITDRGVQCIAYYCR 735

Query: 1095 SIESLQLEEC 1066
             ++ L +++C
Sbjct: 736  GLQQLNIQDC 745



>gb:AF186273_1888623 Homo sapiens leucine-rich repeats containing
            F-box protein FBL3 mRNA, complete
            cds.>gb:BC031556_1980160 Homo sapiens F-box and
            leucine-rich repeat protein 2, mRNA (cDNA clone MGC:34103
            IMAGE:5197151), complete cds.
          Length = 423

 Score =  100 bits (248), Expect = 1e-19
 Identities = 81/348 (23%), Positives = 155/348 (44%), Gaps = 1/348 (0%)
 Frame = -3

Query: 1440 IASLFSSAGNHLMKVKLQS-LNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSG 1264
            + ++    G  L K+ L+  + + D SL         +  L L     I +   + +   
Sbjct: 69   VENISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLS-- 126

Query: 1263 QGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIES 1084
            +   KL+ L +T+C  +T+  ++ +S+GC N++ L L  C  ++ +G+ + V+    +++
Sbjct: 127  RFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKA 186

Query: 1083 LQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNC 904
            L L  C ++    +  I  +   +L +L  ++C  + D    V     C+ L++L +  C
Sbjct: 187  LLLRGCTQLEDEALKHI-QNYCHELVSLNLQSCSRITDEGV-VQICRGCHRLQALCLSGC 244

Query: 903  TGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKT 724
            +   DASL  L   CP L  L  +  + +TD G     ++C   L K++L  CI +TD T
Sbjct: 245  SNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHE-LEKMDLEECILITDST 303

Query: 723  ISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGS 544
            +  ++ +H   L+ L+L+ C  +TD                          GI  L+  +
Sbjct: 304  LIQLS-IHCPKLQALSLSHCELITDD-------------------------GILHLSNST 337

Query: 543  AIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
                 L++L L  C+L +D  L +L      L  L + +C  ++  G+
Sbjct: 338  CGHERLRVLELDNCLLITDVALEHLENC-RGLERLELYDCQQVTRAGI 384



 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 36/132 (27%), Positives = 61/132 (46%)
 Frame = -3

Query: 783 CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRD 604
           C   L K++L GCI V D ++   A+ +   +E LNLNGC  +TD++  +++ +CS L+ 
Sbjct: 76  CGGFLRKLSLRGCIGVGDSSLKTFAQ-NCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKH 134

Query: 603 LDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC 424
           LD                            L+ CV  ++  L  + +   +L  LN+  C
Sbjct: 135 LD----------------------------LTSCVSITNSSLKGISEGCRNLEYLNLSWC 166

Query: 423 VGISHRGVDLLV 388
             I+  G++ LV
Sbjct: 167 DQITKDGIEALV 178



>gb:AF176518_1888019 Homo sapiens leucine-rich repeat-containing F-box
            protein FBL2 mRNA, complete cds.
          Length = 425

 Score =  100 bits (248), Expect = 1e-19
 Identities = 81/348 (23%), Positives = 155/348 (44%), Gaps = 1/348 (0%)
 Frame = -3

Query: 1440 IASLFSSAGNHLMKVKLQS-LNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSG 1264
            + ++    G  L K+ L+  + + D SL         +  L L     I +   + +   
Sbjct: 71   VENISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLS-- 128

Query: 1263 QGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIES 1084
            +   KL+ L +T+C  +T+  ++ +S+GC N++ L L  C  ++ +G+ + V+    +++
Sbjct: 129  RFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKA 188

Query: 1083 LQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNC 904
            L L  C ++    +  I  +   +L +L  ++C  + D    V     C+ L++L +  C
Sbjct: 189  LLLRGCTQLEDEALKHI-QNYCHELVSLNLQSCSRITDEGV-VQICRGCHRLQALCLSGC 246

Query: 903  TGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKT 724
            +   DASL  L   CP L  L  +  + +TD G     ++C   L K++L  CI +TD T
Sbjct: 247  SNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHE-LEKMDLEECILITDST 305

Query: 723  ISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGS 544
            +  ++ +H   L+ L+L+ C  +TD                          GI  L+  +
Sbjct: 306  LIQLS-IHCPKLQALSLSHCELITDD-------------------------GILHLSNST 339

Query: 543  AIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
                 L++L L  C+L +D  L +L      L  L + +C  ++  G+
Sbjct: 340  CGHERLRVLELDNCLLITDVALEHLENC-RGLERLELYDCQQVTRAGI 386



 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 36/132 (27%), Positives = 61/132 (46%)
 Frame = -3

Query: 783 CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRD 604
           C   L K++L GCI V D ++   A+ +   +E LNLNGC  +TD++  +++ +CS L+ 
Sbjct: 78  CGGFLRKLSLRGCIGVGDSSLKTFAQ-NCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKH 136

Query: 603 LDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC 424
           LD                            L+ CV  ++  L  + +   +L  LN+  C
Sbjct: 137 LD----------------------------LTSCVSITNSSLKGISEGCRNLEYLNLSWC 168

Query: 423 VGISHRGVDLLV 388
             I+  G++ LV
Sbjct: 169 DQITKDGIEALV 180



>gb:AX876746_1476674 Sequence 11651 from Patent
            EP1074617.>gb:AK001438_1908437 Homo sapiens cDNA FLJ10576
            fis, clone NT2RP2003329, weakly similar to PUTATIVE
            ADENYLATE CYCLASE REGULATORY PROTEIN.
          Length = 423

 Score =  100 bits (248), Expect = 1e-19
 Identities = 81/348 (23%), Positives = 155/348 (44%), Gaps = 1/348 (0%)
 Frame = -3

Query: 1440 IASLFSSAGNHLMKVKLQS-LNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSG 1264
            + ++    G  L K+ L+  + + D SL         +  L L     I +   + +   
Sbjct: 69   VENISKRCGGFLKKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLS-- 126

Query: 1263 QGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIES 1084
            +   KL+ L +T+C  +T+  ++ +S+GC N++ L L  C  ++ +G+ + V+    +++
Sbjct: 127  RFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKA 186

Query: 1083 LQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNC 904
            L L  C ++    +  I  +   +L +L  ++C  + D    V     C+ L++L +  C
Sbjct: 187  LLLRGCTQLEDEALKHI-QNYCHELVSLNLQSCSRITDEGV-VQICRGCHRLQALCLSGC 244

Query: 903  TGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKT 724
            +   DASL  L   CP L  L  +  + +TD G     ++C   L K++L  CI +TD T
Sbjct: 245  SNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHE-LEKMDLEECILITDST 303

Query: 723  ISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGS 544
            +  ++ +H   L+ L+L+ C  +TD                          GI  L+  +
Sbjct: 304  LIQLS-IHCPKLQALSLSHCELITDD-------------------------GILHLSNST 337

Query: 543  AIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
                 L++L L  C+L +D  L +L      L  L + +C  ++  G+
Sbjct: 338  CGHERLRVLELDNCLLITDVALEHLENC-RGLERLELYDCQQVTRAGI 384



 Score = 51.2 bits (121), Expect = 5e-05
 Identities = 36/132 (27%), Positives = 61/132 (46%)
 Frame = -3

Query: 783 CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRD 604
           C   L K++L GCI V D ++   A+ +   +E LNLNGC  +TD++  +++ +CS L+ 
Sbjct: 76  CGGFLKKLSLRGCIGVGDSSLKTFAQ-NCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKH 134

Query: 603 LDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC 424
           LD                            L+ CV  ++  L  + +   +L  LN+  C
Sbjct: 135 LD----------------------------LTSCVSITNSSLKGISEGCRNLEYLNLSWC 166

Query: 423 VGISHRGVDLLV 388
             I+  G++ LV
Sbjct: 167 DQITKDGIEALV 178



>gb:CR861462_1185457 Pongo pygmaeus mRNA; cDNA DKFZp459E062 (from
            clone DKFZp459E062).
          Length = 423

 Score =  100 bits (248), Expect = 1e-19
 Identities = 81/348 (23%), Positives = 155/348 (44%), Gaps = 1/348 (0%)
 Frame = -3

Query: 1440 IASLFSSAGNHLMKVKLQS-LNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSG 1264
            + ++    G  L K+ L+  + + D SL         +  L L     I +   + +   
Sbjct: 69   VENISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLS-- 126

Query: 1263 QGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIES 1084
            +   KL+ L +T+C  +T+  ++ +S+GC N++ L L  C  ++ +G+ + V+    +++
Sbjct: 127  RFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKA 186

Query: 1083 LQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNC 904
            L L  C ++    +  I  +   +L +L  ++C  + D    V     C+ L++L +  C
Sbjct: 187  LLLRGCTQLEDEALKHI-QNYCHELVSLNLQSCSRITDEGV-VQICRGCHRLQALCLSGC 244

Query: 903  TGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKT 724
            +   DASL  L   CP L  L  +  + +TD G     ++C   L K++L  CI +TD T
Sbjct: 245  SNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHE-LEKMDLEECILITDST 303

Query: 723  ISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGS 544
            +  ++ +H   L+ L+L+ C  +TD                          GI  L+  +
Sbjct: 304  LIQLS-IHCPKLQALSLSHCELITDD-------------------------GILHLSNST 337

Query: 543  AIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
                 L++L L  C+L +D  L +L      L  L + +C  ++  G+
Sbjct: 338  CGHERLRVLELDNCLLITDVALEHLENC-RGLERLELYDCQQVTRAGI 384



 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 36/132 (27%), Positives = 61/132 (46%)
 Frame = -3

Query: 783 CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRD 604
           C   L K++L GCI V D ++   A+ +   +E LNLNGC  +TD++  +++ +CS L+ 
Sbjct: 76  CGGFLRKLSLRGCIGVGDSSLKTFAQ-NCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKH 134

Query: 603 LDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC 424
           LD                            L+ CV  ++  L  + +   +L  LN+  C
Sbjct: 135 LD----------------------------LTSCVSITNSSLKGISEGCRNLEYLNLSWC 166

Query: 423 VGISHRGVDLLV 388
             I+  G++ LV
Sbjct: 167 DQITKDGIEALV 178



>sp|Q9UKC9|FL2_HUMAN F-box/LRR-repeat protein 2 (F-box and
            leucine-rich repeat protein 2) (F-box protein FBL2)
            (F-box protein FBL3).
          Length = 423

 Score =  100 bits (248), Expect = 1e-19
 Identities = 81/348 (23%), Positives = 155/348 (44%), Gaps = 1/348 (0%)
 Frame = -3

Query: 1440 IASLFSSAGNHLMKVKLQS-LNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSG 1264
            + ++    G  L K+ L+  + + D SL         +  L L     I +   + +   
Sbjct: 69   VENISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLS-- 126

Query: 1263 QGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIES 1084
            +   KL+ L +T+C  +T+  ++ +S+GC N++ L L  C  ++ +G+ + V+    +++
Sbjct: 127  RFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKA 186

Query: 1083 LQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNC 904
            L L  C ++    +  I  +   +L +L  ++C  + D    V     C+ L++L +  C
Sbjct: 187  LLLRGCTQLEDEALKHI-QNYCHELVSLNLQSCSRITDEGV-VQICRGCHRLQALCLSGC 244

Query: 903  TGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKT 724
            +   DASL  L   CP L  L  +  + +TD G     ++C   L K++L  CI +TD T
Sbjct: 245  SNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHE-LEKMDLEECILITDST 303

Query: 723  ISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGS 544
            +  ++ +H   L+ L+L+ C  +TD                          GI  L+  +
Sbjct: 304  LIQLS-IHCPKLQALSLSHCELITDD-------------------------GILHLSNST 337

Query: 543  AIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
                 L++L L  C+L +D  L +L      L  L + +C  ++  G+
Sbjct: 338  CGHERLRVLELDNCLLITDVALEHLENC-RGLERLELYDCQQVTRAGI 384



 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 36/132 (27%), Positives = 61/132 (46%)
 Frame = -3

Query: 783 CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRD 604
           C   L K++L GCI V D ++   A+ +   +E LNLNGC  +TD++  +++ +CS L+ 
Sbjct: 76  CGGFLRKLSLRGCIGVGDSSLKTFAQ-NCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKH 134

Query: 603 LDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC 424
           LD                            L+ CV  ++  L  + +   +L  LN+  C
Sbjct: 135 LD----------------------------LTSCVSITNSSLKGISEGCRNLEYLNLSWC 166

Query: 423 VGISHRGVDLLV 388
             I+  G++ LV
Sbjct: 167 DQITKDGIEALV 178



>gb:CR861354_1185354 Pongo pygmaeus mRNA; cDNA DKFZp459A1011 (from
            clone DKFZp459A1011).
          Length = 318

 Score = 99.8 bits (247), Expect = 1e-19
 Identities = 78/291 (26%), Positives = 122/291 (41%)
 Frame = -3

Query: 1272 GSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAES 1093
            G  +G   L  L ++ C  +T  GIEA+ +GC  +K L LR CT L D  +         
Sbjct: 45   GISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHE 104

Query: 1092 IESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSI 913
            + SL L+ C RI+  GV  I               C G             C+ L++L +
Sbjct: 105  LVSLNLQSCSRITDEGVVQI---------------CRG-------------CHRLQALCL 136

Query: 912  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVT 733
              C+   DASL  L   CP L  L  +  + +TD G     ++C   L K++L  CI +T
Sbjct: 137  SGCSNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHE-LEKMDLEECILIT 195

Query: 732  DKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALA 553
            D T+  ++ +H   L+ L+L+ C  +TD                          GI  L+
Sbjct: 196  DGTLIQLS-IHCPKLQALSLSHCELITDD-------------------------GILHLS 229

Query: 552  GGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
              +     L++L L  C+L +D  L +L      L  L + +C  ++  G+
Sbjct: 230  NSTCGHERLRVLELDNCLLITDVALEHLENC-RGLERLELYDCQQVTRAGI 279



 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 74/269 (27%), Positives = 113/269 (42%), Gaps = 55/269 (20%)
 Frame = -3

Query: 1011 LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS 832
            ++ L F  C+ +            C+ L+ L + +C    ++ L  +S  C NL +LNLS
Sbjct: 9    VRLLFFSTCYSLSRF---------CSKLKHLDLTSCVSITNSPLKGISEGCRNLEYLNLS 59

Query: 831  GLNGVTDYGLLPFVQSCDA-------------------------GLVKVNLSGCINVTDK 727
              + +T  G+   V+ C                            LV +NL  C  +TD+
Sbjct: 60   WCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDE 119

Query: 726  TISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALA- 553
             +  I +     L+ L L+GC  +TDASL A+   C  L+ L+ ++ S ++D G   LA 
Sbjct: 120  GVVQICR-GCHRLQALCLSGCSNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLAR 178

Query: 552  -----------------GGSAIQFS-----LQILSLSGCVLASDKCLPYLHKLGNSLAG- 442
                              G+ IQ S     LQ LSLS C L +D  +  LH L NS  G 
Sbjct: 179  NCHELEKMDLEECILITDGTLIQLSIHCPKLQALSLSHCELITDDGI--LH-LSNSTCGH 235

Query: 441  -----LNIQNCVGISHRGVDLLVERLWRC 370
                 L + NC+ I+    D+ +E L  C
Sbjct: 236  ERLRVLELDNCLLIT----DVALEHLENC 260



>gb:AF467461_2496359 Danio rerio PpaA (ppaA) mRNA, partial cds.
          Length = 386

 Score = 99.0 bits (245), Expect = 2e-19
 Identities = 80/304 (26%), Positives = 143/304 (47%), Gaps = 11/304 (3%)
 Frame = -3

Query: 1263 QGLHKLRSLVITACQGVTDLGI-EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIE 1087
            QG+  + SL ++ C  +TD G+  A  +  P+++ L L  C  ++D+ +    +  +++E
Sbjct: 82   QGMPNIESLNLSGCYNLTDNGLGHAFVQDIPSLRILNLSLCKQITDSSLGRIAQYLKNLE 141

Query: 1086 SLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGV------PALPPCNSLR 925
             L L  C  I+  G+  ++      LK+L   +C  + D+  G        A   C +L 
Sbjct: 142  LLDLGGCSNITNTGLL-LIAWGLHNLKSLNLRSCRHVSDVGIGHLAGMTRSAAEGCLTLE 200

Query: 924  SLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGC 745
             L++ +C    D SL  +S+    L  LNLS   G++D G++         L  +NL  C
Sbjct: 201  HLTLQDCQKLTDLSLKHISKGLNKLKGLNLSFCGGISDAGMIHLSHMTQ--LWTLNLRSC 258

Query: 744  INVTDKTISAIA----KLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVS 577
             N++D  I  ++    +L+G     L+++ C  V D SLA IA     L+ L +    +S
Sbjct: 259  DNISDTGIMHLSMGALRLYG-----LDVSFCDKVGDQSLAYIAQGLYQLKSLSLCSCHIS 313

Query: 576  DFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVD 397
            D GI  +         L+ L++  CV  +DK L  +      L G+++  C  I+ RG++
Sbjct: 314  DDGINRMVRQ---MHELKTLNIGQCVRITDKGLELIADHLTQLTGIDLYGCTKITKRGLE 370

Query: 396  LLVE 385
             + +
Sbjct: 371  RITQ 374



 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 76/278 (27%), Positives = 131/278 (47%), Gaps = 12/278 (4%)
 Frame = -3

Query: 1392 LQSLNIS---DISLAVIGHYGVA-LTDLALINLQNINERGFWVMGS-GQGLHKLRSLVIT 1228
            ++SLN+S   +++   +GH  V  +  L ++NL    +     +G   Q L  L  L + 
Sbjct: 87   IESLNLSGCYNLTDNGLGHAFVQDIPSLRILNLSLCKQITDSSLGRIAQYLKNLELLDLG 146

Query: 1227 ACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFV----KAAE---SIESLQLEE 1069
             C  +T+ G+  ++ G  N+K L LR C  +SD G+         AAE   ++E L L++
Sbjct: 147  GCSNITNTGLLLIAWGLHNLKSLNLRSCRHVSDVGIGHLAGMTRSAAEGCLTLEHLTLQD 206

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGD 889
            C +++   +  I      KLK L    C G+ D   G+  L     L +L++ +C    D
Sbjct: 207  CQKLTDLSLKHI-SKGLNKLKGLNLSFCGGISDA--GMIHLSHMTQLWTLNLRSCDNISD 263

Query: 888  ASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIA 709
              ++ LS     L  L++S  + V D  L    Q     L  ++L  C +++D  I+ + 
Sbjct: 264  TGIMHLSMGALRLYGLDVSFCDKVGDQSLAYIAQGL-YQLKSLSLCSC-HISDDGINRMV 321

Query: 708  KLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI 595
            +   E L+ LN+  C  +TD  L  IAD+ + L  +D+
Sbjct: 322  RQMHE-LKTLNIGQCVRITDKGLELIADHLTQLTGIDL 358



 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 63/253 (24%), Positives = 114/253 (45%), Gaps = 7/253 (2%)
 Frame = -3

Query: 1095 SIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLS 916
            S+++  +++   +S       ++     +++L    C+ + D   G   +    SLR L+
Sbjct: 59   SLQTRGIKKVQILSLRRSLSYVIQGMPNIESLNLSGCYNLTDNGLGHAFVQDIPSLRILN 118

Query: 915  ICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINV 736
            +  C    D+SL  +++   NL  L+L G + +T+ GLL         L  +NL  C +V
Sbjct: 119  LSLCKQITDSSLGRIAQYLKNLELLDLGGCSNITNTGLLLIAWGLH-NLKSLNLRSCRHV 177

Query: 735  TDKTISAIAKLHGE------TLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS-KSRVS 577
            +D  I  +A +         TLE L L  C  +TD SL  I+   + L+ L++S    +S
Sbjct: 178  SDVGIGHLAGMTRSAAEGCLTLEHLTLQDCQKLTDLSLKHISKGLNKLKGLNLSFCGGIS 237

Query: 576  DFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVD 397
            D G+  L+        L  L+L  C   SD  + +L      L GL++  C  +  + + 
Sbjct: 238  DAGMIHLSH----MTQLWTLNLRSCDNISDTGIMHLSMGALRLYGLDVSFCDKVGDQSLA 293

Query: 396  LLVERLWRCDILS 358
             + + L++   LS
Sbjct: 294  YIAQGLYQLKSLS 306



 Score = 67.0 bits (162), Expect = 9e-10
 Identities = 77/258 (29%), Positives = 109/258 (42%), Gaps = 48/258 (18%)
 Frame = -3

Query: 939 CNSLRSLSICNCTGFGDASLVVLSRLCPNLV-HLNLSGLNGVTDYGL---LPFVQSCDAG 772
           C + R  S       G  + + L R  P+L   L   G+  V    L   L +V      
Sbjct: 27  CTAWRDASYHKSVWRGVEAKLHLRRANPSLFPSLQTRGIKKVQILSLRRSLSYVIQGMPN 86

Query: 771 LVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI- 595
           +  +NLSGC N+TD  +         +L +LNL+ C  +TD+SL  IA Y   L  LD+ 
Sbjct: 87  IESLNLSGCYNLTDNGLGHAFVQDIPSLRILNLSLCKQITDSSLGRIAQYLKNLELLDLG 146

Query: 594 --------------------------SKSRVSDFGIAALAG--GSAIQ--FSLQILSLSG 505
                                     S   VSD GI  LAG   SA +   +L+ L+L  
Sbjct: 147 GCSNITNTGLLLIAWGLHNLKSLNLRSCRHVSDVGIGHLAGMTRSAAEGCLTLEHLTLQD 206

Query: 504 CVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL--VERLW-----RCDILS*T-- 352
           C   +D  L ++ K  N L GLN+  C GIS  G+  L  + +LW      CD +S T  
Sbjct: 207 CQKLTDLSLKHISKGLNKLKGLNLSFCGGISDAGMIHLSHMTQLWTLNLRSCDNISDTGI 266

Query: 351 ----*SAVRVWGI*SSVC 310
                 A+R++G+  S C
Sbjct: 267 MHLSMGALRLYGLDVSFC 284



 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 65/245 (26%), Positives = 110/245 (44%), Gaps = 9/245 (3%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVALTDLALINLQNINERGF-----WVMGSGQGLHKLRSLVITACQG 1216
            NI++  L +I      L  L L + +++++ G          + +G   L  L +  CQ 
Sbjct: 150  NITNTGLLLIAWGLHNLKSLNLRSCRHVSDVGIGHLAGMTRSAAEGCLTLEHLTLQDCQK 209

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TDL ++ +SKG   +K L L  C  +SD G++      + + +L L  C  IS  G+  
Sbjct: 210  LTDLSLKHISKGLNKLKGLNLSFCGGISDAGMIHLSHMTQ-LWTLNLRSCDNISDTGIMH 268

Query: 1035 ILVHSAGKLKALAFENCF----GMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLS 868
            +   S G L+    +  F    G + LA+    L     L+SLS+C+C    D  +  + 
Sbjct: 269  L---SMGALRLYGLDVSFCDKVGDQSLAYIAQGL---YQLKSLSLCSC-HISDDGINRMV 321

Query: 867  RLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETL 688
            R    L  LN+     +TD G L  +      L  ++L GC  +T + +  I +L    L
Sbjct: 322  RQMHELKTLNIGQCVRITDKG-LELIADHLTQLTGIDLYGCTKITKRGLERITQL--PCL 378

Query: 687  ELLNL 673
            ++ NL
Sbjct: 379  KVFNL 383



>gb:AY398381_2531911 Danio rerio clone RK131A2B02 hypothetical protein
            MGC40195 (MGC40195) mRNA, complete cds.
          Length = 411

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 80/304 (26%), Positives = 143/304 (47%), Gaps = 11/304 (3%)
 Frame = -3

Query: 1263 QGLHKLRSLVITACQGVTDLGI-EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIE 1087
            QG+  + SL ++ C  +TD G+  A  +  P+++ L L  C  ++D+ +    +  +++E
Sbjct: 87   QGMPNIESLNLSGCYNLTDNGLGHAFVQDIPSLRILNLSLCKQITDSSLGRIAQYLKNLE 146

Query: 1086 SLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGV------PALPPCNSLR 925
             L L  C  I+  G+  ++      LK+L   +C  + D+  G        A   C +L 
Sbjct: 147  LLDLGGCSNITNTGLL-LIAWGLHNLKSLNLRSCRHVSDVGIGHLAGMTRSAAEGCLTLE 205

Query: 924  SLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGC 745
             L++ +C    D SL  +S+    L  LNLS   G++D G++         L  +NL  C
Sbjct: 206  HLTLQDCQKLTDLSLKHISKGLNKLKVLNLSFCGGISDAGMIHLSHMTQ--LWTLNLRSC 263

Query: 744  INVTDKTISAIA----KLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVS 577
             N++D  I  ++    +L+G     L+++ C  V D SLA IA     L+ L +    +S
Sbjct: 264  DNISDTGIMHLSMGALRLYG-----LDVSFCDKVGDQSLAYIAQGLYQLKSLSLCSCHIS 318

Query: 576  DFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVD 397
            D GI  +         L+ L++  CV  +DK L  +      L G+++  C  I+ RG++
Sbjct: 319  DDGINRMVRQ---MHELKTLNIGQCVRITDKGLELIADHLTQLTGIDLYGCTKITKRGLE 375

Query: 396  LLVE 385
             + +
Sbjct: 376  RITQ 379



 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 76/278 (27%), Positives = 131/278 (47%), Gaps = 12/278 (4%)
 Frame = -3

Query: 1392 LQSLNIS---DISLAVIGHYGVA-LTDLALINLQNINERGFWVMGS-GQGLHKLRSLVIT 1228
            ++SLN+S   +++   +GH  V  +  L ++NL    +     +G   Q L  L  L + 
Sbjct: 92   IESLNLSGCYNLTDNGLGHAFVQDIPSLRILNLSLCKQITDSSLGRIAQYLKNLELLDLG 151

Query: 1227 ACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFV----KAAE---SIESLQLEE 1069
             C  +T+ G+  ++ G  N+K L LR C  +SD G+         AAE   ++E L L++
Sbjct: 152  GCSNITNTGLLLIAWGLHNLKSLNLRSCRHVSDVGIGHLAGMTRSAAEGCLTLEHLTLQD 211

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGD 889
            C +++   +  I      KLK L    C G+ D   G+  L     L +L++ +C    D
Sbjct: 212  CQKLTDLSLKHI-SKGLNKLKVLNLSFCGGISDA--GMIHLSHMTQLWTLNLRSCDNISD 268

Query: 888  ASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIA 709
              ++ LS     L  L++S  + V D  L    Q     L  ++L  C +++D  I+ + 
Sbjct: 269  TGIMHLSMGALRLYGLDVSFCDKVGDQSLAYIAQGL-YQLKSLSLCSC-HISDDGINRMV 326

Query: 708  KLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI 595
            +   E L+ LN+  C  +TD  L  IAD+ + L  +D+
Sbjct: 327  RQMHE-LKTLNIGQCVRITDKGLELIADHLTQLTGIDL 363



 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 66/245 (26%), Positives = 111/245 (45%), Gaps = 9/245 (3%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVALTDLALINLQNINERGF-----WVMGSGQGLHKLRSLVITACQG 1216
            NI++  L +I      L  L L + +++++ G          + +G   L  L +  CQ 
Sbjct: 155  NITNTGLLLIAWGLHNLKSLNLRSCRHVSDVGIGHLAGMTRSAAEGCLTLEHLTLQDCQK 214

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TDL ++ +SKG   +K L L  C  +SD G++      + + +L L  C  IS  G+  
Sbjct: 215  LTDLSLKHISKGLNKLKVLNLSFCGGISDAGMIHLSHMTQ-LWTLNLRSCDNISDTGIMH 273

Query: 1035 ILVHSAGKLKALAFENCF----GMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLS 868
            +   S G L+    +  F    G + LA+    L     L+SLS+C+C    D  +  + 
Sbjct: 274  L---SMGALRLYGLDVSFCDKVGDQSLAYIAQGL---YQLKSLSLCSC-HISDDGINRMV 326

Query: 867  RLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETL 688
            R    L  LN+     +TD G L  +      L  ++L GC  +T + +  I +L    L
Sbjct: 327  RQMHELKTLNIGQCVRITDKG-LELIADHLTQLTGIDLYGCTKITKRGLERITQL--PCL 383

Query: 687  ELLNL 673
            ++LNL
Sbjct: 384  KVLNL 388



 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 63/253 (24%), Positives = 114/253 (45%), Gaps = 7/253 (2%)
 Frame = -3

Query: 1095 SIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLS 916
            S+++  +++   +S       ++     +++L    C+ + D   G   +    SLR L+
Sbjct: 64   SLQTRGIKKVQILSLRRSLSYVIQGMPNIESLNLSGCYNLTDNGLGHAFVQDIPSLRILN 123

Query: 915  ICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINV 736
            +  C    D+SL  +++   NL  L+L G + +T+ GLL         L  +NL  C +V
Sbjct: 124  LSLCKQITDSSLGRIAQYLKNLELLDLGGCSNITNTGLLLIAWGLH-NLKSLNLRSCRHV 182

Query: 735  TDKTISAIAKLHGE------TLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS-KSRVS 577
            +D  I  +A +         TLE L L  C  +TD SL  I+   + L+ L++S    +S
Sbjct: 183  SDVGIGHLAGMTRSAAEGCLTLEHLTLQDCQKLTDLSLKHISKGLNKLKVLNLSFCGGIS 242

Query: 576  DFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVD 397
            D G+  L+        L  L+L  C   SD  + +L      L GL++  C  +  + + 
Sbjct: 243  DAGMIHLSH----MTQLWTLNLRSCDNISDTGIMHLSMGALRLYGLDVSFCDKVGDQSLA 298

Query: 396  LLVERLWRCDILS 358
             + + L++   LS
Sbjct: 299  YIAQGLYQLKSLS 311



 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 76/258 (29%), Positives = 108/258 (41%), Gaps = 48/258 (18%)
 Frame = -3

Query: 939 CNSLRSLSICNCTGFGDASLVVLSRLCPNLV-HLNLSGLNGVTDYGL---LPFVQSCDAG 772
           C + R  S       G  + + L R  P+L   L   G+  V    L   L +V      
Sbjct: 32  CTAWRDASYHKSVWRGVEAKLHLRRANPSLFPSLQTRGIKKVQILSLRRSLSYVIQGMPN 91

Query: 771 LVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI- 595
           +  +NLSGC N+TD  +         +L +LNL+ C  +TD+SL  IA Y   L  LD+ 
Sbjct: 92  IESLNLSGCYNLTDNGLGHAFVQDIPSLRILNLSLCKQITDSSLGRIAQYLKNLELLDLG 151

Query: 594 --------------------------SKSRVSDFGIAALAG--GSAIQ--FSLQILSLSG 505
                                     S   VSD GI  LAG   SA +   +L+ L+L  
Sbjct: 152 GCSNITNTGLLLIAWGLHNLKSLNLRSCRHVSDVGIGHLAGMTRSAAEGCLTLEHLTLQD 211

Query: 504 CVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL--VERLW-----RCDILS*T-- 352
           C   +D  L ++ K  N L  LN+  C GIS  G+  L  + +LW      CD +S T  
Sbjct: 212 CQKLTDLSLKHISKGLNKLKVLNLSFCGGISDAGMIHLSHMTQLWTLNLRSCDNISDTGI 271

Query: 351 ----*SAVRVWGI*SSVC 310
                 A+R++G+  S C
Sbjct: 272 MHLSMGALRLYGLDVSFC 289



>gb:BX908798_830589 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 662

 Score = 98.6 bits (244), Expect = 3e-19
 Identities = 97/337 (28%), Positives = 162/337 (48%), Gaps = 6/337 (1%)
 Frame = -3

Query: 1392 LQSLNISD---ISLAVIGHYG--VALTDLALINLQNINERGFWVMGSGQGLHKLRSLVIT 1228
            LQ LN+S+   ++ A + H     AL  L L   QN+ + G   +    GL  L    ++
Sbjct: 301  LQYLNLSEYKNLTDAGLAHLTPLTALQHLGLSGCQNLTDAGLAHLTPLMGLQHLD---LS 357

Query: 1227 ACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQA 1048
             CQ +TD G+  ++     ++ L L +C  L+D G+         ++ L L  C  ++ A
Sbjct: 358  GCQNLTDAGLAHLTP-LTGLQHLNLSRCNKLTDAGLAHLTPLT-GLQHLDLSGCQNLTDA 415

Query: 1047 GVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLS 868
            G+  +   +   L+ L    C  + D   G+  L P   L+ L++CNC  F D  L  L+
Sbjct: 416  GLAHLTPLTG--LQHLDLSGCQNLTDA--GLAHLTPLTGLQHLNLCNCRKFTDNGLAHLT 471

Query: 867  RLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETL 688
             L   L HLNLS  N +TD GL          L  ++LS C N+TD  ++ +  L   +L
Sbjct: 472  PLSV-LQHLNLSRCNKLTDVGLAHLTPL--TALQHLDLSSCYNLTDVGLAHLTPL--TSL 526

Query: 687  ELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILSL 511
            + L L  C  +TDA L  +    + L+ L++S  + ++D G+A L   +A+Q+    L L
Sbjct: 527  QHLGLISCDKLTDAGLVHL-KLLTGLQHLNLSNCKNLTDAGLAHLTPLTALQY----LYL 581

Query: 510  SGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
            + C   +D  L +L  L  +L  L+++ C  ++  G+
Sbjct: 582  NWCRKLTDAGLAHLTSL-TALQHLDLRYCQNLTDAGL 617



 Score = 94.4 bits (233), Expect = 5e-18
 Identities = 88/266 (33%), Positives = 133/266 (50%), Gaps = 7/266 (2%)
 Frame = -3

Query: 1185 KGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLK 1006
            K C N+K L  ++C  L+D G ++ +    +++ L L +C R++ AG    L H    L 
Sbjct: 246  KSCENLKVLHFKECRHLTDAG-LAHLTPLTALQHLGLGQCWRLTNAG----LAHLT-PLT 299

Query: 1005 ALAFENCFGMKDLA-FGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSG 829
            AL + N    K+L   G+  L P  +L+ L +  C    DA L  L+ L   L HL+LSG
Sbjct: 300  ALQYLNLSEYKNLTDAGLAHLTPLTALQHLGLSGCQNLTDAGLAHLTPLM-GLQHLDLSG 358

Query: 828  LNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTD 649
               +TD GL         GL  +NLS C  +TD  ++ +  L G  L+ L+L+GC  +TD
Sbjct: 359  CQNLTDAGLAHLTPL--TGLQHLNLSRCNKLTDAGLAHLTPLTG--LQHLDLSGCQNLTD 414

Query: 648  ASLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPY 472
            A LA +      L+ LD+S    ++D G+A L   +     LQ L+L  C   +D  L +
Sbjct: 415  AGLAHLTPLTG-LQHLDLSGCQNLTDAGLAHLTPLT----GLQHLNLCNCRKFTDNGLAH 469

Query: 471  LHKLGNSLAGLNIQNC-----VGISH 409
            L  L + L  LN+  C     VG++H
Sbjct: 470  LTPL-SVLQHLNLSRCNKLTDVGLAH 494



>gb:AK129227_2069458 Mus musculus mRNA for mKIAA0840 protein.
          Length = 523

 Score = 97.4 bits (241), Expect = 6e-19
 Identities = 75/283 (26%), Positives = 137/283 (48%), Gaps = 8/283 (2%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            L +++++ C+ +TD G+  +++ CP +++L +  C  +S+  V   V    ++E L +  
Sbjct: 220  LETVIVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSG 279

Query: 1068 CHRIS------QAGVFGILVHSAG-KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSIC 910
            C +++      +A +    +H     ++ L   +CF ++D      A   C  L  L + 
Sbjct: 280  CSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIA-AHCTQLTHLYLR 338

Query: 909  NCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTD 730
             C    D  L  L   C ++  L++S    V+D+GL   +   ++ L  ++++ C  +TD
Sbjct: 339  RCVRLTDEGLRYLVIYCTSIKELSVSDCRFVSDFGLRE-IAKLESRLRYLSIAHCGRITD 397

Query: 729  KTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALA 553
              I  +AK +   L  LN  GC  +TD  +  +A  C+ L+ LDI K   VSD G+ +LA
Sbjct: 398  VGIRYVAK-YCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGLESLA 456

Query: 552  GGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC 424
                  F+L+ LSL  C   + + L  +      L  LN+Q+C
Sbjct: 457  LNC---FNLKRLSLKSCESITGQGLQIVAANCFDLQMLNVQDC 496



 Score = 81.6 bits (200), Expect = 4e-14
 Identities = 57/193 (29%), Positives = 96/193 (49%), Gaps = 8/193 (4%)
 Frame = -3

Query: 939 CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGL-------LPFVQSC 781
           C  LR L +  C    + ++  +  LCPNL HL++SG + VT   L       L  +   
Sbjct: 243 CPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGK 302

Query: 780 DAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDL 601
              +  ++++ C  + D+ +  IA  H   L  L L  C  +TD  L  +  YC+ +++L
Sbjct: 303 QISIRYLDMTDCFVLEDEGLHTIAA-HCTQLTHLYLRRCVRLTDEGLRYLVIYCTSIKEL 361

Query: 600 DISKSR-VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC 424
            +S  R VSDFG+  +A    ++  L+ LS++ C   +D  + Y+ K  + L  LN + C
Sbjct: 362 SVSDCRFVSDFGLREIA---KLESRLRYLSIAHCGRITDVGIRYVAKYCSKLRYLNARGC 418

Query: 423 VGISHRGVDLLVE 385
            GI+  GV+ L +
Sbjct: 419 EGITDHGVEYLAK 431



 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 58/224 (25%), Positives = 103/224 (45%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            +R L +T C  + D G+  ++  C  +  L LR+C  L+D G+   V    SI+ L + +
Sbjct: 306  IRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCTSIKELSVSD 365

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGD 889
            C  +S                       FG++++A         + LR LSI +C    D
Sbjct: 366  CRFVSD----------------------FGLREIA------KLESRLRYLSIAHCGRITD 397

Query: 888  ASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIA 709
              +  +++ C  L +LN  G  G+TD+G+    ++C   L  +++  C  V+D  + ++A
Sbjct: 398  VGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNC-TKLKSLDIGKCPLVSDTGLESLA 456

Query: 708  KLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVS 577
             L+   L+ L+L  C  +T   L  +A  C  L+ L++    VS
Sbjct: 457  -LNCFNLKRLSLKSCESITGQGLQIVAANCFDLQMLNVQDCEVS 499



 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 38/131 (29%), Positives = 65/131 (49%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGI 1198
            +SD  L  I      L  L++ +   I + G   +   +   KLR L    C+G+TD G+
Sbjct: 369  VSDFGLREIAKLESRLRYLSIAHCGRITDVGIRYVA--KYCSKLRYLNARGCEGITDHGV 426

Query: 1197 EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSA 1018
            E ++K C  +K L + KC L+SD G+ S      +++ L L+ C  I+  G+  I+  + 
Sbjct: 427  EYLAKNCTKLKSLDIGKCPLVSDTGLESLALNCFNLKRLSLKSCESITGQGL-QIVAANC 485

Query: 1017 GKLKALAFENC 985
              L+ L  ++C
Sbjct: 486  FDLQMLNVQDC 496



>gb:AP005398_1851132 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC
            clone:P0669G10.>gb:AP005694_1856174 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, BAC
            clone:OSJNBa0063E14.
          Length = 414

 Score = 97.4 bits (241), Expect = 6e-19
 Identities = 88/251 (35%), Positives = 126/251 (50%), Gaps = 7/251 (2%)
 Frame = -3

Query: 1323 LALINL---QNINERGFW---VMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQ 1162
            L +INL   Q+I++R F     MG    L +L  L I ACQ V+D GIE ++  CPN++ 
Sbjct: 116  LKIINLEFAQDIDDRHFVRLKEMGC-TSLQELELLNINACQKVSDKGIETITSLCPNLRA 174

Query: 1161 LCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCF 982
            L +     L+D  +   V+  + I  L L  C  IS  G+  +  +  G LK L    C 
Sbjct: 175  LSIYWIVGLTDLTIRHIVQNCKHIVDLNLSGCKNISDKGMQLVADNYEG-LKKLNITRCI 233

Query: 981  GMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGL 802
             + D       L  C+SL SL++   + F D     +  L  NL  L+L G   VTD G 
Sbjct: 234  KLTDDGL-QEVLQKCSSLESLNLYALSSFSDKVYKKIGSL-TNLTFLDLCGAQNVTDDG- 290

Query: 801  LPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADY 622
            L  +  C   L  +NLS C+ VTD  + AIA+    +L+LL+L G   VTD  L A++ +
Sbjct: 291  LSCISRC-VCLTYLNLSWCVRVTDVGVVAIAQ-GCRSLQLLSLFGIVGVTDVCLEALSKH 348

Query: 621  CS-VLRDLDIS 592
            CS  L  LD++
Sbjct: 349  CSRSLTTLDVN 359



 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 75/239 (31%), Positives = 113/239 (47%), Gaps = 2/239 (0%)
 Frame = -3

Query: 1098 ESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSL 919
            + +E L +  C ++S  G+  I       L+AL+     G+ DL      +  C  +  L
Sbjct: 144  QELELLNINACQKVSDKGIETI-TSLCPNLRALSIYWIVGLTDLTIR-HIVQNCKHIVDL 201

Query: 918  SICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCIN 739
            ++  C    D  + +++     L  LN++    +TD GL   +Q C + L  +NL    +
Sbjct: 202  NLSGCKNISDKGMQLVADNYEGLKKLNITRCIKLTDDGLQEVLQKCSS-LESLNLYALSS 260

Query: 738  VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKS-RVSDFGIA 562
             +DK    I  L    L  L+L G   VTD  L+ I+  C  L  L++S   RV+D G+ 
Sbjct: 261  FSDKVYKKIGSL--TNLTFLDLCGAQNVTDDGLSCISR-CVCLTYLNLSWCVRVTDVGVV 317

Query: 561  ALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK-LGNSLAGLNIQNCVGISHRGVDLLV 388
            A+A G     SLQ+LSL G V  +D CL  L K    SL  L++  C+GI    VDL V
Sbjct: 318  AIAQGCR---SLQLLSLFGIVGVTDVCLEALSKHCSRSLTTLDVNGCIGIKWWEVDLFV 373



 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 59/255 (23%), Positives = 116/255 (45%), Gaps = 30/255 (11%)
 Frame = -3

Query: 1410 HLMKVKLQ-SLNISDISLAVIGHYG-VALTDLALINL---QNINERG------------- 1285
            HL  + L+ + +I D     +   G  +L +L L+N+   Q ++++G             
Sbjct: 115  HLKIINLEFAQDIDDRHFVRLKEMGCTSLQELELLNINACQKVSDKGIETITSLCPNLRA 174

Query: 1284 ---FWVMGSG--------QGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTL 1138
               +W++G          Q    +  L ++ C+ ++D G++ V+     +K+L + +C  
Sbjct: 175  LSIYWIVGLTDLTIRHIVQNCKHIVDLNLSGCKNISDKGMQLVADNYEGLKKLNITRCIK 234

Query: 1137 LSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAF- 961
            L+D+G+   ++   S+ESL L      S       +    G L  L F +  G +++   
Sbjct: 235  LTDDGLQEVLQKCSSLESLNLYALSSFSDK-----VYKKIGSLTNLTFLDLCGAQNVTDD 289

Query: 960  GVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSC 781
            G+  +  C  L  L++  C    D  +V +++ C +L  L+L G+ GVTD  L    + C
Sbjct: 290  GLSCISRCVCLTYLNLSWCVRVTDVGVVAIAQGCRSLQLLSLFGIVGVTDVCLEALSKHC 349

Query: 780  DAGLVKVNLSGCINV 736
               L  ++++GCI +
Sbjct: 350  SRSLTTLDVNGCIGI 364



 Score = 44.3 bits (103), Expect = 0.006
 Identities = 38/114 (33%), Positives = 51/114 (44%), Gaps = 2/114 (1%)
 Frame = -3

Query: 696 ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQI- 520
           + LELLN+N C  V+D  +  I   C  LR L I        G+  L     +Q    I 
Sbjct: 144 QELELLNINACQKVSDKGIETITSLCPNLRALSIYWI----VGLTDLTIRHIVQNCKHIV 199

Query: 519 -LSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL 361
            L+LSGC   SDK +  +      L  LNI  C+ ++  G   L E L +C  L
Sbjct: 200 DLNLSGCKNISDKGMQLVADNYEGLKKLNITRCIKLTDDG---LQEVLQKCSSL 250



>gb:AF174593_1887911 Homo sapiens F-box protein Fbl7 (FBL7) mRNA,
            partial cds.
          Length = 483

 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 76/283 (26%), Positives = 135/283 (47%), Gaps = 8/283 (2%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            L ++ ++ C+ +TD G+  +++ CP +++L +  C  +S+  V   V    ++E L +  
Sbjct: 180  LETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSG 239

Query: 1068 CHRIS------QAGVFGILVHSAG-KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSIC 910
            C +++      +A +    +H     ++ L   +CF ++D      A   C  L  L + 
Sbjct: 240  CSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIA-AHCTQLTHLYLR 298

Query: 909  NCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTD 730
             C    D  L  L   C ++  L++S    V+D+GL   +   ++ L  ++++ C  VTD
Sbjct: 299  RCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLRE-IAKLESRLRYLSIAHCGRVTD 357

Query: 729  KTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALA 553
              I  +AK +   L  LN  GC  +TD  +  +A  C+ L+ LDI K   VSD G+  LA
Sbjct: 358  VGIRYVAK-YCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGLECLA 416

Query: 552  GGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC 424
                  F+L+ LSL  C   + + L  +      L  LN+Q+C
Sbjct: 417  LNC---FNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDC 456



 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 57/193 (29%), Positives = 96/193 (49%), Gaps = 8/193 (4%)
 Frame = -3

Query: 939 CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGL-------LPFVQSC 781
           C  LR L +  C    + ++  +  LCPNL HL++SG + VT   L       L  +   
Sbjct: 203 CPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGK 262

Query: 780 DAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDL 601
              +  ++++ C  + D+ +  IA  H   L  L L  C  +TD  L  +  YC+ +++L
Sbjct: 263 QISIRYLDMTDCFVLEDEGLHTIAA-HCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKEL 321

Query: 600 DISKSR-VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC 424
            +S  R VSDFG+  +A    ++  L+ LS++ C   +D  + Y+ K  + L  LN + C
Sbjct: 322 SVSDCRFVSDFGLREIA---KLESRLRYLSIAHCGRVTDVGIRYVAKYCSKLRYLNARGC 378

Query: 423 VGISHRGVDLLVE 385
            GI+  GV+ L +
Sbjct: 379 EGITDHGVEYLAK 391



 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 58/224 (25%), Positives = 102/224 (45%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            +R L +T C  + D G+  ++  C  +  L LR+C  L+D G+   V    SI+ L + +
Sbjct: 266  IRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSD 325

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGD 889
            C  +S                       FG++++A         + LR LSI +C    D
Sbjct: 326  CRFVSD----------------------FGLREIA------KLESRLRYLSIAHCGRVTD 357

Query: 888  ASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIA 709
              +  +++ C  L +LN  G  G+TD+G+    ++C   L  +++  C  V+D  +  +A
Sbjct: 358  VGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNC-TKLKSLDIGKCPLVSDTGLECLA 416

Query: 708  KLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVS 577
             L+   L+ L+L  C  +T   L  +A  C  L+ L++    VS
Sbjct: 417  -LNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVS 459



 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 36/131 (27%), Positives = 64/131 (48%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGI 1198
            +SD  L  I      L  L++ +   + + G   +   +   KLR L    C+G+TD G+
Sbjct: 329  VSDFGLREIAKLESRLRYLSIAHCGRVTDVGIRYVA--KYCSKLRYLNARGCEGITDHGV 386

Query: 1197 EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSA 1018
            E ++K C  +K L + KC L+SD G+        +++ L L+ C  I+  G+  I+  + 
Sbjct: 387  EYLAKNCTKLKSLDIGKCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGL-QIVAANC 445

Query: 1017 GKLKALAFENC 985
              L+ L  ++C
Sbjct: 446  FDLQTLNVQDC 456



>gb:AB020647_1865245 Homo sapiens mRNA for KIAA0840 protein, partial
            cds.
          Length = 523

 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 76/283 (26%), Positives = 135/283 (47%), Gaps = 8/283 (2%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            L ++ ++ C+ +TD G+  +++ CP +++L +  C  +S+  V   V    ++E L +  
Sbjct: 220  LETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSG 279

Query: 1068 CHRIS------QAGVFGILVHSAG-KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSIC 910
            C +++      +A +    +H     ++ L   +CF ++D      A   C  L  L + 
Sbjct: 280  CSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIA-AHCTQLTHLYLR 338

Query: 909  NCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTD 730
             C    D  L  L   C ++  L++S    V+D+GL   +   ++ L  ++++ C  VTD
Sbjct: 339  RCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLRE-IAKLESRLRYLSIAHCGRVTD 397

Query: 729  KTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALA 553
              I  +AK +   L  LN  GC  +TD  +  +A  C+ L+ LDI K   VSD G+  LA
Sbjct: 398  VGIRYVAK-YCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGLECLA 456

Query: 552  GGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC 424
                  F+L+ LSL  C   + + L  +      L  LN+Q+C
Sbjct: 457  LNC---FNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDC 496



 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 57/193 (29%), Positives = 96/193 (49%), Gaps = 8/193 (4%)
 Frame = -3

Query: 939 CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGL-------LPFVQSC 781
           C  LR L +  C    + ++  +  LCPNL HL++SG + VT   L       L  +   
Sbjct: 243 CPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGK 302

Query: 780 DAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDL 601
              +  ++++ C  + D+ +  IA  H   L  L L  C  +TD  L  +  YC+ +++L
Sbjct: 303 QISIRYLDMTDCFVLEDEGLHTIAA-HCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKEL 361

Query: 600 DISKSR-VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC 424
            +S  R VSDFG+  +A    ++  L+ LS++ C   +D  + Y+ K  + L  LN + C
Sbjct: 362 SVSDCRFVSDFGLREIA---KLESRLRYLSIAHCGRVTDVGIRYVAKYCSKLRYLNARGC 418

Query: 423 VGISHRGVDLLVE 385
            GI+  GV+ L +
Sbjct: 419 EGITDHGVEYLAK 431



 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 58/224 (25%), Positives = 102/224 (45%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            +R L +T C  + D G+  ++  C  +  L LR+C  L+D G+   V    SI+ L + +
Sbjct: 306  IRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSD 365

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGD 889
            C  +S                       FG++++A         + LR LSI +C    D
Sbjct: 366  CRFVSD----------------------FGLREIA------KLESRLRYLSIAHCGRVTD 397

Query: 888  ASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIA 709
              +  +++ C  L +LN  G  G+TD+G+    ++C   L  +++  C  V+D  +  +A
Sbjct: 398  VGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNC-TKLKSLDIGKCPLVSDTGLECLA 456

Query: 708  KLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVS 577
             L+   L+ L+L  C  +T   L  +A  C  L+ L++    VS
Sbjct: 457  -LNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVS 499



 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 36/131 (27%), Positives = 64/131 (48%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGI 1198
            +SD  L  I      L  L++ +   + + G   +   +   KLR L    C+G+TD G+
Sbjct: 369  VSDFGLREIAKLESRLRYLSIAHCGRVTDVGIRYVA--KYCSKLRYLNARGCEGITDHGV 426

Query: 1197 EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSA 1018
            E ++K C  +K L + KC L+SD G+        +++ L L+ C  I+  G+  I+  + 
Sbjct: 427  EYLAKNCTKLKSLDIGKCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGL-QIVAANC 485

Query: 1017 GKLKALAFENC 985
              L+ L  ++C
Sbjct: 486  FDLQTLNVQDC 496



>sp|Q9UJT9|FXL7_HUMAN F-box/LRR-repeat protein 7 (F-box and
            leucine-rich repeat protein 7).>gb:AF199356_1889696 Homo
            sapiens F-box protein FBL6 (FBL6) mRNA, complete
            cds.>gb:BC075061_1989560 Homo sapiens F-box and
            leucine-rich repeat protein 7, mRNA (cDNA clone
            MGC:104130 IMAGE:30915585), complete cds.
          Length = 491

 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 76/283 (26%), Positives = 135/283 (47%), Gaps = 8/283 (2%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            L ++ ++ C+ +TD G+  +++ CP +++L +  C  +S+  V   V    ++E L +  
Sbjct: 188  LETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSG 247

Query: 1068 CHRIS------QAGVFGILVHSAG-KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSIC 910
            C +++      +A +    +H     ++ L   +CF ++D      A   C  L  L + 
Sbjct: 248  CSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIA-AHCTQLTHLYLR 306

Query: 909  NCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTD 730
             C    D  L  L   C ++  L++S    V+D+GL   +   ++ L  ++++ C  VTD
Sbjct: 307  RCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLRE-IAKLESRLRYLSIAHCGRVTD 365

Query: 729  KTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALA 553
              I  +AK +   L  LN  GC  +TD  +  +A  C+ L+ LDI K   VSD G+  LA
Sbjct: 366  VGIRYVAK-YCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGLECLA 424

Query: 552  GGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC 424
                  F+L+ LSL  C   + + L  +      L  LN+Q+C
Sbjct: 425  LNC---FNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDC 464



 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 57/193 (29%), Positives = 96/193 (49%), Gaps = 8/193 (4%)
 Frame = -3

Query: 939 CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGL-------LPFVQSC 781
           C  LR L +  C    + ++  +  LCPNL HL++SG + VT   L       L  +   
Sbjct: 211 CPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGK 270

Query: 780 DAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDL 601
              +  ++++ C  + D+ +  IA  H   L  L L  C  +TD  L  +  YC+ +++L
Sbjct: 271 QISIRYLDMTDCFVLEDEGLHTIAA-HCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKEL 329

Query: 600 DISKSR-VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC 424
            +S  R VSDFG+  +A    ++  L+ LS++ C   +D  + Y+ K  + L  LN + C
Sbjct: 330 SVSDCRFVSDFGLREIA---KLESRLRYLSIAHCGRVTDVGIRYVAKYCSKLRYLNARGC 386

Query: 423 VGISHRGVDLLVE 385
            GI+  GV+ L +
Sbjct: 387 EGITDHGVEYLAK 399



 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 58/224 (25%), Positives = 102/224 (45%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            +R L +T C  + D G+  ++  C  +  L LR+C  L+D G+   V    SI+ L + +
Sbjct: 274  IRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSD 333

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGD 889
            C  +S                       FG++++A         + LR LSI +C    D
Sbjct: 334  CRFVSD----------------------FGLREIA------KLESRLRYLSIAHCGRVTD 365

Query: 888  ASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIA 709
              +  +++ C  L +LN  G  G+TD+G+    ++C   L  +++  C  V+D  +  +A
Sbjct: 366  VGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNC-TKLKSLDIGKCPLVSDTGLECLA 424

Query: 708  KLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVS 577
             L+   L+ L+L  C  +T   L  +A  C  L+ L++    VS
Sbjct: 425  -LNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVS 467



 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 36/131 (27%), Positives = 64/131 (48%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGI 1198
            +SD  L  I      L  L++ +   + + G   +   +   KLR L    C+G+TD G+
Sbjct: 337  VSDFGLREIAKLESRLRYLSIAHCGRVTDVGIRYVA--KYCSKLRYLNARGCEGITDHGV 394

Query: 1197 EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSA 1018
            E ++K C  +K L + KC L+SD G+        +++ L L+ C  I+  G+  I+  + 
Sbjct: 395  EYLAKNCTKLKSLDIGKCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGL-QIVAANC 453

Query: 1017 GKLKALAFENC 985
              L+ L  ++C
Sbjct: 454  FDLQTLNVQDC 464



>gb:BC031285_1980114 Homo sapiens F-box and leucine-rich repeat
            protein 13, mRNA (cDNA clone MGC:39815 IMAGE:5298780),
            complete cds.
          Length = 707

 Score = 94.4 bits (233), Expect = 5e-18
 Identities = 97/393 (24%), Positives = 161/393 (40%), Gaps = 53/393 (13%)
 Frame = -3

Query: 1398 VKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQ 1219
            + L +  I++ ++ ++  +   L +L+L   +   ++G   +  G G HKL  L ++ C 
Sbjct: 276  LNLSNTTITNRTMRLLPRHFHNLQNLSLAYCRRFTDKGLQYLNLGNGCHKLIYLDLSGCT 335

Query: 1218 GVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVF 1039
             ++  G   ++  C  +  L +     L+DN V + V+    I SL       IS     
Sbjct: 336  QISVQGFRYIANSCTGIMHLTINDMPTLTDNCVKALVEKCSRITSLVFTGAPHISDCTFR 395

Query: 1038 GILVHSAGKLKALAFENCFGMKDLAF------------------------GVPALPPCNS 931
             +   SA KL+ + FE    + D +F                         + +L P   
Sbjct: 396  AL---SACKLRKIRFEGNKRVTDASFKFIDKNYPNLSHIYMADCKGITDSSLRSLSPLKQ 452

Query: 930  L----------------------------RSLSICNCTGFGDASLVVLSRLCPNLVHLNL 835
            L                            R L++ NC    DAS++ LS  CPNL +L+L
Sbjct: 453  LTVLNLANCVRIGDMGLKQFLDGPASMRIRELNLSNCVRLSDASVMKLSERCPNLNYLSL 512

Query: 834  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV 655
                 +T  G+   V      LV ++LSG    TD +  A  K     LE L+++ C  +
Sbjct: 513  RNCEHLTAQGIGYIVNI--FSLVSIDLSG----TDISNEAFCK-SSLILEHLDVSYCSQL 565

Query: 654  TDASLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCL 478
            +D  + A+A YC  L  L I+   +++D  +  L   SA    L IL +SGCVL +D+ L
Sbjct: 566  SDMIIKALAIYCINLTSLSIAGCPKITDSAMEML---SAKCHYLHILDISGCVLLTDQIL 622

Query: 477  PYLHKLGNSLAGLNIQNCVGISHRGVDLLVERL 379
              L      L  L +Q C  IS +    +  ++
Sbjct: 623  EDLQIGCKQLRILKMQYCTNISKKAAQRMSSKV 655



 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 76/351 (21%), Positives = 138/351 (39%), Gaps = 8/351 (2%)
 Frame = -3

Query: 1386 SLNISDISLAVIGHYGVALTDLALINLQNINERGFWV----MGSGQGLHKLRSLVITACQ 1219
            +++ S +   +   Y V+      +N+  +N RG  +      S      L+ L ++ C 
Sbjct: 197  AIDFSSVKNVIPDKYIVSTLQRWRLNVLRLNFRGCLLRPKTFRSVSHCRNLQELNVSDCP 256

Query: 1218 GVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFV-KAAESIESLQLEECHRISQAGV 1042
              TD  +  +S+GCP V  LCL        N  +  + +   ++++L L  C R +  G 
Sbjct: 257  TFTDESMRHISEGCPGV--LCLNLSNTTITNRTMRLLPRHFHNLQNLSLAYCRRFTDKG- 313

Query: 1041 FGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRL 862
                      L+ L   N                C+ L  L +  CT         ++  
Sbjct: 314  ----------LQYLNLGN---------------GCHKLIYLDLSGCTQISVQGFRYIANS 348

Query: 861  CPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLEL 682
            C  ++HL ++ +  +TD  +   V+ C   +  +  +G  +++D T  A++      L  
Sbjct: 349  CTGIMHLTINDMPTLTDNCVKALVEKCSR-ITSLVFTGAPHISDCTFRALSACK---LRK 404

Query: 681  LNLNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILSLSG 505
            +   G   VTDAS   I      L  + ++  + ++D  + +L+        L +L+L+ 
Sbjct: 405  IRFEGNKRVTDASFKFIDKNYPNLSHIYMADCKGITDSSLRSLSPLK----QLTVLNLAN 460

Query: 504  CVLASDKCLPYL--HKLGNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS 358
            CV   D  L           +  LN+ NCV +S   V  L ER    + LS
Sbjct: 461  CVRIGDMGLKQFLDGPASMRIRELNLSNCVRLSDASVMKLSERCPNLNYLS 511



>gb:BC020572_1977069 Homo sapiens F-box and leucine-rich repeat
            protein 13, mRNA (cDNA clone IMAGE:4412932), partial cds.
          Length = 569

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 99/417 (23%), Positives = 163/417 (39%), Gaps = 77/417 (18%)
 Frame = -3

Query: 1398 VKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQ 1219
            + L +  I++ ++ ++  +   L +L+L   +   ++G   +  G G HKL  L ++ C 
Sbjct: 110  LNLSNTTITNRTMRLLPRHFHNLQNLSLAYCRRFTDKGLQYLNLGNGCHKLIYLDLSGCT 169

Query: 1218 GVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVF 1039
             ++  G   ++  C  +  L +     L+DN V + V+    I SL       IS     
Sbjct: 170  QISVQGFRYIANSCTGIMHLTINDMPTLTDNCVKALVEKCSRITSLVFTGAPHISDCTFR 229

Query: 1038 GILVHSAGKLKALAFENCFGMKDLAF------------------------GVPALPPCNS 931
             +   SA KL+ + FE    + D +F                         + +L P   
Sbjct: 230  AL---SACKLRKIRFEGNKRVTDASFKFIDKNYPNLSHIYMADCKGITDSSLRSLSPLKQ 286

Query: 930  L----------------------------RSLSICNCTGFGDASLVVLSRLCPNLVHLNL 835
            L                            R L++ NC    DAS++ LS  CPNL +L+L
Sbjct: 287  LTVLNLANCVRIGDMGLKQFLDGPASMRIRELNLSNCVRLSDASVMKLSERCPNLNYLSL 346

Query: 834  SGLNGVTDYGLLPFVQSCDAGLVKVNLSG------------------------CINVTDK 727
                 +T  G+   V      LV ++LSG                        C  +TD 
Sbjct: 347  RNCEHLTAQGIGYIVNI--FSLVSIDLSGTDISNEGLNVLSRHKKLKELSVSECYRITDD 404

Query: 726  TISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALAG 550
             I A  K     LE L+++ C  ++D  + A+A YC  L  L I+   +++D  +  L  
Sbjct: 405  GIQAFCK-SSLILEHLDVSYCSQLSDMIIKALAIYCINLTSLSIAGCPKITDSAMEML-- 461

Query: 549  GSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVERL 379
             SA    L IL +SGCVL +D+ L  L      L  L +Q C  IS +    +  ++
Sbjct: 462  -SAKCHYLHILDISGCVLLTDQILEDLQIGCKQLRILKMQYCTNISKKAAQRMSSKV 517



 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 76/351 (21%), Positives = 138/351 (39%), Gaps = 8/351 (2%)
 Frame = -3

Query: 1386 SLNISDISLAVIGHYGVALTDLALINLQNINERGFWV----MGSGQGLHKLRSLVITACQ 1219
            +++ S +   +   Y V+      +N+  +N RG  +      S      L+ L ++ C 
Sbjct: 31   AIDFSSVKNVIPDKYIVSTLQRWRLNVLRLNFRGCLLRPKTFRSVSHCRNLQELNVSDCP 90

Query: 1218 GVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFV-KAAESIESLQLEECHRISQAGV 1042
              TD  +  +S+GCP V  LCL        N  +  + +   ++++L L  C R +  G 
Sbjct: 91   TFTDESMRHISEGCPGV--LCLNLSNTTITNRTMRLLPRHFHNLQNLSLAYCRRFTDKG- 147

Query: 1041 FGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRL 862
                      L+ L   N                C+ L  L +  CT         ++  
Sbjct: 148  ----------LQYLNLGN---------------GCHKLIYLDLSGCTQISVQGFRYIANS 182

Query: 861  CPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLEL 682
            C  ++HL ++ +  +TD  +   V+ C   +  +  +G  +++D T  A++      L  
Sbjct: 183  CTGIMHLTINDMPTLTDNCVKALVEKCSR-ITSLVFTGAPHISDCTFRALSACK---LRK 238

Query: 681  LNLNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILSLSG 505
            +   G   VTDAS   I      L  + ++  + ++D  + +L+        L +L+L+ 
Sbjct: 239  IRFEGNKRVTDASFKFIDKNYPNLSHIYMADCKGITDSSLRSLSPLK----QLTVLNLAN 294

Query: 504  CVLASDKCLPYL--HKLGNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS 358
            CV   D  L           +  LN+ NCV +S   V  L ER    + LS
Sbjct: 295  CVRIGDMGLKQFLDGPASMRIRELNLSNCVRLSDASVMKLSERCPNLNYLS 345



 Score = 40.0 bits (92), Expect = 0.12
 Identities = 46/183 (25%), Positives = 80/183 (43%), Gaps = 14/183 (7%)
 Frame = -3

Query: 1407 LMKVKLQSLNISDISLAVIGH-------YGVALTDLALINLQ--NINERGFWVMGSGQGL 1255
            +MK+  +  N++ +SL    H       Y V +  L  I+L   +I+  G  V+   +  
Sbjct: 331  VMKLSERCPNLNYLSLRNCEHLTAQGIGYIVNIFSLVSIDLSGTDISNEGLNVLSRHK-- 388

Query: 1254 HKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQL 1075
             KL+ L ++ C  +TD GI+A  K    ++ L +  C+ LSD  + +      ++ SL +
Sbjct: 389  -KLKELSVSECYRITDDGIQAFCKSSLILEHLDVSYCSQLSDMIIKALAIYCINLTSLSI 447

Query: 1074 EECHRISQAGVFGILVHSAGKLKALAFENCF-----GMKDLAFGVPALPPCNSLRSLSIC 910
              C +I+ + +  +L      L  L    C       ++DL  G      C  LR L + 
Sbjct: 448  AGCPKITDSAM-EMLSAKCHYLHILDISGCVLLTDQILEDLQIG------CKQLRILKMQ 500

Query: 909  NCT 901
             CT
Sbjct: 501  YCT 503



>gb:AK097537_1914904 Homo sapiens cDNA FLJ40218 fis, clone
            TESTI2021599.
          Length = 735

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 99/417 (23%), Positives = 163/417 (39%), Gaps = 77/417 (18%)
 Frame = -3

Query: 1398 VKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQ 1219
            + L +  I++ ++ ++  +   L +L+L   +   ++G   +  G G HKL  L ++ C 
Sbjct: 276  LNLSNTTITNRTMRLLPRHFHNLQNLSLAYCRRFTDKGLQYLNLGNGCHKLIYLDLSGCT 335

Query: 1218 GVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVF 1039
             ++  G   ++  C  +  L +     L+DN V + V+    I SL       IS     
Sbjct: 336  QISVQGFRYIANSCTGIMHLTINDMPTLTDNCVKALVEKCSRITSLVFTGAPHISDCTFR 395

Query: 1038 GILVHSAGKLKALAFENCFGMKDLAF------------------------GVPALPPCNS 931
             +   SA KL+ + FE    + D +F                         + +L P   
Sbjct: 396  AL---SACKLRKIRFEGNKRVTDASFKFIDKNYPNLSHIYMADCKGITDSSLRSLSPLKQ 452

Query: 930  L----------------------------RSLSICNCTGFGDASLVVLSRLCPNLVHLNL 835
            L                            R L++ NC    DAS++ LS  CPNL +L+L
Sbjct: 453  LTVLNLANCVRIGDMGLKQFLDGPASMRIRELNLSNCVRLSDASVMKLSERCPNLNYLSL 512

Query: 834  SGLNGVTDYGLLPFVQSCDAGLVKVNLSG------------------------CINVTDK 727
                 +T  G+   V      LV ++LSG                        C  +TD 
Sbjct: 513  RNCEHLTAQGIGYIVNI--FSLVSIDLSGTDISNEGLNVLSRHKKLKELSVSECYRITDD 570

Query: 726  TISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALAG 550
             I A  K     LE L+++ C  ++D  + A+A YC  L  L I+   +++D  +  L  
Sbjct: 571  GIQAFCK-SSLILEHLDVSYCSQLSDMIIKALAIYCINLTSLSIAGCPKITDSAMEML-- 627

Query: 549  GSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVERL 379
             SA    L IL +SGCVL +D+ L  L      L  L +Q C  IS +    +  ++
Sbjct: 628  -SAKCHYLHILDISGCVLLTDQILEDLQIGCKQLRILKMQYCTNISKKAAQRMSSKV 683



 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 76/351 (21%), Positives = 138/351 (39%), Gaps = 8/351 (2%)
 Frame = -3

Query: 1386 SLNISDISLAVIGHYGVALTDLALINLQNINERGFWV----MGSGQGLHKLRSLVITACQ 1219
            +++ S +   +   Y V+      +N+  +N RG  +      S      L+ L ++ C 
Sbjct: 197  AIDFSSVKNVIPDKYIVSTLQRWRLNVLRLNFRGCLLRPKTFRSVSHCRNLQELNVSDCP 256

Query: 1218 GVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFV-KAAESIESLQLEECHRISQAGV 1042
              TD  +  +S+GCP V  LCL        N  +  + +   ++++L L  C R +  G 
Sbjct: 257  TFTDESMRHISEGCPGV--LCLNLSNTTITNRTMRLLPRHFHNLQNLSLAYCRRFTDKG- 313

Query: 1041 FGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRL 862
                      L+ L   N                C+ L  L +  CT         ++  
Sbjct: 314  ----------LQYLNLGN---------------GCHKLIYLDLSGCTQISVQGFRYIANS 348

Query: 861  CPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLEL 682
            C  ++HL ++ +  +TD  +   V+ C   +  +  +G  +++D T  A++      L  
Sbjct: 349  CTGIMHLTINDMPTLTDNCVKALVEKCSR-ITSLVFTGAPHISDCTFRALSACK---LRK 404

Query: 681  LNLNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILSLSG 505
            +   G   VTDAS   I      L  + ++  + ++D  + +L+        L +L+L+ 
Sbjct: 405  IRFEGNKRVTDASFKFIDKNYPNLSHIYMADCKGITDSSLRSLSPLK----QLTVLNLAN 460

Query: 504  CVLASDKCLPYL--HKLGNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS 358
            CV   D  L           +  LN+ NCV +S   V  L ER    + LS
Sbjct: 461  CVRIGDMGLKQFLDGPASMRIRELNLSNCVRLSDASVMKLSERCPNLNYLS 511



 Score = 40.0 bits (92), Expect = 0.12
 Identities = 46/183 (25%), Positives = 80/183 (43%), Gaps = 14/183 (7%)
 Frame = -3

Query: 1407 LMKVKLQSLNISDISLAVIGH-------YGVALTDLALINLQ--NINERGFWVMGSGQGL 1255
            +MK+  +  N++ +SL    H       Y V +  L  I+L   +I+  G  V+   +  
Sbjct: 497  VMKLSERCPNLNYLSLRNCEHLTAQGIGYIVNIFSLVSIDLSGTDISNEGLNVLSRHK-- 554

Query: 1254 HKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQL 1075
             KL+ L ++ C  +TD GI+A  K    ++ L +  C+ LSD  + +      ++ SL +
Sbjct: 555  -KLKELSVSECYRITDDGIQAFCKSSLILEHLDVSYCSQLSDMIIKALAIYCINLTSLSI 613

Query: 1074 EECHRISQAGVFGILVHSAGKLKALAFENCF-----GMKDLAFGVPALPPCNSLRSLSIC 910
              C +I+ + +  +L      L  L    C       ++DL  G      C  LR L + 
Sbjct: 614  AGCPKITDSAM-EMLSAKCHYLHILDISGCVLLTDQILEDLQIG------CKQLRILKMQ 666

Query: 909  NCT 901
             CT
Sbjct: 667  YCT 669



>gb:AK029566_1161558 Mus musculus adult male testis cDNA, RIKEN
            full-length enriched library, clone:4921539K22
            product:hypothetical F-box domain containing protein,
            full insert sequence.
          Length = 745

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 96/378 (25%), Positives = 166/378 (43%), Gaps = 46/378 (12%)
 Frame = -3

Query: 1407 LMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVIT 1228
            ++ + L +  I++ ++ ++  Y   L +L+L   +   ++G   +  G G HKL  L ++
Sbjct: 312  VLYLNLSNTTITNRTMRLLPKYFHNLQNLSLAYCEKFTDKGLQYLNLGNGCHKLIYLDLS 371

Query: 1227 ACQGVTDLGIEAVSK----GCPNVKQLC---LRKCTL----------LSDNGVVSFVKAA 1099
             C  V       +S     G P++       L  C L          +SD    S  +  
Sbjct: 372  GCTQVLVEKCPRISSVVLIGSPHISDSAFKALSSCDLKKIRFEGNKRISDACFKSIDRNY 431

Query: 1098 ESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLA----FGVPALPPCNS 931
              I  + + +C  ++ + +  + +    +L  L   NC  + D+     F  PA      
Sbjct: 432  PGINHIYMVDCKGLTDSSLKSLSLLK--QLTVLNLTNCIRIGDIGLKHFFDGPA---SIR 486

Query: 930  LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLS 751
            LR L++ NC+  GD+S++ LS  CPNL +LNL     +TD   + ++ S    L+ V+LS
Sbjct: 487  LRELNLTNCSLLGDSSVIRLSERCPNLHYLNLRNCEHLTDLA-IEYIASM-LSLISVDLS 544

Query: 750  G------------------------CINVTDKTISAIAKLHGETLELLNLNGCGCVTDAS 643
            G                        C+N+TD  I A  K     LE L+++ C  +TD  
Sbjct: 545  GTLISNEGMTILSRHRKLREVSVSDCVNITDFGIRAYCKT-SLLLEHLDVSYCSQLTDDI 603

Query: 642  LAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLH 466
            +  IA +C+ +  L+I+   +++D G+  L   SA    L IL +SGC+  +D+ +  L 
Sbjct: 604  IKTIAIFCTRITSLNIAGCPKITDAGMEIL---SARCHYLHILDISGCIQLTDQIIQDLQ 660

Query: 465  KLGNSLAGLNIQNCVGIS 412
                 L  L +Q C  IS
Sbjct: 661  IGCKQLRILKMQFCKSIS 678



 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 87/365 (23%), Positives = 142/365 (38%), Gaps = 69/365 (18%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCP-------------------------NVKQLCLRKC 1144
            L+ L ++ CQ  TD  +  +S+GCP                         N++ L L  C
Sbjct: 286  LQELNVSDCQSFTDESMRHISEGCPGVLYLNLSNTTITNRTMRLLPKYFHNLQNLSLAYC 345

Query: 1143 TLLSDNGV--VSFVKAAESIESLQL--------EECHRISQAGVFG--------ILVHSA 1018
               +D G+  ++       +  L L        E+C RIS   + G            S+
Sbjct: 346  EKFTDKGLQYLNLGNGCHKLIYLDLSGCTQVLVEKCPRISSVVLIGSPHISDSAFKALSS 405

Query: 1017 GKLKALAFENCFGMKDLAF-GVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHL 841
              LK + FE    + D  F  +    P   +  + + +C G  D+SL  LS L   L  L
Sbjct: 406  CDLKKIRFEGNKRISDACFKSIDRNYP--GINHIYMVDCKGLTDSSLKSLS-LLKQLTVL 462

Query: 840  NLSGLNGVTDYGLLPFVQS-CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGC 664
            NL+    + D GL  F        L ++NL+ C  + D ++  +++     L  LNL  C
Sbjct: 463  NLTNCIRIGDIGLKHFFDGPASIRLRELNLTNCSLLGDSSVIRLSE-RCPNLHYLNLRNC 521

Query: 663  GCVTDASLAAIADYCSV-----------------------LRDLDISKS-RVSDFGIAAL 556
              +TD ++  IA   S+                       LR++ +S    ++DFGI A 
Sbjct: 522  EHLTDLAIEYIASMLSLISVDLSGTLISNEGMTILSRHRKLREVSVSDCVNITDFGIRAY 581

Query: 555  AGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVERLW 376
               S +   L+ L +S C   +D  +  +      +  LNI  C  I+  G+++L  R  
Sbjct: 582  CKTSLL---LEHLDVSYCSQLTDDIIKTIAIFCTRITSLNIAGCPKITDAGMEILSARCH 638

Query: 375  RCDIL 361
               IL
Sbjct: 639  YLHIL 643



 Score = 43.5 bits (101), Expect = 0.011
 Identities = 42/181 (23%), Positives = 77/181 (42%), Gaps = 1/181 (0%)
 Frame = -3

Query: 951 ALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAG 772
           A+  C +L+ L++ +C  F D S+  +S  CP +++LNLS  N       +  +      
Sbjct: 279 AVSHCKNLQELNVSDCQSFTDESMRHISEGCPGVLYLNLS--NTTITNRTMRLLPKYFHN 336

Query: 771 LVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI 595
           L  ++L+ C   TDK +  +   +G   L  L+L+GC  V       I+        + I
Sbjct: 337 LQNLSLAYCEKFTDKGLQYLNLGNGCHKLIYLDLSGCTQVLVEKCPRISSV------VLI 390

Query: 594 SKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGI 415
               +SD    AL+        L+ +   G    SD C   + +    +  + + +C G+
Sbjct: 391 GSPHISDSAFKALS-----SCDLKKIRFEGNKRISDACFKSIDRNYPGINHIYMVDCKGL 445

Query: 414 S 412
           +
Sbjct: 446 T 446



 Score = 35.4 bits (80), Expect = 3.0
 Identities = 19/68 (27%), Positives = 33/68 (48%)
 Frame = -3

Query: 1251 KLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLE 1072
            ++ SL I  C  +TD G+E +S  C  +  L +  C  L+D  +       + +  L+++
Sbjct: 613  RITSLNIAGCPKITDAGMEILSARCHYLHILDISGCIQLTDQIIQDLQIGCKQLRILKMQ 672

Query: 1071 ECHRISQA 1048
             C  IS A
Sbjct: 673  FCKSISPA 680



>gb:AE013599_1133354 Drosophila melanogaster chromosome 2R, complete
            sequence.>gb:AE003458_1210653 Drosophila melanogaster
            chromosome 2R, section 66 of 74 of the complete
            sequence.>gb:AF187980_1249186 Drosophila melanogaster
            Partner of Paired (ppa) mRNA, complete
            cds.>gb:AY119098_1300820 Drosophila melanogaster RE01138
            full insert cDNA.
          Length = 538

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 75/299 (25%), Positives = 144/299 (48%), Gaps = 7/299 (2%)
 Frame = -3

Query: 1260 GLHKLRSLVITACQGVTDLGI-EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIES 1084
            G+  L SL ++ C  V D+ +  A S   PN+K L L  C  ++D  +    +   ++E+
Sbjct: 232  GVPALTSLNLSGCFNVADMNLGHAFSVDLPNLKTLDLSLCKQITDTSLGRIAQHLRNLET 291

Query: 1083 LQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPA------LPPCNSLRS 922
            L+L  C  I+  G+  ++     KLK L   +C+ + D   G  A            L  
Sbjct: 292  LELGGCCNITNTGLL-LIAWGLKKLKHLNLRSCWHISDQGIGHLAGFSRETAEGNLQLEY 350

Query: 921  LSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCI 742
            L + +C    D +L  +++   +L  +NLS    VTD GL    +     L ++NL  C 
Sbjct: 351  LGLQDCQRLSDEALGHIAQGLTSLKSINLSFCVSVTDSGLKHLARM--PKLEQLNLRSCD 408

Query: 741  NVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIA 562
            N++D  ++ + +  G  +  L+++ C  ++D +L  IA     LR L +++ +++D G+ 
Sbjct: 409  NISDIGMAYLTE-GGSGINSLDVSFCDKISDQALTHIAQGLYRLRSLSLNQCQITDHGML 467

Query: 561  ALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVE 385
             +A        L+ L++  C   +DK L  L +   +L  +++  C  +S +G+D++++
Sbjct: 468  KIAKAL---HELENLNIGQCSRITDKGLQTLAEDLTNLKTIDLYGCTQLSSKGIDIIMK 523



 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 82/311 (26%), Positives = 147/311 (47%), Gaps = 4/311 (1%)
 Frame = -3

Query: 1380 NISDISLAVIGH-YGVALTDLALINLQNINERGFWVMGS-GQGLHKLRSLVITACQGVTD 1207
            N++D++L   GH + V L +L  ++L    +     +G   Q L  L +L +  C  +T+
Sbjct: 246  NVADMNL---GHAFSVDLPNLKTLDLSLCKQITDTSLGRIAQHLRNLETLELGGCCNITN 302

Query: 1206 LGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILV 1027
             G+  ++ G   +K L LR C  +SD G+      +       L+               
Sbjct: 303  TGLLLIAWGLKKLKHLNLRSCWHISDQGIGHLAGFSRETAEGNLQ--------------- 347

Query: 1026 HSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLV 847
                 L+ L  ++C  + D A G  A     SL+S+++  C    D+ L  L+R+ P L 
Sbjct: 348  -----LEYLGLQDCQRLSDEALGHIA-QGLTSLKSINLSFCVSVTDSGLKHLARM-PKLE 400

Query: 846  HLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAK-LHGETLELLNLN 670
             LNL   + ++D G + ++    +G+  +++S C  ++D+ ++ IA+ L+   L  L+LN
Sbjct: 401  QLNLRSCDNISDIG-MAYLTEGGSGINSLDVSFCDKISDQALTHIAQGLY--RLRSLSLN 457

Query: 669  GCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLA 493
             C  +TD  +  IA     L +L+I + SR++D G+  LA       +L+ + L GC   
Sbjct: 458  QCQ-ITDHGMLKIAKALHELENLNIGQCSRITDKGLQTLAEDLT---NLKTIDLYGCTQL 513

Query: 492  SDKCLPYLHKL 460
            S K +  + KL
Sbjct: 514  SSKGIDIIMKL 524



 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 66/235 (28%), Positives = 105/235 (44%), Gaps = 28/235 (11%)
 Frame = -3

Query: 978 MKDLAFGVPALPPCN---------------------SLRSLSICNCTGFGDASLVVLSRL 862
           +KDL  GVPAL   N                     +L++L +  C    D SL  +++ 
Sbjct: 226 LKDLVLGVPALTSLNLSGCFNVADMNLGHAFSVDLPNLKTLDLSLCKQITDTSLGRIAQH 285

Query: 861 CPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGET--- 691
             NL  L L G   +T+ GLL         L  +NL  C +++D+ I  +A    ET   
Sbjct: 286 LRNLETLELGGCCNITNTGLLLIAWGLKK-LKHLNLRSCWHISDQGIGHLAGFSRETAEG 344

Query: 690 ---LELLNLNGCGCVTDASLAAIADYCSVLRDLDISKS-RVSDFGIAALAGGSAIQFSLQ 523
              LE L L  C  ++D +L  IA   + L+ +++S    V+D G+  LA        L+
Sbjct: 345 NLQLEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCVSVTDSGLKHLAR----MPKLE 400

Query: 522 ILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVERLWRCDILS 358
            L+L  C   SD  + YL + G+ +  L++  C  IS + +  + + L+R   LS
Sbjct: 401 QLNLRSCDNISDIGMAYLTEGGSGINSLDVSFCDKISDQALTHIAQGLYRLRSLS 455



 Score = 53.5 bits (127), Expect = 1e-05
 Identities = 48/197 (24%), Positives = 87/197 (44%), Gaps = 9/197 (4%)
 Frame = -3

Query: 1398 VKLQSLNISD---ISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLH------KL 1246
            ++L+ L + D   +S   +GH    LT L  INL       F V  +  GL       KL
Sbjct: 346  LQLEYLGLQDCQRLSDEALGHIAQGLTSLKSINLS------FCVSVTDSGLKHLARMPKL 399

Query: 1245 RSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEEC 1066
              L + +C  ++D+G+  +++G   +  L +  C  +SD  +    +    + SL L +C
Sbjct: 400  EQLNLRSCDNISDIGMAYLTEGGSGINSLDVSFCDKISDQALTHIAQGLYRLRSLSLNQC 459

Query: 1065 HRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDA 886
             +I+  G+  I   +  +L+ L    C  + D      A     +L+++ +  CT     
Sbjct: 460  -QITDHGMLKI-AKALHELENLNIGQCSRITDKGLQTLA-EDLTNLKTIDLYGCTQLSSK 516

Query: 885  SLVVLSRLCPNLVHLNL 835
             + ++ +L P L  LNL
Sbjct: 517  GIDIIMKL-PKLQKLNL 532



 Score = 53.5 bits (127), Expect = 1e-05
 Identities = 55/215 (25%), Positives = 85/215 (39%), Gaps = 35/215 (16%)
 Frame = -3

Query: 939 CNSLRSLSICNCTGFGDASLVVLSRLCPNLVH-LNLSGLNGVTDYGLLPFVQSCDAG--- 772
           C + R  +       G  + + L R  P+L + L   G+  V    L   ++    G   
Sbjct: 176 CTAWRDAAYAKSVWKGVEAKLHLKRSSPSLFNCLVKRGIKKVQILSLRRSLKDLVLGVPA 235

Query: 771 LVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI- 595
           L  +NLSGC NV D  +     +    L+ L+L+ C  +TD SL  IA +   L  L++ 
Sbjct: 236 LTSLNLSGCFNVADMNLGHAFSVDLPNLKTLDLSLCKQITDTSLGRIAQHLRNLETLELG 295

Query: 594 --------------------------SKSRVSDFGIAALAGGSAI----QFSLQILSLSG 505
                                     S   +SD GI  LAG S         L+ L L  
Sbjct: 296 GCCNITNTGLLLIAWGLKKLKHLNLRSCWHISDQGIGHLAGFSRETAEGNLQLEYLGLQD 355

Query: 504 CVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
           C   SD+ L ++ +   SL  +N+  CV ++  G+
Sbjct: 356 CQRLSDEALGHIAQGLTSLKSINLSFCVSVTDSGL 390



>gb:BX908798_831121 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 1143

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 101/343 (29%), Positives = 166/343 (48%), Gaps = 24/343 (6%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLG 1201
            N +D  LA +    VAL  L L     I + G   +     L  L+ L +  C  +TD G
Sbjct: 791  NFTDAGLAHLSPL-VALQHLDLGGCYKITDSGLAHLSR---LVALQHLDLGGCYEITDSG 846

Query: 1200 IEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHS 1021
            +  +S+    ++ L L +C  L+D+G+ +++    +++ L L+ C +I+  G+  +   S
Sbjct: 847  LTYLSR-LVALQHLNLNRCVCLTDDGL-AYLSHLVALQYLDLDRCWKITDRGLAHL--SS 902

Query: 1020 AGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHL 841
               L+ L    C  + D   G+  L    SL+ L + +C    D+ L  LS L  NL +L
Sbjct: 903  LLALQHLNLGCCNNLTDS--GLAHLSHLTSLKHLDLRDCAKLTDSGLAHLSLLV-NLQYL 959

Query: 840  NLSGLNGVTDYGL-----LPFVQSCDAG------------------LVKVNLSGCINVTD 730
            NL+  N +TD GL     L  +Q  D G                  L  +NL+ C N+TD
Sbjct: 960  NLNRCNNLTDRGLAHLSHLVALQHLDLGECYKITDSGLAHLSLLVNLQYLNLNRCDNLTD 1019

Query: 729  KTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI-SKSRVSDFGIAALA 553
            + ++ +++L   TL+ LNLN C C+TD  LA ++   + LR L++ S   ++  G+A L 
Sbjct: 1020 RGLAHLSRL--VTLQHLNLNCCVCLTDDGLAYLSPLVA-LRHLNLRSCDNLTSAGLAHLT 1076

Query: 552  GGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC 424
               A+Q+    L+LS C   +D  L +L +L  SL  L++  C
Sbjct: 1077 PLIALQY----LNLSYCDSLNDNGLTHLTRLA-SLKHLDLSEC 1114



 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 99/358 (27%), Positives = 172/358 (48%), Gaps = 27/358 (7%)
 Frame = -3

Query: 1392 LQSLNISDISLAVIGHYGVALTDLALINLQNINE-RGFWVMGSGQ--GLHKLRSLVITAC 1222
            ++SL+ S+ +     H  +AL D   + +  ++E R F   G      L  L+ L +  C
Sbjct: 191  IESLDFSNNAYLTDAHL-LALKDCKNLKVLRLHECRNFTDAGLAHLSRLVALQHLDLGGC 249

Query: 1221 QGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV 1042
              +TD G+  +S+    ++ L L  C  L+D+G+ +++    +++ L L EC++I+ +G+
Sbjct: 250  YKITDSGLTYLSR-LVALQHLNLNCCVCLTDDGL-AYLSHLVALQHLDLGECYKITDSGL 307

Query: 1041 FGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRL 862
              +   S   L+ L    C  + D   G+  L    SL+ L + +C    D+ L  LS L
Sbjct: 308  AHL--SSLLALQHLNLGCCNNLTDS--GLAHLSHLTSLKHLDLRDCAKLTDSGLAHLSLL 363

Query: 861  CPNLVHLNLSGLNGVTDYGL-----LPFVQSCDAGLVK------------------VNLS 751
              NL +LNL+    +TD GL     L  +Q  D GL K                  ++L 
Sbjct: 364  V-NLQYLNLNRCYNLTDRGLSHLSHLVALQYLDLGLCKKLTSSGLAHLSPLVALQYLDLD 422

Query: 750  GCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI-SKSRVSD 574
             C  +TD+ ++ +++L    L+ LNLN C C+TD  LA ++   + LR L++     ++ 
Sbjct: 423  RCGEITDRGLAHLSRL--VALQHLNLNCCACLTDDGLAYLSPLVA-LRHLNLRCCGNLTS 479

Query: 573  FGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
             G+A L    A+Q+    L+LS C   +D  L +L +L  SL  L++  C   +  G+
Sbjct: 480  AGLAHLTPLIALQY----LNLSYCDSLNDNGLTHLTRLA-SLKHLDLSECPYFTDSGL 532



 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 83/302 (27%), Positives = 142/302 (47%), Gaps = 27/302 (8%)
 Frame = -3

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TD  + A+ K C N+K L L +C   +D G ++ +    +++ L L  C++I+ +G   
Sbjct: 767  LTDAHLLAL-KDCKNLKVLRLHECRNFTDAG-LAHLSPLVALQHLDLGGCYKITDSG--- 821

Query: 1035 ILVHSAG--KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRL 862
             L H +    L+ L    C+ + D   G+  L    +L+ L++  C    D  L  LS L
Sbjct: 822  -LAHLSRLVALQHLDLGGCYEITD--SGLTYLSRLVALQHLNLNRCVCLTDDGLAYLSHL 878

Query: 861  CP------------------------NLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNL 754
                                       L HLNL   N +TD GL     S    L  ++L
Sbjct: 879  VALQYLDLDRCWKITDRGLAHLSSLLALQHLNLGCCNNLTDSGLAHL--SHLTSLKHLDL 936

Query: 753  SGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKS-RVS 577
              C  +TD  ++ ++ L    L+ LNLN C  +TD  LA ++ +   L+ LD+ +  +++
Sbjct: 937  RDCAKLTDSGLAHLSLL--VNLQYLNLNRCNNLTDRGLAHLS-HLVALQHLDLGECYKIT 993

Query: 576  DFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVD 397
            D G+A L    ++  +LQ L+L+ C   +D+ L +L +L  +L  LN+  CV ++  G+ 
Sbjct: 994  DSGLAHL----SLLVNLQYLNLNRCDNLTDRGLAHLSRL-VTLQHLNLNCCVCLTDDGLA 1048

Query: 396  LL 391
             L
Sbjct: 1049 YL 1050



>gb:AY359239_1948008 Homo sapiens F-box and leucine-rich repeat
            protein 13 transcript variant 2 (FBXL13) mRNA, complete
            cds.
          Length = 690

 Score = 91.7 bits (226), Expect = 3e-17
 Identities = 92/359 (25%), Positives = 159/359 (44%), Gaps = 30/359 (8%)
 Frame = -3

Query: 1398 VKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQ 1219
            + L +  I++ ++ ++  +   L +L+L   +   ++G   +  G G HKL  L ++ C 
Sbjct: 276  LNLSNTTITNRTMRLLPRHFHNLQNLSLAYCRRFTDKGLQYLNLGNGCHKLIYLDLSGCT 335

Query: 1218 GVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVF 1039
             V+  G   ++  C  +  L +     L+DN V + V+    I SL       IS     
Sbjct: 336  QVSVQGFRYIANSCTGIMHLTINDMPTLTDNCVKALVEKCSRITSLVFTGAPHISDCTFR 395

Query: 1038 GILVHSAGKLKALAFENCFGMKDLAFG-VPALPPCNSLRSLSICNCTGFGDASLVVLSRL 862
             +   SA KL+ + FE    + D +F  +    P  +L  + + +C G  D+SL  LS L
Sbjct: 396  AL---SACKLRKIRFEGNKRVTDASFKFIDKNYP--NLSHIYMADCKGITDSSLRSLSPL 450

Query: 861  CPNLVHLNLSGLNGVTDYGLLPFVQS-CDAGLVKVNLSGCINVTDKTISAIAKLHGETLE 685
               L  LNL+    + D GL  F+       + ++NLS C+ ++D ++  +++     L 
Sbjct: 451  -KQLTVLNLANCVRIGDMGLKQFLDGPASMRIRELNLSNCVRLSDASVMKLSE-RCPNLN 508

Query: 684  LLNLNGCGCVTDASLAAIADYCSV-----------------------LRDLDISKS-RVS 577
             L+L  C  +T   +  I +  S+                       L++L +S+  R++
Sbjct: 509  YLSLRNCEHLTAQGIGYIVNIFSLVSIDLSGTDISNEGLNVLSRHKKLKELSVSECYRIT 568

Query: 576  DFGI----AALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGIS 412
            D GI    +A+   SA    L IL +SGCVL +D+ L  L      L  L +Q C  IS
Sbjct: 569  DDGIQITDSAMEMLSAKCHYLHILDISGCVLLTDQILEDLQIGCKQLRILKMQYCTNIS 627



 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 79/340 (23%), Positives = 144/340 (42%), Gaps = 7/340 (2%)
 Frame = -3

Query: 1386 SLNISDISLAVIGHYGVALTDLALINLQNINERGFWV----MGSGQGLHKLRSLVITACQ 1219
            +++ S +   +   Y V+      +N+  +N RG  +      S      L+ L ++ C 
Sbjct: 197  AIDFSSVKNVIPDKYIVSTLQRWRLNVLRLNFRGCLLRPKTFRSVSHCRNLQELNVSDCP 256

Query: 1218 GVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFV-KAAESIESLQLEECHRISQAGV 1042
              TD  +  +S+GCP V  LCL        N  +  + +   ++++L L  C R +  G+
Sbjct: 257  TFTDESMRHISEGCPGV--LCLNLSNTTITNRTMRLLPRHFHNLQNLSLAYCRRFTDKGL 314

Query: 1041 FGI-LVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSR 865
              + L +   KL  L    C  +    F   A   C  +  L+I +     D  +  L  
Sbjct: 315  QYLNLGNGCHKLIYLDLSGCTQVSVQGFRYIA-NSCTGIMHLTINDMPTLTDNCVKALVE 373

Query: 864  LCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLE 685
             C  +  L  +G   ++D     F       L K+   G   VTD +   I K +   L 
Sbjct: 374  KCSRITSLVFTGAPHISD---CTFRALSACKLRKIRFEGNKRVTDASFKFIDKNY-PNLS 429

Query: 684  LLNLNGCGCVTDASLAAIADYCSVLRDLDISKS-RVSDFGIAALAGGSAIQFSLQILSLS 508
             + +  C  +TD+SL +++     L  L+++   R+ D G+     G A    ++ L+LS
Sbjct: 430  HIYMADCKGITDSSLRSLSPL-KQLTVLNLANCVRIGDMGLKQFLDGPA-SMRIRELNLS 487

Query: 507  GCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLV 388
             CV  SD  +  L +   +L  L+++NC  ++ +G+  +V
Sbjct: 488  NCVRLSDASVMKLSERCPNLNYLSLRNCEHLTAQGIGYIV 527



 Score = 33.9 bits (76), Expect = 8.7
 Identities = 34/135 (25%), Positives = 61/135 (45%), Gaps = 16/135 (11%)
 Frame = -3

Query: 1407 LMKVKLQSLNISDISLAVIGH-------YGVALTDLALINLQ--NINERGFWVMGSGQGL 1255
            +MK+  +  N++ +SL    H       Y V +  L  I+L   +I+  G  V+   +  
Sbjct: 497  VMKLSERCPNLNYLSLRNCEHLTAQGIGYIVNIFSLVSIDLSGTDISNEGLNVLSRHK-- 554

Query: 1254 HKLRSLVITACQGVTDLGI-------EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAE 1096
             KL+ L ++ C  +TD GI       E +S  C  +  L +  C LL+D  +       +
Sbjct: 555  -KLKELSVSECYRITDDGIQITDSAMEMLSAKCHYLHILDISGCVLLTDQILEDLQIGCK 613

Query: 1095 SIESLQLEECHRISQ 1051
             +  L+++ C  IS+
Sbjct: 614  QLRILKMQYCTNISK 628



>gb:AY089649_1297305 Drosophila melanogaster RH06780 full insert cDNA.
          Length = 666

 Score = 91.3 bits (225), Expect = 5e-17
 Identities = 97/329 (29%), Positives = 155/329 (47%), Gaps = 28/329 (8%)
 Frame = -3

Query: 1263 QGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIES 1084
            +G H L  LV  + +   D+ + +      +V  L LR C+ +SD G+ + +   +S+  
Sbjct: 353  RGFHAL-GLVGASDEDALDV-VHSFPLASKHVHSLSLR-CSSISDRGLETLLDHLQSLFE 409

Query: 1083 LQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFG-VPALPPCNSLRSLSICN 907
            L+L  C+ +++AG++  L     ++ +L+  +C  + D A G V  L P     SL   +
Sbjct: 410  LELAGCNEVTEAGLWACL---TPRIVSLSLADCINIADEAVGAVAQLLPSLYEFSLQAYH 466

Query: 906  CTGFGDASLVVLS-RLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTD 730
             T   DA+L   S +   +L  L L     +T++G++  V S    L  ++LSGC  +TD
Sbjct: 467  VT---DAALGYFSPKQSHSLSILRLQSCWELTNHGIVNIVHSL-PHLTVLSLSGCSKLTD 522

Query: 729  KTISAIAKLHGETLELLNLNGCGCVTDASLAAIA-----------DYCSVLRDLDISK-- 589
              +  IA+ + + L  L+L+ C  +TDASL  IA           D C  + D+ +    
Sbjct: 523  DGVELIAE-NLQKLRALDLSWCPRITDASLEYIACDLNQLEELTLDRCVHITDIGVGYIS 581

Query: 588  -------------SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSL 448
                         S+V DFG+  L        +LQ+LSL+GC L +   L  L +L   L
Sbjct: 582  TMLSLTALFLRWCSQVRDFGLQHLCS----MRNLQVLSLAGCPLLTSSGLSSLIQL-RHL 636

Query: 447  AGLNIQNCVGISHRGVDLLVERLWRCDIL 361
              L + NC G SH   D L E L RC I+
Sbjct: 637  QELELTNCPGASHELFDYLKEHLPRCLII 665



 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 64/266 (24%), Positives = 114/266 (42%)
 Frame = -3

Query: 1428 FSSAGNHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHK 1249
            F  A  H+  + L+  +ISD  L  +  +  +L +L L     + E G W   +     +
Sbjct: 375  FPLASKHVHSLSLRCSSISDRGLETLLDHLQSLFELELAGCNEVTEAGLWACLT----PR 430

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            + SL +  C  + D  + AV++  P++ +  L+   +          K + S+  L+L+ 
Sbjct: 431  IVSLSLADCINIADEAVGAVAQLLPSLYEFSLQAYHVTDAALGYFSPKQSHSLSILRLQS 490

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGD 889
            C  ++  G+  I VHS   L  L+   C  + D    + A      LR+L +  C    D
Sbjct: 491  CWELTNHGIVNI-VHSLPHLTVLSLSGCSKLTDDGVELIA-ENLQKLRALDLSWCPRITD 548

Query: 888  ASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIA 709
            ASL  ++     L  L L     +TD G+     S    L  + L  C  V D  +  + 
Sbjct: 549  ASLEYIACDLNQLEELTLDRCVHITDIGV--GYISTMLSLTALFLRWCSQVRDFGLQHLC 606

Query: 708  KLHGETLELLNLNGCGCVTDASLAAI 631
             +    L++L+L GC  +T + L+++
Sbjct: 607  SM--RNLQVLSLAGCPLLTSSGLSSL 630



 Score = 53.5 bits (127), Expect = 1e-05
 Identities = 49/199 (24%), Positives = 91/199 (45%)
 Frame = -3

Query: 1383 LNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDL 1204
            +NI+D ++  +     +L + +L    ++ +         Q  H L  L + +C  +T+ 
Sbjct: 440  INIADEAVGAVAQLLPSLYEFSL-QAYHVTDAALGYFSPKQS-HSLSILRLQSCWELTNH 497

Query: 1203 GIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVH 1024
            GI  +    P++  L L  C+ L+D+GV    +  + + +L L  C RI+ A +   +  
Sbjct: 498  GIVNIVHSLPHLTVLSLSGCSKLTDDGVELIAENLQKLRALDLSWCPRITDASL-EYIAC 556

Query: 1023 SAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVH 844
               +L+ L  + C  + D+  GV  +    SL +L +  C+   D  L  L  +  NL  
Sbjct: 557  DLNQLEELTLDRCVHITDI--GVGYISTMLSLTALFLRWCSQVRDFGLQHLCSM-RNLQV 613

Query: 843  LNLSGLNGVTDYGLLPFVQ 787
            L+L+G   +T  GL   +Q
Sbjct: 614  LSLAGCPLLTSSGLSSLIQ 632



>gb:AE014296_1135872 Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE003544_1214848 Drosophila melanogaster
            chromosome 3L, section 41 of 83 of the complete sequence.
          Length = 666

 Score = 91.3 bits (225), Expect = 5e-17
 Identities = 97/329 (29%), Positives = 155/329 (47%), Gaps = 28/329 (8%)
 Frame = -3

Query: 1263 QGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIES 1084
            +G H L  LV  + +   D+ + +      +V  L LR C+ +SD G+ + +   +S+  
Sbjct: 353  RGFHAL-GLVGASDEDALDV-VHSFPLASKHVHSLSLR-CSSISDRGLETLLDHLQSLFE 409

Query: 1083 LQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFG-VPALPPCNSLRSLSICN 907
            L+L  C+ +++AG++  L     ++ +L+  +C  + D A G V  L P     SL   +
Sbjct: 410  LELAGCNEVTEAGLWACL---TPRIVSLSLADCINIADEAVGAVAQLLPSLYEFSLQAYH 466

Query: 906  CTGFGDASLVVLS-RLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTD 730
             T   DA+L   S +   +L  L L     +T++G++  V S    L  ++LSGC  +TD
Sbjct: 467  VT---DAALGYFSPKQSHSLSILRLQSCWELTNHGIVNIVHSL-PHLTVLSLSGCSKLTD 522

Query: 729  KTISAIAKLHGETLELLNLNGCGCVTDASLAAIA-----------DYCSVLRDLDISK-- 589
              +  IA+ + + L  L+L+ C  +TDASL  IA           D C  + D+ +    
Sbjct: 523  DGVELIAE-NLQKLRALDLSWCPRITDASLEYIACDLNQLEELTLDRCVHITDIGVGYIS 581

Query: 588  -------------SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSL 448
                         S+V DFG+  L        +LQ+LSL+GC L +   L  L +L   L
Sbjct: 582  TMLSLTALFLRWCSQVRDFGLQHLCS----MRNLQVLSLAGCPLLTSSGLSSLIQL-RHL 636

Query: 447  AGLNIQNCVGISHRGVDLLVERLWRCDIL 361
              L + NC G SH   D L E L RC I+
Sbjct: 637  QELELTNCPGASHELFDYLKEHLPRCLII 665



 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 64/266 (24%), Positives = 114/266 (42%)
 Frame = -3

Query: 1428 FSSAGNHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHK 1249
            F  A  H+  + L+  +ISD  L  +  +  +L +L L     + E G W   +     +
Sbjct: 375  FPLASKHVHSLSLRCSSISDRGLETLLDHLQSLFELELAGCNEVTEAGLWACLT----PR 430

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            + SL +  C  + D  + AV++  P++ +  L+   +          K + S+  L+L+ 
Sbjct: 431  IVSLSLADCINIADEAVGAVAQLLPSLYEFSLQAYHVTDAALGYFSPKQSHSLSILRLQS 490

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGD 889
            C  ++  G+  I VHS   L  L+   C  + D    + A      LR+L +  C    D
Sbjct: 491  CWELTNHGIVNI-VHSLPHLTVLSLSGCSKLTDDGVELIA-ENLQKLRALDLSWCPRITD 548

Query: 888  ASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIA 709
            ASL  ++     L  L L     +TD G+     S    L  + L  C  V D  +  + 
Sbjct: 549  ASLEYIACDLNQLEELTLDRCVHITDIGV--GYISTMLSLTALFLRWCSQVRDFGLQHLC 606

Query: 708  KLHGETLELLNLNGCGCVTDASLAAI 631
             +    L++L+L GC  +T + L+++
Sbjct: 607  SM--RNLQVLSLAGCPLLTSSGLSSL 630



 Score = 53.5 bits (127), Expect = 1e-05
 Identities = 49/199 (24%), Positives = 91/199 (45%)
 Frame = -3

Query: 1383 LNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDL 1204
            +NI+D ++  +     +L + +L    ++ +         Q  H L  L + +C  +T+ 
Sbjct: 440  INIADEAVGAVAQLLPSLYEFSL-QAYHVTDAALGYFSPKQS-HSLSILRLQSCWELTNH 497

Query: 1203 GIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVH 1024
            GI  +    P++  L L  C+ L+D+GV    +  + + +L L  C RI+ A +   +  
Sbjct: 498  GIVNIVHSLPHLTVLSLSGCSKLTDDGVELIAENLQKLRALDLSWCPRITDASL-EYIAC 556

Query: 1023 SAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVH 844
               +L+ L  + C  + D+  GV  +    SL +L +  C+   D  L  L  +  NL  
Sbjct: 557  DLNQLEELTLDRCVHITDI--GVGYISTMLSLTALFLRWCSQVRDFGLQHLCSM-RNLQV 613

Query: 843  LNLSGLNGVTDYGLLPFVQ 787
            L+L+G   +T  GL   +Q
Sbjct: 614  LSLAGCPLLTSSGLSSLIQ 632



>gb:BX908798_831066 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 670

 Score = 90.9 bits (224), Expect = 6e-17
 Identities = 88/273 (32%), Positives = 140/273 (51%), Gaps = 1/273 (0%)
 Frame = -3

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TD  + A+ K C N+K L L+KC  L+D G+        +++ L L +CH ++ AG+  
Sbjct: 279  LTDAHLLAL-KTCKNLKVLYLKKCCNLTDAGLPHLTPLV-ALQYLDLSKCHNLTDAGLTH 336

Query: 1035 ILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCP 856
            +    A  L  L    C+ + D   G+  L    +L+ L++ NC  F DA L  L+ L  
Sbjct: 337  LTFLDA--LNYLGLGECYNLTDT--GLAHLKSLINLQHLNLNNC-NFTDAGLAHLTPLV- 390

Query: 855  NLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLN 676
             L +LNLS    +TD GL          L ++NLS C N+TD  ++ ++ L   TL+ LN
Sbjct: 391  TLKYLNLSQCYNLTDAGLAHLTPL--VNLQQLNLSDCTNLTDTGLAYLSPL--VTLQHLN 446

Query: 675  LNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCV 499
            LN C  + DA LA +    + L+ L++S  + ++D G+A L    +   +LQ L L GC 
Sbjct: 447  LNVCKLI-DAGLAHLTPLVN-LQQLNLSYCTNLTDAGLAHL----STLVTLQHLDLDGCY 500

Query: 498  LASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
              +D  L +L  L  +L  LN+  C  ++  G+
Sbjct: 501  KLTDIGLAHLTPL-VTLKYLNLSCCHNLTGAGL 532



 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 83/313 (26%), Positives = 140/313 (44%), Gaps = 51/313 (16%)
 Frame = -3

Query: 1320 ALINLQNINERGFWVMGSGQG----LHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCL 1153
            +LINLQ++N        +G      L  L+ L ++ C  +TD G+  ++    N++QL L
Sbjct: 364  SLINLQHLNLNNCNFTDAGLAHLTPLVTLKYLNLSQCYNLTDAGLAHLTP-LVNLQQLNL 422

Query: 1152 RKCTLLSDNGV-----------------------VSFVKAAESIESLQLEECHRISQAGV 1042
              CT L+D G+                       ++ +    +++ L L  C  ++ AG+
Sbjct: 423  SDCTNLTDTGLAYLSPLVTLQHLNLNVCKLIDAGLAHLTPLVNLQQLNLSYCTNLTDAGL 482

Query: 1041 FGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRL 862
              +   +   L+ L  + C+ + D+  G+  L P  +L+ L++  C     A L  L+ L
Sbjct: 483  AHL--STLVTLQHLDLDGCYKLTDI--GLAHLTPLVTLKYLNLSCCHNLTGAGLAHLTPL 538

Query: 861  CPNLVHLNLSGLNGVTDYGLL---PFV-------QSC----DAGLVKV---------NLS 751
               L HL+LS    + D GL    P V         C    DAGL  +         +L 
Sbjct: 539  VA-LKHLDLSWNGDLEDAGLAHLTPLVALKYLDLSECYHLTDAGLAHLRSLVALKHLDLR 597

Query: 750  GCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSD 574
            GC  +TD  I+ +  L    L+ L+L GC  +TDA LA +    + L+DL++    R++D
Sbjct: 598  GCYQLTDAGIAHLTPL--VALKYLDLKGCPNLTDAGLAHLTSLIA-LQDLELPNCQRITD 654

Query: 573  FGIAALAGGSAIQ 535
             G+A LA    ++
Sbjct: 655  AGLAHLASSMTLR 667



>gb:BX908798_831512 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 659

 Score = 90.5 bits (223), Expect = 8e-17
 Identities = 94/296 (31%), Positives = 148/296 (50%), Gaps = 24/296 (8%)
 Frame = -3

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TD  + A+ K C N+K+L L++C  L+D G+V       +++ L L  C +++  G+  
Sbjct: 238  LTDAHLLAL-KNCKNLKELHLQECRNLTDAGLVHLAPLV-ALKHLNLNFCDKLTNTGLAH 295

Query: 1035 ILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCP 856
            +   +A  L+ L   NC  + D   G+  L P  +L+ L++  C    D  LV LS L  
Sbjct: 296  LRPLTA--LQHLNLGNCRNLTDA--GLAHLTPLTALQHLNLNFCDKLTDTGLVRLSPLTA 351

Query: 855  NLVHLNLSGLNGVTDYGLL---PFVQ------SC-----DAGLV---------KVNLSGC 745
             L HL+LS    +TD GL+   P V       SC     DAGLV          ++LS C
Sbjct: 352  -LQHLDLSDCENLTDAGLVHLKPLVALQHLNLSCCENLTDAGLVHLKLLVALQHLDLSDC 410

Query: 744  INVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI-SKSRVSDFG 568
             N+TD  ++ +  L    L+ L+L+ C  +TDA L  +  + + L+ LD+    +V+D G
Sbjct: 411  NNLTDAGLAHLTPL--TALQYLDLSYCNNLTDAGLVHL-KFLTALQHLDLRGCDKVADDG 467

Query: 567  IAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
            +A L   +A    LQ LSLS C   +D  L +L KL  +L  L +  C  ++  G+
Sbjct: 468  LAHLTPLTA----LQALSLSQCRNLTDAGLGHL-KLLTALQYLRLSQCWNLTDAGL 518



 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 82/290 (28%), Positives = 131/290 (45%), Gaps = 27/290 (9%)
 Frame = -3

Query: 1398 VKLQSLNIS---DISLAVIGHYG--VALTDLALINLQNINERGFWVMGSGQGLHKLRSLV 1234
            V LQ LN+S   +++ A + H    VAL  L L +  N+ + G   +     L  L+ L 
Sbjct: 375  VALQHLNLSCCENLTDAGLVHLKLLVALQHLDLSDCNNLTDAG---LAHLTPLTALQYLD 431

Query: 1233 ITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRIS 1054
            ++ C  +TD G+  + K    ++ L LR C  ++D+G+        ++++L L +C  ++
Sbjct: 432  LSYCNNLTDAGLVHL-KFLTALQHLDLRGCDKVADDGLAHLTPLT-ALQALSLSQCRNLT 489

Query: 1053 QAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVV 874
             AG+  + + +A  L+ L    C+ + D   G+  L P  +L+ L +  C    D  LV 
Sbjct: 490  DAGLGHLKLLTA--LQYLRLSQCWNLTDA--GLIHLRPLVALQHLDLSYCGNLTDVGLVH 545

Query: 873  LSRL----------CPNLVHLNLSGLNGVTDYGLLPFVQS---CDAGLVKV--------- 760
            L+ L          C NL    L+ L  +T    L   Q     DAGLV +         
Sbjct: 546  LTPLMALQHLDLNYCENLTGDGLAHLRSLTTLQHLSLNQCWNLTDAGLVHLEPLTALQHL 605

Query: 759  NLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVL 610
            +LS C N TD  +  +  L    L+ LNL GC  VTD  LA    + + L
Sbjct: 606  DLSYCGNFTDVGLVHLTSLMA--LQHLNLRGCDRVTDVGLALFKIFATSL 653



>gb:BX908798_831063 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 623

 Score = 90.1 bits (222), Expect = 1e-16
 Identities = 87/273 (31%), Positives = 136/273 (49%), Gaps = 1/273 (0%)
 Frame = -3

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TD  + A+ K C N+K L L+KC  L+D G +S +    +++ L+L +C R++ AG+  
Sbjct: 278  LTDAHLLAL-KTCKNLKVLYLKKCCNLTDAG-LSHLSPLVALQHLELSDCPRLTDAGLAH 335

Query: 1035 ILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCP 856
            +   S   L+ L    C    D   G+  L P  +L  L++  C  F  A L  L+ L  
Sbjct: 336  LT--SLVALQYLNLSECSNFTDA--GLAHLTPLLTLTHLNLSWCYNFTHAGLAHLTPLVA 391

Query: 855  NLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLN 676
             L HLNL     +TD GL     S    L  +NL  C N+TD  ++ ++ L    L+ L+
Sbjct: 392  -LQHLNLGHCRNITDAGLAHL--SPLVALQHLNLGWCSNLTDAGLAHLSPL--VALQHLD 446

Query: 675  LNGCGCVTDASLAAIADYCSVLRDLDISKS-RVSDFGIAALAGGSAIQFSLQILSLSGCV 499
            L  C  +TDA LA +    + L+ LD+S    ++D G+A L+       +LQ L LS C+
Sbjct: 447  LGWCSNLTDAGLAHLTSLVA-LQHLDLSWCYYLTDAGLAHLSP----LVALQHLDLSNCL 501

Query: 498  LASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
               D  L +L  L  +L  LN+  C  ++  G+
Sbjct: 502  SLKDAGLAHLTLL-VTLKYLNLNKCHNLTDAGL 533



 Score = 74.3 bits (181), Expect = 6e-12
 Identities = 93/328 (28%), Positives = 152/328 (46%), Gaps = 1/328 (0%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLG 1201
            N++D  L+ +    VAL  L L +   + + G   + S   L  L+ L ++ C   TD G
Sbjct: 302  NLTDAGLSHLSPL-VALQHLELSDCPRLTDAGLAHLTS---LVALQYLNLSECSNFTDAG 357

Query: 1200 IEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHS 1021
            +  ++     +  L L  C   +  G+        +++ L L  C  I+ AG+  +    
Sbjct: 358  LAHLTP-LLTLTHLNLSWCYNFTHAGLAHLTPLV-ALQHLNLGHCRNITDAGLAHLSPLV 415

Query: 1020 AGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHL 841
            A  L+ L    C  + D   G+  L P  +L+ L +  C+   DA L  L+ L   L HL
Sbjct: 416  A--LQHLNLGWCSNLTDA--GLAHLSPLVALQHLDLGWCSNLTDAGLAHLTSLVA-LQHL 470

Query: 840  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCG 661
            +LS    +TD GL     S    L  ++LS C+++ D  ++ +  L   TL+ LNLN C 
Sbjct: 471  DLSWCYYLTDAGLAHL--SPLVALQHLDLSNCLSLKDAGLAHLTLL--VTLKYLNLNKCH 526

Query: 660  CVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDK 484
             +TDA LA +    + L+ LD+S+   ++  G+A L        +LQ L +S C   +D 
Sbjct: 527  NLTDAGLAHLTPLVA-LQHLDLSQCPNLTGTGLAHLNS----LMALQHLDMSWCHNLTDA 581

Query: 483  CLPYLHKLGNSLAGLNIQNCVGISHRGV 400
             L +L  L N L  LN+  C  ++  G+
Sbjct: 582  GLTHLTPLVN-LRHLNLTKCPKLTDAGL 608



 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 74/249 (29%), Positives = 118/249 (47%)
 Frame = -3

Query: 1338 VALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQL 1159
            VAL  L L + +NI + G   +     L  L+ L +  C  +TD G+  +S     ++ L
Sbjct: 390  VALQHLNLGHCRNITDAGLAHLSP---LVALQHLNLGWCSNLTDAGLAHLSP-LVALQHL 445

Query: 1158 CLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFG 979
             L  C+ L+D G+        +++ L L  C+ ++ AG+  +    A  L+ L   NC  
Sbjct: 446  DLGWCSNLTDAGLAHLTSLV-ALQHLDLSWCYYLTDAGLAHLSPLVA--LQHLDLSNCLS 502

Query: 978  MKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLL 799
            +KD   G+  L    +L+ L++  C    DA L  L+ L   L HL+LS    +T  GL 
Sbjct: 503  LKDA--GLAHLTLLVTLKYLNLNKCHNLTDAGLAHLTPLVA-LQHLDLSQCPNLTGTGLA 559

Query: 798  PFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYC 619
                +    L  +++S C N+TD  ++ +  L    L  LNL  C  +TDA LA +A   
Sbjct: 560  HL--NSLMALQHLDMSWCHNLTDAGLTHLTPL--VNLRHLNLTKCPKLTDAGLAHLAPLV 615

Query: 618  SVLRDLDIS 592
            + L  LD+S
Sbjct: 616  A-LEHLDLS 623



>gb:BX908798_831510 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 704

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 96/334 (28%), Positives = 157/334 (47%), Gaps = 23/334 (6%)
 Frame = -3

Query: 1332 LTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCL 1153
            LTD  L+ L+N                 L+ L + ACQ +TD G+  ++     ++ L +
Sbjct: 207  LTDAHLLTLRNCEN--------------LKVLHLNACQAITDDGLAHLTP-LTGLQHLDI 251

Query: 1152 RKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGI-------------------- 1033
            R C  L+D+G ++++ +   ++ L L  C+ ++  G+  +                    
Sbjct: 252  RVCEYLTDDG-LAYLTSLTGLQHLNLSGCYHLTDTGLAHLTPLTGLQHLDLRICEYLTAT 310

Query: 1032 -LVHSAGKLKALAFENCFGMKDLA-FGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLC 859
             L H    LKAL   +    K+L   G+  L P  +L+ L +  C    DA LV L+ L 
Sbjct: 311  GLAH-LKPLKALQHLDLSYCKNLTNVGLSHLAPLTALQHLDLSYCWQLADAGLVYLTPL- 368

Query: 858  PNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELL 679
              L HL+LSG + +TD GL          L  ++LS C N+TD  ++ +  L  + L+ L
Sbjct: 369  TGLQHLDLSGYHKLTDAGLAHLTPL--TALQCLDLSYCENLTDVGLAHLMPL--KALQHL 424

Query: 678  NLNGCGCVTDASLAAIADYCSVLRDLDISKS-RVSDFGIAALAGGSAIQFSLQILSLSGC 502
            NL  C  +TD  LA +A   + L+ LD+S   +++D G+A L   +     LQ L LS C
Sbjct: 425  NLRNCRNLTDDGLAHLAP-LTALQHLDLSYCWQLTDAGLAHLTPLT----GLQRLDLSYC 479

Query: 501  VLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
               +D  L +L  L  +L  LN++NC  ++  G+
Sbjct: 480  ENLTDVGLAHLIPL-KALQHLNLRNCRNLTDDGL 512



 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 82/287 (28%), Positives = 142/287 (49%), Gaps = 1/287 (0%)
 Frame = -3

Query: 1257 LHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQ 1078
            L  L+ L ++ C+ +TD+G+  +      ++ L LR C  L+D+G+        +++ L 
Sbjct: 393  LTALQCLDLSYCENLTDVGLAHLMP-LKALQHLNLRNCRNLTDDGLAHLAPLT-ALQHLD 450

Query: 1077 LEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTG 898
            L  C +++ AG+  +   +   L+ L    C  + D+  G+  L P  +L+ L++ NC  
Sbjct: 451  LSYCWQLTDAGLAHLTPLTG--LQRLDLSYCENLTDV--GLAHLIPLKALQHLNLRNCRN 506

Query: 897  FGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTIS 718
              D  LV L+ L   L HL+LS  N +TD GL          L  ++L  CIN+T   ++
Sbjct: 507  LTDDGLVHLAPLTA-LQHLDLSDCNNLTDAGLAHLTPL--TALQHLDLKYCINLTGAGLA 563

Query: 717  AIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSA 541
             +A L G  L+ L+L+ C  + DA L  +    + L+ L +S    ++D G+A L   +A
Sbjct: 564  HLAFLTG--LQYLDLSWCKNLIDAGLVHL-KLLTALQYLGLSYCENLTDDGLAHLRSLTA 620

Query: 540  IQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
                LQ L+L      +D  L +L  L  SL  L+++ C  ++  G+
Sbjct: 621  ----LQHLALIHYKNLTDAGLVHLRSL-TSLQHLDLRYCQNLTGDGL 662



 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 72/254 (28%), Positives = 118/254 (46%), Gaps = 6/254 (2%)
 Frame = -3

Query: 1152 RKCTLLSDNGVVSFVKAAESI-ESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGM 976
            R+C L      + F   +E + +++QL E  RI        ++  + +++AL F N   +
Sbjct: 156  RQCRLNMLKNYLEFTVVSELLNQAVQLAEFERI--------IIPFSKEIEALNFSNNDYL 207

Query: 975  KDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLP 796
             D    +  L  C +L+ L +  C    D  L  L+ L   L HL++     +TD GL  
Sbjct: 208  TDAH--LLTLRNCENLKVLHLNACQAITDDGLAHLTPLT-GLQHLDIRVCEYLTDDGLAY 264

Query: 795  FVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCS 616
                   GL  +NLSGC ++TD  ++ +  L G  L+ L+L  C  +T   LA +     
Sbjct: 265  LTSL--TGLQHLNLSGCYHLTDTGLAHLTPLTG--LQHLDLRICEYLTATGLAHLKP-LK 319

Query: 615  VLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGN----S 451
             L+ LD+S  + +++ G++ LA  +A    LQ L LS C   +D  L YL  L       
Sbjct: 320  ALQHLDLSYCKNLTNVGLSHLAPLTA----LQHLDLSYCWQLADAGLVYLTPLTGLQHLD 375

Query: 450  LAGLNIQNCVGISH 409
            L+G +     G++H
Sbjct: 376  LSGYHKLTDAGLAH 389



>gb:BX908798_831018 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 870

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 98/339 (28%), Positives = 166/339 (48%), Gaps = 8/339 (2%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVALTDLALINL-------QNINERGFWVMGSGQGLHKLRSLVITAC 1222
            N++D  LA +     +LT L  ++L       QN+ + G   + S   L  L+ L ++  
Sbjct: 521  NLTDAGLAHL----TSLTALEHLDLGLDFGYCQNLTDDGLAHLSS---LTALKHLDLSWR 573

Query: 1221 QGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV 1042
            + +TD G+  ++     +K L L  C  L+D G+ +++    +++ L L+    I+  G+
Sbjct: 574  ENLTDAGLAHLTS-LTALKHLDLSWCENLTDEGL-AYLTPLVALQYLSLKGSD-ITDEGL 630

Query: 1041 FGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRL 862
              +   SA  L+ L+  +C  +    +G+  L    +L  L +  C       L+ LS L
Sbjct: 631  EHLAHLSA--LRHLSLNDCRRIYH-GYGLAHLTTLVNLEHLDLSGCYSLSSFKLIFLSSL 687

Query: 861  CPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLEL 682
              NL HLNLSG  G+   GL       +  L  ++LS CIN+TDK ++ +  L G  L+ 
Sbjct: 688  V-NLQHLNLSGCFGLYHDGLEDLTPLMN--LQYLDLSSCINLTDKGLAYLTSLVGLGLQH 744

Query: 681  LNLNGCGCVTDASLAAIADYCSVLRDLDIS-KSRVSDFGIAALAGGSAIQFSLQILSLSG 505
            L+L+GC  +TD  LA +      L  LD+S    ++D G+A L   + +++    L+L G
Sbjct: 745  LDLSGCKEITDTGLAHLTSLVG-LEYLDLSWCENLTDKGLAYLTSFAGLKY----LNLKG 799

Query: 504  CVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLV 388
            C   +D  L +L  L  +L  LN+  CV ++  G+  LV
Sbjct: 800  CKKITDAGLAHLTSL-VTLQRLNLSECVNLTDTGLAHLV 837



 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 79/272 (29%), Positives = 119/272 (43%), Gaps = 30/272 (11%)
 Frame = -3

Query: 1185 KGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLK 1006
            K C N+K LCL+      D G ++ + +  ++++L L EC+ +   G    L H    L 
Sbjct: 356  KNCKNLKVLCLKIFYTPIDTG-LAHLTSLTALQNLDLSECYLLKDTG----LAH-LSSLT 409

Query: 1005 ALAFENCFGMKDLA-FGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSG 829
            AL + +  G  DL   G+  L P  SL+ L +  C       L  L+ L   L HL LS 
Sbjct: 410  ALQYLDLSGCDDLTDAGLAHLTPLVSLQHLDLSKCENLTGDGLAHLTPLVA-LRHLGLSD 468

Query: 828  LNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTD 649
               +TD GL          L  ++LS C N+TD  +  ++ L    L+ L+L  C  +TD
Sbjct: 469  CRNLTDAGLAHLTPL--TALKHLDLSECKNLTDDGLVHLSSL--VALQYLSLKLCENLTD 524

Query: 648  ASLAAIAD--------------YC--------------SVLRDLDIS-KSRVSDFGIAAL 556
            A LA +                YC              + L+ LD+S +  ++D G+A L
Sbjct: 525  AGLAHLTSLTALEHLDLGLDFGYCQNLTDDGLAHLSSLTALKHLDLSWRENLTDAGLAHL 584

Query: 555  AGGSAIQFSLQILSLSGCVLASDKCLPYLHKL 460
               +A    L+ L LS C   +D+ L YL  L
Sbjct: 585  TSLTA----LKHLDLSWCENLTDEGLAYLTPL 612



 Score = 57.4 bits (137), Expect = 7e-07
 Identities = 75/299 (25%), Positives = 121/299 (40%), Gaps = 51/299 (17%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQG--VTD 1207
            N++D  LA +     AL  L L   +N+ + G         L  L +L   + +G  +TD
Sbjct: 575  NLTDAGLAHLTSL-TALKHLDLSWCENLTDEGLAY------LTPLVALQYLSLKGSDITD 627

Query: 1206 LGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILV 1027
             G+E ++     ++ L L  C  +     ++ +    ++E L L  C+ +S   +  I +
Sbjct: 628  EGLEHLAH-LSALRHLSLNDCRRIYHGYGLAHLTTLVNLEHLDLSGCYSLSSFKL--IFL 684

Query: 1026 HSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCP-NL 850
             S   L+ L    CFG+     G+  L P  +L+ L + +C    D  L  L+ L    L
Sbjct: 685  SSLVNLQHLNLSGCFGLYH--DGLEDLTPLMNLQYLDLSSCINLTDKGLAYLTSLVGLGL 742

Query: 849  VHLNLSGLNGVTDYGL------------------------LPFVQS-------------- 784
             HL+LSG   +TD GL                        L ++ S              
Sbjct: 743  QHLDLSGCKEITDTGLAHLTSLVGLEYLDLSWCENLTDKGLAYLTSFAGLKYLNLKGCKK 802

Query: 783  -CDAGLV---------KVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLA 637
              DAGL          ++NLS C+N+TD  ++ +  L    L+ L L  C  +TD  LA
Sbjct: 803  ITDAGLAHLTSLVTLQRLNLSECVNLTDTGLAHLVSL--VNLQDLELRECKSITDTGLA 859



 Score = 43.9 bits (102), Expect = 0.008
 Identities = 50/178 (28%), Positives = 82/178 (46%), Gaps = 1/178 (0%)
 Frame = -3

Query: 930 LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLS 751
           +  L++     F +A  + L   C NL  L L       D GL          L  ++LS
Sbjct: 336 IEELNLSGKDFFTEAHFLALKN-CKNLKVLCLKIFYTPIDTGLAHLTSL--TALQNLDLS 392

Query: 750 GCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSD 574
            C  + D  ++ ++ L    L+ L+L+GC  +TDA LA +    S L+ LD+SK   ++ 
Sbjct: 393 ECYLLKDTGLAHLSSL--TALQYLDLSGCDDLTDAGLAHLTPLVS-LQHLDLSKCENLTG 449

Query: 573 FGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
            G+A L        +L+ L LS C   +D  L +L  L  +L  L++  C  ++  G+
Sbjct: 450 DGLAHLTP----LVALRHLGLSDCRNLTDAGLAHLTPL-TALKHLDLSECKNLTDDGL 502



>gb:AY087448_1572479 Arabidopsis thaliana clone 35534 mRNA, complete
            sequence.
          Length = 353

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 84/317 (26%), Positives = 140/317 (44%), Gaps = 7/317 (2%)
 Frame = -3

Query: 1314 INLQNINERGFWVMG--SGQGLHKLRSLVITACQGVTDLGIEAVSKGCPN----VKQLCL 1153
            INL+ +   G  ++   S     +++ + +   QGV D  ++ V   CP+    ++ L L
Sbjct: 59   INLREMTNAGDRLLAALSLPRYRQVKHINLEFAQGVVDSHLKLVKTECPDALLSLEWLNL 118

Query: 1152 RKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMK 973
              C  +SDNG+ +       ++   +    R++ AG+   LV +   +  L    C  + 
Sbjct: 119  NVCQKISDNGIEAITSICPKLKVFSIYWNVRVTDAGIRN-LVKNCRHITDLNLSGCKSLT 177

Query: 972  DLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPF 793
            D +  + A      L SL+I  C    D  L+ + + C +L  LNL  L+G TD   +  
Sbjct: 178  DKSMQLVA-ESYPDLESLNITRCVKITDDGLLQVLQKCFSLQTLNLYALSGFTDKAYMKI 236

Query: 792  VQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSV 613
              S  A L  +++ G  N++D+ I  IAK +   LE LNL  C  +TDA +  IA+ C+ 
Sbjct: 237  --SLLADLRFLDICGAQNISDEGIGHIAKCN--KLESLNLTWCVRITDAGVNTIANSCT- 291

Query: 612  LRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK-LGNSLAGLN 436
                                       SL+ LSL G V  +D+CL  L +    +L  L+
Sbjct: 292  ---------------------------SLEFLSLFGIVGVTDRCLETLSQTCSTTLTTLD 324

Query: 435  IQNCVGISHRGVDLLVE 385
            +  C GI  R  + L++
Sbjct: 325  VNGCTGIKRRSREELLQ 341



 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 53/187 (28%), Positives = 76/187 (40%), Gaps = 2/187 (1%)
 Frame = -3

Query: 924 SLSICNCTGFGDASLVVLSRLCPNLV-HLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSG 748
           ++++   T  GD  L  LS      V H+NL    GV D  L      C   L+      
Sbjct: 58  TINLREMTNAGDRLLAALSLPRYRQVKHINLEFAQGVVDSHLKLVKTECPDALL------ 111

Query: 747 CINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKS-RVSDF 571
                             +LE LNLN C  ++D  + AI   C  L+   I  + RV+D 
Sbjct: 112 ------------------SLEWLNLNVCQKISDNGIEAITSICPKLKVFSIYWNVRVTDA 153

Query: 570 GIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
           GI  L         +  L+LSGC   +DK +  + +    L  LNI  CV I+  G   L
Sbjct: 154 GIRNLVKNCR---HITDLNLSGCKSLTDKSMQLVAESYPDLESLNITRCVKITDDG---L 207

Query: 390 VERLWRC 370
           ++ L +C
Sbjct: 208 LQVLQKC 214



>gb:HSM803079_1186896 Homo sapiens mRNA; cDNA DKFZp434L2422 (from
            clone DKFZp434L2422).
          Length = 448

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 97/395 (24%), Positives = 152/395 (38%), Gaps = 77/395 (19%)
 Frame = -3

Query: 1332 LTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCL 1153
            L +L+L   +   ++G   +  G G HKL  L ++ C  ++  G   ++  C  +  L +
Sbjct: 11   LQNLSLAYCRRFTDKGLQYLNLGNGCHKLIYLDLSGCTQISVQGFRYIANSCTGIMHLTI 70

Query: 1152 RKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFE------ 991
                 L+DN V + V+    I SL       IS      +   SA KL+ + FE      
Sbjct: 71   NDMPTLTDNCVKALVEKCSRITSLVFTGAPHISDCTFRAL---SACKLRKIRFEGNKRVT 127

Query: 990  --------------------NCFGMKD--------------------LAFGVPAL----- 946
                                +C G+ D                    +  G   L     
Sbjct: 128  DASFKFIDKNYPNLSHIYMADCKGITDSSLRSLSPLKQLTVLNLANCVRIGDMGLKQFLD 187

Query: 945  -PPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGL 769
             P    +R L++ NC    DA ++ LS  CPNL +L+L     +T  G+   V      L
Sbjct: 188  GPASMRIRELNLSNCVRLSDAFVMKLSERCPNLNYLSLRNCEHLTAQGIGYIVNIFS--L 245

Query: 768  VKVNLSG------------------------CINVTDKTISAIAKLHGETLELLNLNGCG 661
            V ++LSG                        C  +TD  I A  K     LE L+++ C 
Sbjct: 246  VSIDLSGTDISNEGLNVLSRHKKLKELSVSECYRITDDGIQAFCK-SSLILEHLDVSYCS 304

Query: 660  CVTDASLAAIADYCSVLRDLDISKS-RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDK 484
             ++D  + A+A YC  L  L I+   +++D  +  L   SA    L IL +SGCVL +D+
Sbjct: 305  QLSDMIIKALAIYCINLTSLSIAGCPKITDSAMEML---SAKCHYLHILDISGCVLLTDQ 361

Query: 483  CLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVERL 379
             L  L      L  L +Q C  IS +    +  ++
Sbjct: 362  ILEDLQIGCKQLRILKMQYCTNISKKAAQRMSSKV 396



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 46/197 (23%), Positives = 83/197 (42%), Gaps = 3/197 (1%)
 Frame = -3

Query: 939 CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKV 760
           C+ L  L +  CT         ++  C  ++HL ++ +  +TD  +   V+ C   +  +
Sbjct: 36  CHKLIYLDLSGCTQISVQGFRYIANSCTGIMHLTINDMPTLTDNCVKALVEKCSR-ITSL 94

Query: 759 NLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR- 583
             +G  +++D T  A++      L  +   G   VTDAS   I      L  + ++  + 
Sbjct: 95  VFTGAPHISDCTFRALSACK---LRKIRFEGNKRVTDASFKFIDKNYPNLSHIYMADCKG 151

Query: 582 VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYL--HKLGNSLAGLNIQNCVGISH 409
           ++D  + +L+        L +L+L+ CV   D  L           +  LN+ NCV +S 
Sbjct: 152 ITDSSLRSLSPLK----QLTVLNLANCVRIGDMGLKQFLDGPASMRIRELNLSNCVRLSD 207

Query: 408 RGVDLLVERLWRCDILS 358
             V  L ER    + LS
Sbjct: 208 AFVMKLSERCPNLNYLS 224



 Score = 40.0 bits (92), Expect = 0.12
 Identities = 46/183 (25%), Positives = 80/183 (43%), Gaps = 14/183 (7%)
 Frame = -3

Query: 1407 LMKVKLQSLNISDISLAVIGH-------YGVALTDLALINLQ--NINERGFWVMGSGQGL 1255
            +MK+  +  N++ +SL    H       Y V +  L  I+L   +I+  G  V+   +  
Sbjct: 210  VMKLSERCPNLNYLSLRNCEHLTAQGIGYIVNIFSLVSIDLSGTDISNEGLNVLSRHK-- 267

Query: 1254 HKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQL 1075
             KL+ L ++ C  +TD GI+A  K    ++ L +  C+ LSD  + +      ++ SL +
Sbjct: 268  -KLKELSVSECYRITDDGIQAFCKSSLILEHLDVSYCSQLSDMIIKALAIYCINLTSLSI 326

Query: 1074 EECHRISQAGVFGILVHSAGKLKALAFENCF-----GMKDLAFGVPALPPCNSLRSLSIC 910
              C +I+ + +  +L      L  L    C       ++DL  G      C  LR L + 
Sbjct: 327  AGCPKITDSAM-EMLSAKCHYLHILDISGCVLLTDQILEDLQIG------CKQLRILKMQ 379

Query: 909  NCT 901
             CT
Sbjct: 380  YCT 382



>gb:BX908798_831482 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 761

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 101/360 (28%), Positives = 165/360 (45%), Gaps = 29/360 (8%)
 Frame = -3

Query: 1392 LQSLNISD---ISLAVIGHYG--VALTDLALINLQNINERGFWVMGSGQGLHKLRSLVIT 1228
            LQ LN+S    ++ A + H    +AL  L L     + +RG   +     L  L+ L ++
Sbjct: 371  LQHLNLSSCKKLTDAGLAHLTPLMALQHLDLSICNKLTDRGLTHLNP---LTALQYLNLS 427

Query: 1227 ACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQA 1048
             C  +T+ G+E +      ++ L L +C  L+D G+   +    +++ L L  C++++ A
Sbjct: 428  QCDNITNAGLEHLIP-LTALQYLNLSQCEKLTDAGL-EHLTPLTALQQLDLSWCYKLTDA 485

Query: 1047 GVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLS 868
            G F  L    G L+ L   +C  + D   G+  L P  +L+ L + NC    D  L  L+
Sbjct: 486  G-FAHLTPLTG-LQYLDLSHCNKLTDA--GLAHLTPLTALQYLDLSNCIKLTDDGLAHLT 541

Query: 867  RLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG--- 697
             L   L HLNLS    +TD G      S    L +++LS C N+TD  ++ +  L     
Sbjct: 542  PLMA-LQHLNLSSCYKLTDAGFAHL--SPLTALQRLDLSYCQNLTDAELAHLTPLTALQR 598

Query: 696  --------------------ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRV 580
                                  L+ LNL GCG +TDA LA +    S L+ LD+S   ++
Sbjct: 599  LDLRYCENLTDAGLVHLKLLTDLQYLNLRGCGYLTDAGLAHLTT-LSGLQHLDLSSCEKL 657

Query: 579  SDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
            +D G+  L     +   LQ L+LS C   +D+ L  L  L  +L  L ++ C+ ++  G+
Sbjct: 658  TDAGLVHL----KLLTDLQYLNLSRCENLTDEGLALLTPL-TALQHLKLRYCINLTDAGL 712



 Score = 84.0 bits (206), Expect = 7e-15
 Identities = 90/331 (27%), Positives = 152/331 (45%), Gaps = 48/331 (14%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVS----------KGCPN--------------VKQLCLRKCT 1141
            L++L + ACQ +TD G+E ++            C N              ++ L L  C 
Sbjct: 221  LKALHLEACQALTDDGLEHLTLLTALQHLNLSRCKNLTDAGLAHLTPLTGLQYLDLSHCN 280

Query: 1140 LLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAF 961
              +D G +++++   +++ L L  C +I+ AG+  +    A  L+ L+   C+ + D   
Sbjct: 281  KFTDAG-LAYLEILTALQHLDLRGCDKITDAGLSHLTPLVA--LQYLSLSQCWNLTDA-- 335

Query: 960  GVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGL-----LP 796
            G+  L P  +L+ L++  C    DA L  L+ L  +L HLNLS    +TD GL     L 
Sbjct: 336  GLIHLKPLTALQYLNLSRCNKLTDAGLEHLA-LLTSLQHLNLSSCKKLTDAGLAHLTPLM 394

Query: 795  FVQSCD------------------AGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLN 670
             +Q  D                    L  +NLS C N+T+  +  +  L    L+ LNL+
Sbjct: 395  ALQHLDLSICNKLTDRGLTHLNPLTALQYLNLSQCDNITNAGLEHLIPL--TALQYLNLS 452

Query: 669  GCGCVTDASLAAIADYCSVLRDLDISKS-RVSDFGIAALAGGSAIQFSLQILSLSGCVLA 493
             C  +TDA L  +    + L+ LD+S   +++D G A L   + +Q+    L LS C   
Sbjct: 453  QCEKLTDAGLEHLTP-LTALQQLDLSWCYKLTDAGFAHLTPLTGLQY----LDLSHCNKL 507

Query: 492  SDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
            +D  L +L  L  +L  L++ NC+ ++  G+
Sbjct: 508  TDAGLAHLTPL-TALQYLDLSNCIKLTDDGL 537



 Score = 84.0 bits (206), Expect = 7e-15
 Identities = 80/267 (29%), Positives = 124/267 (46%), Gaps = 1/267 (0%)
 Frame = -3

Query: 1185 KGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLK 1006
            K C N+K L L  C  L+D+G +  +    +++ L L  C  ++ AG    L H      
Sbjct: 216  KDCKNLKALHLEACQALTDDG-LEHLTLLTALQHLNLSRCKNLTDAG----LAH------ 264

Query: 1005 ALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGL 826
                               L P   L+ L + +C  F DA L  L  L   L HL+L G 
Sbjct: 265  -------------------LTPLTGLQYLDLSHCNKFTDAGLAYLEILTA-LQHLDLRGC 304

Query: 825  NGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDA 646
            + +TD GL          L  ++LS C N+TD  +  +  L    L+ LNL+ C  +TDA
Sbjct: 305  DKITDAGLSHLTPL--VALQYLSLSQCWNLTDAGLIHLKPL--TALQYLNLSRCNKLTDA 360

Query: 645  SLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYL 469
             L  +A   S L+ L++S   +++D G+A L        +LQ L LS C   +D+ L +L
Sbjct: 361  GLEHLALLTS-LQHLNLSSCKKLTDAGLAHLTP----LMALQHLDLSICNKLTDRGLTHL 415

Query: 468  HKLGNSLAGLNIQNCVGISHRGVDLLV 388
            + L  +L  LN+  C  I++ G++ L+
Sbjct: 416  NPL-TALQYLNLSQCDNITNAGLEHLI 441



 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 62/223 (27%), Positives = 104/223 (46%)
 Frame = -3

Query: 1338 VALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQL 1159
            +AL  L L +   + + GF  +     L  L+ L ++ CQ +TD  +  ++     +++L
Sbjct: 544  MALQHLNLSSCYKLTDAGFAHLSP---LTALQRLDLSYCQNLTDAELAHLTP-LTALQRL 599

Query: 1158 CLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFG 979
             LR C  L+D G+V  +K    ++ L L  C  ++ AG+  +   S   L+ L   +C  
Sbjct: 600  DLRYCENLTDAGLVH-LKLLTDLQYLNLRGCGYLTDAGLAHLTTLSG--LQHLDLSSCEK 656

Query: 978  MKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLL 799
            + D   G+  L     L+ L++  C    D  L +L+ L   L HL L     +TD GL 
Sbjct: 657  LTDA--GLVHLKLLTDLQYLNLSRCENLTDEGLALLTPLTA-LQHLKLRYCINLTDAGLA 713

Query: 798  PFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLN 670
                    GL +++LS C N+TD  +  +  L    L+ LNL+
Sbjct: 714  HLTPL--TGLQRLDLSQCWNLTDAGLIHLKLL--TALQHLNLS 752



>gb:BX908798_831575 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 959

 Score = 88.2 bits (217), Expect = 4e-16
 Identities = 89/317 (28%), Positives = 154/317 (48%), Gaps = 4/317 (1%)
 Frame = -3

Query: 1338 VALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQL 1159
            + L  L + +  N+ + G   +   + L  L+ L +++C+ +T +G+  ++    N+  L
Sbjct: 592  ITLQQLNISSCANLTDDG---LAHLKPLIALQQLNLSSCKKLTGVGLAHLTS-LVNLTHL 647

Query: 1158 CLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFG 979
             L +C  L+D G+        +++ L L  C+ ++ AG+  ++   A  L+ L    C  
Sbjct: 648  SLSECGNLTDAGLAHLAPLV-ALQQLDLNFCYNLTDAGLAHLITLVA--LQQLYLSACGN 704

Query: 978  MKDLAFGVPALPPCNSLRSLSICNC---TGFGDASLVVLSRLCPNLVHLNLSGLNGVTDY 808
            + D   G+  L P  +L+ L++  C   TG G A L  L+     L HL+LS    +TD 
Sbjct: 705  LTDA--GLAHLTPLVALQQLNLSGCKKLTGVGLAHLTSLA----TLTHLSLSACANLTDD 758

Query: 807  GLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIA 628
            GL          L  +NLS C N T   ++ +  L    L+ L+L+GC  +TDA LA + 
Sbjct: 759  GLAHLTTL--VALTYLNLSDCNNFTGAGLTHLKPL--VALQYLSLSGCKKLTDAGLAYLK 814

Query: 627  DYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNS 451
               + L+ L++    +++D G+  L    A    LQ LSLSGC   +D  L +L  L  +
Sbjct: 815  PLVA-LQQLNLRGCKKITDAGLTHLMSLVA----LQCLSLSGCKKLTDDGLAHLKPL-VA 868

Query: 450  LAGLNIQNCVGISHRGV 400
            L  L++  CV ++  G+
Sbjct: 869  LTHLSLGECVKLTDDGL 885



 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 93/325 (28%), Positives = 154/325 (47%), Gaps = 7/325 (2%)
 Frame = -3

Query: 1341 GVALTDLA-LINLQNINERGFWVMGSGQGLHKLRSLV------ITACQGVTDLGIEAVSK 1183
            G  L  L  LI L+++ + GF    +  GL  L+ LV      ++ C+ +TD G+  ++ 
Sbjct: 532  GAGLAHLTPLIALKHL-DLGFCYGLTDDGLAHLKPLVALQYLSLSGCKKLTDAGLAHLTS 590

Query: 1182 GCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKA 1003
                ++QL +  C  L+D+G+ + +K   +++ L L  C +++  G+  +   S   L  
Sbjct: 591  -LITLQQLNISSCANLTDDGL-AHLKPLIALQQLNLSSCKKLTGVGLAHLT--SLVNLTH 646

Query: 1002 LAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLN 823
            L+   C  + D   G+  L P  +L+ L +  C    DA L  L  L   L  L LS   
Sbjct: 647  LSLSECGNLTDA--GLAHLAPLVALQQLDLNFCYNLTDAGLAHLITLVA-LQQLYLSACG 703

Query: 822  GVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDAS 643
             +TD GL          L ++NLSGC  +T   ++ +  L   TL  L+L+ C  +TD  
Sbjct: 704  NLTDAGLAHLTPL--VALQQLNLSGCKKLTGVGLAHLTSL--ATLTHLSLSACANLTDDG 759

Query: 642  LAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK 463
            LA +    ++     ++ S  ++F  A L     +  +LQ LSLSGC   +D  L YL  
Sbjct: 760  LAHLTTLVALTY---LNLSDCNNFTGAGLTHLKPL-VALQYLSLSGCKKLTDAGLAYLKP 815

Query: 462  LGNSLAGLNIQNCVGISHRGVDLLV 388
            L  +L  LN++ C  I+  G+  L+
Sbjct: 816  L-VALQQLNLRGCKKITDAGLTHLM 839



 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 90/328 (27%), Positives = 154/328 (46%), Gaps = 1/328 (0%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLG 1201
            N++D+ LA +    + L  L L + +   + G   + S   L  L  L +  C  +TD G
Sbjct: 353  NLTDVGLAYLRPL-ITLQGLNLNSCKKFTDAGLAHLDS---LIDLTQLGLAKCHNITDNG 408

Query: 1200 IEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHS 1021
            + A  +    ++ L L  C  L+D G+V  +K+  ++  L L +C  ++ AG+  +    
Sbjct: 409  L-AYLRPLIALQGLNLNGCKKLTDAGLVH-LKSLVTLTYLNLSQCDDLTDAGLAHLTPLV 466

Query: 1020 AGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHL 841
            A +   L+F  C+ + D   G+  L P  +L++L +  C    D  L  L  L   L  L
Sbjct: 467  ALQHLDLSF-CCYNITDA--GLAHLTPLVALQNLDLSFCYKLTDDGLAHLKPLVA-LKQL 522

Query: 840  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCG 661
            NL   + +T  GL          L  ++L  C  +TD  ++ +  L    L+ L+L+GC 
Sbjct: 523  NLWACSNLTGAGLAHLTPLI--ALKHLDLGFCYGLTDDGLAHLKPL--VALQYLSLSGCK 578

Query: 660  CVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDK 484
             +TDA LA +    + L+ L+IS  + ++D G+A L        +LQ L+LS C   +  
Sbjct: 579  KLTDAGLAHLTSLIT-LQQLNISSCANLTDDGLAHLKP----LIALQQLNLSSCKKLTGV 633

Query: 483  CLPYLHKLGNSLAGLNIQNCVGISHRGV 400
             L +L  L N L  L++  C  ++  G+
Sbjct: 634  GLAHLTSLVN-LTHLSLSECGNLTDAGL 660



 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 69/238 (28%), Positives = 109/238 (45%), Gaps = 6/238 (2%)
 Frame = -3

Query: 1398 VKLQSLNISD------ISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSL 1237
            V LQ LN+S       + LA +      LT L+L    N+ + G   + +   L  L  L
Sbjct: 717  VALQQLNLSGCKKLTGVGLAHLTSLAT-LTHLSLSACANLTDDGLAHLTT---LVALTYL 772

Query: 1236 VITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRI 1057
             ++ C   T  G+  + K    ++ L L  C  L+D G+ +++K   +++ L L  C +I
Sbjct: 773  NLSDCNNFTGAGLTHL-KPLVALQYLSLSGCKKLTDAGL-AYLKPLVALQQLNLRGCKKI 830

Query: 1056 SQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLV 877
            + AG+  ++  S   L+ L+   C  + D   G+  L P  +L  LS+  C    D  L 
Sbjct: 831  TDAGLTHLM--SLVALQCLSLSGCKKLTD--DGLAHLKPLVALTHLSLGECVKLTDDGLA 886

Query: 876  VLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKL 703
             L+ L   L HLNLS  N +T  GL          L  V+L+ C N TD T++ +  L
Sbjct: 887  HLTPLLA-LTHLNLSDCNNLTVAGLAHLTPL--ENLTYVDLNNCNNFTDVTLTYLTSL 941



>gb:BX908798_831484 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 528

 Score = 88.2 bits (217), Expect = 4e-16
 Identities = 81/266 (30%), Positives = 130/266 (48%), Gaps = 1/266 (0%)
 Frame = -3

Query: 1194 AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG 1015
            +V K C N+K L    C +L+D G ++ +K   +++ L L  C+ ++  G+  +   +  
Sbjct: 213  SVLKECKNLKALHFEACQILTDAG-LAHLKPLTALQHLNLSGCYHLTDVGLAHLTFLTG- 270

Query: 1014 KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL 835
             L+ L    C+   D   G+  L    +L+ L++  C    DA L  L  L  +L HLNL
Sbjct: 271  -LQHLDLSQCWHFTD--DGLAHLTSLTALQYLALMGCKNLIDAGLAHLKPL-TSLQHLNL 326

Query: 834  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV 655
             G   +TD GL         GL  +NLS C N+TD  ++ +  L    L+ LNL+ C  +
Sbjct: 327  RGCGYLTDAGLAHLAPL--TGLQHLNLSKCENLTDVGLAHLRLL--VALQYLNLDNCRKL 382

Query: 654  TDASLAAIADYCSVLRDLDISKS-RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCL 478
            TD  LA +    + L+ LD+S+   ++D G+A L        SLQ L LS C   +D  L
Sbjct: 383  TDDGLAHLTPVTN-LQHLDLSQCWHLTDIGLAHLTPLK----SLQHLDLSRCENLTDDGL 437

Query: 477  PYLHKLGNSLAGLNIQNCVGISHRGV 400
             +L  L  +L  L++  C  ++  G+
Sbjct: 438  VHLTPL-TALQHLDLSYCYNLTDDGL 462



 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 75/237 (31%), Positives = 115/237 (48%), Gaps = 6/237 (2%)
 Frame = -3

Query: 1101 AESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRS 922
            ++ I+ L   E   ++ A  F +L      LKAL FE C  + D   G+  L P  +L+ 
Sbjct: 193  SDEIKKLNFSENTHLTDAH-FSVL-KECKNLKALHFEACQILTDA--GLAHLKPLTALQH 248

Query: 921  LSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCI 742
            L++  C    D  L  L+ L   L HL+LS     TD GL          L  + L GC 
Sbjct: 249  LNLSGCYHLTDVGLAHLTFLT-GLQHLDLSQCWHFTDDGLAHLTSL--TALQYLALMGCK 305

Query: 741  NVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGI 565
            N+ D  ++ +  L   +L+ LNL GCG +TDA LA +A     L+ L++SK   ++D G+
Sbjct: 306  NLIDAGLAHLKPL--TSLQHLNLRGCGYLTDAGLAHLAPLTG-LQHLNLSKCENLTDVGL 362

Query: 564  AALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC-----VGISH 409
            A L     +  +LQ L+L  C   +D  L +L  + N L  L++  C     +G++H
Sbjct: 363  AHL----RLLVALQYLNLDNCRKLTDDGLAHLTPVTN-LQHLDLSQCWHLTDIGLAH 414



 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 82/284 (28%), Positives = 133/284 (46%), Gaps = 7/284 (2%)
 Frame = -3

Query: 1392 LQSLNIS------DISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVI 1231
            LQ LN+S      D+ LA +  +   L  L L    +  + G   + S   L  L+ L +
Sbjct: 246  LQHLNLSGCYHLTDVGLAHLT-FLTGLQHLDLSQCWHFTDDGLAHLTS---LTALQYLAL 301

Query: 1230 TACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQ 1051
              C+ + D G+ A  K   +++ L LR C  L+D G+         ++ L L +C  ++ 
Sbjct: 302  MGCKNLIDAGL-AHLKPLTSLQHLNLRGCGYLTDAGLAHLAPLT-GLQHLNLSKCENLTD 359

Query: 1050 AGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVL 871
             G+  + +  A  L+ L  +NC  + D   G+  L P  +L+ L +  C    D  L  L
Sbjct: 360  VGLAHLRLLVA--LQYLNLDNCRKLTD--DGLAHLTPVTNLQHLDLSQCWHLTDIGLAHL 415

Query: 870  SRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGET 691
            + L  +L HL+LS    +TD GL+         L  ++LS C N+TD  ++ +  L   T
Sbjct: 416  TPL-KSLQHLDLSRCENLTDDGLVHLTPL--TALQHLDLSYCYNLTDDGLAHLTPL--TT 470

Query: 690  LELLNLNGCGCVTDASLAAIADYCSVLRDLD-ISKSRVSDFGIA 562
            L+ L+L GC  +TD  LA +    + L+ LD I     +D G+A
Sbjct: 471  LQHLDLMGCKNLTDDGLAHLTPLIA-LQYLDLIGCKNFTDDGLA 513



>pir|T48193|T48193 hypothetical protein F7A7.240 - Arabidopsis
            thaliana>gb:ATF7A7_1550924 Arabidopsis thaliana DNA
            chromosome 5, BAC clone F7A7 (ESSA project).
          Length = 618

 Score = 88.2 bits (217), Expect = 4e-16
 Identities = 78/292 (26%), Positives = 133/292 (45%), Gaps = 6/292 (2%)
 Frame = -3

Query: 1410 HLMKVKLQS-LNISDISLAVIGHYGVALT----DLALINLQNINERGFWVMGSGQGLHKL 1246
            HL ++ L+    + D SL  + H   +L      L   + QN+  RG   + SG G   L
Sbjct: 227  HLEELLLEGCFGVDDDSLKSLRHDCKSLKMYKQKLDASSCQNLTHRGLTSLLSGAGY--L 284

Query: 1245 RSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEEC 1066
            + L ++ C  V  L   +  K    ++ + L  C++  D G+ +      S++ + L +C
Sbjct: 285  QRLDLSHCSSVISLDFASSLKKVSALQSIRLDGCSVTPD-GLKAIGTLCNSLKEVSLSKC 343

Query: 1065 HRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDA 886
              ++    F ++      L+ L   +     +   G+ ++  C SL SL +  C    D 
Sbjct: 344  VSVTDEEAFWLIGQKCRLLEELDLTDNEIDDE---GLKSISSCLSLSSLKLGICLNITDK 400

Query: 885  SLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAK 706
             L  +   C NL  L+L    G+TD G+    Q C   L  +N+S C ++TDK++ +++K
Sbjct: 401  GLSYIGMGCSNLRELDLYRSVGITDVGISTIAQGC-IHLETINISYCQDITDKSLVSLSK 459

Query: 705  LHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALA 553
                 L+     GC  +T   LAAIA  C  L  +D+ K   ++D G+ ALA
Sbjct: 460  C--SLLQTFESRGCPNITSQGLAAIAVRCKRLAKVDLKKCPSINDAGLLALA 509



 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 89/356 (25%), Positives = 157/356 (44%), Gaps = 8/356 (2%)
 Frame = -3

Query: 1428 FSSAGNHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHK 1249
            FS+AG  L+++ L+ +N+ +I L+               N   + +    V+   + L +
Sbjct: 112  FSAAG--LLRLALKCVNLVEIDLS---------------NATEMRDADAAVVAEARSLER 154

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            L+   +  C+ +TD+GI  ++ GC  +  + L+ C  + D GV       + I +L L  
Sbjct: 155  LK---LGRCKMLTDMGIGCIAVGCKKLNTVSLKWCVGVGDLGVGLLAVKCKDIRTLDL-- 209

Query: 1068 CHRISQAGVFGILVHSAGK---LKALAFENCFGMKDLAFGVPALPPCNSLR----SLSIC 910
                S   + G  +H   K   L+ L  E CFG+ D +        C SL+     L   
Sbjct: 210  ----SYLPITGKCLHDILKLQHLEELLLEGCFGVDDDSL-KSLRHDCKSLKMYKQKLDAS 264

Query: 909  NCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTD 730
            +C       L  L      L  L+LS  + V        ++   A L  + L GC +VT 
Sbjct: 265  SCQNLTHRGLTSLLSGAGYLQRLDLSHCSSVISLDFASSLKKVSA-LQSIRLDGC-SVTP 322

Query: 729  KTISAIAKLHGETLELLNLNGCGCVTD-ASLAAIADYCSVLRDLDISKSRVSDFGIAALA 553
              + AI  L   +L+ ++L+ C  VTD  +   I   C +L +LD++ + + D G+ +++
Sbjct: 323  DGLKAIGTL-CNSLKEVSLSKCVSVTDEEAFWLIGQKCRLLEELDLTDNEIDDEGLKSIS 381

Query: 552  GGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVE 385
                   SL  L L  C+  +DK L Y+    ++L  L++   VGI+  G+  + +
Sbjct: 382  S----CLSLSSLKLGICLNITDKGLSYIGMGCSNLRELDLYRSVGITDVGISTIAQ 433



 Score = 67.4 bits (163), Expect = 7e-10
 Identities = 54/244 (22%), Positives = 101/244 (41%), Gaps = 24/244 (9%)
 Frame = -3

Query: 1407 LMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNI-NERGFWVMGS------------ 1267
            L  ++L   +++   L  IG    +L +++L    ++ +E  FW++G             
Sbjct: 310  LQSIRLDGCSVTPDGLKAIGTLCNSLKEVSLSKCVSVTDEEAFWLIGQKCRLLEELDLTD 369

Query: 1266 ----GQGLHK------LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVV 1117
                 +GL        L SL +  C  +TD G+  +  GC N+++L L +   ++D G+ 
Sbjct: 370  NEIDDEGLKSISSCLSLSSLKLGICLNITDKGLSYIGMGCSNLRELDLYRSVGITDVGIS 429

Query: 1116 SFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPC 937
            +  +    +E++ +  C  I+   +  + +     L+      C  +        A+  C
Sbjct: 430  TIAQGCIHLETINISYCQDITDKSL--VSLSKCSLLQTFESRGCPNITSQGLAAIAV-RC 486

Query: 936  NSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQ-SCDAGLVKV 760
              L  + +  C    DA L+ L+    NL  +N+S    VT+ GLL      C   +  V
Sbjct: 487  KRLAKVDLKKCPSINDAGLLALAHFSQNLKQINVSD-TAVTEVGLLSLANIGCLQNIAVV 545

Query: 759  NLSG 748
            N SG
Sbjct: 546  NSSG 549



 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 56/204 (27%), Positives = 87/204 (42%), Gaps = 4/204 (1%)
 Frame = -3

Query: 987 CFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDY 808
           C  + D A  V       +LRSL +     F  A L+ L+  C NLV ++LS    + D 
Sbjct: 82  CPRVTDYALSVVGCLSGPTLRSLDLSRSGSFSAAGLLRLALKCVNLVEIDLSNATEMRDA 141

Query: 807 GLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIA 628
                 ++    L ++ L  C  +TD  I  IA +  + L  ++L  C  V D  +  +A
Sbjct: 142 DAAVVAEA--RSLERLKLGRCKMLTDMGIGCIA-VGCKKLNTVSLKWCVGVGDLGVGLLA 198

Query: 627 DYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSL 448
             C  +R LD+S   ++      L     +Q  L+ L L GC    D  L  L     SL
Sbjct: 199 VKCKDIRTLDLSYLPITG---KCLHDILKLQ-HLEELLLEGCFGVDDDSLKSLRHDCKSL 254

Query: 447 ----AGLNIQNCVGISHRGVDLLV 388
                 L+  +C  ++HRG+  L+
Sbjct: 255 KMYKQKLDASSCQNLTHRGLTSLL 278



>gb:BX908798_830828 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 618

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 98/339 (28%), Positives = 155/339 (45%), Gaps = 5/339 (1%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQG----LHKLRSLVITACQGV 1213
            N++D  LA +           L  LQ++N  G     +G      L  L+ L ++ C+ +
Sbjct: 263  NLTDAGLAYL---------TPLTTLQHLNLAGCKFANAGLAHLTPLVALQHLNLSHCRNL 313

Query: 1212 TDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGI 1033
            TD G+  ++     +  L L  C  ++D G+        ++  L L  C+ ++ AG+  +
Sbjct: 314  TDAGLPHLTL-LTALTYLNLSHCRNITDAGLAHLTPLT-ALTYLNLSSCNNLTDAGLAHL 371

Query: 1032 LVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPN 853
               +A  L  L   +C  + D   G+  L P  +L  L++  C  F DA L  L+ L   
Sbjct: 372  TPLTA--LTYLNLSSCNNLTDA--GLAHLTPLVTLTHLNLSWCYNFTDAGLAHLTPLVA- 426

Query: 852  LVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNL 673
            L HL+L     +TD GL          L  +NLS C N TD  ++ +A L    L+ L+L
Sbjct: 427  LQHLDLGHCRNITDAGLAHLTPL--VALTHLNLSWCYNFTDAGLAHLAPL--VALQHLDL 482

Query: 672  NGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVL 496
            NGC  +TDA LA +A   + L  LD+S  + ++D G+  L        +LQ L LS C  
Sbjct: 483  NGCWQLTDAGLAHLAPLVA-LTHLDLSSCNHLTDAGLPHLTP----LVALQHLDLSYCRN 537

Query: 495  ASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVERL 379
             +D  L +L  L  +L  LN+ +C   +  G+  L   L
Sbjct: 538  LTDAGLAHLAPL-VALTHLNLSSCNHFTDAGLTHLTPLL 575



 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 86/286 (30%), Positives = 142/286 (49%), Gaps = 1/286 (0%)
 Frame = -3

Query: 1254 HKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQL 1075
            +++  L  +    +TD  + A+ K C N+K L L++C  L+D G ++++    +++ L L
Sbjct: 226  NEIEELNFSKNASLTDAHLLAL-KNCKNLKVLHLQECRNLTDAG-LAYLTPLTTLQHLNL 283

Query: 1074 EECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGF 895
              C + + AG+  +    A  L+ L   +C  + D   G+P L    +L  L++ +C   
Sbjct: 284  AGC-KFANAGLAHLTPLVA--LQHLNLSHCRNLTDA--GLPHLTLLTALTYLNLSHCRNI 338

Query: 894  GDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISA 715
             DA L  L+ L   L +LNLS  N +TD GL          L  +NLS C N+TD  ++ 
Sbjct: 339  TDAGLAHLTPLTA-LTYLNLSSCNNLTDAGLAHLTPL--TALTYLNLSSCNNLTDAGLAH 395

Query: 714  IAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAI 538
            +  L   TL  LNL+ C   TDA LA +    + L+ LD+   R ++D G+A L      
Sbjct: 396  LTPL--VTLTHLNLSWCYNFTDAGLAHLTPLVA-LQHLDLGHCRNITDAGLAHLTP---- 448

Query: 537  QFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
              +L  L+LS C   +D  L +L  L  +L  L++  C  ++  G+
Sbjct: 449  LVALTHLNLSWCYNFTDAGLAHLAPL-VALQHLDLNGCWQLTDAGL 493



 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 73/250 (29%), Positives = 109/250 (43%), Gaps = 2/250 (0%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLG 1201
            N++D  LA +      LT L  +NL + N      +     L  L  L ++ C   TD G
Sbjct: 362  NLTDAGLAHL----TPLTALTYLNLSSCNNLTDAGLAHLTPLVTLTHLNLSWCYNFTDAG 417

Query: 1200 IEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHS 1021
            +  ++     ++ L L  C  ++D G+        ++  L L  C+  + AG    L H 
Sbjct: 418  LAHLTP-LVALQHLDLGHCRNITDAGLAHLTPLV-ALTHLNLSWCYNFTDAG----LAHL 471

Query: 1020 AG--KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLV 847
            A    L+ L    C+ + D   G+  L P  +L  L + +C    DA L  L+ L   L 
Sbjct: 472  APLVALQHLDLNGCWQLTDA--GLAHLAPLVALTHLDLSSCNHLTDAGLPHLTPLVA-LQ 528

Query: 846  HLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNG 667
            HL+LS    +TD GL          L  +NLS C + TD  ++ +  L    L+ LNLN 
Sbjct: 529  HLDLSYCRNLTDAGLAHLAPL--VALTHLNLSSCNHFTDAGLTHLTPLLA--LQDLNLNY 584

Query: 666  CGCVTDASLA 637
            C   TDA LA
Sbjct: 585  CENFTDAGLA 594



>gb:AC114261_1205586 Dictyostelium discoideum chromosome 2 map
            126059-159710 strain AX4, complete sequence.
          Length = 2159

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 75/320 (23%), Positives = 148/320 (46%), Gaps = 8/320 (2%)
 Frame = -3

Query: 1383 LNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDL 1204
            + I+D S+  I +    L  L L    +I++    V+   Q L  L+++ +T C  ++D 
Sbjct: 1850 ITINDTSILTITNQSPLLETLILAMCTDISDES--VITIAQRLKNLKNIDLTKCTQISDR 1907

Query: 1203 GIEAVSKGC-PNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILV 1027
            G+  ++K C  N+ +L L  CT ++D  ++       S+  L L +C +I+   +  +  
Sbjct: 1908 GVIEIAKQCKQNLNRLILVSCTQVTDASIIEVANQCSSLIHLDLSQCEKITDQSLLKV-S 1966

Query: 1026 HSAGKLKALAFENCFGMKDLAFGVPALPP------CNSLRSLSICNCTGFGDASLVVLSR 865
                +L+ L  E C  + D+  GV +L        C  L  +    C    D+SL+ L+ 
Sbjct: 1967 QGLRQLRILCMEECI-ITDV--GVSSLGEISEGYGCQYLEVIKFGYCRFISDSSLIKLAF 2023

Query: 864  LCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLE 685
             CP + +L+LS  + +     +         L  + L G  ++T+++I     L    L+
Sbjct: 2024 GCPFVSNLDLSQCSNLITPRAIRSAIKAWPRLHTLRLRGYQSLTNESIVESTPL---KLK 2080

Query: 684  LLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLS 508
             +NL+ C  + D++L      C+ +  LDISK  +++D  + ++        S++++++ 
Sbjct: 2081 TVNLSWCANMEDSALIGFLKQCTAIETLDISKCPKITDNSLESILDSCP---SIRVINVY 2137

Query: 507  GCVLASDKCLPYLHKLGNSL 448
            GC   S   +  L  LG ++
Sbjct: 2138 GCKEISSFTVQKLSSLGKAI 2157



 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 89/421 (21%), Positives = 167/421 (39%), Gaps = 75/421 (17%)
 Frame = -3

Query: 1422 SAGNHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLR 1243
            S   +L+ +KL    I+D SL  I     +LT+L L+  +NI ++G  ++  G+   KL 
Sbjct: 1711 STSRNLLSIKLSGKGITDQSLKKISENCQSLTNLDLVLCENITDQGVQLL--GKNCLKLS 1768

Query: 1242 SLVITACQGVTDLGIEAVSKGCPN------------------------------------ 1171
            S+ + + + +T    +       N                                    
Sbjct: 1769 SINLFSSKNLTSSVFDETINNNNNNNNNVNNNNNNNNIVNNNNNNNNNLNNNNNNNNNNM 1828

Query: 1170 ------------VKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILV 1027
                        +  L L +C  ++D  +++    +  +E+L L  C  IS   V  I  
Sbjct: 1829 IINIFNQQSWSSLTSLNLNRCITINDTSILTITNQSPLLETLILAMCTDISDESVITI-A 1887

Query: 1026 HSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLV 847
                 LK +    C  + D      A     +L  L + +CT   DAS++ ++  C +L+
Sbjct: 1888 QRLKNLKNIDLTKCTQISDRGVIEIAKQCKQNLNRLILVSCTQVTDASIIEVANQCSSLI 1947

Query: 846  HLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG----ETLELL 679
            HL+LS    +TD  LL   Q     L  + +  CI +TD  +S++ ++      + LE++
Sbjct: 1948 HLDLSQCEKITDQSLLKVSQGL-RQLRILCMEECI-ITDVGVSSLGEISEGYGCQYLEVI 2005

Query: 678  NLNGCGCVTDASLAAIADYCSVLRDLDIS-----------KSRVSDF---------GIAA 559
                C  ++D+SL  +A  C  + +LD+S           +S +  +         G  +
Sbjct: 2006 KFGYCRFISDSSLIKLAFGCPFVSNLDLSQCSNLITPRAIRSAIKAWPRLHTLRLRGYQS 2065

Query: 558  LAGGSAIQ---FSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLV 388
            L   S ++     L+ ++LS C    D  L    K   ++  L+I  C  I+   ++ ++
Sbjct: 2066 LTNESIVESTPLKLKTVNLSWCANMEDSALIGFLKQCTAIETLDISKCPKITDNSLESIL 2125

Query: 387  E 385
            +
Sbjct: 2126 D 2126



 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 47/199 (23%), Positives = 94/199 (47%)
 Frame = -3

Query: 1266 GQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIE 1087
            G    +L+ L +  C  +    + ++S  C N++ + L+ C  LS+ G+VS  +   ++ 
Sbjct: 1582 GSTCSQLKKLSLANCINIPSDALNSISMSCKNLEVIILKGCYQLSNPGIVSLARGCPNLY 1641

Query: 1086 SLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICN 907
             + L  C +I+   +  +L  +  +L  L    C  + D AF    +    +L ++ +  
Sbjct: 1642 VVDLSGCMKITDFAIHELL-QNCKQLHTLDLRKCVNLTDGAFQSFNI---TTLANIDLLE 1697

Query: 906  CTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDK 727
            C    D ++  +     NL+ + LSG  G+TD  L    ++C + L  ++L  C N+TD+
Sbjct: 1698 CNYISDQTIFNICSTSRNLLSIKLSG-KGITDQSLKKISENCQS-LTNLDLVLCENITDQ 1755

Query: 726  TISAIAKLHGETLELLNLN 670
             +  + K     L+L ++N
Sbjct: 1756 GVQLLGK---NCLKLSSIN 1771



 Score = 55.1 bits (131), Expect = 4e-06
 Identities = 62/286 (21%), Positives = 112/286 (39%), Gaps = 21/286 (7%)
 Frame = -3

Query: 1278 VMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAA 1099
            ++   +G   L  + ++ C  +TD  I  + + C  +  L LRKC  L+D    SF    
Sbjct: 1630 IVSLARGCPNLYVVDLSGCMKITDFAIHELLQNCKQLHTLDLRKCVNLTDGAFQSF--NI 1687

Query: 1098 ESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSL 919
             ++ ++ L EC+ IS   +F I   S   L         G+ D +        C SL +L
Sbjct: 1688 TTLANIDLLECNYISDQTIFNICSTSRNLLSIKLSGK--GITDQSL-KKISENCQSLTNL 1744

Query: 918  SICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVT--------------------DYGLL 799
             +  C    D  + +L + C  L  +NL     +T                    +    
Sbjct: 1745 DLVLCENITDQGVQLLGKNCLKLSSINLFSSKNLTSSVFDETINNNNNNNNNVNNNNNNN 1804

Query: 798  PFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYC 619
              V + +     +N +   N  +  I+   +    +L  LNLN C  + D S+  I +  
Sbjct: 1805 NIVNNNNNNNNNLNNNNNNNNNNMIINIFNQQSWSSLTSLNLNRCITINDTSILTITNQS 1864

Query: 618  SVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDK 484
             +L  L ++  + +SD  +  +A       +L+ + L+ C   SD+
Sbjct: 1865 PLLETLILAMCTDISDESVITIAQRLK---NLKNIDLTKCTQISDR 1907



 Score = 45.1 bits (105), Expect = 0.004
 Identities = 46/204 (22%), Positives = 78/204 (38%), Gaps = 21/204 (10%)
 Frame = -3

Query: 939  CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKV 760
            C+ L+ LS+ NC      +L  +S  C NL  + L G   +++ G++   + C       
Sbjct: 1585 CSQLKKLSLANCINIPSDALNSISMSCKNLEVIILKGCYQLSNPGIVSLARGCP------ 1638

Query: 759  NLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK--- 589
                                   L +++L+GC  +TD ++  +   C  L  LD+ K   
Sbjct: 1639 ----------------------NLYVVDLSGCMKITDFAIHELLQNCKQLHTLDLRKCVN 1676

Query: 588  ---SRVSDFGIAALAGGSAI-------QFSLQILSLSGCVLA--------SDKCLPYLHK 463
                    F I  LA    +       Q    I S S  +L+        +D+ L  + +
Sbjct: 1677 LTDGAFQSFNITTLANIDLLECNYISDQTIFNICSTSRNLLSIKLSGKGITDQSLKKISE 1736

Query: 462  LGNSLAGLNIQNCVGISHRGVDLL 391
               SL  L++  C  I+ +GV LL
Sbjct: 1737 NCQSLTNLDLVLCENITDQGVQLL 1760



>gb:HSM800297_2017131 Homo sapiens mRNA; cDNA DKFZp564P0622 (from
            clone DKFZp564P0622); partial cds.
          Length = 250

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 70/266 (26%), Positives = 109/266 (40%)
 Frame = -3

Query: 1197 EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSA 1018
            EA+ +GC  +K L LR CT L D  +         + SL L+ C RI+  GV  I     
Sbjct: 2    EALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQI----- 56

Query: 1017 GKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN 838
                      C G             C+ L++L +  C+   DASL  L   CP L  L 
Sbjct: 57   ----------CRG-------------CHRLQALCLSGCSNLTDASLTALGLNCPRLQILE 93

Query: 837  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGC 658
             +  + +TD G     ++C   L K++L  CI +TD T+  ++ +H   L+ L+L  C  
Sbjct: 94   AARCSHLTDAGFTLLARNCHE-LEKMDLEECILITDSTLIQLS-IHCPKLQALSLPHCEL 151

Query: 657  VTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCL 478
            +TD                          GI  L+  +     L++L L  C+L +D  L
Sbjct: 152  ITDD-------------------------GILHLSNSTCGHERLRVLELDNCLLITDVAL 186

Query: 477  PYLHKLGNSLAGLNIQNCVGISHRGV 400
             +L      L  L + +C  ++  G+
Sbjct: 187  EHLENC-RGLERLELYDCQQVTRAGI 211



 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 54/194 (27%), Positives = 90/194 (46%), Gaps = 2/194 (1%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGI 1198
            + D +L  I +Y   L  L L +   I + G  V+   +G H+L++L ++ C  +TD  +
Sbjct: 22   LEDEALKHIQNYCHELVSLNLQSCSRITDEG--VVQICRGCHRLQALCLSGCSNLTDASL 79

Query: 1197 EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSA 1018
             A+   CP ++ L   +C+ L+D G     +    +E + LEEC  I+ + +  + +H  
Sbjct: 80   TALGLNCPRLQILEAARCSHLTDAGFTLLARNCHELEKMDLEECILITDSTLIQLSIH-C 138

Query: 1017 GKLKALAFENCFGMKDLAFGVPALPPC--NSLRSLSICNCTGFGDASLVVLSRLCPNLVH 844
             KL+AL+  +C  + D      +   C    LR L + NC    D +L  L   C  L  
Sbjct: 139  PKLQALSLPHCELITDDGILHLSNSTCGHERLRVLELDNCLLITDVALEHLEN-CRGLER 197

Query: 843  LNLSGLNGVTDYGL 802
            L L     VT  G+
Sbjct: 198  LELYDCQQVTRAGI 211



>gb:AY054560_1563214 Arabidopsis thaliana putative protein (At3g58530;
            F14P22.120) mRNA, complete cds.>gb:AY064636_1566087
            Arabidopsis thaliana putative protein (At3g58530;
            F14P22.120) mRNA, complete cds.
          Length = 353

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 83/317 (26%), Positives = 139/317 (43%), Gaps = 7/317 (2%)
 Frame = -3

Query: 1314 INLQNINERGFWVMG--SGQGLHKLRSLVITACQGVTDLGIEAVSKGCPN----VKQLCL 1153
            INL+ +   G  ++   S     +++ + +   QGV D  ++ V   CP+    ++ L L
Sbjct: 59   INLREMTNAGDRLLAALSLPRYRQVKHINLEFAQGVVDSHLKLVKTECPDALLSLEWLNL 118

Query: 1152 RKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMK 973
              C  +SDNG+ +       ++   +    R++ AG+   LV +   +  L    C  + 
Sbjct: 119  NVCQKISDNGIEAITSICPKLKVFSIYWNVRVTDAGIRN-LVKNCRHITDLNLSGCKSLT 177

Query: 972  DLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPF 793
            D +  + A      L SL+I  C    D  L+ + + C +L  LNL  L+G TD   +  
Sbjct: 178  DKSMQLVA-ESYPDLESLNITRCVKITDDGLLQVLQKCFSLQTLNLYALSGFTDKAYMKI 236

Query: 792  VQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSV 613
              S  A L  +++ G  N++D+ I  IAK +   L  LNL  C  +TDA +  IA+ C+ 
Sbjct: 237  --SLLADLRFLDICGAQNISDEGIGHIAKCN--KLGSLNLTWCVRITDAGVNTIANSCT- 291

Query: 612  LRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHK-LGNSLAGLN 436
                                       SL+ LSL G V  +D+CL  L +    +L  L+
Sbjct: 292  ---------------------------SLEFLSLFGIVGVTDRCLETLSQTCSTTLTTLD 324

Query: 435  IQNCVGISHRGVDLLVE 385
            +  C GI  R  + L++
Sbjct: 325  VNGCTGIKRRSREELLQ 341



 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 53/187 (28%), Positives = 76/187 (40%), Gaps = 2/187 (1%)
 Frame = -3

Query: 924 SLSICNCTGFGDASLVVLSRLCPNLV-HLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSG 748
           ++++   T  GD  L  LS      V H+NL    GV D  L      C   L+      
Sbjct: 58  TINLREMTNAGDRLLAALSLPRYRQVKHINLEFAQGVVDSHLKLVKTECPDALL------ 111

Query: 747 CINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKS-RVSDF 571
                             +LE LNLN C  ++D  + AI   C  L+   I  + RV+D 
Sbjct: 112 ------------------SLEWLNLNVCQKISDNGIEAITSICPKLKVFSIYWNVRVTDA 153

Query: 570 GIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
           GI  L         +  L+LSGC   +DK +  + +    L  LNI  CV I+  G   L
Sbjct: 154 GIRNLVKNCR---HITDLNLSGCKSLTDKSMQLVAESYPDLESLNITRCVKITDDG---L 207

Query: 390 VERLWRC 370
           ++ L +C
Sbjct: 208 LQVLQKC 214



>gb:AE016959_1020937 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC091665_1734853 Oryza sativa
            chromosome 10 clone OSJNBb0016M10, complete
            sequence.>gb:AE017056_1750756 Oryza sativa (japonica
            cultivar-group) chromosome 10, section 10 of 77 of the
            complete sequence.
          Length = 628

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 90/342 (26%), Positives = 147/342 (42%), Gaps = 32/342 (9%)
 Frame = -3

Query: 1410 HLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRS--L 1237
            +L  +K+  L + D +L  IG    AL +L+L NL   ++       S +   KL     
Sbjct: 284  YLKSLKMVWLGVGDEALEAIGSSCSALENLSLDNLNKCSDSSHKPARSTKSKKKLDGGRQ 343

Query: 1236 VITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRI 1057
            V+     + D  IE VS+ C  ++ + +  C ++    +    +   ++  L L      
Sbjct: 344  VVGNEGNLADRSIERVSQNCKMLQHMEINMCHIMESAALEHIGQRCINLLGLTLNSLWID 403

Query: 1056 SQAGV-FGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASL 880
            + A + FG        LK++   NC  + D A    A   C +LR LSI +C   GD +L
Sbjct: 404  NNAFLGFG---RCCFLLKSVCLANCCKISDEAISHIA-QGCKNLRELSIISCPQIGDEAL 459

Query: 879  VVLSRLCPNLVHLNLSGL-------------------------NGVTDYGLLPFVQSCDA 775
            + +   C  L  L L GL                         N +TDYGL   ++ C  
Sbjct: 460  LSVGENCKELRELTLHGLGRLNDTGLATVDQCRFLERLDICGCNQITDYGLTTIIRECH- 518

Query: 774  GLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI 595
             LV +N+S    + D T++ + +   +   L+ L  C  ++D  L  IA  C  L    +
Sbjct: 519  DLVHLNISDTKKIGDTTLAKVGEGFRKLKHLMMLR-CDAISDVGLEDIARGCLQLEACGV 577

Query: 594  SK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVL---ASDKC 481
             + S+V+  G+AALAGGS+    LQ + +  C +   A+ KC
Sbjct: 578  FRCSQVTPAGVAALAGGSS---RLQRIIVEKCKVPEEATGKC 616



 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 51/183 (27%), Positives = 89/183 (48%), Gaps = 5/183 (2%)
 Frame = -3

Query: 939 CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKV 760
           C  L  L++       +  LV ++  C NL  L LSG   V ++GL+   + C+  L ++
Sbjct: 152 CKGLEKLTLNWFLHISEKGLVGIANRCRNLQSLALSG-GYVQNHGLITLAEGCN--LSEL 208

Query: 759 NLSGCINVTDKTISAIAKLHGETLELLNLNGC-GCVTDASLAAIADYCSVLRDLDISKSR 583
            L G   +TD+ +    K+  ++L  L+++ C GC+T  SL AI  YC  L  L +    
Sbjct: 209 KLCGVQELTDEGLVEFVKIRSKSLVSLDISFCNGCITYRSLYAIGTYCHNLEVLSVESKH 268

Query: 582 VSD-FGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQN---CVGI 415
           V++  G+ ++A G     SL+++ L       D+ L  +    ++L  L++ N   C   
Sbjct: 269 VNENKGMISVAKGCQYLKSLKMVWLG----VGDEALEAIGSSCSALENLSLDNLNKCSDS 324

Query: 414 SHR 406
           SH+
Sbjct: 325 SHK 327



>pir|T08680|T08680 hypothetical protein DKFZp564P0622.1 - human
            (fragment)
          Length = 250

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 70/266 (26%), Positives = 109/266 (40%)
 Frame = -3

Query: 1197 EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSA 1018
            EA+ +GC  +K L LR CT L D  +         + SL L+ C RI+  GV  I     
Sbjct: 2    EALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQI----- 56

Query: 1017 GKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN 838
                      C G             C+ L++L +  C+   DASL  L   CP L  L 
Sbjct: 57   ----------CRG-------------CHRLQALCLSGCSNLTDASLTALGLNCPRLQILE 93

Query: 837  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGC 658
             +  + +TD G     ++C   L K++L  CI +TD T+  ++ +H   L+ L+L  C  
Sbjct: 94   AARCSHLTDAGFTLLARNCHE-LEKMDLEECILITDSTLIQLS-IHCPKLQALSLPHCEL 151

Query: 657  VTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCL 478
            +TD                          GI  L+  +     L++L L  C+L +D  L
Sbjct: 152  ITDD-------------------------GILHLSNSTCGHERLRVLELDNCLLITDVAL 186

Query: 477  PYLHKLGNSLAGLNIQNCVGISHRGV 400
             +L      L  L + +C  ++  G+
Sbjct: 187  EHLENC-RGLERLELYDCQQVTRAGI 211



 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 54/194 (27%), Positives = 90/194 (46%), Gaps = 2/194 (1%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGI 1198
            + D +L  I +Y   L  L L +   I + G  V+   +G H+L++L ++ C  +TD  +
Sbjct: 22   LEDEALKHIQNYCHELVSLNLQSCSRITDEG--VVQICRGCHRLQALCLSGCSNLTDASL 79

Query: 1197 EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSA 1018
             A+   CP ++ L   +C+ L+D G     +    +E + LEEC  I+ + +  + +H  
Sbjct: 80   TALGLNCPRLQILEAARCSHLTDAGFTLLARNCHELEKMDLEECILITDSTLIQLSIH-C 138

Query: 1017 GKLKALAFENCFGMKDLAFGVPALPPC--NSLRSLSICNCTGFGDASLVVLSRLCPNLVH 844
             KL+AL+  +C  + D      +   C    LR L + NC    D +L  L   C  L  
Sbjct: 139  PKLQALSLPHCELITDDGILHLSNSTCGHERLRVLELDNCLLITDVALEHLEN-CRGLER 197

Query: 843  LNLSGLNGVTDYGL 802
            L L     VT  G+
Sbjct: 198  LELYDCQQVTRAGI 211



>gb:BX908798_829892 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 602

 Score = 85.5 bits (210), Expect = 3e-15
 Identities = 83/267 (31%), Positives = 130/267 (48%), Gaps = 6/267 (2%)
 Frame = -3

Query: 1191 VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK 1012
            V K C N+K+L L++C  L+D G+        +++ L L EC+ ++ AG+  +    A  
Sbjct: 303  VLKNCKNLKELYLQRCHNLTDAGLAHLAPLL-ALQHLDLSECNNLTDAGLAHLTPLMA-- 359

Query: 1011 LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS 832
            L+ L    C  + D   G+  L P  +L+ L +  C    DA L  L+ L   L HL LS
Sbjct: 360  LQHLNLSYCKNLTDA--GLAHLTPLVALQYLDLSGCDNLTDAGLAHLTPLMA-LQHLGLS 416

Query: 831  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT 652
              + +TD GL          L  ++L+GC  +TD  ++ +  L    L  LNL+ C  +T
Sbjct: 417  ACDKLTDAGLAHLTPL--VALQYLSLNGCDKLTDVGLAHLTPL--VALTHLNLSWCDKLT 472

Query: 651  DASLAAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLP 475
            DA LA +    + L+ L++   R ++D G+A L        +LQ L L+ C   +D  L 
Sbjct: 473  DAGLAHLTPLVA-LQHLNLRWCRKLTDAGLAHLTP----LVALQHLDLNRCPKLTDAGLA 527

Query: 474  YLHKLGNSLAGLNIQNC-----VGISH 409
            +L  L N L  LN+  C     VG++H
Sbjct: 528  HLTSLVN-LRHLNLSYCRKLTDVGLAH 553



 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 78/256 (30%), Positives = 121/256 (47%), Gaps = 5/256 (1%)
 Frame = -3

Query: 1392 LQSLNIS---DISLAVIGHYG--VALTDLALINLQNINERGFWVMGSGQGLHKLRSLVIT 1228
            LQ LN+S   +++ A + H    VAL  L L    N+ + G   +     L  L+ L ++
Sbjct: 360  LQHLNLSYCKNLTDAGLAHLTPLVALQYLDLSGCDNLTDAG---LAHLTPLMALQHLGLS 416

Query: 1227 ACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQA 1048
            AC  +TD G+  ++     ++ L L  C  L+D G+        ++  L L  C +++ A
Sbjct: 417  ACDKLTDAGLAHLTP-LVALQYLSLNGCDKLTDVGLAHLTPLV-ALTHLNLSWCDKLTDA 474

Query: 1047 GVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLS 868
            G+  +    A  L+ L    C  + D   G+  L P  +L+ L +  C    DA L  L+
Sbjct: 475  GLAHLTPLVA--LQHLNLRWCRKLTDA--GLAHLTPLVALQHLDLNRCPKLTDAGLAHLT 530

Query: 867  RLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETL 688
             L  NL HLNLS    +TD GL          L  +NLS C  +TD  ++ +A L    L
Sbjct: 531  SLV-NLRHLNLSYCRKLTDVGLAHLTPL--VALQHLNLSCCRKLTDAGLAHLASLLA--L 585

Query: 687  ELLNLNGCGCVTDASL 640
            + L+L+GC  +TDA L
Sbjct: 586  QHLDLSGCDKLTDAVL 601



 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 81/286 (28%), Positives = 131/286 (45%), Gaps = 23/286 (8%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLG 1201
            N++D  LA +    +AL  L L    N+ + G   +     L  L+ L ++ C+ +TD G
Sbjct: 320  NLTDAGLAHLAPL-LALQHLDLSECNNLTDAG---LAHLTPLMALQHLNLSYCKNLTDAG 375

Query: 1200 IEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHS 1021
            +  ++     ++ L L  C  L+D G+        +++ L L  C +++ AG+  +    
Sbjct: 376  LAHLTP-LVALQYLDLSGCDNLTDAGLAHLTPLM-ALQHLGLSACDKLTDAGLAHLTPLV 433

Query: 1020 AGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHL 841
            A  L+ L+   C  + D+  G+  L P  +L  L++  C    DA L  L+ L   L HL
Sbjct: 434  A--LQYLSLNGCDKLTDV--GLAHLTPLVALTHLNLSWCDKLTDAGLAHLTPLVA-LQHL 488

Query: 840  NLSGLNGVTDYGLL---PFV-----------QSCDAGLVKV---------NLSGCINVTD 730
            NL     +TD GL    P V           +  DAGL  +         NLS C  +TD
Sbjct: 489  NLRWCRKLTDAGLAHLTPLVALQHLDLNRCPKLTDAGLAHLTSLVNLRHLNLSYCRKLTD 548

Query: 729  KTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS 592
              ++ +  L    L+ LNL+ C  +TDA LA +A   + L+ LD+S
Sbjct: 549  VGLAHLTPL--VALQHLNLSCCRKLTDAGLAHLASLLA-LQHLDLS 591



>gb:AC005250_1874894 Homo sapiens BAC clone CTA-318M5 from 7, complete
            sequence.
          Length = 325

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 80/320 (25%), Positives = 146/320 (45%), Gaps = 2/320 (0%)
 Frame = -3

Query: 1332 LTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCL 1153
            L +L+L   +   ++G   +  G G HKL  L ++ C  ++  G   ++  C  +  L +
Sbjct: 5    LQNLSLAYCRRFTDKGLQYLNLGNGCHKLIYLDLSGCTQISVQGFRYIANSCTGIMHLTI 64

Query: 1152 RKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMK 973
                 L+DN V + V+    I SL       IS      +   SA KL+ + FE    + 
Sbjct: 65   NDMPTLTDNCVKALVEKCSRITSLVFTGAPHISDCTFRAL---SACKLRKIRFEGNKRVT 121

Query: 972  DLAFG-VPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLP 796
            D +F  +    P  +L  + + +C G  D+SL  LS L   L  LNL+    + D GL  
Sbjct: 122  DASFKFIDKNYP--NLSHIYMADCKGITDSSLRSLSPL-KQLTVLNLANCVRIGDMGLKQ 178

Query: 795  FVQS-CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYC 619
            F+       + ++NLS C+ ++D ++  +++     L  L+L  C  +T   +  I +  
Sbjct: 179  FLDGPASMRIRELNLSNCVRLSDASVMKLSE-RCPNLNYLSLRNCEHLTAQGIGYIVNIF 237

Query: 618  SVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGL 439
            S++  +D+S + +S+ G+  L+        L+ LS+S C   +D  +    K    L  L
Sbjct: 238  SLV-SIDLSGTDISNEGLNVLSRHK----KLKELSVSECYRITDDGIQAFCKSSLILEHL 292

Query: 438  NIQNCVGISHRGVDLLVERL 379
            ++  C  +S    D++++ L
Sbjct: 293  DVSYCSQLS----DMIIKAL 308



 Score = 47.0 bits (110), Expect = 0.001
 Identities = 46/197 (23%), Positives = 83/197 (42%), Gaps = 3/197 (1%)
 Frame = -3

Query: 939 CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKV 760
           C+ L  L +  CT         ++  C  ++HL ++ +  +TD  +   V+ C   +  +
Sbjct: 30  CHKLIYLDLSGCTQISVQGFRYIANSCTGIMHLTINDMPTLTDNCVKALVEKCSR-ITSL 88

Query: 759 NLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR- 583
             +G  +++D T  A++      L  +   G   VTDAS   I      L  + ++  + 
Sbjct: 89  VFTGAPHISDCTFRALSACK---LRKIRFEGNKRVTDASFKFIDKNYPNLSHIYMADCKG 145

Query: 582 VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYL--HKLGNSLAGLNIQNCVGISH 409
           ++D  + +L+        L +L+L+ CV   D  L           +  LN+ NCV +S 
Sbjct: 146 ITDSSLRSLSPLK----QLTVLNLANCVRIGDMGLKQFLDGPASMRIRELNLSNCVRLSD 201

Query: 408 RGVDLLVERLWRCDILS 358
             V  L ER    + LS
Sbjct: 202 ASVMKLSERCPNLNYLS 218



 Score = 35.0 bits (79), Expect = 3.9
 Identities = 32/123 (26%), Positives = 58/123 (47%), Gaps = 9/123 (7%)
 Frame = -3

Query: 1407 LMKVKLQSLNISDISLAVIGH-------YGVALTDLALINLQ--NINERGFWVMGSGQGL 1255
            +MK+  +  N++ +SL    H       Y V +  L  I+L   +I+  G  V+   +  
Sbjct: 204  VMKLSERCPNLNYLSLRNCEHLTAQGIGYIVNIFSLVSIDLSGTDISNEGLNVLSRHK-- 261

Query: 1254 HKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQL 1075
             KL+ L ++ C  +TD GI+A  K    ++ L +  C+ LSD  + +      ++ SL +
Sbjct: 262  -KLKELSVSECYRITDDGIQAFCKSSLILEHLDVSYCSQLSDMIIKALAIYCINLTSLSI 320

Query: 1074 EEC 1066
              C
Sbjct: 321  AGC 323



>gb:NC18F11_1688417 Neurospora crassa DNA linkage group V Cosmid
            contig 18F11.
          Length = 783

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 63/272 (23%), Positives = 126/272 (46%), Gaps = 2/272 (0%)
 Frame = -3

Query: 1437 ASLFSSAGNHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFW-VMGSGQ 1261
            A L     N+   + L    + DI+   I       + L  +N+ N  +     ++   Q
Sbjct: 184  AGLLKLLRNNTGLLALDISGMEDITETSINAVAEKCSRLQGLNISNCTKISIASLVQLAQ 243

Query: 1260 GLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESL 1081
                ++ L +  C  VTD  + A ++ CPN+ ++ L +C L+ ++ V + +   +++  L
Sbjct: 244  SCRFIKRLKLNECAQVTDEAVIAFAENCPNILEIDLHQCRLIGNDPVTALMSKGKALREL 303

Query: 1080 QLEECHRISQAGVFGILVHSA-GKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNC 904
            +L  C  I  +    +  +    +L+ L   +C  + D A     +     LR+L +  C
Sbjct: 304  RLASCDLIDDSAFLSLPPNKTYEQLRILDLTSCSRLTDRAV-EKIIDVAPRLRNLVLAKC 362

Query: 903  TGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKT 724
                DA++  ++RL  NL +++L     +TD  +   VQ C+  +  ++L  C+++TD +
Sbjct: 363  RNITDAAVFAIARLGKNLHYVHLGHCGNITDEAVKRLVQCCNR-IRYIDLGCCVHLTDDS 421

Query: 723  ISAIAKLHGETLELLNLNGCGCVTDASLAAIA 628
            +  +A L    L+ + L  C  +TD S+ A+A
Sbjct: 422  VVRLATL--PKLKRIGLVKCSNITDESVYALA 451



 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 61/263 (23%), Positives = 118/263 (44%), Gaps = 2/263 (0%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGI 1198
            I+D  L  +      L  L +  +++I E    +    +   +L+ L I+ C  ++   +
Sbjct: 181  ITDAGLLKLLRNNTGLLALDISGMEDITETS--INAVAEKCSRLQGLNISNCTKISIASL 238

Query: 1197 EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSA 1018
              +++ C  +K+L L +C  ++D  V++F +   +I  + L +C  I    V  ++  S 
Sbjct: 239  VQLAQSCRFIKRLKLNECAQVTDEAVIAFAENCPNILEIDLHQCRLIGNDPVTALM--SK 296

Query: 1017 GK-LKALAFENCFGMKDLAF-GVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVH 844
            GK L+ L   +C  + D AF  +P       LR L + +C+   D ++  +  + P L +
Sbjct: 297  GKALRELRLASCDLIDDSAFLSLPPNKTYEQLRILDLTSCSRLTDRAVEKIIDVAPRLRN 356

Query: 843  LNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGC 664
            L L+                            C N+TD  + AIA+L G+ L  ++L  C
Sbjct: 357  LVLAK---------------------------CRNITDAAVFAIARL-GKNLHYVHLGHC 388

Query: 663  GCVTDASLAAIADYCSVLRDLDI 595
            G +TD ++  +   C+ +R +D+
Sbjct: 389  GNITDEAVKRLVQCCNRIRYIDL 411



 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 50/195 (25%), Positives = 98/195 (50%), Gaps = 4/195 (2%)
 Frame = -3

Query: 957 VPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCD 778
           V +L  C+ +  L++  C    DA L+ L R    L+ L++SG+  +T+  +    + C 
Sbjct: 161 VESLEMCSRVERLTMTGCKRITDAGLLKLLRNNTGLLALDISGMEDITETSINAVAEKCS 220

Query: 777 AGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLD 598
             L  +N+S C  ++  ++  +A+     ++ L LN C  VTD ++ A A+ C  + ++D
Sbjct: 221 R-LQGLNISNCTKISIASLVQLAQ-SCRFIKRLKLNECAQVTDEAVIAFAENCPNILEID 278

Query: 597 ISKSRV--SDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYL--HKLGNSLAGLNIQ 430
           + + R+  +D   A ++ G A    L+ L L+ C L  D     L  +K    L  L++ 
Sbjct: 279 LHQCRLIGNDPVTALMSKGKA----LRELRLASCDLIDDSAFLSLPPNKTYEQLRILDLT 334

Query: 429 NCVGISHRGVDLLVE 385
           +C  ++ R V+ +++
Sbjct: 335 SCSRLTDRAVEKIID 349



 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 55/240 (22%), Positives = 101/240 (42%), Gaps = 3/240 (1%)
 Frame = -3

Query: 1341 GVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQ 1162
            G AL +L L +   I++  F  +   +   +LR L +T+C  +TD  +E +    P ++ 
Sbjct: 297  GKALRELRLASCDLIDDSAFLSLPPNKTYEQLRILDLTSCSRLTDRAVEKIIDVAPRLRN 356

Query: 1161 LCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCF 982
            L L KC  ++D  V +  +  +++  + L  C  I+   V   LV    +++ +    C 
Sbjct: 357  LVLAKCRNITDAAVFAIARLGKNLHYVHLGHCGNITDEAV-KRLVQCCNRIRYIDLGCCV 415

Query: 981  GMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGL 802
             + D    V  L     L+ + +  C+   D S+  L+R        N        D  L
Sbjct: 416  HLTD--DSVVRLATLPKLKRIGLVKCSNITDESVYALAR-------ANQRRPRRDADGNL 466

Query: 801  LP---FVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI 631
            +P   +     + L +V+LS C N+T +++            L  LN C  +T  S+  +
Sbjct: 467  VPGDCYNNMHHSSLERVHLSYCTNLTLRSV------------LRLLNACPRLTHLSVTGV 514



>gb:CR382129_1661907 Yarrowia lipolytica chromosome C of strain CLIB99
            of Yarrowia lipolytica.
          Length = 767

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 75/323 (23%), Positives = 143/323 (44%), Gaps = 1/323 (0%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGI 1198
            +SD SL  +      L  + + N+ +I +     +   +   +L+ L  T C  +T+  I
Sbjct: 199  LSDASLVPVLQQNSGLQSVDVTNVSHITDATIKALLPSK--RRLQGLYATGCANITNAAI 256

Query: 1197 EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSA 1018
             A++  C  +K++ +  C  + D   ++ V     +  L L E   +S   V    +   
Sbjct: 257  VALATECRLLKRIKVNSCPNVEDEAAMALVDNCPQLVELDLHENSALS-GSVATEALRKL 315

Query: 1017 GKLKALAFENCFGMKDLAF-GVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHL 841
              L+ L      G+ D  F G PA P  + LR + +  C    DA++  L    P L H+
Sbjct: 316  PNLRELRVGQVTGVNDACFLGFPARPQFDRLRIIDLTACNAITDAAVDRLVTCAPKLRHV 375

Query: 840  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCG 661
             L+    VTD  +   ++     L  ++L  C ++TD  I+ + +   + ++ +++  C 
Sbjct: 376  VLAKCTRVTDRSIRSLLR-LGKSLHYLHLGHCASITDAGIAQLVRAC-QRIQYIDVANCS 433

Query: 660  CVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKC 481
             +TDA++  +A    + R   +    ++D  I ALA  S  + SL+ + LS C   S   
Sbjct: 434  QLTDAAVEDLASLTKLRRIGLVKCVNITDAAIYALASRSGFEASLERVHLSYCAGIS--- 490

Query: 480  LPYLHKLGNSLAGLNIQNCVGIS 412
            +P + +L N    L+  +  G++
Sbjct: 491  IPAVLRLVNVCPRLSHLSLTGVT 513



 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 88/357 (24%), Positives = 149/357 (41%), Gaps = 58/357 (16%)
 Frame = -3

Query: 1248 LRSLVITACQG-VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLE 1072
            +R L +T   G +TD  +  V+  C  +++L L  CT LSD  +V  ++    ++S+ + 
Sbjct: 162  IRRLNLTNLTGEMTDELLSGVAV-CTRLERLTLANCTALSDASLVPVLQQNSGLQSVDVT 220

Query: 1071 ECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG 892
                I+ A +  +L  S  +L+ L    C  + + A  V     C  L+ + + +C    
Sbjct: 221  NVSHITDATIKALL-PSKRRLQGLYATGCANITNAAI-VALATECRLLKRIKVNSCPNVE 278

Query: 891  DASLVVLSRLCPNLVHLN------LSG--------------------LNGVTDYGLLPF- 793
            D + + L   CP LV L+      LSG                    + GV D   L F 
Sbjct: 279  DEAAMALVDNCPQLVELDLHENSALSGSVATEALRKLPNLRELRVGQVTGVNDACFLGFP 338

Query: 792  --------------------------VQSCDAGLVKVNLSGCINVTDKTISAIAKLHGET 691
                                      + +C   L  V L+ C  VTD++I ++ +L G++
Sbjct: 339  ARPQFDRLRIIDLTACNAITDAAVDRLVTCAPKLRHVVLAKCTRVTDRSIRSLLRL-GKS 397

Query: 690  LELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILS 514
            L  L+L  C  +TDA +A +   C  ++ +D++  S+++D  +  LA  +     L+ + 
Sbjct: 398  LHYLHLGHCASITDAGIAQLVRACQRIQYIDVANCSQLTDAAVEDLASLT----KLRRIG 453

Query: 513  LSGCVLASDKCLPYLHKLGN---SLAGLNIQNCVGISHRGVDLLVERLWRCDILS*T 352
            L  CV  +D  +  L        SL  +++  C GIS   V  LV    R   LS T
Sbjct: 454  LVKCVNITDAAIYALASRSGFEASLERVHLSYCAGISIPAVLRLVNVCPRLSHLSLT 510



>gb:BX908798_831222 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 518

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 83/284 (29%), Positives = 137/284 (48%), Gaps = 22/284 (7%)
 Frame = -3

Query: 1185 KGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLK 1006
            K C N+K L L++C  L+D G +S +    +++ L L  C +++ AG+  +   S   L+
Sbjct: 206  KNCKNLKVLYLQECHNLTDAG-LSHLAPLVTLQHLNLSYCSKLTDAGLAHLT--SLVTLQ 262

Query: 1005 ALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGL 826
             L    C+ + D   G+  L P  +L+ L++  C+   DA L  L+ L   L HL+L+  
Sbjct: 263  HLDLSKCYNLTDA--GLTHLTPLAALQHLNLSYCSKLTDAGLAHLTSLV-TLQHLDLTWC 319

Query: 825  NGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDA 646
              +TD GL        A L  +NLS CI +TD  ++ +  L    L+ L+L  C  +T+ 
Sbjct: 320  VNLTDVGLAHLTPL--AALQHLNLSYCIKLTDVGLAHLTSL--VALQHLDLTWCVNLTEV 375

Query: 645  SLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQ---------------------F 532
             LA +    + L+ L++SK   ++D G+A L    A+Q                      
Sbjct: 376  GLAHLTPLVT-LQHLELSKCHNLTDAGLAHLTSLVALQHLNLSICKKITDVGLAHLTPLV 434

Query: 531  SLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
            +LQ L LSGC   +D  L +L  L  +L  L++  CV ++  G+
Sbjct: 435  ALQHLDLSGCDKLTDVGLAHLTTL-VALQHLDLTCCVNLTDAGL 477



 Score = 63.9 bits (154), Expect = 8e-09
 Identities = 79/282 (28%), Positives = 123/282 (43%), Gaps = 28/282 (9%)
 Frame = -3

Query: 1398 VKLQSLNISDISL---AVIGHYG--VALTDLALINLQNINERGFWVMGSGQGLHKLRSLV 1234
            V LQ LN+S  S    A + H    V L  L L    N+ + G   +     L  L+ L 
Sbjct: 234  VTLQHLNLSYCSKLTDAGLAHLTSLVTLQHLDLSKCYNLTDAGLTHLTP---LAALQHLN 290

Query: 1233 ITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRIS 1054
            ++ C  +TD G+  ++     ++ L L  C  L+D G+      A +++ L L  C +++
Sbjct: 291  LSYCSKLTDAGLAHLTS-LVTLQHLDLTWCVNLTDVGLAHLTPLA-ALQHLNLSYCIKLT 348

Query: 1053 QAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVV 874
              G+  +   S   L+ L    C  + ++  G+  L P  +L+ L +  C    DA L  
Sbjct: 349  DVGLAHLT--SLVALQHLDLTWCVNLTEV--GLAHLTPLVTLQHLELSKCHNLTDAGLAH 404

Query: 873  LSRLCPNLVHLNLSGLNGVTDYGLL---PFV-------QSCD-------------AGLVK 763
            L+ L   L HLNLS    +TD GL    P V         CD               L  
Sbjct: 405  LTSLVA-LQHLNLSICKKITDVGLAHLTPLVALQHLDLSGCDKLTDVGLAHLTTLVALQH 463

Query: 762  VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLA 637
            ++L+ C+N+TD  +  +  L    L+ LNL+ C  +TDA LA
Sbjct: 464  LDLTCCVNLTDAGLVHLKPLMA--LQHLNLSYCTNLTDAGLA 503



 Score = 54.3 bits (129), Expect = 6e-06
 Identities = 58/203 (28%), Positives = 94/203 (46%), Gaps = 6/203 (2%)
 Frame = -3

Query: 1383 LNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLV------ITAC 1222
            +N++D+ LA        LT LA +   N++   + +  +  GL  L SLV      +T C
Sbjct: 320  VNLTDVGLA-------HLTPLAALQHLNLS---YCIKLTDVGLAHLTSLVALQHLDLTWC 369

Query: 1221 QGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV 1042
              +T++G+  ++     ++ L L KC  L+D G+        +++ L L  C +I+  G+
Sbjct: 370  VNLTEVGLAHLTP-LVTLQHLELSKCHNLTDAGLAHLTSLV-ALQHLNLSICKKITDVGL 427

Query: 1041 FGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRL 862
              +    A  L+ L    C  + D+  G+  L    +L+ L +  C    DA LV L  L
Sbjct: 428  AHLTPLVA--LQHLDLSGCDKLTDV--GLAHLTTLVALQHLDLTCCVNLTDAGLVHLKPL 483

Query: 861  CPNLVHLNLSGLNGVTDYGLLPF 793
               L HLNLS    +TD GL  F
Sbjct: 484  MA-LQHLNLSYCTNLTDAGLAHF 505



>gb:BX908798_830548 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 583

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 82/262 (31%), Positives = 132/262 (50%), Gaps = 1/262 (0%)
 Frame = -3

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TD  + A+ K C N+K L L  C  ++D+G+        +++ L L +C  ++  G+  
Sbjct: 239  LTDAHLLAL-KNCENLKVLHLEACLAITDDGLAHLAPLV-ALQHLDLSDCENLTDVGLAH 296

Query: 1035 ILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCP 856
            +   +A  L+ L    C+       G+  L P  +L+ L++  C+   DA L  L+ L  
Sbjct: 297  LTPLTA--LQHLDLRGCYFTD---AGLAHLTPLTALQHLNLSFCSNATDAGLAHLTPLTA 351

Query: 855  NLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLN 676
             L HL+L G   +TD GL         GL  ++L GC ++TD  ++ +  L    L+ LN
Sbjct: 352  -LQHLDLRGCY-LTDAGLAHLTPL--TGLQHLDLIGCKDLTDAGLAHLRPL--TALQHLN 405

Query: 675  LNGCGCVTDASLAAIADYCSVLRDLDIS-KSRVSDFGIAALAGGSAIQFSLQILSLSGCV 499
            LN C  +TDA LA +    + L+ LD+S  S ++D G+A L     +  +LQ L+LSGC 
Sbjct: 406  LNWCRNLTDAGLAHLTP-LTALQHLDLSFCSNITDDGLAHL----TLLTTLQHLNLSGCY 460

Query: 498  LASDKCLPYLHKLGNSLAGLNI 433
              +D  L +L  L   L  LN+
Sbjct: 461  KLTDAGLAHLTLL-TGLQHLNL 481



 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 85/306 (27%), Positives = 145/306 (47%), Gaps = 22/306 (7%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            L+ L ++ C+ +TD+G+  ++     ++ L LR C   +D G+        +++ L L  
Sbjct: 278  LQHLDLSDCENLTDVGLAHLTP-LTALQHLDLRGC-YFTDAGLAHLTPLT-ALQHLNLSF 334

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGD 889
            C   + AG+  +   +A  L+ L    C+ + D   G+  L P   L+ L +  C    D
Sbjct: 335  CSNATDAGLAHLTPLTA--LQHLDLRGCY-LTDA--GLAHLTPLTGLQHLDLIGCKDLTD 389

Query: 888  ASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIA 709
            A L  L  L   L HLNL+    +TD GL          L  ++LS C N+TD  ++ + 
Sbjct: 390  AGLAHLRPLTA-LQHLNLNWCRNLTDAGLAHLTPL--TALQHLDLSFCSNITDDGLAHLT 446

Query: 708  KLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS-KSRVSDFGIAALAGGSAIQF 532
             L   TL+ LNL+GC  +TDA LA +    + L+ L+++    ++D G+A L   + +Q+
Sbjct: 447  LL--TTLQHLNLSGCYKLTDAGLAHLT-LLTGLQHLNLNWYKNLTDAGLAHLTPLAGLQY 503

Query: 531  ---------------------SLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGI 415
                                 +LQ L+LSGC   +D  L +L  L  +L  L++  C+ +
Sbjct: 504  LALTDCKNLTDAGLAHLTPLTALQHLNLSGCYKLTDAGLAHLTSL-TALQYLDLSYCMNL 562

Query: 414  SHRGVD 397
            +  G+D
Sbjct: 563  TDDGLD 568



>pir|C71419|C71419 hypothetical protein - Arabidopsis
            thaliana>gb:ATCHRIV41_1545349 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 41.>gb:ATFCA4_1551597
            Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
            fragment No. 4.
          Length = 712

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 67/280 (23%), Positives = 118/280 (42%)
 Frame = -3

Query: 1413 NHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLV 1234
            + L  +KLQ ++++D++ A +G    +L  LAL + Q+  ++G   +G G    KL+ L 
Sbjct: 475  HRLKNLKLQCVSVTDVAFAAVGELCTSLERLALYSFQHFTDKGMRAIGKGS--KKLKDLT 532

Query: 1233 ITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRIS 1054
            ++ C  V+  G+EA++ GC  ++++ +  C  +   G+ +  K+   ++ L L  C RI 
Sbjct: 533  LSDCYFVSCKGLEAIAHGCKELERVEINGCHNIGTRGIEAIGKSCPRLKELALLYCQRIG 592

Query: 1053 QAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVV 874
             + +  I     G LKA  F++ F                             GD  L  
Sbjct: 593  NSALQEI---GKGYLKAGTFDHKF--------------------------QNIGDMPLAE 623

Query: 873  LSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGE 694
            L   CP L  L LS  + +TD GL   VQ C                            +
Sbjct: 624  LGEGCPMLKDLVLSHCHHITDNGLNHLVQKC----------------------------K 655

Query: 693  TLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSD 574
             LE  ++  C  +T A +A +   C  ++ + I K +V++
Sbjct: 656  LLETCHMVYCPGITSAGVATVVSSCPHIKKVLIEKWKVTE 695



 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 68/274 (24%), Positives = 107/274 (39%), Gaps = 25/274 (9%)
 Frame = -3

Query: 1137 LSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFG 958
            L+D G+ +       IE+L L  C  +S  G+  +                         
Sbjct: 333  LTDTGLTALANGFPRIENLSLIWCPNVSSVGLCSLA------------------------ 368

Query: 957  VPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCD 778
                  C SL+SL +  C   GD  L  + + C  L  LNL    G+TD G++  V  C 
Sbjct: 369  ----QKCTSLKSLDLQGCY-VGDQGLAAVGKFCKQLEELNLRFCEGLTDVGVIDLVVGCS 423

Query: 777  AGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNG----------------------- 667
              L  + ++    +TD ++ A+   H + LE+L L+                        
Sbjct: 424  KSLKSIGVAASAKITDLSLEAVGS-HCKLLEVLYLDSEYIHDKGLIAVAQGCHRLKNLKL 482

Query: 666  -CGCVTDASLAAIADYCSVLRDLDI-SKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLA 493
             C  VTD + AA+ + C+ L  L + S    +D G+ A+  GS     L+ L+LS C   
Sbjct: 483  QCVSVTDVAFAAVGELCTSLERLALYSFQHFTDKGMRAIGKGSK---KLKDLTLSDCYFV 539

Query: 492  SDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
            S K L  +      L  + I  C  I  RG++ +
Sbjct: 540  SCKGLEAIAHGCKELERVEINGCHNIGTRGIEAI 573



 Score = 67.0 bits (162), Expect = 9e-10
 Identities = 80/332 (24%), Positives = 138/332 (41%), Gaps = 1/332 (0%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLG 1201
            N+S + L  +       T L  ++LQ        +   G+   +L  L +  C+G+TD+G
Sbjct: 358  NVSSVGLCSLAQ---KCTSLKSLDLQGCYVGDQGLAAVGKFCKQLEELNLRFCEGLTDVG 414

Query: 1200 IEAVSKGC-PNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVH 1024
            +  +  GC  ++K + +     ++D  + +     + +E L L+    I   G+  +   
Sbjct: 415  VIDLVVGCSKSLKSIGVAASAKITDLSLEAVGSHCKLLEVLYLDS-EYIHDKGLIAV-AQ 472

Query: 1023 SAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVH 844
               +LK L  + C  + D+AF       C SL  L++ +   F D  +  + +    L  
Sbjct: 473  GCHRLKNLKLQ-CVSVTDVAFAAVG-ELCTSLERLALYSFQHFTDKGMRAIGKGSKKLKD 530

Query: 843  LNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGC 664
            L LS    V+  GL      C   L +V ++GC N+  + I AI K      EL  L  C
Sbjct: 531  LTLSDCYFVSCKGLEAIAHGCKE-LERVEINGCHNIGTRGIEAIGKSCPRLKELALLY-C 588

Query: 663  GCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDK 484
              + +++L  I          D     + D  +A L  G  +   L+ L LS C   +D 
Sbjct: 589  QRIGNSALQEIGKGYLKAGTFDHKFQNIGDMPLAELGEGCPM---LKDLVLSHCHHITDN 645

Query: 483  CLPYLHKLGNSLAGLNIQNCVGISHRGVDLLV 388
             L +L +    L   ++  C GI+  GV  +V
Sbjct: 646  GLNHLVQKCKLLETCHMVYCPGITSAGVATVV 677



>gb:BX908798_831511 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 454

 Score = 84.0 bits (206), Expect = 7e-15
 Identities = 79/247 (31%), Positives = 123/247 (49%), Gaps = 1/247 (0%)
 Frame = -3

Query: 1185 KGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLK 1006
            K C N+K L L  C  ++D+G ++ +    S++ L L  C  ++ AG+  +   +A  L+
Sbjct: 217  KNCENLKLLHLEACQAITDDG-LAHLALLTSLQHLNLYFCVNLTDAGLAHLTPLTA--LQ 273

Query: 1005 ALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGL 826
             L    C+ + D   G+  L P   L+ L++ +C    DA L  L+ L   L++LNLS  
Sbjct: 274  HLNLSYCWKITDA--GLAHLTPLTDLQHLNLSDCENLTDAGLAHLTPLTA-LLYLNLSKC 330

Query: 825  NGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDA 646
              +T+ GL         GL  +NL  C N+TD   S +A L    L+ L+L+ C  +TDA
Sbjct: 331  YHLTNVGLAHLAPL--TGLQYLNLKWCWNLTDAGFSHLASL--TALQHLDLSDCENLTDA 386

Query: 645  SLAAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYL 469
             LA +A   + L+ L +S+ R ++D G+A L   +A    LQ L L  C   +D  L   
Sbjct: 387  GLAYLAS-LTALQYLGLSQCRNLTDVGLAHLTPLTA----LQHLDLRECDKVTDAGLARF 441

Query: 468  HKLGNSL 448
              L  SL
Sbjct: 442  KTLATSL 448



>gb:BX908798_830299 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 765

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 104/366 (28%), Positives = 162/366 (44%), Gaps = 23/366 (6%)
 Frame = -3

Query: 1428 FSSAGNHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHK 1249
            F    NH +  +++ LN S             LTD  L+ L+N                 
Sbjct: 249  FEKILNHFLN-EIEELNFSK---------NAHLTDAHLLALKNCEN-------------- 284

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            L+ L + AC  +TD G+  ++     +K L L  C L +D+G+V     A +++ L L  
Sbjct: 285  LKVLNLQACHNLTDAGLAHLTP-LAALKHLDLSGCEL-TDDGLVHLTPLA-ALQHLDLSH 341

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGD 889
            C   + AG+  + +  A  L+ L   +C  + D   G+  L    +L+ L + +C  F D
Sbjct: 342  CRNFTDAGLAHLKLLVA--LQHLNLSHCGKLTDA--GLAHLKLLVALQHLDLSHCRNFTD 397

Query: 888  ASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPF----------VQSC----DAGLVKV--- 760
            A L  L +L   L HLNLS    +TD GL             +  C    DAGL  +   
Sbjct: 398  AGLAHL-KLLVALQHLNLSYCGNLTDAGLAHLTPLMALQHLDLNGCHNLTDAGLTHLTSL 456

Query: 759  ------NLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLD 598
                  NLS   N TD  ++ +  L    L+ LNL+ CG  TDA LA +    + L+ LD
Sbjct: 457  VVLQYLNLSWNYNFTDAGLAHLTPLMA--LQHLNLSYCGNFTDAGLAHLTS-LAALKHLD 513

Query: 597  ISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVG 418
            +    ++D G+A L     +  +LQ L+LS C   +D  L +L KL  +L  L++  C  
Sbjct: 514  LIGCELTDDGLAHL----KLLVALQHLNLSYCGKLTDDGLAHL-KLLVALQHLDLSGCDK 568

Query: 417  ISHRGV 400
            ++  G+
Sbjct: 569  LTGAGL 574



 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 89/298 (29%), Positives = 139/298 (46%), Gaps = 28/298 (9%)
 Frame = -3

Query: 1398 VKLQSLNIS---DISLAVIGHYG--VALTDLALINLQNINERGFWVMGSGQGLHKLRSLV 1234
            V LQ LN+S   + + A + H    +AL  L L    N  + G   + S   L  L+ L 
Sbjct: 457  VVLQYLNLSWNYNFTDAGLAHLTPLMALQHLNLSYCGNFTDAGLAHLTS---LAALKHLD 513

Query: 1233 ITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRIS 1054
            +  C+ +TD G+ A  K    ++ L L  C  L+D+G+ + +K   +++ L L  C +++
Sbjct: 514  LIGCE-LTDDGL-AHLKLLVALQHLNLSYCGKLTDDGL-AHLKLLVALQHLDLSGCDKLT 570

Query: 1053 QAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVV 874
             AG+  +    A  L+ L   +C  + D   G+  L P  +LR L + +C     A L  
Sbjct: 571  GAGLAHLKFLVA--LQHLNLSHCGKLTD--DGLVNLTPLAALRHLDLSHCGKLTGAGLAH 626

Query: 873  LSRLCPNLVHLNLSGLNGVTDYGLLPF----------VQSC----DAGLVKVN------- 757
            L  L   L HLNLS    +TD GL+            +  C    DAGLV ++       
Sbjct: 627  LKFLVA-LQHLNLSHCGKLTDAGLVNLSPLMALQHLDLSHCGNLTDAGLVNLSPLMALQH 685

Query: 756  --LSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK 589
              LS C N+TD  +  +  L    L+ L+L+ CG +TD  LA ++   + L+ LD SK
Sbjct: 686  LDLSHCGNLTDDGLVNLKFL--VALQHLDLSHCGNLTDDGLAHLSPLIA-LQHLDRSK 740



 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 110/415 (26%), Positives = 166/415 (40%), Gaps = 72/415 (17%)
 Frame = -3

Query: 1428 FSSAGNHLMK--VKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGL 1255
            F+ AG   +K  V LQ LN+S        H G  LTD  L +L+               L
Sbjct: 345  FTDAGLAHLKLLVALQHLNLS--------HCG-KLTDAGLAHLKL--------------L 381

Query: 1254 HKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQL 1075
              L+ L ++ C+  TD G+ A  K    ++ L L  C  L+D G+        +++ L L
Sbjct: 382  VALQHLDLSHCRNFTDAGL-AHLKLLVALQHLNLSYCGNLTDAGLAHLTPLM-ALQHLDL 439

Query: 1074 EECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGF 895
              CH ++ AG+  +   S   L+ L     +   D   G+  L P  +L+ L++  C  F
Sbjct: 440  NGCHNLTDAGLTHLT--SLVVLQYLNLSWNYNFTDA--GLAHLTPLMALQHLNLSYCGNF 495

Query: 894  GDASLVVLS-----------------------RLCPNLVHLNLSGLNGVTDYGLLPF--- 793
             DA L  L+                       +L   L HLNLS    +TD GL      
Sbjct: 496  TDAGLAHLTSLAALKHLDLIGCELTDDGLAHLKLLVALQHLNLSYCGKLTDDGLAHLKLL 555

Query: 792  -------VQSCD----AGLVKV---------NLSGCINVTDK--------------TISA 715
                   +  CD    AGL  +         NLS C  +TD                +S 
Sbjct: 556  VALQHLDLSGCDKLTGAGLAHLKFLVALQHLNLSHCGKLTDDGLVNLTPLAALRHLDLSH 615

Query: 714  IAKLHGE---------TLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGI 565
              KL G           L+ LNL+ CG +TDA L  ++   + L+ LD+S    ++D G+
Sbjct: 616  CGKLTGAGLAHLKFLVALQHLNLSHCGKLTDAGLVNLSPLMA-LQHLDLSHCGNLTDAGL 674

Query: 564  AALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
              L+       +LQ L LS C   +D  L  L K   +L  L++ +C  ++  G+
Sbjct: 675  VNLSP----LMALQHLDLSHCGNLTDDGLVNL-KFLVALQHLDLSHCGNLTDDGL 724



>gb:BX908798_831470 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 528

 Score = 82.8 bits (203), Expect = 2e-14
 Identities = 80/263 (30%), Positives = 128/263 (48%), Gaps = 1/263 (0%)
 Frame = -3

Query: 1185 KGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLK 1006
            K C N++ L  +KC  ++D G+   V   + ++ L L  C  ++ AG+  +   +A  L+
Sbjct: 216  KDCKNIEVLYFKKCRGVTDAGLAHLV-PLKGLQHLDLSYCENLTDAGLAYLKPLTA--LQ 272

Query: 1005 ALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGL 826
             L    C+ + D   G+  L P   L+ L +  C    DA L  L+ L   L HL LS  
Sbjct: 273  HLNLSGCWNLTDA--GLVHLTPLVGLQHLDLSYCENLTDAGLAHLTPLTA-LQHLGLSCC 329

Query: 825  NGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDA 646
              +TD GL     +    L  ++LS C N+TD ++S +  L    L+ L L GC  +TDA
Sbjct: 330  ENLTDAGLAHL--ALLTTLQHLDLSCCYNLTDASLSHLTPL--TALQHLYLIGCENLTDA 385

Query: 645  SLAAIADYCSVLRDLDISKS-RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYL 469
             LA +    + L+ LD+S    ++D G++ L   +     LQ L+LS C   +D  L +L
Sbjct: 386  GLAHLTP-LTALQHLDLSCCFNLTDAGLSHLTPLT----GLQHLNLSRCYKLTDAGLAHL 440

Query: 468  HKLGNSLAGLNIQNCVGISHRGV 400
              L  +L  LN+  C  ++  G+
Sbjct: 441  TTL-VALQHLNLSECRHLTDAGL 462



 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 84/296 (28%), Positives = 136/296 (45%), Gaps = 1/296 (0%)
 Frame = -3

Query: 1332 LTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCL 1153
            L  L L   +N+ + G   +   + L  L+ L ++ C  +TD G+  ++     ++ L L
Sbjct: 246  LQHLDLSYCENLTDAGLAYL---KPLTALQHLNLSGCWNLTDAGLVHLTP-LVGLQHLDL 301

Query: 1152 RKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMK 973
              C  L+D G+        +++ L L  C  ++ AG+  + + +   L+ L    C+ + 
Sbjct: 302  SYCENLTDAGLAHLTPLT-ALQHLGLSCCENLTDAGLAHLALLTT--LQHLDLSCCYNLT 358

Query: 972  DLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPF 793
            D +     L P  +L+ L +  C    DA L  L+ L   L HL+LS    +TD GL   
Sbjct: 359  DASLS--HLTPLTALQHLYLIGCENLTDAGLAHLTPLTA-LQHLDLSCCFNLTDAGLSHL 415

Query: 792  VQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSV 613
                  GL  +NLS C  +TD  ++ +  L    L+ LNL+ C  +TDA LA +    + 
Sbjct: 416  TPL--TGLQHLNLSRCYKLTDAGLAHLTTL--VALQHLNLSECRHLTDAGLAHLTP-LTA 470

Query: 612  LRDLDISKS-RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSL 448
            L+ LD+     ++D G+A L   +A    LQ L LS C   +D  L     L  SL
Sbjct: 471  LQHLDLKYCINLTDAGLAHLTPLTA----LQHLDLSRCRRLTDDGLDRFKTLATSL 522



 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 75/237 (31%), Positives = 116/237 (48%)
 Frame = -3

Query: 1110 VKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNS 931
            +K  ++IE L  ++C  ++ AG+   LV   G L+ L    C  + D   G+  L P  +
Sbjct: 215  LKDCKNIEVLYFKKCRGVTDAGL-AHLVPLKG-LQHLDLSYCENLTDA--GLAYLKPLTA 270

Query: 930  LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLS 751
            L+ L++  C    DA LV L+ L   L HL+LS    +TD GL          L  + LS
Sbjct: 271  LQHLNLSGCWNLTDAGLVHLTPLV-GLQHLDLSYCENLTDAGLAHLTPL--TALQHLGLS 327

Query: 750  GCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDF 571
             C N+TD  ++ +A L   TL+ L+L+ C  +TDASL+ +    ++     I    ++D 
Sbjct: 328  CCENLTDAGLAHLALL--TTLQHLDLSCCYNLTDASLSHLTPLTALQHLYLIGCENLTDA 385

Query: 570  GIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
            G+A L   +A    LQ L LS C   +D  L +L  L   L  LN+  C  ++  G+
Sbjct: 386  GLAHLTPLTA----LQHLDLSCCFNLTDAGLSHLTPL-TGLQHLNLSRCYKLTDAGL 437



>gb:BX908798_830581 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 695

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 100/374 (26%), Positives = 167/374 (44%), Gaps = 45/374 (12%)
 Frame = -3

Query: 1386 SLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTD 1207
            S N++D  L  +      LT L  +NL   N+     +   + L  L+ L ++ C+ +TD
Sbjct: 285  SYNLTDAGLVHLA----PLTALQKLNLGRYNQLTDAGLAHLKPLTALQRLDLSFCEDLTD 340

Query: 1206 LGIEAVSKGCPNVKQLCLRKCTLLSDNGVV-----------------------SFVKAAE 1096
             G+ A  +    +++L LR C  L+D+G+V                       S +    
Sbjct: 341  DGL-AHLRPLTALQRLDLRYCEKLTDDGLVHLRPLTALQRLNLSNCWHTGAGLSHLSPLT 399

Query: 1095 SIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLS 916
             ++ L L EC  ++ AG+  + + +   L+ L    C  + D   G+  L     L+ L+
Sbjct: 400  GLQHLNLYECINLTDAGLVHLKLLTG--LQHLNLSYCDELTDA--GLVHLKLLTGLQHLN 455

Query: 915  ICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINV 736
            + NC    DA LV L  L   L HLNLS  + +TD GL+        GL  +NLS C N+
Sbjct: 456  LSNCNNLTDAGLVHLKFLT-GLQHLNLSYCDELTDAGLVHL--KLLTGLQHLNLSNCNNL 512

Query: 735  TDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSDFGIAA 559
            TD  ++ +  L G  L+ L+L+ C  +TD  LA +    + L+ L++S  R ++D G+  
Sbjct: 513  TDAGLAHLTPLTG--LQHLDLSYCSKLTDDGLAHLKP-LTALQCLNLSNCRNLTDAGLVH 569

Query: 558  LAGGSAIQ---------------------FSLQILSLSGCVLASDKCLPYLHKLGNSLAG 442
            L   + +Q                      +L+ L L GC   +D  L +L  L  +L  
Sbjct: 570  LKLLTGLQHLNLSDYKNLTDDGLIHLMPLMALRHLELLGCENLTDAGLVHLTPL-TALQH 628

Query: 441  LNIQNCVGISHRGV 400
            LN+ +C  ++  G+
Sbjct: 629  LNLSHCDDLTDAGL 642



 Score = 80.9 bits (198), Expect = 6e-14
 Identities = 78/276 (28%), Positives = 130/276 (47%)
 Frame = -3

Query: 1389 QSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVT 1210
            + +N++D  L  +      LT L  +NL   +E     +   + L  L+ L ++ C  +T
Sbjct: 408  ECINLTDAGLVHLK----LLTGLQHLNLSYCDELTDAGLVHLKLLTGLQHLNLSNCNNLT 463

Query: 1209 DLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGIL 1030
            D G+  + K    ++ L L  C  L+D G+V  +K    ++ L L  C+ ++ AG+  + 
Sbjct: 464  DAGLVHL-KFLTGLQHLNLSYCDELTDAGLVH-LKLLTGLQHLNLSNCNNLTDAGLAHLT 521

Query: 1029 VHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNL 850
              +   L+ L    C  + D   G+  L P  +L+ L++ NC    DA LV L +L   L
Sbjct: 522  PLTG--LQHLDLSYCSKLTD--DGLAHLKPLTALQCLNLSNCRNLTDAGLVHL-KLLTGL 576

Query: 849  VHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLN 670
             HLNLS    +TD GL+  +      L  + L GC N+TD  +  +  L    L+ LNL+
Sbjct: 577  QHLNLSDYKNLTDDGLIHLMPLM--ALRHLELLGCENLTDAGLVHLTPL--TALQHLNLS 632

Query: 669  GCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIA 562
             C  +TDA LA +     +     +    ++D G+A
Sbjct: 633  HCDDLTDAGLAHLTSLTGLQHLELLGCENLTDAGLA 668



 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 85/288 (29%), Positives = 130/288 (45%), Gaps = 24/288 (8%)
 Frame = -3

Query: 1191 VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK 1012
            + K C N+K L L KC  L+D+G ++ +    +++ L L   + ++ AG    LVH A  
Sbjct: 245  ILKNCKNLKVLHLEKCRALTDDG-LAHLTPLTALQYLNLSASYNLTDAG----LVHLA-P 298

Query: 1011 LKALAFENCFGMKDLA-FGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL 835
            L AL   N      L   G+  L P  +L+ L +  C    D  L  L  L   L  L+L
Sbjct: 299  LTALQKLNLGRYNQLTDAGLAHLKPLTALQRLDLSFCEDLTDDGLAHLRPLTA-LQRLDL 357

Query: 834  SGLNGVTDYGLLPF----------VQSC------------DAGLVKVNLSGCINVTDKTI 721
                 +TD GL+            + +C              GL  +NL  CIN+TD  +
Sbjct: 358  RYCEKLTDDGLVHLRPLTALQRLNLSNCWHTGAGLSHLSPLTGLQHLNLYECINLTDAGL 417

Query: 720  SAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGS 544
              +  L G  L+ LNL+ C  +TDA L  +    + L+ L++S  + ++D G+  L    
Sbjct: 418  VHLKLLTG--LQHLNLSYCDELTDAGLVHL-KLLTGLQHLNLSNCNNLTDAGLVHL---- 470

Query: 543  AIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
                 LQ L+LS C   +D  L +L KL   L  LN+ NC  ++  G+
Sbjct: 471  KFLTGLQHLNLSYCDELTDAGLVHL-KLLTGLQHLNLSNCNNLTDAGL 517



 Score = 57.4 bits (137), Expect = 7e-07
 Identities = 60/203 (29%), Positives = 96/203 (47%), Gaps = 3/203 (1%)
 Frame = -3

Query: 1392 LQSLNIS---DISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITAC 1222
            LQ LN+S   +++ A + H  + LT L  +NL N N      +     L  L+ L ++ C
Sbjct: 476  LQHLNLSYCDELTDAGLVHLKL-LTGLQHLNLSNCNNLTDAGLAHLTPLTGLQHLDLSYC 534

Query: 1221 QGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV 1042
              +TD G+ A  K    ++ L L  C  L+D G+V  +K    ++ L L +   ++  G+
Sbjct: 535  SKLTDDGL-AHLKPLTALQCLNLSNCRNLTDAGLVH-LKLLTGLQHLNLSDYKNLTDDGL 592

Query: 1041 FGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRL 862
              ++   A  L+ L    C  + D   G+  L P  +L+ L++ +C    DA L  L+ L
Sbjct: 593  IHLMPLMA--LRHLELLGCENLTDA--GLVHLTPLTALQHLNLSHCDDLTDAGLAHLTSL 648

Query: 861  CPNLVHLNLSGLNGVTDYGLLPF 793
               L HL L G   +TD GL  F
Sbjct: 649  T-GLQHLELLGCENLTDAGLARF 670



>gb:BX908798_830588 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 734

 Score = 82.0 bits (201), Expect = 3e-14
 Identities = 94/337 (27%), Positives = 151/337 (44%), Gaps = 26/337 (7%)
 Frame = -3

Query: 1332 LTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCL 1153
            LT L  +NL    +     +   + L  L+ L ++ C  +TD G+  ++     ++ L L
Sbjct: 348  LTGLQHLNLNRCKDLTDAGLSHLKPLTALQHLNLSECWKLTDAGLAHLTP-LTALQHLDL 406

Query: 1152 RKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMK 973
             +C  L+D G+        +++ L L +C   + AG    L H    L  L + N    K
Sbjct: 407  SRCNSLTDAGLAHLTPLT-ALQHLDLSDCQNFTDAG----LAHLTS-LTGLQYLNLSEYK 460

Query: 972  DLA-FGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLP 796
            +L   G+  L P  +L+ L++CNC  F D  L  L+ L   L HL+LS    +TD GL  
Sbjct: 461  NLTDAGLAHLTPLTALQHLNLCNCRKFTDNGLAHLTPLTA-LQHLDLSHCKNLTDDGLAH 519

Query: 795  FVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIAD--- 625
                   GL ++ LS C  +TD  ++ +  L    L+ L+L+ C  +TDA LA +     
Sbjct: 520  LAPL--TGLQRLVLSWCDKLTDAGLAHLTPL--TALQYLDLSCCE-ITDAGLAHLTPLTG 574

Query: 624  -------YCSVLRDLDI---------------SKSRVSDFGIAALAGGSAIQFSLQILSL 511
                   YC  L D  +               S +R++D G+A LA  +A    LQ L+L
Sbjct: 575  LQHLVLVYCWQLTDAGLAHLTPLTTLQYLYLGSCNRLTDAGLAHLAPLTA----LQHLAL 630

Query: 510  SGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
            + C   +D  L +L  L  +L  L +  C  ++  G+
Sbjct: 631  NDCRKLTDTGLAHLTPL-TALQHLTLNRCEKLTDDGL 666



 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 76/263 (28%), Positives = 128/263 (48%), Gaps = 1/263 (0%)
 Frame = -3

Query: 1185 KGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLK 1006
            K C N+K L  +KC  ++D G ++ +    +++ L L +C +++  G+  +   +   L+
Sbjct: 246  KNCKNLKILHFKKCWGVTDAG-LAHLTPLTTLQYLDLSDCEKLTDDGLAHLTPLTG--LQ 302

Query: 1005 ALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGL 826
             L    C  + D   G+  L P  +L+ L++  C    DA L  L+ L   L HLNL+  
Sbjct: 303  HLDLSWCSSLTDA--GLAHLTPLTALQHLNLNRCEYLKDAGLAHLTPL-TGLQHLNLNRC 359

Query: 825  NGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDA 646
              +TD GL          L  +NLS C  +TD  ++ +  L    L+ L+L+ C  +TDA
Sbjct: 360  KDLTDAGLSHLKPL--TALQHLNLSECWKLTDAGLAHLTPL--TALQHLDLSRCNSLTDA 415

Query: 645  SLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYL 469
             LA +    + L+ LD+S     +D G+A L   + +Q+    L+LS     +D  L +L
Sbjct: 416  GLAHLTP-LTALQHLDLSDCQNFTDAGLAHLTSLTGLQY----LNLSEYKNLTDAGLAHL 470

Query: 468  HKLGNSLAGLNIQNCVGISHRGV 400
              L  +L  LN+ NC   +  G+
Sbjct: 471  TPL-TALQHLNLCNCRKFTDNGL 492



 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 81/292 (27%), Positives = 132/292 (45%), Gaps = 6/292 (2%)
 Frame = -3

Query: 1392 LQSLNISD---ISLAVIGHYGVALTDLALINL---QNINERGFWVMGSGQGLHKLRSLVI 1231
            LQ L++SD    + A + H   +LT L  +NL   +N+ + G   +     L  L+ L +
Sbjct: 426  LQHLDLSDCQNFTDAGLAHL-TSLTGLQYLNLSEYKNLTDAG---LAHLTPLTALQHLNL 481

Query: 1230 TACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQ 1051
              C+  TD G+  ++     ++ L L  C  L+D+G+         ++ L L  C +++ 
Sbjct: 482  CNCRKFTDNGLAHLTP-LTALQHLDLSHCKNLTDDGLAHLAPLT-GLQRLVLSWCDKLTD 539

Query: 1050 AGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVL 871
            AG    L H    L AL + +    +    G+  L P   L+ L +  C    DA L  L
Sbjct: 540  AG----LAHLT-PLTALQYLDLSCCEITDAGLAHLTPLTGLQHLVLVYCWQLTDAGLAHL 594

Query: 870  SRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGET 691
            + L   L +L L   N +TD GL          L  + L+ C  +TD  ++ +  L    
Sbjct: 595  TPLT-TLQYLYLGSCNRLTDAGLAHLAPL--TALQHLALNDCRKLTDTGLAHLTPL--TA 649

Query: 690  LELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQ 535
            L+ L LN C  +TD  LA +    + L+ LD+S   ++D G+A L    A+Q
Sbjct: 650  LQHLTLNRCEKLTDDGLAHLKPLAA-LQYLDLSYCEITDAGLAHLTHLMALQ 700



>gb:BX908798_830838 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 1082

 Score = 81.6 bits (200), Expect = 4e-14
 Identities = 90/277 (32%), Positives = 136/277 (49%), Gaps = 5/277 (1%)
 Frame = -3

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TD  + A+ K C N+K L L++C  L+D G ++ + +  +++ L L  C   + AG   
Sbjct: 781  LTDAHLLAL-KNCKNLKALHLQECPNLTDAG-LAHLTSLVTLQHLDLSYCSNFTDAG--- 835

Query: 1035 ILVHSAGKLKALAFENCFGMKDLA-FGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLC 859
             L H    L AL   N    ++L   G+  L P  +L+ L +  C+ F DA L  L+ L 
Sbjct: 836  -LAH-LRPLVALTHLNLRWCRNLTDAGLAHLTPLVALKYLDLSYCSNFTDAGLTHLTPLV 893

Query: 858  PNLVHLNLSGLNGVTDYGLL---PFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETL 688
              L HL+LS  +  TD GL    P V      L  +NL  C N TD  ++ +  L    L
Sbjct: 894  -TLQHLDLSCCSNFTDAGLAHLRPLV-----ALTHLNLRWCHNFTDAGLAHLTPL--VAL 945

Query: 687  ELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSL 511
            + LNLN C  +TDA LA +    + L++LD+S  S  +D G+A L         LQ L L
Sbjct: 946  QHLNLNLCWKLTDAGLAHLRPLVA-LQNLDLSYCSNFTDAGLAHLTP----LVVLQHLDL 1000

Query: 510  SGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
            S C   +D  L +L  L  +L  L++  C  ++  G+
Sbjct: 1001 SSCKKLTDAGLAHLTPL-VALQHLDLSWCNHLTDAGL 1036



>gb:BT002473_1636076 Arabidopsis thaliana SKP1 interacting partner 2
            (SKIP2) (At5g67250) mRNA, complete
            cds.>gb:BT008886_1640082 Arabidopsis thaliana At5g67250
            mRNA, complete cds.>gb:AF263378_1781679 Arabidopsis
            thaliana SKP1 interacting partner 2 (SKIP2) mRNA,
            complete cds.
          Length = 527

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 90/348 (25%), Positives = 141/348 (40%), Gaps = 54/348 (15%)
 Frame = -3

Query: 1428 FSSAGNHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHK 1249
            F S     ++   +S+++SD +LA+I         +  +NL  +  RG            
Sbjct: 103  FDSVTKLALRCDRKSVSLSDEALAMIS--------VRCLNLTRVKLRG------------ 142

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
                    C+ +TDLG+E  +K C N+K+L +  C      GV + ++  + +E L ++ 
Sbjct: 143  --------CREITDLGMEDFAKNCKNLKKLSVGSCNF-GAKGVNAMLEHCKLLEELSVKR 193

Query: 1068 CHRISQAG--------------------------VFGILVHSAGKLKALAFENCFGMKDL 967
               I +A                           VF  L+ +   LK L    C G  D 
Sbjct: 194  LRGIHEAAELIHLPDDASSSSLRSICLKELVNGQVFEPLLATTRTLKTLKIIRCLGDWDK 253

Query: 966  AF-----------------------GVPALPPCNSLRSLSICN---CTGFGDASLVVLSR 865
                                     G+ A+  C+++ +L I     C+ FG   L+ ++ 
Sbjct: 254  VLQMIANGKSSLSEIHLERLQVSDIGLSAISKCSNVETLHIVKTPECSNFG---LIYVAE 310

Query: 864  LCPNLVHLNLSG--LNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGET 691
             C  L  L++ G   N + D GLL   + C   L ++ L G +N T  +++AIA  + E 
Sbjct: 311  RCKLLRKLHIDGWRTNRIGDEGLLSVAKHC-LNLQELVLIG-VNATHMSLAAIAS-NCEK 367

Query: 690  LELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGG 547
            LE L L G G + D  +A IA  C  LR   I    VSD GI ALA G
Sbjct: 368  LERLALCGSGTIGDTEIACIARKCGALRKFCIKGCPVSDRGIEALAVG 415



 Score = 42.0 bits (97), Expect = 0.032
 Identities = 30/93 (32%), Positives = 48/93 (51%)
 Frame = -3

Query: 1410 HLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVI 1231
            +L ++ L  +N + +SLA I      L  LAL     I +     +    G   LR   I
Sbjct: 342  NLQELVLIGVNATHMSLAAIASNCEKLERLALCGSGTIGDTEIACIARKCGA--LRKFCI 399

Query: 1230 TACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLS 1132
              C  V+D GIEA++ GCPN+ +L ++KC +++
Sbjct: 400  KGCP-VSDRGIEALAVGCPNLVKLKVKKCKVVT 431



>gb:BX908798_831474 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 552

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 100/366 (27%), Positives = 168/366 (45%), Gaps = 28/366 (7%)
 Frame = -3

Query: 1413 NHLMKVKLQSLNISDISLA----VIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKL 1246
            N+L    + +L    I LA    +I H+   +  L   N  ++ +     +   +    L
Sbjct: 164  NYLEFTVVSALLNQTIQLAEFEKIINHFSNEIEALNFSNNAHLTDAHLLTL---KNCENL 220

Query: 1245 RSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEEC 1066
            + L + ACQ +TD G+  ++     ++ L L  C  L+D G+V  +K+  ++++L L  C
Sbjct: 221  KVLHLEACQAITDDGLAHLAP-LTALQHLNLNGCYKLTDAGLV-HLKSLTALQTLDLSYC 278

Query: 1065 HRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDA 886
              +  AG+  +   +A  L+ LA  +C  + D   G+  L    +L++L +  C  F DA
Sbjct: 279  KNLKDAGLVHLKPLTA--LQNLALTSCKNLTDR--GLSHLKSLTALQTLDLSYCKNFKDA 334

Query: 885  SLVVLSRLCPNLVHLNLSGLNGVTDYGL-----LPFVQSC---------DAGLVKVN--- 757
             L  L  L   L  L+LS    +TD GL     L  +Q+          DAGL  +    
Sbjct: 335  GLAHLPPLTA-LQTLDLSYCKDLTDRGLSHLKSLTALQTLNLSYCKKLKDAGLAHLKPLT 393

Query: 756  ------LSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI 595
                  L+ C N+TD+ +S +  L    L+ L L+GC  +TDA LA +    + L+ L +
Sbjct: 394  ALQYLALNSCKNLTDRGLSHLKSL--MALQHLVLSGCDNLTDAGLAHLKP-LTALQTLGL 450

Query: 594  SK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVG 418
             +   ++  G+A LA  +A    LQ L LS C    D  L +L  L  +L  L ++ C  
Sbjct: 451  RRCQNLTGDGLAHLAPLTA----LQTLDLSYCKKLKDAGLAHLKPL-TALQTLGLKWCSN 505

Query: 417  ISHRGV 400
            ++  G+
Sbjct: 506  LTDAGL 511



 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 84/297 (28%), Positives = 138/297 (46%), Gaps = 1/297 (0%)
 Frame = -3

Query: 1335 ALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLC 1156
            AL  L L   +N+ + G   +   + L  L++L +T+C+ +TD G+  + K    ++ L 
Sbjct: 269  ALQTLDLSYCKNLKDAGLVHL---KPLTALQNLALTSCKNLTDRGLSHL-KSLTALQTLD 324

Query: 1155 LRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGM 976
            L  C    D G ++ +    ++++L L  C  ++  G+  +   S   L+ L    C  +
Sbjct: 325  LSYCKNFKDAG-LAHLPPLTALQTLDLSYCKDLTDRGLSHL--KSLTALQTLNLSYCKKL 381

Query: 975  KDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLP 796
            KD   G+  L P  +L+ L++ +C    D  L  L  L   L HL LSG + +TD GL  
Sbjct: 382  KDA--GLAHLKPLTALQYLALNSCKNLTDRGLSHLKSLMA-LQHLVLSGCDNLTDAGLAH 438

Query: 795  FVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCS 616
                    L  + L  C N+T   ++ +A L    L+ L+L+ C  + DA LA +    +
Sbjct: 439  LKPL--TALQTLGLRRCQNLTGDGLAHLAPL--TALQTLDLSYCKKLKDAGLAHLKP-LT 493

Query: 615  VLRDLDIS-KSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSL 448
             L+ L +   S ++D G+A L   +A    LQ L LS C   +   L     LG SL
Sbjct: 494  ALQTLGLKWCSNLTDAGLAHLKPLAA----LQHLDLSYCNNLTRAGLANFKILGASL 546



>gb:BX908798_831471 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 683

 Score = 80.5 bits (197), Expect = 8e-14
 Identities = 87/288 (30%), Positives = 138/288 (47%), Gaps = 24/288 (8%)
 Frame = -3

Query: 1191 VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK 1012
            V K C N+K L L+ C  L+D G ++ +     ++ L L  C  ++ AG+  +   +A  
Sbjct: 244  VLKNCKNLKVLYLQGCRNLTDAG-LAHLTPLTGLQHLNLSWCRNLTDAGLAHLAPLTA-- 300

Query: 1011 LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS 832
            L+ L   +C  + D   G+  L P  +L+ L +  C    DA L  L+ L   L +L+LS
Sbjct: 301  LQYLDLSHCRNLTDT--GLAHLTPLTALQHLDLRVCKNITDAGLAHLAPLTA-LQNLDLS 357

Query: 831  GLNGVTDYGL-----LPFVQS---------CDAGLV---------KVNLSGCINVTDKTI 721
                +TD GL     L  +Q           DAGLV          + LS C N+TD  +
Sbjct: 358  DCGHLTDAGLAYLTPLTALQHLNLYFCFNLTDAGLVHLRPLTALQTLGLSQCWNLTDTGL 417

Query: 720  SAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGS 544
            + +  L    L+ LNL+ C  +TDA LA +    + L+ L++S    ++D G+A LA  +
Sbjct: 418  AHLTPL--TALQHLNLSRCYKLTDAGLAHLTP-LTALQHLNLSYCENLTDDGLAHLAPLT 474

Query: 543  AIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
            A+Q+    L LS C   +D  L +L  L  +L  LN+  C  ++  G+
Sbjct: 475  ALQY----LRLSQCWKLTDAGLAHLTPL-TALQHLNLSRCYKLTDAGL 517



 Score = 80.1 bits (196), Expect = 1e-13
 Identities = 79/276 (28%), Positives = 138/276 (50%), Gaps = 1/276 (0%)
 Frame = -3

Query: 1389 QSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVT 1210
            Q  N++D  LA +      LT L  +NL    +     +     L  L+ L ++ C+ +T
Sbjct: 408  QCWNLTDTGLAHL----TPLTALQHLNLSRCYKLTDAGLAHLTPLTALQHLNLSYCENLT 463

Query: 1209 DLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGIL 1030
            D G+  ++     ++ L L +C  L+D G+        +++ L L  C++++ AG+  + 
Sbjct: 464  DDGLAHLAP-LTALQYLRLSQCWKLTDAGLAHLTPLT-ALQHLNLSRCYKLTDAGLARLT 521

Query: 1029 VHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNL 850
              +A  L+ L  + C  + D   G+  L P + L+ L++ NC    DA L  L+ L   L
Sbjct: 522  PLTA--LQHLDLKYCINLTDA--GLARLTPLSGLQHLALTNCKYLTDAGLAHLTLLTA-L 576

Query: 849  VHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLN 670
             +L L+    +TD GL          L  ++LS C ++TD  ++ +  L G  L+ LNL+
Sbjct: 577  QYLALANCKNLTDVGLAHLTPL--TALQHLDLSECRHLTDAGLAHLTPLTG--LQHLNLS 632

Query: 669  GCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGI 565
             C  +TDA LA ++   SVL+ L +S+ SR++D G+
Sbjct: 633  WCRNLTDAGLAHLSP-LSVLQHLALSQCSRLTDDGL 667



 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 74/256 (28%), Positives = 120/256 (46%), Gaps = 5/256 (1%)
 Frame = -3

Query: 1392 LQSLNIS---DISLAVIGHYG--VALTDLALINLQNINERGFWVMGSGQGLHKLRSLVIT 1228
            LQ LN+S    ++ A + H     AL  L L   +N+ + G   +     L  LR   ++
Sbjct: 426  LQHLNLSRCYKLTDAGLAHLTPLTALQHLNLSYCENLTDDGLAHLAPLTALQYLR---LS 482

Query: 1227 ACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQA 1048
             C  +TD G+  ++     ++ L L +C  L+D G+        +++ L L+ C  ++ A
Sbjct: 483  QCWKLTDAGLAHLTP-LTALQHLNLSRCYKLTDAGLARLTPLT-ALQHLDLKYCINLTDA 540

Query: 1047 GVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLS 868
            G+  +   S   L+ LA  NC  + D   G+  L    +L+ L++ NC    D  L  L+
Sbjct: 541  GLARLTPLSG--LQHLALTNCKYLTDA--GLAHLTLLTALQYLALANCKNLTDVGLAHLT 596

Query: 867  RLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETL 688
             L   L HL+LS    +TD GL         GL  +NLS C N+TD  ++ ++ L    L
Sbjct: 597  PLTA-LQHLDLSECRHLTDAGLAHLTPL--TGLQHLNLSWCRNLTDAGLAHLSPL--SVL 651

Query: 687  ELLNLNGCGCVTDASL 640
            + L L+ C  +TD  L
Sbjct: 652  QHLALSQCSRLTDDGL 667



 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 60/180 (33%), Positives = 89/180 (49%), Gaps = 1/180 (0%)
 Frame = -3

Query: 936 NSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVN 757
           N +  ++        DA L+VL   C NL  L L G   +TD GL         GL  +N
Sbjct: 224 NEIERVNFSENAHLTDAHLLVLKN-CKNLKVLYLQGCRNLTDAGLAHLTPL--TGLQHLN 280

Query: 756 LSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLR-DLDISKSRV 580
           LS C N+TD  ++ +A L    L+ L+L+ C  +TD  LA +    ++   DL + K+ +
Sbjct: 281 LSWCRNLTDAGLAHLAPL--TALQYLDLSHCRNLTDTGLAHLTPLTALQHLDLRVCKN-I 337

Query: 579 SDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
           +D G+A LA  +A    LQ L LS C   +D  L YL  L  +L  LN+  C  ++  G+
Sbjct: 338 TDAGLAHLAPLTA----LQNLDLSDCGHLTDAGLAYLTPL-TALQHLNLYFCFNLTDAGL 392



>gb:BX908798_830834 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 731

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 91/301 (30%), Positives = 142/301 (47%), Gaps = 26/301 (8%)
 Frame = -3

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TD  + A+ K C N+K L L++C  L+D G+V ++    S++ L L +C +++ AG   
Sbjct: 335  LTDAHLLAL-KNCKNLKALHLQECYKLTDTGLV-YLAPLVSLQYLNLFDCIKLTDAG--- 389

Query: 1035 ILVHSAGKLKALAFENCFGMKDLA-FGVPALPPCNSLRSLSICNCTGFGDAS------LV 877
             L H    L AL   N  G   L   G+  L P  +L+ L +  C    DA       LV
Sbjct: 390  -LAHLT-PLVALRHLNLMGCNKLTNAGLMHLRPLMALQHLDLSCCRNLTDAGLAHLAPLV 447

Query: 876  VLSRLC------------------PNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLS 751
             L  LC                   NL HLNL+    +TD GL          L  ++LS
Sbjct: 448  ALQHLCLSECTNLTGAGLAHLKPLVNLQHLNLNSCYKLTDAGLAHLTPL--MALQHLDLS 505

Query: 750  GCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSD 574
             C N+TD  ++ +  L    L+ L+LN C   TDA L  +    + L+ L++S  R ++D
Sbjct: 506  CCRNLTDAGLAHLRPL--VALQHLDLNCCKNFTDAGLTHLTPLVA-LQHLNLSCCRNLTD 562

Query: 573  FGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDL 394
             G+A L        +L  L+L+GC   +D  L +L  L  +L  LN+ +C  +++ G++ 
Sbjct: 563  AGLAYLMP----LVALSHLNLAGCHNFTDAGLAHLAPL-VALQHLNLGDCYRLTNAGLEH 617

Query: 393  L 391
            L
Sbjct: 618  L 618



 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 78/272 (28%), Positives = 126/272 (46%), Gaps = 6/272 (2%)
 Frame = -3

Query: 1398 VKLQSLNISDISLAVIGHYGVALTDLA-LINLQNINERGFWVMGSGQGLH-----KLRSL 1237
            V LQ L +S+ +       G  L  L  L+NLQ++N    + +      H      L+ L
Sbjct: 447  VALQHLCLSECTNLT----GAGLAHLKPLVNLQHLNLNSCYKLTDAGLAHLTPLMALQHL 502

Query: 1236 VITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRI 1057
             ++ C+ +TD G+ A  +    ++ L L  C   +D G+        +++ L L  C  +
Sbjct: 503  DLSCCRNLTDAGL-AHLRPLVALQHLDLNCCKNFTDAGLTHLTPLV-ALQHLNLSCCRNL 560

Query: 1056 SQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLV 877
            + AG+  ++   A  L  L    C    D   G+  L P  +L+ L++ +C    +A L 
Sbjct: 561  TDAGLAYLMPLVA--LSHLNLAGCHNFTDA--GLAHLAPLVALQHLNLGDCYRLTNAGLE 616

Query: 876  VLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG 697
             L+ L   L HL+LS    +TD GL   V      L  ++LS C  +TD  ++ +  L  
Sbjct: 617  HLTPLVA-LQHLDLSECEKLTDAGLTHLVPL--VALTHLDLSECDKLTDAGLAHLTPL-- 671

Query: 696  ETLELLNLNGCGCVTDASLAAIADYCSVLRDL 601
            E L+ LNLN C  +TDA LA +    + L+DL
Sbjct: 672  EALQHLNLNWCDKLTDAGLAHLTPLLA-LQDL 702



>gb:BX908798_831476 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 517

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 84/285 (29%), Positives = 145/285 (50%), Gaps = 1/285 (0%)
 Frame = -3

Query: 1251 KLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLE 1072
            K+ +L  +    +TD  + A+ K C N+K L L  C  ++D+G ++ +    +++ L L 
Sbjct: 226  KIEALNFSENAYLTDAHLLAL-KVCKNLKVLHLEACQAITDDG-LAHLTPLTALQHLDLS 283

Query: 1071 ECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG 892
            +C +++  G+  +   +A  L+ L    C  + D   G+  L P  +L+ L++ +C    
Sbjct: 284  QCRKLTGIGLAHLTPLTA--LQHLDLSGCDNLTDA--GLAHLAPLTALQHLNLSDCENLT 339

Query: 891  DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI 712
            DA LV LS L   L HL+LS    + +Y  L  ++   A L  ++LS CIN+TD  ++ +
Sbjct: 340  DAGLVHLSPLIA-LQHLDLSYCWRL-NYAGLAHLKPLTA-LQYLDLSHCINLTDAGLAHL 396

Query: 711  AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKS-RVSDFGIAALAGGSAIQ 535
              L    L+ LNL  C  +TDA LA +    + L+ L++S+   ++D G+  L   +A  
Sbjct: 397  KPL--MRLQYLNLRYCENLTDAGLAHLTPLMA-LQHLNLSECYHLTDAGLTHLTPLTA-- 451

Query: 534  FSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
              LQ L LS C   +D  L +L  L   L  L++  C  ++  G+
Sbjct: 452  --LQHLDLSHCRSLTDAGLAHLTSL-TVLQYLDLSYCKNLTDAGL 493



>gb:BX908798_831064 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 657

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 85/286 (29%), Positives = 135/286 (47%), Gaps = 22/286 (7%)
 Frame = -3

Query: 1191 VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGI------- 1033
            V K C N+K L L  C  L+D G ++ +    +++ L L +C  ++ AG+  +       
Sbjct: 329  VLKNCKNLKALYLEGCKNLTDTG-LAHLSPLVALQHLSLFDCENLTDAGLAYLSPLENLQ 387

Query: 1032 ---LVHS----------AGKLKALAFENCFGMKDL-AFGVPALPPCNSLRSLSICNCTGF 895
               L HS             L AL   N FG ++L   G+  L    +L+ L +  C   
Sbjct: 388  HLNLSHSKHFTNAGLAHLSPLAALQHLNLFGCENLTGDGLTHLSSLVALQHLGLNFCRNL 447

Query: 894  GDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISA 715
             DA L  L+ L   L HL+L+  + +TD GL          L  +NL  C N+TD  +  
Sbjct: 448  TDAGLAHLAPLV-TLQHLDLNFCDNLTDTGLAHLTSL--VTLQHLNLGWCRNLTDAGLVH 504

Query: 714  IAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAI 538
            ++ L  E L+ L+LN C  +TDA LA +    + L+ L++ + R ++D G+A L    A+
Sbjct: 505  LSPL--ENLQHLDLNDCYNLTDAGLAHLTPLVA-LQHLNLRRCRKLTDAGLAHLTPLVAL 561

Query: 537  QFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
            Q+    L L GC   +D  L +L  L  +L  L +  C  ++ RG+
Sbjct: 562  QY----LDLFGCRNLTDAGLTHLTPL-IALQHLYLGLCNNLTDRGL 602



>gb:BX908798_830698 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 590

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 78/263 (29%), Positives = 127/263 (48%), Gaps = 1/263 (0%)
 Frame = -3

Query: 1185 KGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLK 1006
            K C NVK L  +KC  ++D G ++ +    +++ L L +C  ++ AG+  +   +A  L+
Sbjct: 247  KDCKNVKVLYFKKCRDVTDAG-LAHLTPLTALQHLGLSDCENLTDAGLAHLTTLTA--LQ 303

Query: 1005 ALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGL 826
             L    C+ + D   G+  L P   L+ L + +C     A L  L+ L   L HL+L   
Sbjct: 304  HLDLSGCWNLTD--SGLVHLTPLVGLQHLGLSDCENLTVAGLAHLTSLTA-LQHLDLRNC 360

Query: 825  NGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDA 646
              +TD GL          L  ++LS C N+TD  ++ +  L    L+ LNL  C  +TDA
Sbjct: 361  YNLTDAGLAHLTPL--TALQHLDLSCCYNLTDAGLAHLTPL--TALQHLNLCCCRKLTDA 416

Query: 645  SLAAIADYCSVLRDLDISKS-RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYL 469
             LA +    + L+ LD+S    ++D G+A L   +A    L  L+LS C   +   L +L
Sbjct: 417  GLAHLTP-LTALQHLDLSYCYNLTDAGLAHLTPLTA----LLHLNLSECWKLTGAGLAHL 471

Query: 468  HKLGNSLAGLNIQNCVGISHRGV 400
              L  +L  LN+  C  ++  G+
Sbjct: 472  TPL-VALQHLNLSKCNNLTDAGL 493



 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 74/259 (28%), Positives = 120/259 (46%), Gaps = 1/259 (0%)
 Frame = -3

Query: 1338 VALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQL 1159
            V L  L L + +N+   G   + S   L  L+ L +  C  +TD G+  ++     ++ L
Sbjct: 325  VGLQHLGLSDCENLTVAGLAHLTS---LTALQHLDLRNCYNLTDAGLAHLTP-LTALQHL 380

Query: 1158 CLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFG 979
             L  C  L+D G+        +++ L L  C +++ AG+  +   +A  L+ L    C+ 
Sbjct: 381  DLSCCYNLTDAGLAHLTPLT-ALQHLNLCCCRKLTDAGLAHLTPLTA--LQHLDLSYCYN 437

Query: 978  MKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLL 799
            + D   G+  L P  +L  L++  C     A L  L+ L   L HLNLS  N +TD GL+
Sbjct: 438  LTDA--GLAHLTPLTALLHLNLSECWKLTGAGLAHLTPLVA-LQHLNLSKCNNLTDAGLV 494

Query: 798  PFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYC 619
                     L  +NLS C   TD  ++ +  L    L+ L+L GC  +TDA L  +    
Sbjct: 495  HLAPL--TALQHLNLSWCKKFTDAGLAHLTLL--TALQSLDLIGCNNLTDAGLVHLTP-L 549

Query: 618  SVLRDLD-ISKSRVSDFGI 565
            + L+ LD I    ++D G+
Sbjct: 550  TALQYLDLIGCKNLTDAGL 568



>pir|G96837|G96837 unknown protein T21F11.10 [imported] - Arabidopsis
            thaliana>gb:AE005173_895569 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:AC018849_1538420 Arabidopsis thaliana
            chromosome 1 BAC T21F11 genomic sequence, complete
            sequence.>gb:BT002966_1636549 Arabidopsis thaliana clone
            RAFL14-85-E11 (R20418) putative F-box family protein,
            AtFBL14 (At1g80570) mRNA, complete
            cds.>gb:BT004407_1637479 Arabidopsis thaliana clone
            U20418 putative F-box family protein, AtFBL14 (At1g80570)
            mRNA, complete cds.
          Length = 467

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 93/358 (25%), Positives = 155/358 (43%), Gaps = 28/358 (7%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGI 1198
            + D  L V+     +LTDL L     I + G   +G      +L SL +     +T  G+
Sbjct: 84   VDDQGLLVLTTNCHSLTDLTLSFCTFITDVG---IGHLSSCPELSSLKLNFAPRITGCGV 140

Query: 1197 EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSA 1018
             +++ GC  +++L L +C  ++    + +    E++E L ++ C  I +  +   L +S 
Sbjct: 141  LSLAVGCKKLRRLHLIRCLNVASVEWLEYFGKLETLEELCIKNCRAIGEGDLIK-LRNSW 199

Query: 1017 GKLKALAFE--------NCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRL 862
             KL +L FE          +   D+      L PC+SL  LS+ NC       L  + R 
Sbjct: 200  RKLTSLQFEVDANYRYMKVYDQLDVERWPKQLVPCDSLVELSLGNCIIAPGRGLACVLRN 259

Query: 861  CPNLVHLNLSGLNGVTDYGLLPFVQSC------------DAGLVKVNLSGCINVTDKTIS 718
            C NL  L+L    GV+D  ++  VQ              D  L  +N +  + +TD+++S
Sbjct: 260  CKNLEKLHLDMCTGVSDSDIIALVQKASHLRSISLRVPSDFTLPLLN-NITLRLTDESLS 318

Query: 717  AIAKLHGETLELLNLN-------GCGCVTDASLAAIADYCSVLRDLDISKSRV-SDFGIA 562
            AIA+ H   LE   ++            T   +  +   C V R+L +    V +D G+ 
Sbjct: 319  AIAQ-HCSKLESFKISFSDGEFPSLFSFTLQGIITLIQKCPV-RELSLDHVCVFNDMGME 376

Query: 561  ALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLV 388
            AL         L+IL L  C   SD+ L  + +   SL  L +  C+G++  G+  LV
Sbjct: 377  ALCSAQ----KLEILELVHCQEVSDEGLILVSQF-PSLNVLKLSKCLGVTDDGMRPLV 429



 Score = 42.7 bits (99), Expect = 0.019
 Identities = 44/181 (24%), Positives = 72/181 (39%), Gaps = 41/181 (22%)
 Frame = -3

Query: 1203 GIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECH------------R 1060
            G+  V + C N+++L L  CT +SD+ +++ V+ A  + S+ L                R
Sbjct: 252  GLACVLRNCKNLEKLHLDMCTGVSDSDIIALVQKASHLRSISLRVPSDFTLPLLNNITLR 311

Query: 1059 ISQAGVFGILVH-----------SAGKLKALAFENCFGMKDLA----------------- 964
            ++   +  I  H           S G+  +L      G+  L                  
Sbjct: 312  LTDESLSAIAQHCSKLESFKISFSDGEFPSLFSFTLQGIITLIQKCPVRELSLDHVCVFN 371

Query: 963  -FGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQ 787
              G+ AL     L  L + +C    D  L+++S+  P+L  L LS   GVTD G+ P V 
Sbjct: 372  DMGMEALCSAQKLEILELVHCQEVSDEGLILVSQF-PSLNVLKLSKCLGVTDDGMRPLVG 430

Query: 786  S 784
            S
Sbjct: 431  S 431



>gb:BX908798_830753 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 666

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 85/295 (28%), Positives = 137/295 (46%), Gaps = 23/295 (7%)
 Frame = -3

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TD  + A+ K C N+K L  + C +++D G ++ +    S++ L L +   I+ AG+  
Sbjct: 197  LTDAHLLAL-KNCKNLKILHFKNCRVITDAG-LAHLTPLTSLQRLNLSKLWCITDAGLAH 254

Query: 1035 ILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCP 856
            +    A  L+ L    C  + D   G+  L P  +L+ L +  C    DA L  L+ L  
Sbjct: 255  LTTLKA--LQHLDLSQCSKLTD--DGLAHLTPLTALQHLGLNYCENLTDAGLAHLT-LLT 309

Query: 855  NLVHLNLSGLNGVTDYGL-----LPFVQSCD------------------AGLVKVNLSGC 745
             L HL+LS    +TD GL     L  +Q  D                   GL  ++LS C
Sbjct: 310  GLQHLDLSNCKNLTDAGLAHLTSLMALQHLDLSWCLKLTDAGLAHLTSLTGLQHLDLSNC 369

Query: 744  INVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGI 565
             N+TD  ++ +  L    L+ LNL+ C  +TDA LA +    + L+ L++S+  ++  G+
Sbjct: 370  KNLTDAGLAHLTSL--MALQHLNLSWCLKLTDAGLAHLTP-LTALQHLNLSRYNLTYAGL 426

Query: 564  AALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
            A L   +     LQ L LSG     D  L +L  L  +L  LN+  C  ++  G+
Sbjct: 427  AHLTSLT----GLQHLDLSGSRKLIDAGLAHLRPL-VALQHLNLTGCWKLTDAGL 476



 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 96/337 (28%), Positives = 157/337 (46%), Gaps = 6/337 (1%)
 Frame = -3

Query: 1392 LQSLNISD---ISLAVIGHYGV--ALTDLALINLQNINERGFWVMGSGQGLHKLRSLVIT 1228
            LQ LN+S    I+ A + H     AL  L L     + + G   +     L  L+ L + 
Sbjct: 236  LQRLNLSKLWCITDAGLAHLTTLKALQHLDLSQCSKLTDDG---LAHLTPLTALQHLGLN 292

Query: 1227 ACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQA 1048
             C+ +TD G+  ++     ++ L L  C  L+D G+ + + +  +++ L L  C +++ A
Sbjct: 293  YCENLTDAGLAHLTL-LTGLQHLDLSNCKNLTDAGL-AHLTSLMALQHLDLSWCLKLTDA 350

Query: 1047 GVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLS 868
            G+  +   S   L+ L   NC  + D   G+  L    +L+ L++  C    DA L  L+
Sbjct: 351  GLAHLT--SLTGLQHLDLSNCKNLTDA--GLAHLTSLMALQHLNLSWCLKLTDAGLAHLT 406

Query: 867  RLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETL 688
             L   L HLNLS  N    Y  L  + S   GL  ++LSG   + D  ++ +  L    L
Sbjct: 407  PLTA-LQHLNLSRYN--LTYAGLAHLTSL-TGLQHLDLSGSRKLIDAGLAHLRPL--VAL 460

Query: 687  ELLNLNGCGCVTDASLAAIADYCSVLRDLDIS-KSRVSDFGIAALAGGSAIQFSLQILSL 511
            + LNL GC  +TDA LA ++     L+ L +S    ++  G+A L    A+Q+    L L
Sbjct: 461  QHLNLTGCWKLTDAGLAHLSP-LKALQTLGLSWCQNLTGAGLAHLKPLVALQY----LDL 515

Query: 510  SGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
            S C   +D  L +L  L  +L  LN+  C  ++  G+
Sbjct: 516  SNCNNLTDAGLAHLRPL-VALQHLNLTGCWKLTDAGL 551



 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 94/331 (28%), Positives = 149/331 (45%), Gaps = 24/331 (7%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLG 1201
            N++D  LA +      L  L L N +N+ + G   + S   L  L+ L ++ C  +TD G
Sbjct: 296  NLTDAGLAHLTLL-TGLQHLDLSNCKNLTDAGLAHLTS---LMALQHLDLSWCLKLTDAG 351

Query: 1200 IEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHS 1021
            +  ++     ++ L L  C  L+D G+ + + +  +++ L L  C +++ AG    L H 
Sbjct: 352  LAHLTS-LTGLQHLDLSNCKNLTDAGL-AHLTSLMALQHLNLSWCLKLTDAG----LAHL 405

Query: 1020 AGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHL 841
               L AL   N         G+  L     L+ L +       DA L  L  L   L HL
Sbjct: 406  T-PLTALQHLNLSRYNLTYAGLAHLTSLTGLQHLDLSGSRKLIDAGLAHLRPLVA-LQHL 463

Query: 840  NLSGLNGVTDYGL-------------LPFVQSCD-AGLVKV---------NLSGCINVTD 730
            NL+G   +TD GL             L + Q+   AGL  +         +LS C N+TD
Sbjct: 464  NLTGCWKLTDAGLAHLSPLKALQTLGLSWCQNLTGAGLAHLKPLVALQYLDLSNCNNLTD 523

Query: 729  KTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKS-RVSDFGIAALA 553
              ++ +  L    L+ LNL GC  +TDA LA +    + L+ L++S   +++D G+A L 
Sbjct: 524  AGLAHLRPL--VALQHLNLTGCWKLTDAGLAHLTSLMA-LQHLNLSWCLKLTDAGLAHLK 580

Query: 552  GGSAIQFSLQILSLSGCVLASDKCLPYLHKL 460
                   +LQ L LS C   +D+ L +L  L
Sbjct: 581  P----LVALQHLDLSNCNNLTDEGLTHLRPL 607



>gb:BX908798_829604 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 531

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 72/230 (31%), Positives = 114/230 (49%), Gaps = 4/230 (1%)
 Frame = -3

Query: 1101 AESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRS 922
            +  IE L   E   ++ A +  +   +   LKAL  + C  + D   G+ +L    +L+ 
Sbjct: 295  SNEIEKLNFSENAHLTDAHLLAL--KNCKNLKALHLQACHNLTD--DGLASLTSLTNLQY 350

Query: 921  LSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLL---PFVQSCDAGLVKVNLS 751
            L++  C    +  L     L   L +LNLSG   +TD GL    P V      L  +NLS
Sbjct: 351  LNLSCCDKLTNKGLAHFKSLIA-LQYLNLSGCAFITDAGLAHLKPLV-----ALQYLNLS 404

Query: 750  GCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS-KSRVSD 574
            GC  +TD  ++ +  L    L+ LNL+GC  +TDA LA +    + L+ LD+S  + +++
Sbjct: 405  GCAFITDAGLAHLKPL--VALQYLNLSGCAFITDAGLAHLTPLVT-LKHLDLSWCNSLTN 461

Query: 573  FGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC 424
             G+  LA       +LQ L+LSGC+  ++  L +L  L N L  LN+ +C
Sbjct: 462  AGLERLAS----LVALQHLNLSGCIYLTEAGLTHLTSLTN-LQQLNLNHC 506



 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 62/194 (31%), Positives = 98/194 (50%), Gaps = 2/194 (1%)
 Frame = -3

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TD  + A+ K C N+K L L+ C  L+D+G+ S + +  +++ L L  C +++  G   
Sbjct: 309  LTDAHLLAL-KNCKNLKALHLQACHNLTDDGLAS-LTSLTNLQYLNLSCCDKLTNKG--- 363

Query: 1035 ILVH--SAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRL 862
             L H  S   L+ L    C  + D   G+  L P  +L+ L++  C    DA L  L  L
Sbjct: 364  -LAHFKSLIALQYLNLSGCAFITDA--GLAHLKPLVALQYLNLSGCAFITDAGLAHLKPL 420

Query: 861  CPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLEL 682
               L +LNLSG   +TD GL          L  ++LS C ++T+  +  +A L    L+ 
Sbjct: 421  VA-LQYLNLSGCAFITDAGLAHLTPL--VTLKHLDLSWCNSLTNAGLERLASL--VALQH 475

Query: 681  LNLNGCGCVTDASL 640
            LNL+GC  +T+A L
Sbjct: 476  LNLSGCIYLTEAGL 489



>gb:BX908798_831548 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 537

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 88/318 (27%), Positives = 149/318 (46%), Gaps = 6/318 (1%)
 Frame = -3

Query: 1395 KLQSLNISDISLAVIGHYGVALTD---LALINLQNINERGFWVMGSGQGLHKLRSLVITA 1225
            +++ LN SD ++ +   Y +AL D   L ++NL++        +     L  LR L ++ 
Sbjct: 240  EIEELNFSD-NVYLTDAYLLALKDCKNLKMLNLKSCKNLTDAGLAHLTPLTALRRLDLSF 298

Query: 1224 CQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAG 1045
            C+ +TD G+  ++     ++ L L  C  L+D G+        ++  L L  C +++ AG
Sbjct: 299  CRNLTDAGLANLTPLIA-LQHLDLSWCKNLTDAGLAHLTPLG-ALHYLDLSICGKLTDAG 356

Query: 1044 VFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSR 865
            +  +       L+ L    C  + D   G+  L    +L+ L +  C    DA L  L+R
Sbjct: 357  LAHLT--PLVDLQHLNLRYCQKLSDA--GLAHLRSLVTLQHLDLSYCQNLTDAGLAHLAR 412

Query: 864  LCPNLVHLNLSGLNGVTDYGLL---PFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGE 694
            L   L HL+L+    +T+ GL+   P V      L  ++LS C  +T+  +     L   
Sbjct: 413  LTA-LQHLSLNRCKNLTEAGLVHLRPLVT-----LQHLDLSYCQKLTNDGLGLFKSL--T 464

Query: 693  TLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILS 514
             L+ LNLN C  +TDA LA ++     L+ LD+  + ++D G+A L    A+Q+    L 
Sbjct: 465  ALQYLNLNHCQKLTDAGLAHLSP-LGALQHLDLWCTNITDAGLAHLKPLGALQY----LG 519

Query: 513  LSGCVLASDKCLPYLHKL 460
            LS C   +D  L +L  L
Sbjct: 520  LSRCTNLTDAGLAHLSPL 537



>gb:BX908798_831051 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 559

 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 92/317 (29%), Positives = 137/317 (43%), Gaps = 50/317 (15%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            L+ L + +CQ +TD  +  ++     ++ L L KC  L+D G+V       +++ L L  
Sbjct: 252  LKVLHLVSCQAITDDRLAHLTP-LTALQHLNLSKCRKLTDTGLVHLTPLT-ALQHLDLSY 309

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGMKDLA-FGVPALPPCNSLRSLSICNCTGFG 892
            C  ++ AG    L H    LKAL   N  G   L   G+  L P  +L+ L +  C    
Sbjct: 310  CKNLTDAG----LAHLT-PLKALQHLNLRGFGKLTDAGLVHLTPLTALQYLDLSWCKNLT 364

Query: 891  DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFV----------QSC------------- 781
            DA L  L+ L   L HLNLSG   +TD GL   +            C             
Sbjct: 365  DAGLAHLTPLT-GLQHLNLSGWYHLTDAGLARLIFLTALQHLDLSDCENLTSAGLERLTS 423

Query: 780  ----------------DAGLVKV---------NLSGCINVTDKTISAIAKLHGETLELLN 676
                            DAGL+ +         NLSGC ++TD  +  +  L    L+ LN
Sbjct: 424  LTALQHLGLSYCMNLTDAGLIHLTPLTALQHLNLSGCFHLTDAGLVHLTPL--TALQHLN 481

Query: 675  LNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILSLSGCV 499
            L GC  +TDA LA +    + L+ L++S+ + +++ G+  LA  +A    LQ L+LS C 
Sbjct: 482  LGGCENLTDAGLAYLTP-LTALQHLNLSRCKHLTEAGLTHLASLTA----LQHLNLSYCD 536

Query: 498  LASDKCLPYLHKLGNSL 448
              +D  L     L  SL
Sbjct: 537  NLTDAGLERFKALAASL 553



 Score = 77.4 bits (189), Expect = 7e-13
 Identities = 79/273 (28%), Positives = 127/273 (46%), Gaps = 1/273 (0%)
 Frame = -3

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TD    A+ K C N+K L L  C  ++D+  ++ +    +++ L L +C +++  G   
Sbjct: 238  LTDAHFSAL-KDCKNLKVLHLVSCQAITDDR-LAHLTPLTALQHLNLSKCRKLTDTG--- 292

Query: 1035 ILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCP 856
             LVH                         L P  +L+ L +  C    DA L  L+ L  
Sbjct: 293  -LVH-------------------------LTPLTALQHLDLSYCKNLTDAGLAHLTPL-K 325

Query: 855  NLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLN 676
             L HLNL G   +TD GL+         L  ++LS C N+TD  ++ +  L G  L+ LN
Sbjct: 326  ALQHLNLRGFGKLTDAGLVHLTPL--TALQYLDLSWCKNLTDAGLAHLTPLTG--LQHLN 381

Query: 675  LNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCV 499
            L+G   +TDA LA +  + + L+ LD+S    ++  G+  L   +A    LQ L LS C+
Sbjct: 382  LSGWYHLTDAGLARLI-FLTALQHLDLSDCENLTSAGLERLTSLTA----LQHLGLSYCM 436

Query: 498  LASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
              +D  L +L  L  +L  LN+  C  ++  G+
Sbjct: 437  NLTDAGLIHLTPL-TALQHLNLSGCFHLTDAGL 468



 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 69/216 (31%), Positives = 110/216 (50%), Gaps = 1/216 (0%)
 Frame = -3

Query: 1035 ILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCP 856
            I+ H + +++AL F N   + D  F   AL  C +L+ L + +C    D  L  L+ L  
Sbjct: 219  IINHLSNEIEALNFSNNTYLTDAHFS--ALKDCKNLKVLHLVSCQAITDDRLAHLTPLTA 276

Query: 855  NLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLN 676
             L HLNLS    +TD GL+         L  ++LS C N+TD  ++ +  L  + L+ LN
Sbjct: 277  -LQHLNLSKCRKLTDTGLVHLTPL--TALQHLDLSYCKNLTDAGLAHLTPL--KALQHLN 331

Query: 675  LNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILSLSGCV 499
            L G G +TDA L  +    + L+ LD+S  + ++D G+A L   +     LQ L+LSG  
Sbjct: 332  LRGFGKLTDAGLVHLTP-LTALQYLDLSWCKNLTDAGLAHLTPLT----GLQHLNLSGWY 386

Query: 498  LASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
              +D  L  L  L  +L  L++ +C  ++  G++ L
Sbjct: 387  HLTDAGLARLIFL-TALQHLDLSDCENLTSAGLERL 421



>gb:BC087158_2110046 Rattus norvegicus cDNA clone MGC:95282
            IMAGE:7134260, complete cds.
          Length = 589

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 70/280 (25%), Positives = 126/280 (45%), Gaps = 2/280 (0%)
 Frame = -3

Query: 1407 LMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVIT 1228
            ++ + L +  I++ ++ ++  Y   L +L+L   +   ++G   +  G G HKL  L ++
Sbjct: 314  VLYLNLSNTTITNRTMRLLPRYFHNLQNLSLAYCRKFTDKGLQYLNLGNGCHKLIYLDLS 373

Query: 1227 ACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQA 1048
             C  ++  G   ++  C  +  L +     L+DN V   V+    I S+       IS  
Sbjct: 374  GCTQISVQGFRNIANSCTGIMHLTINDMPTLTDNCVKVLVEKCPRISSVVFIGSPHISDC 433

Query: 1047 GVFGILVHSAGKLKALAFENCFGMKDLAF-GVPALPPCNSLRSLSICNCTGFGDASLVVL 871
                +   SA  LK + FE    + D  F  V    P   +  + + +C G  D+SL  L
Sbjct: 434  AFKAL---SACDLKKIRFEGNKRITDACFKSVDRNYP--GISHIYMVDCKGLTDSSLKSL 488

Query: 870  SRLCPNLVHLNLSGLNGVTDYGLLPFVQS-CDAGLVKVNLSGCINVTDKTISAIAKLHGE 694
            S L   L  LNL+    + D GL  F        L ++NL+ C  + D ++  +++    
Sbjct: 489  SVL-KQLTVLNLTNCVRIGDIGLRQFFDGPASVKLRELNLANCSLLGDTSVIRLSE-RCP 546

Query: 693  TLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSD 574
             L  LNL  C  +TD ++  IA   S++  +D+S + +S+
Sbjct: 547  NLHYLNLRNCEHLTDLAIEYIASMLSLI-SIDLSGTLISN 585



 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 73/321 (22%), Positives = 139/321 (43%), Gaps = 9/321 (2%)
 Frame = -3

Query: 1314 INLQNINERGFWV----MGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRK 1147
            +N+  +N RG  +    + S      L+ L ++ C   TD  +  +S+GCP V  L L  
Sbjct: 262  LNVLRLNFRGCVLRAKTLKSVSHCKNLQELNVSDCPSFTDESMRHISEGCPGVLYLNLSN 321

Query: 1146 CTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGI-LVHSAGKLKALAFENCFGMKD 970
             T+ ++  +    +   ++++L L  C + +  G+  + L +   KL  L    C  +  
Sbjct: 322  TTI-TNRTMRLLPRYFHNLQNLSLAYCRKFTDKGLQYLNLGNGCHKLIYLDLSGCTQISV 380

Query: 969  LAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFV 790
              F   A   C  +  L+I +     D  + VL   CP +  +   G   ++D      +
Sbjct: 381  QGFRNIA-NSCTGIMHLTINDMPTLTDNCVKVLVEKCPRISSVVFIGSPHISDCAFKA-L 438

Query: 789  QSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVL 610
             +CD  L K+   G   +TD    ++ + +     +  ++ C  +TD+SL ++    SVL
Sbjct: 439  SACD--LKKIRFEGNKRITDACFKSVDRNYPGISHIYMVD-CKGLTDSSLKSL----SVL 491

Query: 609  RDLDISKS----RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAG 442
            + L +       R+ D G+     G A    L+ L+L+ C L  D  +  L +   +L  
Sbjct: 492  KQLTVLNLTNCVRIGDIGLRQFFDGPA-SVKLRELNLANCSLLGDTSVIRLSERCPNLHY 550

Query: 441  LNIQNCVGISHRGVDLLVERL 379
            LN++NC  ++   ++ +   L
Sbjct: 551  LNLRNCEHLTDLAIEYIASML 571



>gb:BX908798_831490 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 261

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 81/271 (29%), Positives = 132/271 (48%), Gaps = 4/271 (1%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            L+ L ++ C  +T+ G+  ++     ++ L L +C+ L+D G+        +++ L L  
Sbjct: 3    LKYLNLSGCSKLTNAGLAHLTP-LKTLQHLNLSRCSRLTDAGLAHLTPLT-ALQHLGLSY 60

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGD 889
            C  ++ AG+  + + +A  L+ LA  NC  + D+  G+  L P  SL+ L + NC    D
Sbjct: 61   CENLTDAGLAHLALLTA--LQDLALANCKHLTDV--GLVHLTPLTSLQHLDLSNCMNLTD 116

Query: 888  ASLVVLSRLCPNLVHLNLSGLNGVTDYG---LLPFVQSCDAGLVKVNLSGCINVTDKTIS 718
              LV L+ L   L HL LSG + +TD G   L P       GL +     C N+T   ++
Sbjct: 117  DGLVHLTPLTA-LQHLVLSGCDNLTDAGLAHLTPLTALQTLGLRR----WCQNLTGDGLA 171

Query: 717  AIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS-KSRVSDFGIAALAGGSA 541
             +A L    L+ L+L+ C  + DA LA +    + L+ L +   S+++D G+A L   +A
Sbjct: 172  HLAPL--TALQTLDLSYCKNLKDAGLAHLTP-LTALQTLGLKWCSKLTDAGLAHLKPLAA 228

Query: 540  IQFSLQILSLSGCVLASDKCLPYLHKLGNSL 448
                LQ L LS C   +D  L     L  SL
Sbjct: 229  ----LQHLDLSHCRSLTDAGLARFKILATSL 255



 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 41/122 (33%), Positives = 70/122 (57%), Gaps = 1/122 (0%)
 Frame = -3

Query: 762 VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-S 586
           +NLSGC  +T+  ++ +  L  +TL+ LNL+ C  +TDA LA +    + L+ L +S   
Sbjct: 6   LNLSGCSKLTNAGLAHLTPL--KTLQHLNLSRCSRLTDAGLAHLTP-LTALQHLGLSYCE 62

Query: 585 RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHR 406
            ++D G+A L    A+  +LQ L+L+ C   +D  L +L  L  SL  L++ NC+ ++  
Sbjct: 63  NLTDAGLAHL----ALLTALQDLALANCKHLTDVGLVHLTPL-TSLQHLDLSNCMNLTDD 117

Query: 405 GV 400
           G+
Sbjct: 118 GL 119



>sp|Q9QZH7|FL2L_RAT F-box/LRR-repeat protein 2-like.>pir|T52349|T52349
            F-box protein FBL2 [imported] - rat>gb:AK036217_1164394
            Mus musculus 16 days neonate cerebellum cDNA, RIKEN
            full-length enriched library, clone:9630046G05
            product:F-BOX PROTEIN FBL2 homolog [Rattus norvegicus],
            full insert sequence.>gb:AF182443_2058104 Rattus
            norvegicus F-box protein FBL2 (FBL2) mRNA, complete cds.
          Length = 276

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 64/217 (29%), Positives = 94/217 (43%), Gaps = 2/217 (0%)
 Frame = -3

Query: 1200 IEAVSKGCPN-VKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVH 1024
            +E +SK C   +++L LR C  + DN + +F +   +IE L L  C + + A        
Sbjct: 82   VENISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRNIEVLSLNGCTKTTDA-------- 133

Query: 1023 SAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVH 844
                        C  +            C+ LR L + +CT   + SL  LS  CP L  
Sbjct: 134  -----------TCTSLSKF---------CSKLRHLDLASCTSITNMSLKALSEGCPLLEQ 173

Query: 843  LNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGC 664
            LN+S  + VT  G+   V+ C  GL  + L GC  + D+ +  I   H   L  LNL  C
Sbjct: 174  LNISWCDQVTKDGIQALVRGC-GGLKALFLKGCTQLEDEALKYIG-AHCPELVTLNLQTC 231

Query: 663  GCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAAL 556
              +TD  L  I   C  L+ L  S  S ++D  + AL
Sbjct: 232  LQITDEGLITICRGCHKLQSLCASGCSNITDAILNAL 268



 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 56/183 (30%), Positives = 83/183 (45%), Gaps = 2/183 (1%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            LR L +  C GV D  +   ++ C N++ L L  CT  +D    S  K    +  L L  
Sbjct: 93   LRKLSLRGCLGVGDNALRTFAQNCRNIEVLSLNGCTKTTDATCTSLSKFCSKLRHLDLAS 152

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGM-KDLAFGVPAL-PPCNSLRSLSICNCTGF 895
            C  I+   +   L      L+ L    C  + KD   G+ AL   C  L++L +  CT  
Sbjct: 153  CTSITNMSL-KALSEGCPLLEQLNISWCDQVTKD---GIQALVRGCGGLKALFLKGCTQL 208

Query: 894  GDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISA 715
             D +L  +   CP LV LNL     +TD GL+   + C   L  +  SGC N+TD  ++A
Sbjct: 209  EDEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHK-LQSLCASGCSNITDAILNA 267

Query: 714  IAK 706
            + +
Sbjct: 268  LGQ 270



 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 37/134 (27%), Positives = 70/134 (52%)
 Frame = -3

Query: 1251 KLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLE 1072
            KLR L + +C  +T++ ++A+S+GCP ++QL +  C  ++ +G+ + V+    +++L L+
Sbjct: 144  KLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLK 203

Query: 1071 ECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG 892
             C ++    +  I  H   +L  L  + C  + D    +     C+ L+SL    C+   
Sbjct: 204  GCTQLEDEALKYIGAH-CPELVTLNLQTCLQITDEGL-ITICRGCHKLQSLCASGCSNIT 261

Query: 891  DASLVVLSRLCPNL 850
            DA L  L + CP L
Sbjct: 262  DAILNALGQNCPRL 275



 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 43/161 (26%), Positives = 73/161 (45%)
 Frame = -3

Query: 1263 QGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIES 1084
            Q    +  L +  C   TD    ++SK C  ++ L L  CT +++  + +  +    +E 
Sbjct: 114  QNCRNIEVLSLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPLLEQ 173

Query: 1083 LQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNC 904
            L +  C ++++ G+   LV   G LKAL  + C  ++D A        C  L +L++  C
Sbjct: 174  LNISWCDQVTKDGIQA-LVRGCGGLKALFLKGCTQLEDEALKYIGAH-CPELVTLNLQTC 231

Query: 903  TGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSC 781
                D  L+ + R C  L  L  SG + +TD  L    Q+C
Sbjct: 232  LQITDEGLITICRGCHKLQSLCASGCSNITDAILNALGQNC 272



 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 44/152 (28%), Positives = 72/152 (47%), Gaps = 24/152 (15%)
 Frame = -3

Query: 783 CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRD 604
           C   L K++L GC+ V D  +   A+ +   +E+L+LNGC   TDA+  +++ +CS LR 
Sbjct: 89  CGGFLRKLSLRGCLGVGDNALRTFAQ-NCRNIEVLSLNGCTKTTDATCTSLSKFCSKLRH 147

Query: 603 LDI-SKSRVSDFGIAALAGGSAIQFSLQI-----------------------LSLSGCVL 496
           LD+ S + +++  + AL+ G  +   L I                       L L GC  
Sbjct: 148 LDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQ 207

Query: 495 ASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
             D+ L Y+      L  LN+Q C+ I+  G+
Sbjct: 208 LEDEALKYIGAHCPELVTLNLQTCLQITDEGL 239



 Score = 42.0 bits (97), Expect = 0.032
 Identities = 30/129 (23%), Positives = 56/129 (43%)
 Frame = -3

Query: 1434 SLFSSAGNHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGL 1255
            S F S   HL      S  I+++SL  +      L  L +     + + G   +  G G 
Sbjct: 139  SKFCSKLRHLDLASCTS--ITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCG- 195

Query: 1254 HKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQL 1075
              L++L +  C  + D  ++ +   CP +  L L+ C  ++D G+++  +    ++SL  
Sbjct: 196  -GLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQSLCA 254

Query: 1074 EECHRISQA 1048
              C  I+ A
Sbjct: 255  SGCSNITDA 263



 Score = 37.4 bits (85), Expect = 0.78
 Identities = 21/71 (29%), Positives = 35/71 (49%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGI 1198
            + D +L  IG +   L  L L     I + G   +   +G HKL+SL  + C  +TD  +
Sbjct: 208  LEDEALKYIGAHCPELVTLNLQTCLQITDEGLITIC--RGCHKLQSLCASGCSNITDAIL 265

Query: 1197 EAVSKGCPNVK 1165
             A+ + CP ++
Sbjct: 266  NALGQNCPRLR 276



>gb:CR382139_1673111 Debaryomyces hansenii chromosome G of strain
            CBS767 of Debaryomyces hansenii.
          Length = 732

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 74/310 (23%), Positives = 147/310 (47%), Gaps = 10/310 (3%)
 Frame = -3

Query: 1251 KLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLE 1072
            KL+S+ +T   G+ D  I A++  CP ++ L    C  +S++ ++  +K+   ++ ++  
Sbjct: 224  KLQSIDLTGVTGIHDDIILALANNCPRLQGLYAPGCGKVSEDAILKLLKSCPMLKRVKFN 283

Query: 1071 ECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG 892
                I+   +   +  +   L  +   NC  + D    +  L   + LR   I N  G  
Sbjct: 284  GSANITDRSIEA-MHENCKSLVEIDLHNCSNVTDKYLKLIFLN-LSQLREFRISNAAGVT 341

Query: 891  DASLVVLSRLCPNLVHL------NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTD 730
            D     L  L P+  +L      +++G N +TD  L+  +  C   L  V LS C+ +TD
Sbjct: 342  DR----LFELLPSEYYLEKLRIVDITGCNAITDR-LIEKLVMCAPRLRNVVLSKCMQITD 396

Query: 729  KTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS-KSRVSDFGIAALA 553
             ++ A+++L G +L  ++L  CG +TD  +A++   C  ++ +D++  S+++D+ +  LA
Sbjct: 397  ASLRALSQL-GRSLHYIHLGHCGLITDFGVASLVRSCHRIQYIDLACCSQLTDWTLVELA 455

Query: 552  GGSAIQFSLQILSLSGCVLASDK-CLPYLHKLG--NSLAGLNIQNCVGISHRGVDLLVER 382
                    L+ + L  C L SD   L  + + G  + L  +++  C  ++   + LL++ 
Sbjct: 456  NLP----KLRRIGLVKCSLISDSGILELVRRRGEQDCLERVHLSYCTNLTIGPIYLLLKN 511

Query: 381  LWRCDILS*T 352
              +   LS T
Sbjct: 512  CPKLTHLSLT 521



 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 63/242 (26%), Positives = 113/242 (46%), Gaps = 10/242 (4%)
 Frame = -3

Query: 1182 GCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGI-------LVH 1024
            GCP +++L L  CT L+ + V S +K  E ++S+ L         GV GI       L +
Sbjct: 195  GCPKLERLTLVNCTKLTYSPVTSVLKNCEKLQSIDL--------TGVTGIHDDIILALAN 246

Query: 1023 SAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVH 844
            +  +L+ L    C  + + A  +  L  C  L+ +         D S+  +   C +LV 
Sbjct: 247  NCPRLQGLYAPGCGKVSEDAI-LKLLKSCPMLKRVKFNGSANITDRSIEAMHENCKSLVE 305

Query: 843  LNLSGLNGVTD-YGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI-AKLHGETLELLNLN 670
            ++L   + VTD Y  L F+    + L +  +S    VTD+    + ++ + E L ++++ 
Sbjct: 306  IDLHNCSNVTDKYLKLIFLNL--SQLREFRISNAAGVTDRLFELLPSEYYLEKLRIVDIT 363

Query: 669  GCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLA 493
            GC  +TD  +  +      LR++ +SK  +++D  + AL   S +  SL  + L  C L 
Sbjct: 364  GCNAITDRLIEKLVMCAPRLRNVVLSKCMQITDASLRAL---SQLGRSLHYIHLGHCGLI 420

Query: 492  SD 487
            +D
Sbjct: 421  TD 422



 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 59/253 (23%), Positives = 109/253 (43%)
 Frame = -3

Query: 1170 VKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFE 991
            +K+L L   T L D+ ++        +E L L  C +++ + V  +L +           
Sbjct: 173  IKRLNLSFMTKLVDDDLLKLFVGCPKLERLTLVNCTKLTYSPVTSVLKN----------- 221

Query: 990  NCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTD 811
                             C  L+S+ +   TG  D  ++ L+  CP L  L   G   V++
Sbjct: 222  -----------------CEKLQSIDLTGVTGIHDDIILALANNCPRLQGLYAPGCGKVSE 264

Query: 810  YGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI 631
              +L  ++SC   L +V  +G  N+TD++I A+ + + ++L  ++L+ C  VTD  L  I
Sbjct: 265  DAILKLLKSCPM-LKRVKFNGSANITDRSIEAMHE-NCKSLVEIDLHNCSNVTDKYLKLI 322

Query: 630  ADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNS 451
                S LR+  IS +      +  L         L+I+ ++GC   +D+ +  L      
Sbjct: 323  FLNLSQLREFRISNAAGVTDRLFELLPSEYYLEKLRIVDITGCNAITDRLIEKLVMCAPR 382

Query: 450  LAGLNIQNCVGIS 412
            L  + +  C+ I+
Sbjct: 383  LRNVVLSKCMQIT 395



 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 59/230 (25%), Positives = 99/230 (43%), Gaps = 5/230 (2%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLG 1201
            N++D  L +I      L +  + N   + +R F ++ S   L KLR + IT C  +TD  
Sbjct: 313  NVTDKYLKLIFLNLSQLREFRISNAAGVTDRLFELLPSEYYLEKLRIVDITGCNAITDRL 372

Query: 1200 IEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHS 1021
            IE +    P ++ + L KC  ++D  + +  +   S+  + L  C  I+  GV   LV S
Sbjct: 373  IEKLVMCAPRLRNVVLSKCMQITDASLRALSQLGRSLHYIHLGHCGLITDFGV-ASLVRS 431

Query: 1020 AGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHL 841
                                       C+ ++ + +  C+   D +LV L+ L P L  +
Sbjct: 432  ---------------------------CHRIQYIDLACCSQLTDWTLVELANL-PKLRRI 463

Query: 840  NLSGLNGVTDYGLLPFV-----QSCDAGLVKVNLSGCINVTDKTISAIAK 706
             L   + ++D G+L  V     Q C   L +V+LS C N+T   I  + K
Sbjct: 464  GLVKCSLISDSGILELVRRRGEQDC---LERVHLSYCTNLTIGPIYLLLK 510



>gb:BX908798_830587 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 553

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 96/339 (28%), Positives = 154/339 (45%), Gaps = 1/339 (0%)
 Frame = -3

Query: 1413 NHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLV 1234
            NH +K K+++LN SD            LTD  L+ L++                 L+ L 
Sbjct: 190  NHFLK-KIETLNFSD---------NAYLTDAHLLALKDCEN--------------LKVLH 225

Query: 1233 ITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRIS 1054
               C GVTD G+  ++     +++L L  C  L+D+G+        +++ L L  C  ++
Sbjct: 226  CKKCWGVTDAGLAHLTP-LTALQRLDLSYCENLTDDGLAHLTPLT-ALQHLDLSYCENLT 283

Query: 1053 QAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVV 874
              G+  +    A  L+ LA  NC  + D   G+  L    +L+ L +       DA L  
Sbjct: 284  DDGLAHLAPLKA--LQRLALTNCKNLTDA--GLTHLTTLTALQHLDLSQYWKLTDAGLAH 339

Query: 873  LSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGE 694
            L  L   L HL+LS    +TD G+          L  ++LS   N+TD  ++ +  L G 
Sbjct: 340  LKPLTA-LQHLDLSLCYYLTDAGIAHLKPL--TALQHLDLSQYRNLTDAGLAHLTPLMG- 395

Query: 693  TLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKS-RVSDFGIAALAGGSAIQFSLQIL 517
             L+ LNL+ C  +TDA LA +A   + L+ L++S    ++D G+  L   +A    LQ L
Sbjct: 396  -LQYLNLSACKNLTDAGLAHLAP-LTALQHLNLSSCYNLTDAGLVHLIPLTA----LQHL 449

Query: 516  SLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
             LS     +D  L +L  L  +L  LN+ NC  ++  G+
Sbjct: 450  YLSDWENLTDTGLAHLAPL-TALQHLNLSNCRKLTDDGL 487



 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 78/273 (28%), Positives = 122/273 (44%), Gaps = 25/273 (9%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLG 1201
            N++D  LA +     AL  LAL N +N+ + G   + +   L  L+ L ++    +TD G
Sbjct: 281  NLTDDGLAHLAPLK-ALQRLALTNCKNLTDAGLTHLTT---LTALQHLDLSQYWKLTDAG 336

Query: 1200 IEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHS 1021
            + A  K    ++ L L  C  L+D G+ + +K   +++ L L +   ++ AG    L H 
Sbjct: 337  L-AHLKPLTALQHLDLSLCYYLTDAGI-AHLKPLTALQHLDLSQYRNLTDAG----LAHL 390

Query: 1020 AGKLKALAFENCFGMKDLA-FGVPALPPCNSLRSLSICNCTGFGDASLVVL--------- 871
               L  L + N    K+L   G+  L P  +L+ L++ +C    DA LV L         
Sbjct: 391  T-PLMGLQYLNLSACKNLTDAGLAHLAPLTALQHLNLSSCYNLTDAGLVHLIPLTALQHL 449

Query: 870  -------------SRLCP--NLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINV 736
                         + L P   L HLNLS    +TD GL          L  ++LS C N 
Sbjct: 450  YLSDWENLTDTGLAHLAPLTALQHLNLSNCRKLTDDGLAHLKSLVT--LTHLDLSWCKNF 507

Query: 735  TDKTISAIAKLHGETLELLNLNGCGCVTDASLA 637
            TD+ ++ +  L G  L+ L L+ C  +TD  LA
Sbjct: 508  TDEGLTHLTPLTG--LQYLVLSLCYHLTDDGLA 538



>gb:BX908798_830444 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 653

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 78/274 (28%), Positives = 140/274 (51%), Gaps = 2/274 (0%)
 Frame = -3

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TD  + A+ K C N+K L L KC +++D+G ++ +    +++ L+L +C +++ AG+  
Sbjct: 236  LTDAHLLAL-KDCKNLKVLHLEKCQVITDDG-LAHLTPLTALQHLELSDCRKLTDAGLAH 293

Query: 1035 ILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNC-TGFGDASLVVLSRLC 859
            +   +A  L+ L    C  + D   G+  L P  +L+ L++  C     DA L  L+ L 
Sbjct: 294  LTPLTA--LQHLNLSFCDKLTDA--GLAHLTPLTALQHLNLSRCYYKLTDAGLAHLTPLT 349

Query: 858  PNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELL 679
              L HLNLS  + +TD GL+        GL  ++L     +T   ++ +  L    L+ L
Sbjct: 350  A-LQHLNLSFCDKLTDAGLVHL--KLLTGLQHLDLREFWELTGAGLAHLTTL--TALQHL 404

Query: 678  NLNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILSLSGC 502
            +L+GC  +TD  LA +    + L+ LD+ + R +++ G+  L     +   LQ L+LS C
Sbjct: 405  DLSGCDKLTDVGLAHLTP-LTTLQHLDLKRCRNLTNAGLVHL----KLLTGLQHLNLSEC 459

Query: 501  VLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
               +D  L +L  L  +L  L++  C  ++  G+
Sbjct: 460  YHLTDAGLAHLTPL-TALQHLDLSQCSKLTDDGL 492



 Score = 67.0 bits (162), Expect = 9e-10
 Identities = 76/292 (26%), Positives = 125/292 (42%), Gaps = 60/292 (20%)
 Frame = -3

Query: 1332 LTDLALINL------QNINERGFWVMGSGQGLHKLRSLV------ITACQGVTDLGIEAV 1189
            LTD  L++L      Q+++ R FW + +G GL  L +L       ++ C  +TD+G+  +
Sbjct: 362  LTDAGLVHLKLLTGLQHLDLREFWEL-TGAGLAHLTTLTALQHLDLSGCDKLTDVGLAHL 420

Query: 1188 SKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKL 1009
            +     ++ L L++C  L++ G+V  +K    ++ L L EC+ ++ AG+  +   +A  L
Sbjct: 421  TP-LTTLQHLDLKRCRNLTNAGLVH-LKLLTGLQHLNLSECYHLTDAGLAHLTPLTA--L 476

Query: 1008 KALAFENCFGMKDLAF-----------------------GVPALPPCNSLRSLSICNCTG 898
            + L    C  + D                          G+  L P  +L+ L +  C  
Sbjct: 477  QHLDLSQCSKLTDDGLAHLTPLTALQHLDLSQCSKLTDDGLAHLTPLTALQHLVLARCRN 536

Query: 897  FGDASLVVLSRLCPNLVHLNLSG-------------------------LNGVTDYGLLPF 793
              DA L  L+ L   L HLNLSG                          NG+TD GL   
Sbjct: 537  LTDAGLAHLTPL-ETLQHLNLSGGYKLTGAGLAHLRPLVALQHLDLSYCNGLTDAGLAHL 595

Query: 792  VQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLA 637
                   L  ++LS C  +TD  ++ +  L    L+ L+L+ C  +TDA LA
Sbjct: 596  TPL--VALQHLDLSYCDGLTDAGLTHLRPL--VALQHLDLSYCDGLTDAGLA 643



 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 59/205 (28%), Positives = 99/205 (48%), Gaps = 5/205 (2%)
 Frame = -3

Query: 1392 LQSLNISD---ISLAVIGHYG--VALTDLALINLQNINERGFWVMGSGQGLHKLRSLVIT 1228
            LQ LN+S+   ++ A + H     AL  L L     + + G   +     L  L+ L ++
Sbjct: 451  LQHLNLSECYHLTDAGLAHLTPLTALQHLDLSQCSKLTDDG---LAHLTPLTALQHLDLS 507

Query: 1227 ACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQA 1048
             C  +TD G+  ++     ++ L L +C  L+D G+ + +   E+++ L L   ++++ A
Sbjct: 508  QCSKLTDDGLAHLTP-LTALQHLVLARCRNLTDAGL-AHLTPLETLQHLNLSGGYKLTGA 565

Query: 1047 GVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLS 868
            G+  +    A  L+ L    C G+ D   G+  L P  +L+ L +  C G  DA L  L 
Sbjct: 566  GLAHLRPLVA--LQHLDLSYCNGLTDA--GLAHLTPLVALQHLDLSYCDGLTDAGLTHLR 621

Query: 867  RLCPNLVHLNLSGLNGVTDYGLLPF 793
             L   L HL+LS  +G+TD GL  F
Sbjct: 622  PLVA-LQHLDLSYCDGLTDAGLAHF 645



>gb:BX908798_831472 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 310

 Score = 76.3 bits (186), Expect = 2e-12
 Identities = 67/211 (31%), Positives = 101/211 (47%), Gaps = 3/211 (1%)
 Frame = -3

Query: 1185 KGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG--K 1012
            K C N+K L L  C  L+D+G +  +    +++ L L  C  ++ AG    LVH      
Sbjct: 98   KDCKNLKALYLEACQALTDDG-LEHLTLLTALQHLDLSGCWNLTDAG----LVHLTPLVG 152

Query: 1011 LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS 832
            L+ L    C+ + D   G+  L P  +L+ L + +C    DA L  L  L   L HL LS
Sbjct: 153  LQHLKLNACYNLTD--DGLVHLTPLTALQHLDLSDCMNLTDAGLAHLKPLTA-LQHLGLS 209

Query: 831  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT 652
                +TD GL         GL  + LS C+N+TD  +  +  L    L+ LNL  C  VT
Sbjct: 210  CCENLTDAGLAHLAPL--TGLQYLALSDCMNLTDDGLVHLKPL--TALQHLNLRNCRNVT 265

Query: 651  DASLAAIADYCSVLRDLDISK-SRVSDFGIA 562
            DA LA +      L+ L++ +  +V++ G+A
Sbjct: 266  DAGLAHLTP-LKALQQLNLRRCDKVTNTGLA 295



 Score = 73.9 bits (180), Expect = 8e-12
 Identities = 66/240 (27%), Positives = 111/240 (46%)
 Frame = -3

Query: 1356 VIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGC 1177
            +I H+   +  L  +N   +       +   +    L++L + ACQ +TD G+E ++   
Sbjct: 70   IINHFSKKIEGLNFLNQAYLTNAHLLAL---KDCKNLKALYLEACQALTDDGLEHLTL-L 125

Query: 1176 PNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALA 997
              ++ L L  C  L+D G+V        ++ L+L  C+ ++  G+  +   +A  L+ L 
Sbjct: 126  TALQHLDLSGCWNLTDAGLVHLTPLV-GLQHLKLNACYNLTDDGLVHLTPLTA--LQHLD 182

Query: 996  FENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGV 817
              +C  + D   G+  L P  +L+ L +  C    DA L  L+ L   L +L LS    +
Sbjct: 183  LSDCMNLTDA--GLAHLKPLTALQHLGLSCCENLTDAGLAHLAPL-TGLQYLALSDCMNL 239

Query: 816  TDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLA 637
            TD GL+         L  +NL  C NVTD  ++ +  L  + L+ LNL  C  VT+  LA
Sbjct: 240  TDDGLVHLKPL--TALQHLNLRNCRNVTDAGLAHLTPL--KALQQLNLRRCDKVTNTGLA 295



>gb:AY823669_2088564 Rattus norvegicus spinal cord injury and
            regeneration related protein 1 (Scirr1) mRNA, complete
            cds.
          Length = 479

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 82/289 (28%), Positives = 134/289 (46%), Gaps = 4/289 (1%)
 Frame = -3

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TD G+E + +    V +L L  C   ++ G+ S + A   I SL + +C  ++   +  
Sbjct: 205  ITDAGLEVMLEQMQGVVRLELSGCNDFTEAGLWSSLSAR--ITSLSVSDCINVADDAIAA 262

Query: 1035 I--LVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRL 862
            I  L+ +  +L   A+     + D A         +S  +L + +C    +  +V +   
Sbjct: 263  ISQLLPNLAELSLQAYH----VTDTALAYFTARQGHSTHTLRLLSCWEITNHGVVNVVHS 318

Query: 861  CPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIA-KLHGETLE 685
             PNL  L+LSG + VTD G +  V      L  ++LS C  +TD  +  +A  LH   LE
Sbjct: 319  LPNLTSLSLSGCSKVTDDG-VELVAENLRKLRSLDLSWCPRITDMALEYVACDLH--RLE 375

Query: 684  LLNLNGCGCVTDASLAAIADYCSVLRDLDIS-KSRVSDFGIAALAGGSAIQFSLQILSLS 508
             L L+ C  +TD  L+ ++   S LR L +    +V DFG+  L        SL++LSL+
Sbjct: 376  ELVLDRCVRITDTGLSYLSTMSS-LRSLYLRWCCQVQDFGLKHLLA----MRSLRLLSLA 430

Query: 507  GCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL 361
            GC L +   L  L +L   L  L + NC G +        + L RC ++
Sbjct: 431  GCPLLTTTGLSGLVQL-QELEELELTNCPGATPELFKYFSQHLPRCLVI 478



 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 54/187 (28%), Positives = 89/187 (47%), Gaps = 4/187 (2%)
 Frame = -3

Query: 1410 HLMKVKLQSLNISDISLAVI-GHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLV 1234
            +L ++ LQ+ +++D +LA      G +   L L++   I   G  V+     L  L SL 
Sbjct: 269  NLAELSLQAYHVTDTALAYFTARQGHSTHTLRLLSCWEITNHG--VVNVVHSLPNLTSLS 326

Query: 1233 ITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRIS 1054
            ++ C  VTD G+E V++    ++ L L  C  ++D  +         +E L L+ C RI+
Sbjct: 327  LSGCSKVTDDGVELVAENLRKLRSLDLSWCPRITDMALEYVACDLHRLEELVLDRCVRIT 386

Query: 1053 QAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNC---TGFGDAS 883
              G+  +   S+  L++L    C  ++D  FG+  L    SLR LS+  C   T  G + 
Sbjct: 387  DTGLSYLSTMSS--LRSLYLRWCCQVQD--FGLKHLLAMRSLRLLSLAGCPLLTTTGLSG 442

Query: 882  LVVLSRL 862
            LV L  L
Sbjct: 443  LVQLQEL 449



>gb:BX908798_829891 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 642

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 83/294 (28%), Positives = 140/294 (47%), Gaps = 2/294 (0%)
 Frame = -3

Query: 1410 HLMKVKLQSL-NISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLV 1234
            +L  ++LQ+  N +D  LA +    +AL  L L   +N+ + G   +     L  L+ L 
Sbjct: 330  NLKVLQLQACHNFTDAGLAHLTPL-MALQHLNLSYCKNLTDAGLAHLAP---LVVLQHLN 385

Query: 1233 ITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRIS 1054
            +++C  +TD G+  ++     +  L L  C  L+D G+        ++  L L EC +++
Sbjct: 386  LSSCHNLTDAGLAHLTP-LVALTHLNLSWCNKLTDAGLAHLTPLV-ALTHLDLRECDKLT 443

Query: 1053 QAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVV 874
              G+  + +     L+ L    C  + D   G+  L    +L+ L +C C    DA L  
Sbjct: 444  NRGLAHLALLLT--LQYLDLNYCRNLTDA--GLAHLSSLVALQHLKLCCCVSLTDAGLAH 499

Query: 873  LSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGE 694
            L+ L   L HL+LS    +TD GL          L  + LSGC  +TD  ++ + +L   
Sbjct: 500  LAPLVA-LTHLDLSWCFNITDAGLAHLTPLVT--LQHLGLSGCRRLTDVGLAHLTRL--V 554

Query: 693  TLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQ 535
             L+ L LN C  +TDA LA +    + L+ LD+S+ R +++ G+A L    A+Q
Sbjct: 555  ALQHLGLNRCDNLTDAGLAHLTPLIN-LQHLDLSECRKLTNAGLAHLTPLVALQ 607



 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 80/258 (31%), Positives = 124/258 (48%), Gaps = 7/258 (2%)
 Frame = -3

Query: 1110 VKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNS 931
            +K  ++++ LQL+ CH  + AG+  +    A  L+ L    C  + D   G+  L P   
Sbjct: 325  LKNCKNLKVLQLQACHNFTDAGLAHLTPLMA--LQHLNLSYCKNLTDA--GLAHLAPLVV 380

Query: 930  LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLS 751
            L+ L++ +C    DA L  L+ L   L HLNLS  N +TD GL          L  ++L 
Sbjct: 381  LQHLNLSSCHNLTDAGLAHLTPLVA-LTHLNLSWCNKLTDAGLAHLTPL--VALTHLDLR 437

Query: 750  GCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDF 571
             C  +T++ ++ +A L   TL+ L+LN C  +TDA LA ++   ++          ++D 
Sbjct: 438  ECDKLTNRGLAHLALLL--TLQYLDLNYCRNLTDAGLAHLSSLVALQHLKLCCCVSLTDA 495

Query: 570  GIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC-----VGISH- 409
            G+A LA       +L  L LS C   +D  L +L  L  +L  L +  C     VG++H 
Sbjct: 496  GLAHLAP----LVALTHLDLSWCFNITDAGLAHLTPL-VTLQHLGLSGCRRLTDVGLAHL 550

Query: 408  -RGVDLLVERLWRCDILS 358
             R V L    L RCD L+
Sbjct: 551  TRLVALQHLGLNRCDNLT 568



 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 79/265 (29%), Positives = 127/265 (47%), Gaps = 3/265 (1%)
 Frame = -3

Query: 1185 KGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG--K 1012
            K C N+K L L+ C   +D G ++ +    +++ L L  C  ++ AG    L H A    
Sbjct: 326  KNCKNLKVLQLQACHNFTDAG-LAHLTPLMALQHLNLSYCKNLTDAG----LAHLAPLVV 380

Query: 1011 LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS 832
            L+ L   +C  + D   G+  L P  +L  L++  C    DA L  L+ L   L HL+L 
Sbjct: 381  LQHLNLSSCHNLTDA--GLAHLTPLVALTHLNLSWCNKLTDAGLAHLTPLVA-LTHLDLR 437

Query: 831  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT 652
              + +T+ GL          L  ++L+ C N+TD  ++ ++ L    L+ L L  C  +T
Sbjct: 438  ECDKLTNRGLAHLALLLT--LQYLDLNYCRNLTDAGLAHLSSL--VALQHLKLCCCVSLT 493

Query: 651  DASLAAIADYCSVLRDLDISKS-RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLP 475
            DA LA +A   + L  LD+S    ++D G+A L        +LQ L LSGC   +D  L 
Sbjct: 494  DAGLAHLAPLVA-LTHLDLSWCFNITDAGLAHLTP----LVTLQHLGLSGCRRLTDVGLA 548

Query: 474  YLHKLGNSLAGLNIQNCVGISHRGV 400
            +L +L  +L  L +  C  ++  G+
Sbjct: 549  HLTRL-VALQHLGLNRCDNLTDAGL 572



>pir|T45673|T45673 hypothetical protein F14P22.120 - Arabidopsis
            thaliana>gb:ATF14P22_1548621 Arabidopsis thaliana DNA
            chromosome 3, BAC clone F14P22.
          Length = 314

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 59/200 (29%), Positives = 93/200 (46%), Gaps = 2/200 (1%)
 Frame = -3

Query: 1257 LHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQ 1078
            L  L  L +  CQ ++D GIEA++  CP +K   +     ++D G+ + VK    I  L 
Sbjct: 95   LLSLEWLNLNVCQKISDNGIEAITSICPKLKVFSIYWNVRVTDAGIRNLVKNCRHITDLN 154

Query: 1077 LEECHRISQAGVF--GILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNC 904
            L  C +IS   +F  G +V  A           F   D A+   +L     LR L IC  
Sbjct: 155  LSGC-KISNIDLFVSGYIVKLAVLSSGNDIAISFSFTDKAYMKISL--LADLRFLDICGA 211

Query: 903  TGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKT 724
                D  +  +++ C  L  LNL+    +TD G+     SC + L  ++L G + VTD+ 
Sbjct: 212  QNISDEGIGHIAK-CNKLESLNLTWCVRITDAGVNTIANSCTS-LEFLSLFGIVGVTDRC 269

Query: 723  ISAIAKLHGETLELLNLNGC 664
            +  +++    TL  L++NGC
Sbjct: 270  LETLSQTCSTTLTTLDVNGC 289



>gb:AP003227_1825684 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0018C10.>gb:AP003561_1830785 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:B1065E10.
          Length = 379

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 53/156 (33%), Positives = 78/156 (50%), Gaps = 2/156 (1%)
 Frame = -3

Query: 939 CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKV 760
           C+ LR L +       D SL  L+  CP+L  LN+SG +  +D  L      C   L  +
Sbjct: 130 CHDLRELDLSRSFRLSDRSLYALAHGCPHLTRLNISGCSNFSDAALAYLSSQC-KNLKCL 188

Query: 759 NLSGCIN-VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKS- 586
           NL GC+  V+D+ + AIA   G+ L+ LNL  C  VTD  + ++A  C  LR LD+    
Sbjct: 189 NLCGCVRAVSDRALQAIACNCGQ-LQSLNLGWCDSVTDKGVTSLASGCPELRALDLCGCV 247

Query: 585 RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCL 478
            ++D  + ALA G      L+ L L  C   +D+ +
Sbjct: 248 LITDESVVALANGCP---HLRSLGLYYCQNITDRAM 280



 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 67/261 (25%), Positives = 109/261 (41%), Gaps = 2/261 (0%)
 Frame = -3

Query: 1278 VMGSGQGLHKLRSLVITACQG-VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKA 1102
            VM   Q   KL+ L +   +  + D  +EAV+  C ++++L L +   LSD  + +    
Sbjct: 96   VMSLAQKFTKLQVLSLRQIKPQLEDSAVEAVANNCHDLRELDLSRSFRLSDRSLYALAHG 155

Query: 1101 AESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRS 922
               +  L +  C   S A              ALA+ +                C +L+ 
Sbjct: 156  CPHLTRLNISGCSNFSDA--------------ALAYLS--------------SQCKNLKC 187

Query: 921  LSICNCT-GFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGC 745
            L++C C     D +L  ++  C  L  LNL   + VTD G+      C   L  ++L GC
Sbjct: 188  LNLCGCVRAVSDRALQAIACNCGQLQSLNLGWCDSVTDKGVTSLASGCPE-LRALDLCGC 246

Query: 744  INVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGI 565
            + +TD+++ A+A      L  L L  C  +TD ++ ++A     +R    SK R  D   
Sbjct: 247  VLITDESVVALAN-GCPHLRSLGLYYCQNITDRAMYSLAANSRRVR----SKGRSWDAAA 301

Query: 564  AALAGGSAIQFSLQILSLSGC 502
               AG  A    L  L++S C
Sbjct: 302  RKNAGAGA--DGLASLNISQC 320



 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 50/207 (24%), Positives = 88/207 (42%), Gaps = 8/207 (3%)
 Frame = -3

Query: 1410 HLMKVKLQSL-NISDISLAVIGHYGVALTDLALIN-LQNINERGFWVMGSGQGLHKLRSL 1237
            HL ++ +    N SD +LA +      L  L L   ++ +++R    +    G  +L+SL
Sbjct: 158  HLTRLNISGCSNFSDAALAYLSSQCKNLKCLNLCGCVRAVSDRALQAIACNCG--QLQSL 215

Query: 1236 VITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRI 1057
             +  C  VTD G+ +++ GCP ++ L L  C L++D  VV+       + SL L  C  I
Sbjct: 216  NLGWCDSVTDKGVTSLASGCPELRALDLCGCVLITDESVVALANGCPHLRSLGLYYCQNI 275

Query: 1056 SQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLV 877
            +   ++ +  +S          +    K+   G       + L SL+I  CT     ++ 
Sbjct: 276  TDRAMYSLAANSRRVRSKGRSWDAAARKNAGAG------ADGLASLNISQCTALTPPAVQ 329

Query: 876  VLS------RLCPNLVHLNLSGLNGVT 814
             +         CP    L +SG   +T
Sbjct: 330  AVCDSFPALHTCPERHSLIISGCLSLT 356



 Score = 51.2 bits (121), Expect = 5e-05
 Identities = 44/132 (33%), Positives = 71/132 (53%), Gaps = 4/132 (3%)
 Frame = -3

Query: 774 GLVKVNLSGC-INVTDKTISAIAKLHGETLELLNLNGCGC-VTDASLAAIADYCSVLRDL 601
           G+  ++LS C  ++ D  +S   K     L++L+L      + D+++ A+A+ C  LR+L
Sbjct: 79  GVTNLSLSWCQAHMNDLVMSLAQKF--TKLQVLSLRQIKPQLEDSAVEAVANNCHDLREL 136

Query: 600 DISKS-RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC 424
           D+S+S R+SD  + ALA G      L  L++SGC   SD  L YL     +L  LN+  C
Sbjct: 137 DLSRSFRLSDRSLYALAHGCP---HLTRLNISGCSNFSDAALAYLSSQCKNLKCLNLCGC 193

Query: 423 V-GISHRGVDLL 391
           V  +S R +  +
Sbjct: 194 VRAVSDRALQAI 205



 Score = 49.7 bits (117), Expect = 2e-04
 Identities = 48/168 (28%), Positives = 75/168 (44%), Gaps = 4/168 (2%)
 Frame = -3

Query: 891 DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI 712
           D+++  ++  C +L  L+LS    ++D  L      C   L ++N+SGC N +D   +A+
Sbjct: 120 DSAVEAVANNCHDLRELDLSRSFRLSDRSLYALAHGCPH-LTRLNISGCSNFSD---AAL 175

Query: 711 AKLHGETLELLNLNGCGCV---TDASLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGS 544
           A L  +   L  LN CGCV   +D +L AIA  C  L+ L++     V+D G+ +LA   
Sbjct: 176 AYLSSQCKNLKCLNLCGCVRAVSDRALQAIACNCGQLQSLNLGWCDSVTDKGVTSLA--- 232

Query: 543 AIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
                      SGC                 L  L++  CV I+   V
Sbjct: 233 -----------SGCP---------------ELRALDLCGCVLITDESV 254



>gb:BX908798_831172 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 813

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 79/264 (29%), Positives = 123/264 (46%), Gaps = 6/264 (2%)
 Frame = -3

Query: 1170 VKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFE 991
            ++ L L  C  L+D G+        ++  L L EC  ++  G+  + + S   L+ L+ +
Sbjct: 455  LRHLGLSDCRNLTDAGLAHLTPLV-ALRHLDLSECKNLTDDGL--VHLSSLVALQYLSLK 511

Query: 990  NCFGMKDLAFGVPALPPCNSLRSLSI-----CNCTGFGDASLVVLSRLCPNLVHLNLSGL 826
             C  + D   G+  L P  +L  L +     C C    D  L  LS L   L HL+LS  
Sbjct: 512  LCENLTDA--GLAHLTPLTTLEHLDLGLDLGC-CHNLTDDGLAHLSSLTA-LKHLDLSWR 567

Query: 825  NGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDA 646
              +TD GL          L  ++LS C N+TD+ ++ +  L    L+ L+L G   +TD 
Sbjct: 568  ENLTDAGLAHLTPL--TALRHLDLSWCENLTDEGLAYLTPL--VALQYLSLKGSD-ITDE 622

Query: 645  SLAAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYL 469
             L  +A + S LR L ++  R ++ +G+A L        +L+ L LSGC       L YL
Sbjct: 623  GLEHLA-HLSALRHLSLNDCRRINGYGLAHLTS----LVNLEHLDLSGCYHLPSFQLIYL 677

Query: 468  HKLGNSLAGLNIQNCVGISHRGVD 397
              L N L  LN+  C G+ H G++
Sbjct: 678  SSLVN-LQHLNLSECFGLCHDGLE 700



 Score = 70.5 bits (171), Expect = 8e-11
 Identities = 85/311 (27%), Positives = 149/311 (47%), Gaps = 8/311 (2%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVALTDLALINL-------QNINERGFWVMGSGQGLHKLRSLVITAC 1222
            N++D  LA +      LT L  ++L        N+ + G   + S   L  L+ L ++  
Sbjct: 515  NLTDAGLAHL----TPLTTLEHLDLGLDLGCCHNLTDDGLAHLSS---LTALKHLDLSWR 567

Query: 1221 QGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV 1042
            + +TD G+  ++     ++ L L  C  L+D G+ +++    +++ L L+    I+  G+
Sbjct: 568  ENLTDAGLAHLTP-LTALRHLDLSWCENLTDEGL-AYLTPLVALQYLSLKGSD-ITDEGL 624

Query: 1041 FGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRL 862
              +   SA  L+ L+  +C  +    +G+  L    +L  L +  C       L+ LS L
Sbjct: 625  EHLAHLSA--LRHLSLNDCRRIN--GYGLAHLTSLVNLEHLDLSGCYHLPSFQLIYLSSL 680

Query: 861  CPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLEL 682
              NL HLNLS   G+   GL       +  L  ++LSGCIN+TD+ ++ +  L G  L+ 
Sbjct: 681  V-NLQHLNLSECFGLCHDGLEDLTPLMN--LQYLDLSGCINLTDQGLAYLTSLVGLDLQH 737

Query: 681  LNLNGCGCVTDASLAAIADYCSVLRDLDISKS-RVSDFGIAALAGGSAIQFSLQILSLSG 505
            L+L+GC  +TD  LA +    + L+ L++S+   ++D G+A L        +LQ L L  
Sbjct: 738  LDLSGCKKITDTGLAHLTSLVT-LQHLNLSECVNLTDTGLAHLVS----LVNLQYLELRE 792

Query: 504  CVLASDKCLPY 472
            C   +D  L +
Sbjct: 793  CKNITDAGLAH 803



 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 77/266 (28%), Positives = 123/266 (46%), Gaps = 24/266 (9%)
 Frame = -3

Query: 1185 KGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLK 1006
            K C N+K LCL+      D G ++ + +  +++ L L EC+ +   G+  +   +A +  
Sbjct: 350  KNCKNLKVLCLKIFYTPIDTG-LAHLTSLTALQHLDLSECYLLKDTGLAHLSSLTALQYL 408

Query: 1005 ALAFENCFGMKDLAF---------------------GVPALPPCNSLRSLSICNCTGFGD 889
             L+    F    LA                      G+  L P  +LR L + +C    D
Sbjct: 409  DLSDSGNFTDAGLAHLTPLVSLQHLDLSKSENLTGDGLAHLTPLVALRHLGLSDCRNLTD 468

Query: 888  ASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIA 709
            A L  L+ L   L HL+LS    +TD GL+    S    L  ++L  C N+TD  ++ + 
Sbjct: 469  AGLAHLTPLVA-LRHLDLSECKNLTDDGLVHL--SSLVALQYLSLKLCENLTDAGLAHLT 525

Query: 708  KLHG-ETLEL-LNLNGCGCVTDASLAAIADYCSVLRDLDIS-KSRVSDFGIAALAGGSAI 538
             L   E L+L L+L  C  +TD  LA ++   + L+ LD+S +  ++D G+A L   +A 
Sbjct: 526  PLTTLEHLDLGLDLGCCHNLTDDGLAHLSS-LTALKHLDLSWRENLTDAGLAHLTPLTA- 583

Query: 537  QFSLQILSLSGCVLASDKCLPYLHKL 460
               L+ L LS C   +D+ L YL  L
Sbjct: 584  ---LRHLDLSWCENLTDEGLAYLTPL 606



>gb:CRU303349_1673663 Capsella rubella ORF1, ORF2, ORF3, ORF4, ORF5
            and ORF6 (partial).
          Length = 606

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 83/305 (27%), Positives = 136/305 (44%), Gaps = 12/305 (3%)
 Frame = -3

Query: 1314 INLQNINERGFWVMGSG-QGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTL 1138
            I+ + IN+ G +++    +GL  +R   +   Q V+D G  ++   C N+K+  +R   L
Sbjct: 292  ISFKRINDMGIFLLSEACKGLESVR---LGGFQKVSDAGFASLLHSCRNLKKFEVRGAFL 348

Query: 1137 LSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFG 958
            LSD        ++  ++ ++L  C  I+                                
Sbjct: 349  LSDLAFHDVTGSSCFLQEVRLSTCPLITSE-----------------------------A 379

Query: 957  VPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCD 778
            V  L  C +L  L + +C    D+ L  +S L   L  LNL+G + VTD G+L   +S D
Sbjct: 380  VKKLGLCGNLEVLDLGSCKSISDSCLNSVSVL-RRLTSLNLAGAD-VTDSGMLALGKS-D 436

Query: 777  AGLVKVNLSGCINVTDKTISAIAKLHG---ETLELLNLNGCGCVTDASLAAIADYCSVLR 607
              + +++L GC  V+D+ IS +    G   +TL  L+L     ++D ++  I  YC  L 
Sbjct: 437  VPITQLSLRGCKRVSDRGISHLLINEGTISKTLSTLDLGHMPGMSDRAIHTITRYCKALT 496

Query: 606  DLDI-SKSRVSDFGIAALA-------GGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNS 451
            +L I S   V+D  I +LA       GGS     L+ L++  CV  +   L +L K   S
Sbjct: 497  ELSIRSCFYVTDSSIESLATRERQVEGGSK---QLRKLNIHNCVSLTTGALRWLSK--PS 551

Query: 450  LAGLN 436
             AGL+
Sbjct: 552  FAGLH 556



>gb:ATH303346_1552436 Arabidopsis thaliana partial mRNA for
            hypothetical protein (ORF1), clone G2F2.
          Length = 601

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 82/305 (26%), Positives = 135/305 (44%), Gaps = 12/305 (3%)
 Frame = -3

Query: 1314 INLQNINERGFWVMGSG-QGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTL 1138
            I+ + IN+ G +++    +GL  +R   +     V+D G  ++   C N+K+  +R   L
Sbjct: 287  ISFKRINDMGIFLLSEACKGLESVR---LGGFPKVSDAGFASLLHSCRNLKKFEVRGAFL 343

Query: 1137 LSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFG 958
            LSD        ++ S++ ++L  C  I+                                
Sbjct: 344  LSDLAFHDVTGSSCSLQEVRLSTCPLITSE-----------------------------A 374

Query: 957  VPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCD 778
            V  L  C +L  L + +C    D+ L  +S L   L  LNL+G + VTD G+L   +S D
Sbjct: 375  VKKLGLCGNLEVLDLGSCKSISDSCLNSVSAL-RKLTSLNLAGAD-VTDSGMLALGKS-D 431

Query: 777  AGLVKVNLSGCINVTDKTISAIAKLHG---ETLELLNLNGCGCVTDASLAAIADYCSVLR 607
              + +++L GC  V+D+ IS +    G   +TL  L+L     ++D ++  I   C  L 
Sbjct: 432  VPITQLSLRGCRRVSDRGISYLLNNEGTISKTLSTLDLGHMPGISDRAIHTITHCCKALT 491

Query: 606  DLDI-SKSRVSDFGIAALA-------GGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNS 451
            +L I S   V+D  I +LA       GGS     L+ L++  CV  +   L +L K   S
Sbjct: 492  ELSIRSCFHVTDSSIESLATWERQAEGGSK---QLRKLNVHNCVSLTTGALRWLSK--PS 546

Query: 450  LAGLN 436
             AGL+
Sbjct: 547  FAGLH 551



>gb:CR859619_1183726 Pongo pygmaeus mRNA; cDNA DKFZp459G1413 (from
           clone DKFZp459G1413).
          Length = 258

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 52/152 (34%), Positives = 84/152 (55%), Gaps = 4/152 (2%)
 Frame = -3

Query: 930 LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG----VTDYGLLPFVQSCDAGLVK 763
           +++L + +C    DA+L+ LS  C  L  LNL+   G    VT  G+     SC   L +
Sbjct: 63  VQTLDLRSCD-ISDAALLHLSN-CRKLKKLNLNASKGNRVSVTSEGIKVVASSCSY-LHE 119

Query: 762 VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR 583
            +L  C N+TD+ + A+A L+ + L+++NL GC  +TD SL A+   C  L+ +D S ++
Sbjct: 120 ASLKRCCNLTDEGVVALA-LNCQLLKIINLGGCLSITDVSLHALGKNCPFLQCVDFSATQ 178

Query: 582 VSDFGIAALAGGSAIQFSLQILSLSGCVLASD 487
           VSD G+ AL  G   +  L+ + +  CV  +D
Sbjct: 179 VSDSGVIALVSGPCAK-KLEEIHMGHCVNLTD 209



 Score = 51.2 bits (121), Expect = 5e-05
 Identities = 59/224 (26%), Positives = 94/224 (41%), Gaps = 7/224 (3%)
 Frame = -3

Query: 1251 KLRSLVITACQG-VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQL 1075
            K R + I + QG +TD  I  +    P V+ L LR C + SD  +            L L
Sbjct: 37   KDRLIKIMSMQGRITDSNISEILH--PEVQTLDLRSCDI-SDAAL------------LHL 81

Query: 1074 EECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGF 895
              C ++ +      L  S G   ++  E   G+K +A        C+ L   S+  C   
Sbjct: 82   SNCRKLKKLN----LNASKGNRVSVTSE---GIKVVASS------CSYLHEASLKRCCNL 128

Query: 894  GDASLVVLSRLCPNLVHLNLSGLNGVTDYGL------LPFVQSCDAGLVKVNLSGCINVT 733
             D  +V L+  C  L  +NL G   +TD  L       PF+Q  D    +V+ SG     
Sbjct: 129  TDEGVVALALNCQLLKIINLGGCLSITDVSLHALGKNCPFLQCVDFSATQVSDSG----- 183

Query: 732  DKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDL 601
               I+ ++    + LE +++  C  +TD ++ A+  YC  +R L
Sbjct: 184  --VIALVSGPCAKKLEEIHMGHCVNLTDGAVEAVLTYCPQIRIL 225



 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 54/225 (24%), Positives = 94/225 (41%), Gaps = 23/225 (10%)
 Frame = -3

Query: 1413 NHLMKVKLQSLNISDISLAVIGHYGVALTDL--------ALINLQNINERGFWVMGSGQG 1258
            + L+K+      I+D +++ I H  V   DL        AL++L N              
Sbjct: 38   DRLIKIMSMQGRITDSNISEILHPEVQTLDLRSCDISDAALLHLSNCR------------ 85

Query: 1257 LHKLRSLVITACQG----VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESI 1090
              KL+ L + A +G    VT  GI+ V+  C  + +  L++C  L+D GVV+     + +
Sbjct: 86   --KLKKLNLNASKGNRVSVTSEGIKVVASSCSYLHEASLKRCCNLTDEGVVALALNCQLL 143

Query: 1089 ESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAF--------GVPAL---P 943
            + + L  C  I+      + +H+ GK       NC  ++ + F        GV AL   P
Sbjct: 144  KIINLGGCLSITD-----VSLHALGK-------NCPFLQCVDFSATQVSDSGVIALVSGP 191

Query: 942  PCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDY 808
                L  + + +C    D ++  +   CP +  L   G   +TD+
Sbjct: 192  CAKKLEEIHMGHCVNLTDGAVEAVLTYCPQIRILLFHGCPLITDH 236



>pir|E96598|E96598 protein F20N2.2 [imported] - Arabidopsis
            thaliana>gb:AE005173_893442 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:AC002328_1530232 Genomic sequence for
            Arabidopsis thaliana BAC F20N2 from chromosome I,
            complete sequence.>gb:AY102102_1577710 Arabidopsis
            thaliana At1g55590/F20N2_18 mRNA, complete
            cds.>gb:BT001062_1635317 Arabidopsis thaliana
            At1g55590/F20N2_18 mRNA, complete cds.
          Length = 607

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 82/305 (26%), Positives = 135/305 (44%), Gaps = 12/305 (3%)
 Frame = -3

Query: 1314 INLQNINERGFWVMGSG-QGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTL 1138
            I+ + IN+ G +++    +GL  +R   +     V+D G  ++   C N+K+  +R   L
Sbjct: 293  ISFKRINDMGIFLLSEACKGLESVR---LGGFPKVSDAGFASLLHSCRNLKKFEVRGAFL 349

Query: 1137 LSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFG 958
            LSD        ++ S++ ++L  C  I+                                
Sbjct: 350  LSDLAFHDVTGSSCSLQEVRLSTCPLITSE-----------------------------A 380

Query: 957  VPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCD 778
            V  L  C +L  L + +C    D+ L  +S L   L  LNL+G + VTD G+L   +S D
Sbjct: 381  VKKLGLCGNLEVLDLGSCKSISDSCLNSVSAL-RKLTSLNLAGAD-VTDSGMLALGKS-D 437

Query: 777  AGLVKVNLSGCINVTDKTISAIAKLHG---ETLELLNLNGCGCVTDASLAAIADYCSVLR 607
              + +++L GC  V+D+ IS +    G   +TL  L+L     ++D ++  I   C  L 
Sbjct: 438  VPITQLSLRGCRRVSDRGISYLLNNEGTISKTLSTLDLGHMPGISDRAIHTITHCCKALT 497

Query: 606  DLDI-SKSRVSDFGIAALA-------GGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNS 451
            +L I S   V+D  I +LA       GGS     L+ L++  CV  +   L +L K   S
Sbjct: 498  ELSIRSCFHVTDSSIESLATWERQAEGGSK---QLRKLNVHNCVSLTTGALRWLSK--PS 552

Query: 450  LAGLN 436
             AGL+
Sbjct: 553  FAGLH 557



>gb:BC086357_2109548 Rattus norvegicus similar to F-box protein FBL2
           (predicted), mRNA (cDNA clone MGC:105998 IMAGE:7303722),
           complete cds.
          Length = 213

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 50/152 (32%), Positives = 84/152 (55%), Gaps = 4/152 (2%)
 Frame = -3

Query: 921 LSICNCTGFGDASLVVLSRLCPNLVHLNLSGL----NGVTDYGLLPFVQSCDAGLVKVNL 754
           L  CN +   D +L  L + C  L  LNL       N +T  G+     SC + L +++L
Sbjct: 23  LRSCNIS---DVALQHLCK-CRKLKALNLKSCREHRNSITSEGIKAVASSC-SDLHEISL 77

Query: 753 SGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSD 574
            GC +VTD+ + A+A L+ + L++++L GC  +TD SL A+   C  L+ +D S ++VSD
Sbjct: 78  KGCCSVTDEGVLALA-LNCQLLKIIDLGGCLSITDESLHALGKNCPFLQCVDFSTTQVSD 136

Query: 573 FGIAALAGGSAIQFSLQILSLSGCVLASDKCL 478
            G+ AL  G   +  L+ +++  C+  +DK +
Sbjct: 137 NGVVALVSGPCAK-QLEEINMGYCINLTDKAV 167



 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 60/197 (30%), Positives = 94/197 (47%), Gaps = 6/197 (3%)
 Frame = -3

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEEC--HR--ISQA 1048
            +TD  I  V    P V++L LR C + SD  +    K  + +++L L+ C  HR  I+  
Sbjct: 5    ITDSNINEVLH--PEVQRLDLRSCNI-SDVALQHLCKCRK-LKALNLKSCREHRNSITSE 60

Query: 1047 GVFGILVHSAGKLKALAFENCFGMKDLAFGVPALP-PCNSLRSLSICNCTGFGDASLVVL 871
            G+  +   S   L  ++ + C  + D   GV AL   C  L+ + +  C    D SL  L
Sbjct: 61   GIKAV-ASSCSDLHEISLKGCCSVTDE--GVLALALNCQLLKIIDLGGCLSITDESLHAL 117

Query: 870  SRLCPNLVHLNLSGLNGVTDYGLLPFVQS-CDAGLVKVNLSGCINVTDKTISAIAKLHGE 694
             + CP L  ++ S    V+D G++  V   C   L ++N+  CIN+TDK + A      +
Sbjct: 118  GKNCPFLQCVDFSTTQ-VSDNGVVALVSGPCAKQLEEINMGYCINLTDKAVEAALTACPQ 176

Query: 693  TLELLNLNGCGCVTDAS 643
               LL  +GC  +TD S
Sbjct: 177  ICILL-FHGCPLITDHS 192



 Score = 38.9 bits (89), Expect = 0.27
 Identities = 40/155 (25%), Positives = 69/155 (44%), Gaps = 13/155 (8%)
 Frame = -3

Query: 1410 HLMKV-KLQSLNISDI-----SLAVIGHYGVA-----LTDLALINLQNINERGFWVMGSG 1264
            HL K  KL++LN+        S+   G   VA     L +++L    ++ + G  V+   
Sbjct: 35   HLCKCRKLKALNLKSCREHRNSITSEGIKAVASSCSDLHEISLKGCCSVTDEG--VLALA 92

Query: 1263 QGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVK--AAESI 1090
                 L+ + +  C  +TD  + A+ K CP + Q      T +SDNGVV+ V    A+ +
Sbjct: 93   LNCQLLKIIDLGGCLSITDESLHALGKNCPFL-QCVDFSTTQVSDNGVVALVSGPCAKQL 151

Query: 1089 ESLQLEECHRISQAGVFGILVHSAGKLKALAFENC 985
            E + +  C  ++   V   L  +  ++  L F  C
Sbjct: 152  EEINMGYCINLTDKAVEAALT-ACPQICILLFHGC 185



 Score = 35.0 bits (79), Expect = 3.9
 Identities = 23/86 (26%), Positives = 40/86 (46%)
 Frame = -3

Query: 1383 LNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDL 1204
            L+I+D SL  +G     L  +     Q +++ G   + SG    +L  + +  C  +TD 
Sbjct: 107  LSITDESLHALGKNCPFLQCVDFSTTQ-VSDNGVVALVSGPCAKQLEEINMGYCINLTDK 165

Query: 1203 GIEAVSKGCPNVKQLCLRKCTLLSDN 1126
             +EA    CP +  L    C L++D+
Sbjct: 166  AVEAALTACPQICILLFHGCPLITDH 191



>gb:AC135419_1742238 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OSJNBa0044P19, complete sequence.
          Length = 376

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 75/259 (28%), Positives = 113/259 (43%), Gaps = 23/259 (8%)
 Frame = -3

Query: 1092 IESLQLEECHRISQAGVFGILVHSAGKLKALAF-ENCFGMKDLAFGVPALPP-CNSLRSL 919
            + +L L  C + +   +   L H   KL+ L   +N   ++D A  V A+   C+ LR L
Sbjct: 80   LTNLSLSRCQQ-NMNNLMISLAHKFTKLQVLTLRQNIPQLEDSA--VEAVSNYCHDLREL 136

Query: 918  SICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCIN 739
             +       D SL  L+R CP L  LN+SG +  +D  L      C      +NL GC  
Sbjct: 137  DLSRSFRLSDRSLYALARGCPQLTKLNISGCSNFSDTALTYLTFHC-KNFKCLNLCGCGK 195

Query: 738  -VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKS-RVSDFGI 565
              TD+ + AIA+  G+ L+ LNL  C  VTD  + ++A  C  LR LD+     ++D  +
Sbjct: 196  AATDRALQAIARNCGQ-LQSLNLGWCEDVTDKGVTSLASGCPDLRALDLCGCVLITDESV 254

Query: 564  AALAGGSAIQFSLQILSLSGCVLASDKCLPYL-------------------HKLGNSLAG 442
             ALA G      L+ L L  C   +D+ +  L                    K  + LA 
Sbjct: 255  IALATGCP---HLRSLGLYYCQNITDRAMYSLANSRVKSKRRRWDSVRSSSSKEEDGLAN 311

Query: 441  LNIQNCVGISHRGVDLLVE 385
            LNI  C  ++   V  + +
Sbjct: 312  LNISQCTALTPPAVQAVCD 330



 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 53/215 (24%), Positives = 90/215 (41%), Gaps = 5/215 (2%)
 Frame = -3

Query: 1254 HKLRSL-VITACQGVTDL---GIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIE 1087
            HK   L V+T  Q +  L    +EAVS  C ++++L L +   LSD  + +  +    + 
Sbjct: 101  HKFTKLQVLTLRQNIPQLEDSAVEAVSNYCHDLRELDLSRSFRLSDRSLYALARGCPQLT 160

Query: 1086 SLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICN 907
             L +  C   S   +  +  H                            C + + L++C 
Sbjct: 161  KLNISGCSNFSDTALTYLTFH----------------------------CKNFKCLNLCG 192

Query: 906  C-TGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTD 730
            C     D +L  ++R C  L  LNL     VTD G+      C   L  ++L GC+ +TD
Sbjct: 193  CGKAATDRALQAIARNCGQLQSLNLGWCEDVTDKGVTSLASGC-PDLRALDLCGCVLITD 251

Query: 729  KTISAIAKLHGETLELLNLNGCGCVTDASLAAIAD 625
            +++ A+A      L  L L  C  +TD ++ ++A+
Sbjct: 252  ESVIALA-TGCPHLRSLGLYYCQNITDRAMYSLAN 285



 Score = 40.4 bits (93), Expect = 0.092
 Identities = 36/157 (22%), Positives = 66/157 (42%)
 Frame = -3

Query: 1374 SDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIE 1195
            +D +L  I      L  L L   +++ ++G   + SG     LR+L +  C  +TD  + 
Sbjct: 198  TDRALQAIARNCGQLQSLNLGWCEDVTDKGVTSLASG--CPDLRALDLCGCVLITDESVI 255

Query: 1194 AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG 1015
            A++ GCP+++ L L  C  ++D  + S   +    +  + +     S     G+   +  
Sbjct: 256  ALATGCPHLRSLGLYYCQNITDRAMYSLANSRVKSKRRRWDSVRSSSSKEEDGLANLNIS 315

Query: 1014 KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNC 904
            +  AL       ++ +    PAL  C    SL I  C
Sbjct: 316  QCTALTPP---AVQAVCDSFPALHTCPGRHSLIISGC 349



>gb:BX908798_829755 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 337

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 82/283 (28%), Positives = 142/283 (50%), Gaps = 6/283 (2%)
 Frame = -3

Query: 1392 LQSLNIS---DISLAVIGHYG--VALTDLALINLQNINERGFWVMGSGQGLHKLRSLVIT 1228
            LQ LN+S    ++ A + H    VAL +L L     + + G   +     L  L+ L + 
Sbjct: 56   LQHLNLSVCGKLTGAGLAHLTPLVALENLDLSQCGKLTDAG---LAHLTPLVALQHLGMR 112

Query: 1227 ACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQA 1048
             C+ +TD+G+ A  +    ++ L L  C+ L+D G+ + ++   +++ L L+ C  ++  
Sbjct: 113  GCRKLTDVGL-AHLRPLVALQHLDLDGCSNLTDAGL-AHLRPLVALQHLNLKRCDNLTDI 170

Query: 1047 GVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLS 868
            G+  +    A  L+ L  + C  + D   G+  L P  +L+ L++  C  F DA L  L+
Sbjct: 171  GLAHLRPLVA--LQHLDLDGCNNLTDA--GLAHLTPLVALQHLNLRGCFKFTDAGLAHLT 226

Query: 867  RLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETL 688
             L   L +LNLS  + +TD GL          L  +NLS C  +T   ++ +  L    L
Sbjct: 227  PLVA-LQYLNLSDCSNLTDAGLAHLKSL--VALQHLNLSWCSKLTGAGLAHLTPL--VAL 281

Query: 687  ELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSDFGIA 562
            E L+L+ CG +TDA LA +A   + L+ L++ + R ++D G+A
Sbjct: 282  EDLDLSQCGKLTDAGLAHLA-LLTALQYLNLERCRKLTDAGLA 323



 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 60/184 (32%), Positives = 89/184 (48%), Gaps = 6/184 (3%)
 Frame = -3

Query: 942 PCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVK 763
           P  +L+ L +  C    DA L  L  L   L HLNLS  + +TD GL          L  
Sbjct: 3   PLVALQHLEL-GCCKLTDAGLAHLKSLVA-LQHLNLSWCDNLTDTGLAHLTPL--TALQH 58

Query: 762 VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR 583
           +NLS C  +T   ++ +  L    LE L+L+ CG +TDA LA +    + L+ L +   R
Sbjct: 59  LNLSVCGKLTGAGLAHLTPL--VALENLDLSQCGKLTDAGLAHLTPLVA-LQHLGMRGCR 115

Query: 582 -VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC-----V 421
            ++D G+A L        +LQ L L GC   +D  L +L  L  +L  LN++ C     +
Sbjct: 116 KLTDVGLAHLRP----LVALQHLDLDGCSNLTDAGLAHLRPL-VALQHLNLKRCDNLTDI 170

Query: 420 GISH 409
           G++H
Sbjct: 171 GLAH 174



>pir|T45861|T45861 hypothetical protein F3A4.160 - Arabidopsis
            thaliana>gb:ATF3A4_1550562 Arabidopsis thaliana DNA
            chromosome 3, BAC clone F3A4.
          Length = 522

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 73/290 (25%), Positives = 125/290 (43%), Gaps = 48/290 (16%)
 Frame = -3

Query: 1233 ITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSD--NGVVSFVKAAESIESLQLEECHR 1060
            +  C+ +TDLG+E+ ++ C ++++L    CT  +   N ++   K  E +   ++   H 
Sbjct: 138  LRGCREITDLGMESFARNCKSLRKLSCGSCTFGAKGINAMLEHCKVLEELSLKRIRGLHE 197

Query: 1059 ISQ--------------------AGVFGILVHSAGKLKALAFENCFGMKDLAF------- 961
            +++                      VFG LV +   LK +    C G  D  F       
Sbjct: 198  LAEPIKLSLSASLRSVFLKELVNGQVFGSLV-ATRTLKKVKIIRCLGNWDRVFEMNGNGN 256

Query: 960  ----------------GVPALPPCNSLRSLSIC---NCTGFGDASLVVLSRLCPNLVHLN 838
                            G+  +  C++L +L I    +C+  G AS+V   +L   L H++
Sbjct: 257  SSLTEIRLERLQVTDIGLFGISKCSNLETLHIVKTPDCSNLGLASVVERCKLLRKL-HID 315

Query: 837  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGC 658
               +  + D GL+   + C   L ++ L G ++ T  ++SAIA  + + LE L L G G 
Sbjct: 316  GWRVKRIGDQGLMSVAKHC-LNLQELVLIG-VDATYMSLSAIAS-NCKKLERLALCGSGT 372

Query: 657  VTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLS 508
            + DA +  IA+ C  LR   I    +SD G+ ALA G      L++   S
Sbjct: 373  IGDAEIGCIAEKCVTLRKFCIKGCLISDVGVQALALGCPKLVKLKVKKCS 422



 Score = 36.6 bits (83), Expect = 1.3
 Identities = 24/73 (32%), Positives = 41/73 (56%)
 Frame = -3

Query: 891 DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI 712
           D +L ++S  C NL+ + L G   +TD G+  F ++C + L K++   C     K I+A+
Sbjct: 120 DEALFIVSIRCSNLIRVKLRGCREITDLGMESFARNCKS-LRKLSCGSC-TFGAKGINAM 177

Query: 711 AKLHGETLELLNL 673
            + H + LE L+L
Sbjct: 178 LE-HCKVLEELSL 189



 Score = 35.4 bits (80), Expect = 3.0
 Identities = 24/93 (25%), Positives = 49/93 (52%)
 Frame = -3

Query: 1410 HLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVI 1231
            +L ++ L  ++ + +SL+ I      L  LAL     I +     +   +    LR   I
Sbjct: 336  NLQELVLIGVDATYMSLSAIASNCKKLERLALCGSGTIGDAEIGCIA--EKCVTLRKFCI 393

Query: 1230 TACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLS 1132
              C  ++D+G++A++ GCP + +L ++KC+L++
Sbjct: 394  KGCL-ISDVGVQALALGCPKLVKLKVKKCSLVT 425



>sp|O74783|POF2_SCHPO F-box/LRR-repeat protein 2 (F-box and
            leucine-rich repeat protein 2) (F-box protein
            pof2).>pir|T39987|T39987 probable regulatory protein -
            fission yeast  (Schizosaccharomyces
            pombe)>gb:AB062778_1522164 Schizosaccharomyces pombe gene
            for Pof2 F-box protein, complete cds.>gb:SPBC25B2_1719638
            S.pombe chromosome II cosmid c25B2.
          Length = 463

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 60/242 (24%), Positives = 98/242 (40%), Gaps = 51/242 (21%)
 Frame = -3

Query: 1200 IEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAA-------------------------E 1096
            +E +S  CPN+K L +  C L+ D G+V  +K                           E
Sbjct: 138  LEYISDNCPNLKALNIGNCGLVEDTGMVQIIKRCPYLNRLIIPNCRKLTDVSLQILSEKE 197

Query: 1095 SIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDL--------------AFG 958
             +  L +  C     A     LV     LK L+ + C  +                 A  
Sbjct: 198  DLIELDISGCEGFHNADTLSRLVSRNRGLKELSMDGCTELSHFITFLNLNCELDAMRALS 257

Query: 957  VPALPPC------------NSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVT 814
            +  LP              + L SL +  C G  D+SL+ L++L  +L  L+L     +T
Sbjct: 258  LNNLPDLKDSDIELITCKFSKLNSLFLSKCIGLTDSSLLSLTKLSQSLTTLHLGHCYEIT 317

Query: 813  DYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAA 634
            D G+   ++SC   +  ++  GC+ ++D  +SAIAKL    L+ + L  C C+TD S+  
Sbjct: 318  DIGVQCLLKSC-KNITYIDFGGCLRLSDIAVSAIAKL--PYLQRVGLVKCICLTDLSVIL 374

Query: 633  IA 628
            ++
Sbjct: 375  LS 376



 Score = 55.5 bits (132), Expect = 3e-06
 Identities = 45/189 (23%), Positives = 86/189 (45%)
 Frame = -3

Query: 1335 ALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLC 1156
            A+  L+L NL ++ +    ++       KL SL ++ C G+TD  + +++K   ++  L 
Sbjct: 252  AMRALSLNNLPDLKDSDIELITCK--FSKLNSLFLSKCIGLTDSSLLSLTKLSQSLTTLH 309

Query: 1155 LRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGM 976
            L  C  ++D GV   +K+ ++I  +    C R+S   V  I       L+ +    C  +
Sbjct: 310  LGHCYEITDIGVQCLLKSCKNITYIDFGGCLRLSDIAVSAIA--KLPYLQRVGLVKCICL 367

Query: 975  KDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLP 796
             DL+  + +     +L  + +  C G    S+  L   C  L HL+++G+N +    L  
Sbjct: 368  TDLSVILLSGSFSRNLERVHLSYCIGLTAKSVSYLMYNCKTLKHLSVTGINSILCTELRS 427

Query: 795  FVQSCDAGL 769
            F +    G+
Sbjct: 428  FSRPIPDGI 436



 Score = 34.3 bits (77), Expect = 6.6
 Identities = 38/149 (25%), Positives = 56/149 (37%), Gaps = 27/149 (18%)
 Frame = -3

Query: 774 GLVKVNLSGCINVTDKTI---------------SAIAKLHGETLE----------LLNLN 670
           G+ ++NLSGC  +++  I               S I  L    LE           LN+ 
Sbjct: 95  GISRLNLSGCTRISEPLIGKLLYQNLNLVTINFSNIFSLPANILEYISDNCPNLKALNIG 154

Query: 669 GCGCVTDASLAAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILSLSGCV-L 496
            CG V D  +  I   C  L  L I   R ++D  +  L+     +  L  L +SGC   
Sbjct: 155 NCGLVEDTGMVQIIKRCPYLNRLIIPNCRKLTDVSLQILSE----KEDLIELDISGCEGF 210

Query: 495 ASDKCLPYLHKLGNSLAGLNIQNCVGISH 409
            +   L  L      L  L++  C  +SH
Sbjct: 211 HNADTLSRLVSRNRGLKELSMDGCTELSH 239



>gb:AF467464_2496361 Gallus gallus PPA (PPA) gene, partial cds.
          Length = 188

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 56/179 (31%), Positives = 89/179 (49%)
 Frame = -3

Query: 921 LSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCI 742
           L++ +C    D SL  L+R    L  LNLS   G++D GLL    S  + L  +NL  C 
Sbjct: 1   LTLQDCQKLSDLSLKHLARGLGRLRQLNLSFCGGISDAGLLHL--SHMSSLRSLNLRSCD 58

Query: 741 NVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIA 562
           N++D  I  +A +    L  L+++ C  V D SLA IA     LR L +    +SD GI 
Sbjct: 59  NISDTGIMHLA-MGSLRLSGLDVSFCDKVGDQSLAYIAQGLDGLRSLSLCSCHISDEGIN 117

Query: 561 ALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVE 385
            +         L+ L++  CV  +DK L  + +  + L G+++  C  I+ RG++ + +
Sbjct: 118 RMVRQ---MHGLRTLNIGQCVRITDKGLELIAEHLSQLTGIDLYGCTRITKRGLERITQ 173



 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 52/181 (28%), Positives = 88/181 (48%), Gaps = 2/181 (1%)
 Frame = -3

Query: 1239 LVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHR 1060
            L +  CQ ++DL ++ +++G   ++QL L  C  +SD G++  +    S+ SL L  C  
Sbjct: 1    LTLQDCQKLSDLSLKHLARGLGRLRQLNLSFCGGISDAGLL-HLSHMSSLRSLNLRSCDN 59

Query: 1059 ISQAGVFGILVHSAGKLKALAFENC--FGMKDLAFGVPALPPCNSLRSLSICNCTGFGDA 886
            IS  G+  + + S  +L  L    C   G + LA+    L   + LRSLS+C+C    D 
Sbjct: 60   ISDTGIMHLAMGSL-RLSGLDVSFCDKVGDQSLAYIAQGL---DGLRSLSLCSC-HISDE 114

Query: 885  SLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAK 706
             +  + R    L  LN+     +TD G L  +    + L  ++L GC  +T + +  I +
Sbjct: 115  GINRMVRQMHGLRTLNIGQCVRITDKG-LELIAEHLSQLTGIDLYGCTRITKRGLERITQ 173

Query: 705  L 703
            L
Sbjct: 174  L 174



>gb:BX908798_830832 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 667

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 91/322 (28%), Positives = 148/322 (45%), Gaps = 47/322 (14%)
 Frame = -3

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGV------------------------VSFV 1108
            +TD  + A+ K C N+K L L++C  L+D G+                        ++ +
Sbjct: 271  LTDAHLLAL-KNCKNLKALHLQECDKLTDAGLAHLASLMALQHLNLNGCWELTDAGLAHL 329

Query: 1107 KAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSL 928
             +  +++ L L +CH+I+ AG+  +   S   L+ L    C  + D   G+  L P  +L
Sbjct: 330  ASLMALQHLNLAKCHKITDAGLAHLT--SLVALQHLDLSCCRNLTDA--GLTHLRPLVAL 385

Query: 927  RSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGL-----LPFVQSCD----- 778
              L++  C    DA L  L+ L   L HL+LS    +TD GL     L  +Q  D     
Sbjct: 386  THLNLAKCHKITDAGLAHLTSLVA-LQHLDLSYCEKLTDAGLAHLTPLVALQHLDLSYSH 444

Query: 777  ----AGLV---------KVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLA 637
                AGL           +NL+ C   TD  ++ +  L    L+ L+L+ C  +TDA LA
Sbjct: 445  HFTNAGLAHLTSLVALQHLNLNSCYKFTDAGLAHLTSL--VALQHLDLSCCRNLTDAGLA 502

Query: 636  AIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLG 457
             +A   + L+ LD+S S    F  A LA  +++  +LQ L LS C   +D  L +L  L 
Sbjct: 503  HLAPLVA-LQHLDLSYSH--HFTNAGLAHLTSL-VALQHLDLSCCRNLTDAGLAHLTSL- 557

Query: 456  NSLAGLNIQNCVGISHRGVDLL 391
             +L  L++ +C  ++  G++ L
Sbjct: 558  VALQHLDLSSCKKLTDAGLEHL 579



 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 74/259 (28%), Positives = 116/259 (44%), Gaps = 5/259 (1%)
 Frame = -3

Query: 1398 VKLQSLNIS---DISLAVIGHYG--VALTDLALINLQNINERGFWVMGSGQGLHKLRSLV 1234
            V LQ L++S    ++ A + H    VAL  L L    +    G   + S   L  L+ L 
Sbjct: 408  VALQHLDLSYCEKLTDAGLAHLTPLVALQHLDLSYSHHFTNAGLAHLTS---LVALQHLN 464

Query: 1233 ITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRIS 1054
            + +C   TD G+  ++     ++ L L  C  L+D G+        +++ L L   H  +
Sbjct: 465  LNSCYKFTDAGLAHLTS-LVALQHLDLSCCRNLTDAGLAHLAPLV-ALQHLDLSYSHHFT 522

Query: 1053 QAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVV 874
             AG+  +   S   L+ L    C  + D   G+  L    +L+ L + +C    DA L  
Sbjct: 523  NAGLAHLT--SLVALQHLDLSCCRNLTDA--GLAHLTSLVALQHLDLSSCKKLTDAGLEH 578

Query: 873  LSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGE 694
            L+ L   L HL+LS    +TD GL          L  ++LS C  +TD  ++ +A L   
Sbjct: 579  LTPLVA-LQHLDLSSCKKLTDAGLAHLAPL--VALQHLDLSSCKKLTDAGLAHLAPL--V 633

Query: 693  TLELLNLNGCGCVTDASLA 637
             L+ LNLN C  +TDA +A
Sbjct: 634  ALQHLNLNWCDKLTDAGVA 652



 Score = 55.1 bits (131), Expect = 4e-06
 Identities = 72/259 (27%), Positives = 119/259 (45%), Gaps = 19/259 (7%)
 Frame = -3

Query: 1119 VSFVKAAESIESLQLEECHRISQAGV-----------------FGILVHSAGKLKALA-F 994
            +SFV   + +  +QL + +++S+AG                  F     S  +LKAL  F
Sbjct: 159  ISFVPLEDILSFIQLADYYQLSEAGKKLEKQLIDAYKSQKLEPFNSTTDSLVELKALLNF 218

Query: 993  ENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVT 814
               + +  L   +  +   + L   S  + T F      +L      +  LN S    +T
Sbjct: 219  AQQYQLNTLKNYLELIVVSSLLNQAS--HVTEFEK----ILKHFSNEIERLNFSKNIFLT 272

Query: 813  DYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAA 634
            D  LL  +++C   L  ++L  C  +TD  ++ +A L    L+ LNLNGC  +TDA LA 
Sbjct: 273  DAHLLA-LKNCK-NLKALHLQECDKLTDAGLAHLASLMA--LQHLNLNGCWELTDAGLAH 328

Query: 633  IADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLG 457
            +A   + L+ L+++K  +++D G+A L        +LQ L LS C   +D  L +L  L 
Sbjct: 329  LASLMA-LQHLNLAKCHKITDAGLAHLTS----LVALQHLDLSCCRNLTDAGLTHLRPL- 382

Query: 456  NSLAGLNIQNCVGISHRGV 400
             +L  LN+  C  I+  G+
Sbjct: 383  VALTHLNLAKCHKITDAGL 401



 Score = 47.4 bits (111), Expect = 8e-04
 Identities = 62/223 (27%), Positives = 103/223 (46%), Gaps = 8/223 (3%)
 Frame = -3

Query: 1428 FSSAG-NHLMK-VKLQSLNIS------DISLAVIGHYGVALTDLALINLQNINERGFWVM 1273
            F++AG  HL   V LQ LN++      D  LA +    VAL  L L   +N+ + G   +
Sbjct: 446  FTNAGLAHLTSLVALQHLNLNSCYKFTDAGLAHLTSL-VALQHLDLSCCRNLTDAGLAHL 504

Query: 1272 GSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAES 1093
                 L  L+ L ++     T+ G+  ++     ++ L L  C  L+D G+        +
Sbjct: 505  AP---LVALQHLDLSYSHHFTNAGLAHLTS-LVALQHLDLSCCRNLTDAGLAHLTSLV-A 559

Query: 1092 IESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSI 913
            ++ L L  C +++ AG+  +    A  L+ L   +C  + D   G+  L P  +L+ L +
Sbjct: 560  LQHLDLSSCKKLTDAGLEHLTPLVA--LQHLDLSSCKKLTDA--GLAHLAPLVALQHLDL 615

Query: 912  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS 784
             +C    DA L  L+ L   L HLNL+  + +TD G+  F  S
Sbjct: 616  SSCKKLTDAGLAHLAPLVA-LQHLNLNWCDKLTDAGVAHFKSS 657



>gb:BC067906_1987553 Homo sapiens hypothetical protein LOC196394,
           mRNA (cDNA clone MGC:87706 IMAGE:5314530), complete cds.
          Length = 213

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 51/152 (33%), Positives = 84/152 (55%), Gaps = 4/152 (2%)
 Frame = -3

Query: 930 LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG----VTDYGLLPFVQSCDAGLVK 763
           +++L + +C    DA+L+ LS  C  L  LNL+   G    VT  G+     SC   L +
Sbjct: 18  VQTLDLRSCD-ISDAALLHLSN-CRKLKKLNLNASKGNRVSVTSEGIKAVASSCSY-LHE 74

Query: 762 VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR 583
            +L  C N+TD+ + A+A L+ + L++++L GC  +TD SL A+   C  L+ +D S ++
Sbjct: 75  ASLKRCCNLTDEGVVALA-LNCQLLKIIDLGGCLSITDVSLHALGKNCPFLQCVDFSATQ 133

Query: 582 VSDFGIAALAGGSAIQFSLQILSLSGCVLASD 487
           VSD G+ AL  G   +  L+ + +  CV  +D
Sbjct: 134 VSDSGVIALVSGPCAK-KLEEIHMGHCVNLTD 164



 Score = 51.2 bits (121), Expect = 5e-05
 Identities = 52/217 (23%), Positives = 93/217 (42%), Gaps = 18/217 (8%)
 Frame = -3

Query: 1404 MKVKLQSLNISDI---SLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLV 1234
            M+ ++   NIS+I    +  +      ++D AL++L N                KL+ L 
Sbjct: 1    MQGQITDSNISEILHPEVQTLDLRSCDISDAALLHLSNCR--------------KLKKLN 46

Query: 1233 ITACQG----VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEEC 1066
            + A +G    VT  GI+AV+  C  + +  L++C  L+D GVV+     + ++ + L  C
Sbjct: 47   LNASKGNRVSVTSEGIKAVASSCSYLHEASLKRCCNLTDEGVVALALNCQLLKIIDLGGC 106

Query: 1065 HRISQAGVFGILVHSAGKLKALAFENCFGMKDLAF--------GVPAL---PPCNSLRSL 919
              I+      + +H+ GK       NC  ++ + F        GV AL   P    L  +
Sbjct: 107  LSITD-----VSLHALGK-------NCPFLQCVDFSATQVSDSGVIALVSGPCAKKLEEI 154

Query: 918  SICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDY 808
             + +C    D ++  +   CP +  L   G   +TD+
Sbjct: 155  HMGHCVNLTDGAVEAVLTYCPQIRILLFHGCPLITDH 191



 Score = 47.4 bits (111), Expect = 8e-04
 Identities = 45/173 (26%), Positives = 77/173 (44%), Gaps = 9/173 (5%)
 Frame = -3

Query: 1092 IESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFG--MKDLAFGVPALPP-CNSLRS 922
            +++L L  C  IS A +  +   +  KLK L      G  +   + G+ A+   C+ L  
Sbjct: 18   VQTLDLRSCD-ISDAALLHL--SNCRKLKKLNLNASKGNRVSVTSEGIKAVASSCSYLHE 74

Query: 921  LSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGL------LPFVQSCDAGLVKV 760
             S+  C    D  +V L+  C  L  ++L G   +TD  L       PF+Q  D    +V
Sbjct: 75   ASLKRCCNLTDEGVVALALNCQLLKIIDLGGCLSITDVSLHALGKNCPFLQCVDFSATQV 134

Query: 759  NLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDL 601
            + SG        I+ ++    + LE +++  C  +TD ++ A+  YC  +R L
Sbjct: 135  SDSG-------VIALVSGPCAKKLEEIHMGHCVNLTDGAVEAVLTYCPQIRIL 180



>gb:BC045831_1983645 Homo sapiens, clone IMAGE:5265088, mRNA,
           partial cds.
          Length = 294

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 51/152 (33%), Positives = 84/152 (55%), Gaps = 4/152 (2%)
 Frame = -3

Query: 930 LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG----VTDYGLLPFVQSCDAGLVK 763
           +++L + +C    DA+L+ LS  C  L  LNL+   G    VT  G+     SC   L +
Sbjct: 99  VQTLDLRSCD-ISDAALLHLSN-CRKLKKLNLNASKGNRVSVTSEGIKAVASSCSY-LHE 155

Query: 762 VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR 583
            +L  C N+TD+ + A+A L+ + L++++L GC  +TD SL A+   C  L+ +D S ++
Sbjct: 156 ASLKRCCNLTDEGVVALA-LNCQLLKIIDLGGCLSITDVSLHALGKNCPFLQCVDFSATQ 214

Query: 582 VSDFGIAALAGGSAIQFSLQILSLSGCVLASD 487
           VSD G+ AL  G   +  L+ + +  CV  +D
Sbjct: 215 VSDSGVIALVSGPCAK-KLEEIHMGHCVNLTD 245



 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 55/225 (24%), Positives = 95/225 (42%), Gaps = 23/225 (10%)
 Frame = -3

Query: 1413 NHLMKVKLQSLNISDISLAVIGHYGVALTDL--------ALINLQNINERGFWVMGSGQG 1258
            + L+K+      I+D +++ I H  V   DL        AL++L N              
Sbjct: 74   DRLIKIMSMQGQITDSNISEILHPEVQTLDLRSCDISDAALLHLSNCR------------ 121

Query: 1257 LHKLRSLVITACQG----VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESI 1090
              KL+ L + A +G    VT  GI+AV+  C  + +  L++C  L+D GVV+     + +
Sbjct: 122  --KLKKLNLNASKGNRVSVTSEGIKAVASSCSYLHEASLKRCCNLTDEGVVALALNCQLL 179

Query: 1089 ESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAF--------GVPAL---P 943
            + + L  C  I+      + +H+ GK       NC  ++ + F        GV AL   P
Sbjct: 180  KIIDLGGCLSITD-----VSLHALGK-------NCPFLQCVDFSATQVSDSGVIALVSGP 227

Query: 942  PCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDY 808
                L  + + +C    D ++  +   CP +  L   G   +TD+
Sbjct: 228  CAKKLEEIHMGHCVNLTDGAVEAVLTYCPQIRILLFHGCPLITDH 272



 Score = 49.7 bits (117), Expect = 2e-04
 Identities = 51/205 (24%), Positives = 91/205 (44%), Gaps = 13/205 (6%)
 Frame = -3

Query: 1176 PNVKQLCLRKCTLLSDNGVVSFVKAAE----SIESLQLEECHRISQAGVFGILVHSAGKL 1009
            PN+K   ++   ++S  G ++    +E     +++L L  C  IS A +  +   +  KL
Sbjct: 70   PNIKDRLIK---IMSMQGQITDSNISEILHPEVQTLDLRSCD-ISDAALLHL--SNCRKL 123

Query: 1008 KALAFENCFG--MKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN 838
            K L      G  +   + G+ A+   C+ L   S+  C    D  +V L+  C  L  ++
Sbjct: 124  KKLNLNASKGNRVSVTSEGIKAVASSCSYLHEASLKRCCNLTDEGVVALALNCQLLKIID 183

Query: 837  LSGLNGVTDYGL------LPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLN 676
            L G   +TD  L       PF+Q  D    +V+ SG        I+ ++    + LE ++
Sbjct: 184  LGGCLSITDVSLHALGKNCPFLQCVDFSATQVSDSG-------VIALVSGPCAKKLEEIH 236

Query: 675  LNGCGCVTDASLAAIADYCSVLRDL 601
            +  C  +TD ++ A+  YC  +R L
Sbjct: 237  MGHCVNLTDGAVEAVLTYCPQIRIL 261



>gb:BC037897_1982248 Homo sapiens hypothetical protein LOC196394,
           mRNA (cDNA clone IMAGE:5275850), partial cds.
          Length = 281

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 51/152 (33%), Positives = 84/152 (55%), Gaps = 4/152 (2%)
 Frame = -3

Query: 930 LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG----VTDYGLLPFVQSCDAGLVK 763
           +++L + +C    DA+L+ LS  C  L  LNL+   G    VT  G+     SC   L +
Sbjct: 86  VQTLDLRSCD-ISDAALLHLSN-CRKLKKLNLNASKGNRVSVTSEGIKAVASSCSY-LHE 142

Query: 762 VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR 583
            +L  C N+TD+ + A+A L+ + L++++L GC  +TD SL A+   C  L+ +D S ++
Sbjct: 143 ASLKRCCNLTDEGVVALA-LNCQLLKIIDLGGCLSITDVSLHALGKNCPFLQCVDFSATQ 201

Query: 582 VSDFGIAALAGGSAIQFSLQILSLSGCVLASD 487
           VSD G+ AL  G   +  L+ + +  CV  +D
Sbjct: 202 VSDSGVIALVSGPCAK-KLEEIHMGHCVNLTD 232



 Score = 53.9 bits (128), Expect = 8e-06
 Identities = 58/234 (24%), Positives = 99/234 (42%), Gaps = 23/234 (9%)
 Frame = -3

Query: 1440 IASLFSSAGNHLMKVKLQSLNISDISLAVIGHYGVALTDL--------ALINLQNINERG 1285
            I  L S+  + L+K+      I+D +++ I H  V   DL        AL++L N     
Sbjct: 52   IKPLPSNIKDRLIKIMSMQGQITDSNISEILHPEVQTLDLRSCDISDAALLHLSNCR--- 108

Query: 1284 FWVMGSGQGLHKLRSLVITACQG----VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVV 1117
                       KL+ L + A +G    VT  GI+AV+  C  + +  L++C  L+D GVV
Sbjct: 109  -----------KLKKLNLNASKGNRVSVTSEGIKAVASSCSYLHEASLKRCCNLTDEGVV 157

Query: 1116 SFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAF-------- 961
            +     + ++ + L  C  I+      + +H+ GK       NC  ++ + F        
Sbjct: 158  ALALNCQLLKIIDLGGCLSITD-----VSLHALGK-------NCPFLQCVDFSATQVSDS 205

Query: 960  GVPAL---PPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDY 808
            GV AL   P    L  + + +C    D ++  +   CP +  L   G   +TD+
Sbjct: 206  GVIALVSGPCAKKLEEIHMGHCVNLTDGAVEAVLTYCPQIRILLFHGCPLITDH 259



 Score = 49.7 bits (117), Expect = 2e-04
 Identities = 58/224 (25%), Positives = 94/224 (41%), Gaps = 7/224 (3%)
 Frame = -3

Query: 1251 KLRSLVITACQG-VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQL 1075
            K R + I + QG +TD  I  +    P V+ L LR C + SD  +            L L
Sbjct: 60   KDRLIKIMSMQGQITDSNISEILH--PEVQTLDLRSCDI-SDAAL------------LHL 104

Query: 1074 EECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGF 895
              C ++ +      L  S G   ++  E   G+K +A        C+ L   S+  C   
Sbjct: 105  SNCRKLKKLN----LNASKGNRVSVTSE---GIKAVASS------CSYLHEASLKRCCNL 151

Query: 894  GDASLVVLSRLCPNLVHLNLSGLNGVTDYGL------LPFVQSCDAGLVKVNLSGCINVT 733
             D  +V L+  C  L  ++L G   +TD  L       PF+Q  D    +V+ SG     
Sbjct: 152  TDEGVVALALNCQLLKIIDLGGCLSITDVSLHALGKNCPFLQCVDFSATQVSDSG----- 206

Query: 732  DKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDL 601
               I+ ++    + LE +++  C  +TD ++ A+  YC  +R L
Sbjct: 207  --VIALVSGPCAKKLEEIHMGHCVNLTDGAVEAVLTYCPQIRIL 248



>gb:BC036680_1982003 Homo sapiens F-box and leucine-rich repeat
            protein 16, mRNA (cDNA clone MGC:33974 IMAGE:5262152),
            complete cds.
          Length = 479

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 81/289 (28%), Positives = 133/289 (46%), Gaps = 4/289 (1%)
 Frame = -3

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TD G+E + +    V +L L  C   ++ G+ S + A   I SL + +C  ++   +  
Sbjct: 205  ITDAGLEVMLEQMQGVVRLELSGCNDFTEAGLWSSLSAR--ITSLSVSDCINVADDAIAA 262

Query: 1035 I--LVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRL 862
            I  L+ +  +L   A+     + D A         +S  +L + +C    +  +V +   
Sbjct: 263  ISQLLPNLAELSLQAYH----VTDTALAYFTARQGHSTHTLRLLSCWEITNHGVVNVVHS 318

Query: 861  CPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIA-KLHGETLE 685
             PNL  L+LSG + VTD G +  V      L  ++LS C  +TD  +  +A  LH   LE
Sbjct: 319  LPNLTALSLSGCSKVTDDG-VELVAENLRKLRSLDLSWCPRITDMALEYVACDLH--RLE 375

Query: 684  LLNLNGCGCVTDASLAAIADYCSVLRDLDIS-KSRVSDFGIAALAGGSAIQFSLQILSLS 508
             L L+ C  +TD  L+ ++   S LR L +    +V DFG+  L        SL++LS +
Sbjct: 376  ELVLDRCVRITDTGLSYLSTMSS-LRSLYLRWCCQVQDFGLKHLLALG----SLRLLSPA 430

Query: 507  GCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVERLWRCDIL 361
            GC L +   L  L +L   L  L + NC G +        + L RC ++
Sbjct: 431  GCPLLTTTGLSGLVQL-QELEELELTNCPGATPELFKYFSQHLPRCLVI 478



 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 59/217 (27%), Positives = 99/217 (45%), Gaps = 13/217 (5%)
 Frame = -3

Query: 1437 ASLFSSAGNHLMKVKLQS-LNISDISLAVIGHYGVALTDLALINLQ--NINERGFWVMGS 1267
            A L+SS    +  + +   +N++D ++A I      L +LA ++LQ  ++ +       +
Sbjct: 234  AGLWSSLSARITSLSVSDCINVADDAIAAISQL---LPNLAELSLQAYHVTDTALAYFTA 290

Query: 1266 GQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIE 1087
             QG H   +L + +C  +T+ G+  V    PN+  L L  C+ ++D+GV    +    + 
Sbjct: 291  RQG-HSTHTLRLLSCWEITNHGVVNVVHSLPNLTALSLSGCSKVTDDGVELVAENLRKLR 349

Query: 1086 SLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSI-- 913
            SL L  C RI+   +   +     +L+ L  + C  + D   G+  L   +SLRSL +  
Sbjct: 350  SLDLSWCPRITDMAL-EYVACDLHRLEELVLDRCVRITDT--GLSYLSTMSSLRSLYLRW 406

Query: 912  -CNCTGFGDASLVVLSRL-------CPNLVHLNLSGL 826
             C    FG   L+ L  L       CP L    LSGL
Sbjct: 407  CCQVQDFGLKHLLALGSLRLLSPAGCPLLTTTGLSGL 443



>gb:AK175307_1817295 Arabidopsis thaliana mRNA for hypothetical
            protein, complete cds, clone: RAFL21-73-P17.
          Length = 762

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 68/269 (25%), Positives = 123/269 (45%), Gaps = 3/269 (1%)
 Frame = -3

Query: 1284 FWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVK 1105
            F +  S + L  L +L I+    ++D+G+  +    P +  + L +C+LL+ + +     
Sbjct: 473  FTLARSPKVLPMLSTLSISGACRLSDVGLRQLVSSAPAITSINLNQCSLLTSSSIDMLSD 532

Query: 1104 AAESI-ESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSL 928
            +  S+   L + EC  I    +   L     KL+ L+  +   +K             +L
Sbjct: 533  SLGSVLRELYINECQNIDMKHILAAL-KKFEKLEVLSLADLPSVKGRFLKEFVTARGQTL 591

Query: 927  RSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSG 748
            + L + N     D+S+ V+S  CPNL  L+L+ +  +TD  L      C A      L  
Sbjct: 592  KQLILTNSRKLSDSSIKVISENCPNLSVLDLANVCKLTDSSLGYLANGCQA---LEKLIF 648

Query: 747  CIN-VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSD 574
            C N  +D+ ++A  +  G +L+ L+LN    V   +  A+A +   L+ LDIS  R +S+
Sbjct: 649  CRNPFSDEAVAAFVETAGGSLKELSLNNVKKVGHNTALALAKHSDKLQILDISWCREMSN 708

Query: 573  FGIAALAGGSAIQFSLQILSLSGCVLASD 487
              +  +   S+   SL++L + GC   +D
Sbjct: 709  DLLGYIVDNSS---SLKVLKVFGCSQVTD 734



>gb:AY085898_1570961 Arabidopsis thaliana clone 19486 mRNA, complete
            sequence.
          Length = 360

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 56/215 (26%), Positives = 95/215 (44%), Gaps = 5/215 (2%)
 Frame = -3

Query: 1254 HKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQL 1075
            H+L+ L ++    +TD  + A++ GCP++ +L L  CT  SD  +    +    ++ L L
Sbjct: 117  HELQELDLSKSLKITDRSLYALAHGCPDLTKLNLSGCTSFSDTAIAYLTRFCRKLKVLNL 176

Query: 1074 EECHRISQAGVFGILVHSAGKLKALAFENCFGMKD-----LAFGVPALPPCNSLRSLSIC 910
              C +         + ++  ++++L    C  + D     LA+G      C  LR+L +C
Sbjct: 177  CGCVKAVTDNALEAIGNNCNQMQSLNLGWCENISDDGVMSLAYG------CPDLRTLDLC 230

Query: 909  NCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTD 730
             C    D S+V L+  C +L  L L     +TD  +    QS     VK N  G      
Sbjct: 231  GCVLITDESVVALADWCVHLRSLGLYYCRNITDRAIYSLAQSG----VK-NKPGSWKSVK 285

Query: 729  KTISAIAKLHGETLELLNLNGCGCVTDASLAAIAD 625
            K      K   E L  LN++ C  +T +++ A+ D
Sbjct: 286  K-----GKYDEEGLRSLNISQCTALTSSAVQAVCD 315



 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 55/205 (26%), Positives = 87/205 (42%), Gaps = 20/205 (9%)
 Frame = -3

Query: 939 CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKV 760
           C+ L+ L +       D SL  L+  CP+L  LNLSG    +D  +    + C   L  +
Sbjct: 116 CHELQELDLSKSLKITDRSLYALAHGCPDLTKLNLSGCTSFSDTAIAYLTRFC-RKLKVL 174

Query: 759 NLSGCIN-VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKS- 586
           NL GC+  VTD  + AI   +   ++ LNL  C  ++D  + ++A  C  LR LD+    
Sbjct: 175 NLCGCVKAVTDNALEAIGN-NCNQMQSLNLGWCENISDDGVMSLAYGCPDLRTLDLCGCV 233

Query: 585 RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLG----------------- 457
            ++D  + ALA        L+ L L  C   +D+ +  L + G                 
Sbjct: 234 LITDESVVALADWCV---HLRSLGLYYCRNITDRAIYSLAQSGVKNKPGSWKSVKKGKYD 290

Query: 456 -NSLAGLNIQNCVGISHRGVDLLVE 385
              L  LNI  C  ++   V  + +
Sbjct: 291 EEGLRSLNISQCTALTSSAVQAVCD 315



 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 48/189 (25%), Positives = 85/189 (44%)
 Frame = -3

Query: 1266 GQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIE 1087
            G   ++++SL +  C+ ++D G+ +++ GCP+++ L L  C L++D  VV+       + 
Sbjct: 192  GNNCNQMQSLNLGWCENISDDGVMSLAYGCPDLRTLDLCGCVLITDESVVALADWCVHLR 251

Query: 1086 SLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICN 907
            SL L  C  I+   ++  L  S  K K  ++++    K    G         LRSL+I  
Sbjct: 252  SLGLYYCRNITDRAIYS-LAQSGVKNKPGSWKSVKKGKYDEEG---------LRSLNISQ 301

Query: 906  CTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDK 727
            CT                   L  S +  V D    P + +C +G   + +SGC+N+T  
Sbjct: 302  CTA------------------LTSSAVQAVCD--SFPALHTC-SGRHSLVMSGCLNLTTV 340

Query: 726  TISAIAKLH 700
              + I + H
Sbjct: 341  HCACILQAH 349



 Score = 55.1 bits (131), Expect = 4e-06
 Identities = 43/121 (35%), Positives = 65/121 (53%), Gaps = 3/121 (2%)
 Frame = -3

Query: 774 GLVKVNLSGCIN-VTDKTISAIAKLHGETLELLNLN-GCGCVTDASLAAIADYCSVLRDL 601
           GL ++ LS C N +    +S + K     L+ LNL      + D ++ AIA++C  L++L
Sbjct: 65  GLTRLRLSWCNNNMNSLVLSLVPKF--VKLQTLNLRQDKPQLEDNAVEAIANHCHELQEL 122

Query: 600 DISKS-RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC 424
           D+SKS +++D  + ALA G      L  L+LSGC   SD  + YL +    L  LN+  C
Sbjct: 123 DLSKSLKITDRSLYALAHGCP---DLTKLNLSGCTSFSDTAIAYLTRFCRKLKVLNLCGC 179

Query: 423 V 421
           V
Sbjct: 180 V 180



>gb:AK095387_1914352 Homo sapiens cDNA FLJ38068 fis, clone
            CTONG2015358.
          Length = 456

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 69/242 (28%), Positives = 103/242 (42%), Gaps = 30/242 (12%)
 Frame = -3

Query: 1014 KLKALAFENC-----FGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNL 850
            +L  L   NC      G+K    G    P    +  L++ NC    DAS++ LS  CPNL
Sbjct: 173  QLTVLNLANCVRIGDMGLKQFLDG----PASMRIGELNLSNCVRLSDASVMKLSERCPNL 228

Query: 849  VHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSG------------------------CI 742
             +L+L     +T  G+   V      LV ++LSG                        C 
Sbjct: 229  NYLSLRNCEHLTAQGIGYIVNIFS--LVSIDLSGTDISNEGLNVLSRHKKLKELSVSECY 286

Query: 741  NVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKS-RVSDFGI 565
             +TD  I A  K     LE L+++ C  ++D  + A+A YC  L  L I+   +++D  +
Sbjct: 287  RITDDGIQAFCK-SSLILEHLDVSYCSQLSDMIIKALAIYCINLTSLSIAGCPKITDSAM 345

Query: 564  AALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVE 385
              L   SA    L IL +SGCVL +D+ L  L      L  L +Q C  IS +    +  
Sbjct: 346  EML---SAKCHYLHILDISGCVLLTDQILEDLQIGCKQLRILKMQYCTNISKKAAQRMSS 402

Query: 384  RL 379
            ++
Sbjct: 403  KV 404



 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 60/226 (26%), Positives = 105/226 (46%), Gaps = 3/226 (1%)
 Frame = -3

Query: 1332 LTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCL 1153
            LT L L N   I + G      G    ++  L ++ C  ++D  +  +S+ CPN+  L L
Sbjct: 174  LTVLNLANCVRIGDMGLKQFLDGPASMRIGELNLSNCVRLSDASVMKLSERCPNLNYLSL 233

Query: 1152 RKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMK 973
            R C  L+  G + ++    S+ S+ L     IS  G+  +  H   KLK L+   C+ + 
Sbjct: 234  RNCEHLTAQG-IGYIVNIFSLVSIDLSGTD-ISNEGLNVLSRHK--KLKELSVSECYRIT 289

Query: 972  DLAFGVPALPPCNS---LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGL 802
            D   G+ A   C S   L  L +  C+   D  +  L+  C NL  L+++G   +TD  +
Sbjct: 290  D--DGIQAF--CKSSLILEHLDVSYCSQLSDMIIKALAIYCINLTSLSIAGCPKITDSAM 345

Query: 801  LPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGC 664
                  C   L  +++SGC+ +TD+ +  + ++  + L +L +  C
Sbjct: 346  EMLSAKCHY-LHILDISGCVLLTDQILEDL-QIGCKQLRILKMQYC 389



 Score = 34.7 bits (78), Expect = 5.1
 Identities = 19/66 (28%), Positives = 32/66 (48%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            L SL I  C  +TD  +E +S  C  +  L +  C LL+D  +       + +  L+++ 
Sbjct: 329  LTSLSIAGCPKITDSAMEMLSAKCHYLHILDISGCVLLTDQILEDLQIGCKQLRILKMQY 388

Query: 1068 CHRISQ 1051
            C  IS+
Sbjct: 389  CTNISK 394



 Score = 34.7 bits (78), Expect = 5.1
 Identities = 21/82 (25%), Positives = 41/82 (50%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGI 1198
            +SD+ +  +  Y + LT L++     I +    ++ +    H L  L I+ C  +TD  +
Sbjct: 314  LSDMIIKALAIYCINLTSLSIAGCPKITDSAMEMLSAK--CHYLHILDISGCVLLTDQIL 371

Query: 1197 EAVSKGCPNVKQLCLRKCTLLS 1132
            E +  GC  ++ L ++ CT +S
Sbjct: 372  EDLQIGCKQLRILKMQYCTNIS 393



>gb:AF176701_1888028 Homo sapiens F-box protein FBL9 mRNA, partial
            cds.
          Length = 313

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 66/234 (28%), Positives = 114/234 (48%), Gaps = 15/234 (6%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            L SL ++ C  +TD  + AVS+G  ++++L L K   L+D G  + +   + ++SL+   
Sbjct: 49   LTSLDLSGCSELTDGALLAVSRGLRHLRRLSLGKLQRLTDAGCTA-LGGLQELQSLRHGR 107

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGMKD------LAFGV---------PALPPCN 934
               ++QA   G +  +  +L +L+  +C  +K        A G          P+L    
Sbjct: 108  GRELAQA--LGCMHGAPSQLASLSLAHCSSLKSRPELEHQASGTKDACPEPQGPSLLTLR 165

Query: 933  SLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNL 754
            +L+ L +  C+   DASL  + +    L  L+LS L  +TD GL+   + C + L  + L
Sbjct: 166  ALQELDLTACSKLTDASLAKVLQFL-QLRQLSLSLLPELTDNGLVAVARGCPS-LEHLAL 223

Query: 753  SGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS 592
            S C  ++DK  +  A      L+ LNL+ C  + + +L AI   C  LR LD++
Sbjct: 224  SHCSRLSDKGWAQAAS-SWPRLQHLNLSSCSQLIEQTLDAIGQACRQLRVLDVA 276



 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 36/126 (28%), Positives = 58/126 (46%)
 Frame = -3

Query: 1257 LHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQ 1078
            L  L+ L +TAC  +TD  +  V +    ++QL L     L+DNG+V+  +   S+E L 
Sbjct: 164  LRALQELDLTACSKLTDASLAKVLQFL-QLRQLSLSLLPELTDNGLVAVARGCPSLEHLA 222

Query: 1077 LEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTG 898
            L  C R+S  G +     S  +L+ L   +C  + +          C  LR L +  C G
Sbjct: 223  LSHCSRLSDKG-WAQAASSWPRLQHLNLSSCSQLIEQTLDAIG-QACRQLRVLDVATCPG 280

Query: 897  FGDASL 880
               A++
Sbjct: 281  INMAAV 286



 Score = 37.4 bits (85), Expect = 0.78
 Identities = 30/96 (31%), Positives = 48/96 (50%), Gaps = 1/96 (1%)
 Frame = -3

Query: 690 LELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILS 514
           L  L+L+GC  +TD +L A++     LR L + K  R++D G  AL G   +Q    +  
Sbjct: 49  LTSLDLSGCSELTDGALLAVSRGLRHLRRLSLGKLQRLTDAGCTALGGLQELQ---SLRH 105

Query: 513 LSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHR 406
             G  LA  + L  +H   + LA L++ +C  +  R
Sbjct: 106 GRGRELA--QALGCMHGAPSQLASLSLAHCSSLKSR 139



>gb:BX908798_831388 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 456

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 66/219 (30%), Positives = 103/219 (47%), Gaps = 1/219 (0%)
 Frame = -3

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TD  + A+ K C N+K L L++C   +D G+        +++ L L  C R++  G   
Sbjct: 236  LTDAHLLAL-KNCKNLKVLDLQECWNFTDAGLAHLTPLT-ALQHLDLTGCFRVTDTG--- 290

Query: 1035 ILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCP 856
             L H +  L AL   N  G      G+  L P  +L+ L +  C    DA L  L  L  
Sbjct: 291  -LAHLS-PLVALQHLNLIGCDLTDAGLVHLKPLIALKHLDLMRCWNLTDAGLAHLRPLVA 348

Query: 855  NLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLN 676
             L HLNL+    +TD GL          L  ++L  C  +T   ++ +  L    L+ LN
Sbjct: 349  -LQHLNLTNCENITDVGLAHLTPL--VALKHLDLMQCWKLTGNGLARLRSL--VALQHLN 403

Query: 675  LNGCGCVTDASLAAIADYCSVLRDLDISKS-RVSDFGIA 562
            L+GC  +TDA LA +    + L+ LD++    ++D G+A
Sbjct: 404  LSGCSYLTDAGLAHLRPLVA-LQHLDLANCYELTDAGLA 441



 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 59/182 (32%), Positives = 88/182 (48%), Gaps = 6/182 (3%)
 Frame = -3

Query: 1257 LHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQ 1078
            L  L+ L +T C  VTD G+  +S     ++ L L  C  L+D G+V  +K   +++ L 
Sbjct: 272  LTALQHLDLTGCFRVTDTGLAHLSP-LVALQHLNLIGCD-LTDAGLV-HLKPLIALKHLD 328

Query: 1077 LEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNC-- 904
            L  C  ++ AG+  +    A  L+ L   NC  + D+  G+  L P  +L+ L +  C  
Sbjct: 329  LMRCWNLTDAGLAHLRPLVA--LQHLNLTNCENITDV--GLAHLTPLVALKHLDLMQCWK 384

Query: 903  -TGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLL---PFVQSCDAGLVKVNLSGCINV 736
             TG G A L    R    L HLNLSG + +TD GL    P V      L  ++L+ C  +
Sbjct: 385  LTGNGLARL----RSLVALQHLNLSGCSYLTDAGLAHLRPLV-----ALQHLDLANCYEL 435

Query: 735  TD 730
            TD
Sbjct: 436  TD 437



 Score = 42.7 bits (99), Expect = 0.019
 Identities = 40/147 (27%), Positives = 75/147 (51%), Gaps = 4/147 (2%)
 Frame = -3

Query: 1398 VKLQSLNI--SDISLAVIGHYG--VALTDLALINLQNINERGFWVMGSGQGLHKLRSLVI 1231
            V LQ LN+   D++ A + H    +AL  L L+   N+ + G   +   + L  L+ L +
Sbjct: 298  VALQHLNLIGCDLTDAGLVHLKPLIALKHLDLMRCWNLTDAG---LAHLRPLVALQHLNL 354

Query: 1230 TACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQ 1051
            T C+ +TD+G+  ++     +K L L +C  L+ NG+   +++  +++ L L  C  ++ 
Sbjct: 355  TNCENITDVGLAHLTP-LVALKHLDLMQCWKLTGNGLAR-LRSLVALQHLNLSGCSYLTD 412

Query: 1050 AGVFGILVHSAGKLKALAFENCFGMKD 970
            AG+  +    A  L+ L   NC+ + D
Sbjct: 413  AGLAHLRPLVA--LQHLDLANCYELTD 437



>pir|B86347|B86347 hypothetical protein F24J8.5 [imported] -
            Arabidopsis thaliana>gb:AE005172_891093 Arabidopsis
            thaliana chromosome 1, top arm complete
            sequence.>gb:AC015447_1537996 Arabidopsis thaliana
            chromosome I BAC F24J8 genomic sequence, complete
            sequence.>gb:AY058081_1564220 Arabidopsis thaliana
            At1g21410/F24J8_17 mRNA, complete
            cds.>gb:AY090308_1574060 Arabidopsis thaliana
            At1g21410/F24J8_17 mRNA, complete cds.
          Length = 360

 Score = 71.6 bits (174), Expect = 4e-11
 Identities = 56/215 (26%), Positives = 95/215 (44%), Gaps = 5/215 (2%)
 Frame = -3

Query: 1254 HKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQL 1075
            H+L+ L ++    +TD  + A++ GCP++ +L L  CT  SD  +    +    ++ L L
Sbjct: 117  HELQELDLSKSLKITDRSLYALAHGCPDLTKLNLSGCTSFSDTAIAYLTRFCRKLKVLNL 176

Query: 1074 EECHRISQAGVFGILVHSAGKLKALAFENCFGMKD-----LAFGVPALPPCNSLRSLSIC 910
              C +         + ++  ++++L    C  + D     LA+G      C  LR+L +C
Sbjct: 177  CGCVKAVTDNALEAIGNNCNQMQSLNLGWCENISDDGVMSLAYG------CPDLRTLDLC 230

Query: 909  NCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTD 730
             C    D S+V L+  C +L  L L     +TD  +    QS     VK N  G      
Sbjct: 231  GCVLITDESVVALADWCVHLRSLGLYYCRNITDRAMYSLAQSG----VK-NKPGSWKSVK 285

Query: 729  KTISAIAKLHGETLELLNLNGCGCVTDASLAAIAD 625
            K      K   E L  LN++ C  +T +++ A+ D
Sbjct: 286  K-----GKYDEEGLRSLNISQCTALTPSAVQAVCD 315



 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 55/205 (26%), Positives = 87/205 (42%), Gaps = 20/205 (9%)
 Frame = -3

Query: 939 CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKV 760
           C+ L+ L +       D SL  L+  CP+L  LNLSG    +D  +    + C   L  +
Sbjct: 116 CHELQELDLSKSLKITDRSLYALAHGCPDLTKLNLSGCTSFSDTAIAYLTRFC-RKLKVL 174

Query: 759 NLSGCIN-VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKS- 586
           NL GC+  VTD  + AI   +   ++ LNL  C  ++D  + ++A  C  LR LD+    
Sbjct: 175 NLCGCVKAVTDNALEAIGN-NCNQMQSLNLGWCENISDDGVMSLAYGCPDLRTLDLCGCV 233

Query: 585 RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLG----------------- 457
            ++D  + ALA        L+ L L  C   +D+ +  L + G                 
Sbjct: 234 LITDESVVALADWCV---HLRSLGLYYCRNITDRAMYSLAQSGVKNKPGSWKSVKKGKYD 290

Query: 456 -NSLAGLNIQNCVGISHRGVDLLVE 385
              L  LNI  C  ++   V  + +
Sbjct: 291 EEGLRSLNISQCTALTPSAVQAVCD 315



 Score = 55.5 bits (132), Expect = 3e-06
 Identities = 48/189 (25%), Positives = 85/189 (44%)
 Frame = -3

Query: 1266 GQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIE 1087
            G   ++++SL +  C+ ++D G+ +++ GCP+++ L L  C L++D  VV+       + 
Sbjct: 192  GNNCNQMQSLNLGWCENISDDGVMSLAYGCPDLRTLDLCGCVLITDESVVALADWCVHLR 251

Query: 1086 SLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICN 907
            SL L  C  I+   ++  L  S  K K  ++++    K    G         LRSL+I  
Sbjct: 252  SLGLYYCRNITDRAMYS-LAQSGVKNKPGSWKSVKKGKYDEEG---------LRSLNISQ 301

Query: 906  CTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDK 727
            CT                   L  S +  V D    P + +C +G   + +SGC+N+T  
Sbjct: 302  CTA------------------LTPSAVQAVCD--SFPALHTC-SGRHSLVMSGCLNLTTV 340

Query: 726  TISAIAKLH 700
              + I + H
Sbjct: 341  HCACILQAH 349



 Score = 55.1 bits (131), Expect = 4e-06
 Identities = 43/121 (35%), Positives = 65/121 (53%), Gaps = 3/121 (2%)
 Frame = -3

Query: 774 GLVKVNLSGCIN-VTDKTISAIAKLHGETLELLNLN-GCGCVTDASLAAIADYCSVLRDL 601
           GL ++ LS C N +    +S + K     L+ LNL      + D ++ AIA++C  L++L
Sbjct: 65  GLTRLRLSWCNNNMNSLVLSLVPKF--VKLQTLNLRQDKPQLEDNAVEAIANHCHELQEL 122

Query: 600 DISKS-RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC 424
           D+SKS +++D  + ALA G      L  L+LSGC   SD  + YL +    L  LN+  C
Sbjct: 123 DLSKSLKITDRSLYALAHGCP---DLTKLNLSGCTSFSDTAIAYLTRFCRKLKVLNLCGC 179

Query: 423 V 421
           V
Sbjct: 180 V 180



>gb:CR382132_1665004 Yarrowia lipolytica chromosome F of strain CLIB99
            of Yarrowia lipolytica.
          Length = 964

 Score = 71.2 bits (173), Expect = 5e-11
 Identities = 71/300 (23%), Positives = 134/300 (44%), Gaps = 26/300 (8%)
 Frame = -3

Query: 1404 MKVKLQSLNISDISLAVIGHYGVALTDLALIN-LQNINERGFWVMGSGQGLHKLRSLVIT 1228
            + +K  + +I D S+  I ++  A   L  I+   ++ + GF  + +G GL K+R   +T
Sbjct: 650  LDLKPYNRSIDDTSIVSIVNFVGARPKLVDISSCFHLTDDGFSYLVNGIGLAKIRVFKMT 709

Query: 1227 ACQGVTDLGIE--AVSKGCPNVKQLCLRKCTLLSDNGVV--------------------- 1117
            +   V+ + I    V     +++++ L  C  + D+ +                      
Sbjct: 710  SVWEVSGMAIMDLTVPSIGADLEEVDLSNCRKVGDSTLARLVGWVQEEGGENSGDRETSP 769

Query: 1116 -SFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPP 940
             S V     ++ + +  C  I+   +  + V++A +L+ L    C  + D  FG   + P
Sbjct: 770  SSSVVGCPKLKRITISYCKHITDRSMHHMAVYAADRLEMLNLTRCTTITDHGFGYWNIRP 829

Query: 939  CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKV 760
               LR L + +CT   D +++ +     NL  L+LS    ++D  +      C + L  +
Sbjct: 830  FTRLRELVLADCTFLSDKAIISIVGAAKNLEFLDLSFCCALSDVSVEVLSLGCPS-LKSL 888

Query: 759  NLSGCIN-VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR 583
            NLS C + V+D  + A+A +H   LE L++ GC  VT   +  I   C  L+ LDI++ +
Sbjct: 889  NLSFCGSAVSDANLRAVA-MHLLDLEHLSVRGCVRVTAVGVDTILAGCLKLKTLDITQCK 947



>pir|D96512|D96512 hypothetical protein F2G19.16 [imported] -
            Arabidopsis thaliana>gb:AE005173_892682 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC083835_1733196 Arabidopsis thaliana
            chromosome 1 BAC F2G19 genomic sequence, complete
            sequence.
          Length = 518

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 89/331 (26%), Positives = 138/331 (41%), Gaps = 35/331 (10%)
 Frame = -3

Query: 1434 SLFSSAGNHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGL 1255
            S F S     +K   +S++I D +L  I      L  L L   + + +     +G     
Sbjct: 98   SRFDSVTKLSLKCDRRSVSIGDEALVKISLRCRNLKRLKLRACRELTD-----VGMAAFA 152

Query: 1254 HKLRSLVITACQGVTDLG---IEAVSKGCPNVKQLCLRKCTLLSDNG--VVSFVKAAESI 1090
               + L I +C G  D G   ++AV   C N+++L +++    +D    ++    AA S+
Sbjct: 153  ENCKDLKIFSC-GSCDFGAKGVKAVLDHCSNLEELSIKRLRGFTDIAPEMIGPGVAASSL 211

Query: 1089 ESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAF----------------- 961
            +S+ L+E +       FG ++  A  LK+L    C G  DL                   
Sbjct: 212  KSICLKELYN---GQCFGPVIVGAKNLKSLKLFRCSGDWDLLLQEMSGKDHGVVEIHLER 268

Query: 960  ------GVPALPPCNSLRSLSICN---CTGFGDASLVVLSRLCPNLVHLNLSG--LNGVT 814
                   + A+  C+SL SL +     CT FG   L  ++  C  L  L++ G   N + 
Sbjct: 269  MQVSDVALSAISYCSSLESLHLVKTPECTNFG---LAAIAEKCKRLRKLHIDGWKANLIG 325

Query: 813  DYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT--DASL 640
            D GL+   + C   L ++ L G     + T  ++  L  + L L  L  CGC T  D  L
Sbjct: 326  DEGLVAVAKFCSQ-LQELVLIG----VNPTTLSLGMLAAKCLNLERLALCGCDTFGDPEL 380

Query: 639  AAIADYCSVLRDLDISKSRVSDFGIAALAGG 547
            + IA  C  LR L I    +SD GI  LA G
Sbjct: 381  SCIAAKCPALRKLCIKNCPISDVGIENLANG 411



 Score = 34.3 bits (77), Expect = 6.6
 Identities = 23/90 (25%), Positives = 45/90 (50%)
 Frame = -3

Query: 1413 NHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLV 1234
            + L ++ L  +N + +SL ++    + L  LAL       +     + +      LR L 
Sbjct: 337  SQLQELVLIGVNPTTLSLGMLAAKCLNLERLALCGCDTFGDPELSCIAAK--CPALRKLC 394

Query: 1233 ITACQGVTDLGIEAVSKGCPNVKQLCLRKC 1144
            I  C  ++D+GIE ++ GCP + ++ ++KC
Sbjct: 395  IKNCP-ISDVGIENLANGCPGLTKVKIKKC 423



>gb:AF467463_2066642 Mus musculus PPA (Ppa) mRNA, partial cds.
          Length = 184

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 55/179 (30%), Positives = 88/179 (49%)
 Frame = -3

Query: 921 LSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCI 742
           L++ +C    D SL  +SR    L  LNLS   G++D GLL    S    L  +NL  C 
Sbjct: 1   LTLQDCQKLTDLSLKHISRGLTGLRLLNLSFCGGISDAGLLHL--SHMGSLRSLNLRSCD 58

Query: 741 NVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIA 562
           N++D  I  +A +    L  L+++ C  V D SLA IA     L+ L +    +SD GI 
Sbjct: 59  NISDTGIMHLA-MGSLRLSGLDVSFCDKVGDQSLAYIAQGLDGLKSLSLCSCHISDDGIN 117

Query: 561 ALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVE 385
            +         L+ L++  CV  +DK L  + +  + L G+++  C  I+ RG++ + +
Sbjct: 118 RMVRQ---MHGLRTLNIGQCVRITDKGLELIAEHLSQLTGIDLYGCTRITKRGLERITQ 173



 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 56/191 (29%), Positives = 93/191 (48%), Gaps = 2/191 (1%)
 Frame = -3

Query: 1239 LVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHR 1060
            L +  CQ +TDL ++ +S+G   ++ L L  C  +SD G++  +    S+ SL L  C  
Sbjct: 1    LTLQDCQKLTDLSLKHISRGLTGLRLLNLSFCGGISDAGLL-HLSHMGSLRSLNLRSCDN 59

Query: 1059 ISQAGVFGILVHSAGKLKALAFENC--FGMKDLAFGVPALPPCNSLRSLSICNCTGFGDA 886
            IS  G+  + + S  +L  L    C   G + LA+    L   + L+SLS+C+C    D 
Sbjct: 60   ISDTGIMHLAMGSL-RLSGLDVSFCDKVGDQSLAYIAQGL---DGLKSLSLCSC-HISDD 114

Query: 885  SLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAK 706
             +  + R    L  LN+     +TD G L  +    + L  ++L GC  +T + +  I +
Sbjct: 115  GINRMVRQMHGLRTLNIGQCVRITDKG-LELIAEHLSQLTGIDLYGCTRITKRGLERITQ 173

Query: 705  LHGETLELLNL 673
            L    L++LNL
Sbjct: 174  L--PCLKVLNL 182



>gb:AE017348_1758146 Cryptococcus neoformans var. neoformans JEC21
            chromosome 8, complete sequence.
          Length = 928

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 69/305 (22%), Positives = 129/305 (42%), Gaps = 16/305 (5%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            L SL +T      D  +  V + C  ++ + L +C L+ D GV++  K + ++  ++ E+
Sbjct: 263  LVSLDLTGVINTDDAVLVIVGETCQKLQAINLSECRLVGDEGVLALAKESRALRRIKFEK 322

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGD 889
            CHRI+Q  +   L+ +   +    F++   +         L   + LR + +  C    +
Sbjct: 323  CHRITQKSLIP-LIRACPLVLEYDFQDVISLSSSVLHTVFL-HASHLREIRVNGCVSLNE 380

Query: 888  ASLVVLSRLCPNLVHLNLSGLNGVT----DYGL-----------LPFVQSCDAGLVKVNL 754
              +       PNL+ L+    +GV     D G+            P   + +  L  V++
Sbjct: 381  NCI-------PNLLDLSEMQDDGVAKVSEDVGIKIEPAEGVTMWRPVTTTFEY-LRVVDM 432

Query: 753  SGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVS 577
            +GC ++ DK +  +   +   L  L LN C  +TD SL +I      L +L +   S ++
Sbjct: 433  TGCTDLGDKAVDNLI-TNAPKLRQLTLNKCPALTDKSLESIGKLGKHLHNLHLGHVSLIT 491

Query: 576  DFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVD 397
            D G+  LA        L+ L L+ C L +D C+  + +    L    +     I+   + 
Sbjct: 492  DDGVINLARSCT---RLRYLDLACCTLLTDACVAEIGENMPKLKRFGLVKVTNITDEAIY 548

Query: 396  LLVER 382
             LV +
Sbjct: 549  SLVRK 553



 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 41/157 (26%), Positives = 69/157 (43%)
 Frame = -3

Query: 939 CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKV 760
           C+ L  L+I         +L  +    PNLV L+L+G+    D  L+   ++C   L  +
Sbjct: 234 CSRLERLNISGADKLTSGALRNVIACMPNLVSLDLTGVINTDDAVLVIVGETCQK-LQAI 292

Query: 759 NLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRV 580
           NLS C  V D+ + A+AK     L  +    C  +T  SL  +   C ++ + D     V
Sbjct: 293 NLSECRLVGDEGVLALAK-ESRALRRIKFEKCHRITQKSLIPLIRACPLVLEYDFQD--V 349

Query: 579 SDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYL 469
                + L         L+ + ++GCV  ++ C+P L
Sbjct: 350 ISLSSSVLHTVFLHASHLREIRVNGCVSLNENCIPNL 386



 Score = 45.4 bits (106), Expect = 0.003
 Identities = 34/143 (23%), Positives = 65/143 (45%)
 Frame = -3

Query: 1251 KLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLE 1072
            KLR L +  C  +TD  +E++ K   ++  L L   +L++D+GV++  ++   +  L L 
Sbjct: 452  KLRQLTLNKCPALTDKSLESIGKLGKHLHNLHLGHVSLITDDGVINLARSCTRLRYLDLA 511

Query: 1071 ECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG 892
             C  ++ A V  I   +  KLK         + D A     +    SL  + +  C    
Sbjct: 512  CCTLLTDACVAEI-GENMPKLKRFGLVKVTNITDEAI-YSLVRKHTSLERVHLSYCDQLS 569

Query: 891  DASLVVLSRLCPNLVHLNLSGLN 823
              ++  L     ++ HL+L+G++
Sbjct: 570  VKAIAYLLNKLAHIKHLSLTGVS 592



>gb:BX908798_831119 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 380

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 88/330 (26%), Positives = 153/330 (46%), Gaps = 9/330 (2%)
 Frame = -3

Query: 1431 LFSSAGNHLMKVKLQSLNISD-ISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGL 1255
            +F+S+ + L+K+K + LN +    L  + +Y      L L  + ++ ++ F++    + L
Sbjct: 102  IFNSSEDSLVKLK-ELLNFTQQYQLNALKNY------LELTVVSSLLKQAFYLTKFEKIL 154

Query: 1254 H----KLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIE 1087
            +    ++  L  +    +TD  + A+ K C N+K+L L+ C +L+D G ++ + +  +++
Sbjct: 155  NHFSNEIEGLNFSEKYSLTDTHLLAL-KNCKNLKELHLQDCYMLTDAG-LAHLASLVALQ 212

Query: 1086 SLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICN 907
             L L  C +++ AG    L H                         L P   L+ LS+  
Sbjct: 213  HLNLAGCRKLTDAG----LAH-------------------------LTPLVVLQYLSLAG 243

Query: 906  CTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLL---PFVQSCDAGLVKVNLSGCINV 736
            C    DA L  L+ L   L HL+L+G   +T  GL    P V      L  +NLS C  +
Sbjct: 244  CDNLTDAGLAHLTPLVA-LQHLDLNGCPNLTGVGLAHLKPLV-----ALQHLNLSWCDKL 297

Query: 735  TDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAA 559
            TD  ++ +  L    L  LNL GC  +TDA L  +    + L+ LD++  S ++D G+A 
Sbjct: 298  TDAGLAHLKPL--VALHYLNLAGCDKLTDAGLVHLMPLVT-LQHLDLTACSNLTDVGLAH 354

Query: 558  LAGGSAIQFSLQILSLSGCVLASDKCLPYL 469
            L        +LQ L+L  C   +D  L ++
Sbjct: 355  LKP----LVALQHLNLGWCPNLTDAGLAHI 380



 Score = 38.5 bits (88), Expect = 0.35
 Identities = 38/124 (30%), Positives = 66/124 (53%), Gaps = 6/124 (4%)
 Frame = -3

Query: 762 VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR 583
           +N S   ++TD  + A+     + L+ L+L  C  +TDA LA +A   + L+ L+++  R
Sbjct: 164 LNFSEKYSLTDTHLLALKNC--KNLKELHLQDCYMLTDAGLAHLASLVA-LQHLNLAGCR 220

Query: 582 -VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC-----V 421
            ++D G+A L     +Q+    LSL+GC   +D  L +L  L  +L  L++  C     V
Sbjct: 221 KLTDAGLAHLTPLVVLQY----LSLAGCDNLTDAGLAHLTPL-VALQHLDLNGCPNLTGV 275

Query: 420 GISH 409
           G++H
Sbjct: 276 GLAH 279



>pir|A96799|A96799 hypothetical protein F22K20.10 [imported] -
            Arabidopsis thaliana>gb:AE005173_895230 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC002291_1530119 Arabidopsis thaliana
            chromosome I BAC F22K20 genomic sequence, complete
            sequence.>gb:AY087441_1572472 Arabidopsis thaliana clone
            3549 mRNA, complete sequence.
          Length = 360

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 49/203 (24%), Positives = 86/203 (42%), Gaps = 22/203 (10%)
 Frame = -3

Query: 1254 HKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQL 1075
            H+L+ L ++    +TD  + ++++GC N+ +L L  CT  SD  +    +    ++ L L
Sbjct: 117  HELQDLDLSKSSKITDHSLYSLARGCTNLTKLNLSGCTSFSDTALAHLTRFCRKLKILNL 176

Query: 1074 EECHRISQAGVFGILVHSAGKLKALAFENCFGMKD-----LAFGVPALPPCNSLRSLSIC 910
              C           +  +  +L++L    C  + D     LA+G      C  LR+L +C
Sbjct: 177  CGCVEAVSDNTLQAIGENCNQLQSLNLGWCENISDDGVMSLAYG------CPDLRTLDLC 230

Query: 909  NCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS-----------------C 781
            +C    D S+V L+  C +L  L L     +TD  +    QS                  
Sbjct: 231  SCVLITDESVVALANRCIHLRSLGLYYCRNITDRAMYSLAQSGVKNKHEMWRAVKKGKFD 290

Query: 780  DAGLVKVNLSGCINVTDKTISAI 712
            + GL  +N+S C  +T   + A+
Sbjct: 291  EEGLRSLNISQCTYLTPSAVQAV 313



 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 53/163 (32%), Positives = 81/163 (49%), Gaps = 2/163 (1%)
 Frame = -3

Query: 939 CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKV 760
           C+ L+ L +   +   D SL  L+R C NL  LNLSG    +D  L    + C   L  +
Sbjct: 116 CHELQDLDLSKSSKITDHSLYSLARGCTNLTKLNLSGCTSFSDTALAHLTRFC-RKLKIL 174

Query: 759 NLSGCIN-VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI-SKS 586
           NL GC+  V+D T+ AI + +   L+ LNL  C  ++D  + ++A  C  LR LD+ S  
Sbjct: 175 NLCGCVEAVSDNTLQAIGE-NCNQLQSLNLGWCENISDDGVMSLAYGCPDLRTLDLCSCV 233

Query: 585 RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLG 457
            ++D  + ALA        L+ L L  C   +D+ +  L + G
Sbjct: 234 LITDESVVALANRC---IHLRSLGLYYCRNITDRAMYSLAQSG 273



 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 61/247 (24%), Positives = 102/247 (41%), Gaps = 2/247 (0%)
 Frame = -3

Query: 1434 SLFSSAGNHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINER--GFWVMGSGQ 1261
            SL+S A       KL     +  S   + H       L ++NL    E      +   G+
Sbjct: 134  SLYSLARGCTNLTKLNLSGCTSFSDTALAHLTRFCRKLKILNLCGCVEAVSDNTLQAIGE 193

Query: 1260 GLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESL 1081
              ++L+SL +  C+ ++D G+ +++ GCP+++ L L  C L++D  VV+       + SL
Sbjct: 194  NCNQLQSLNLGWCENISDDGVMSLAYGCPDLRTLDLCSCVLITDESVVALANRCIHLRSL 253

Query: 1080 QLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCT 901
             L  C  I+   ++  L  S  K K    E    +K   F          LRSL+I  CT
Sbjct: 254  GLYYCRNITDRAMYS-LAQSGVKNK---HEMWRAVKKGKFDE------EGLRSLNISQCT 303

Query: 900  GFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTI 721
                              +L  S +  V D    P + +C +G   + +SGC+N+     
Sbjct: 304  ------------------YLTPSAVQAVCD--TFPALHTC-SGRHSLVMSGCLNLQSVHC 342

Query: 720  SAIAKLH 700
            + I + H
Sbjct: 343  ACILQAH 349



 Score = 55.1 bits (131), Expect = 4e-06
 Identities = 38/119 (31%), Positives = 64/119 (53%), Gaps = 1/119 (0%)
 Frame = -3

Query: 774 GLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI 595
           GL +++LS C    +  + ++A    +   L+       + D ++ AIA++C  L+DLD+
Sbjct: 65  GLTRLSLSWCKKNMNSLVLSLAPKFVKLQTLVLRQDKPQLEDNAVEAIANHCHELQDLDL 124

Query: 594 SK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCV 421
           SK S+++D  + +LA G     +L  L+LSGC   SD  L +L +    L  LN+  CV
Sbjct: 125 SKSSKITDHSLYSLARGCT---NLTKLNLSGCTSFSDTALAHLTRFCRKLKILNLCGCV 180



>gb:OSJN00271_1697717 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0002J11, complete
            sequence.>gb:OSJN00283_1697935 Oryza sativa genomic DNA,
            chromosome 4, BAC clone: OSJNBb0116K07, complete
            sequence.
          Length = 522

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 80/320 (25%), Positives = 136/320 (42%), Gaps = 32/320 (10%)
 Frame = -3

Query: 1332 LTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCL 1153
            L  L L  L+ +++ G   +     +  +R L + +C         AV + CP ++ L +
Sbjct: 133  LARLKLRGLRQLSDDGLASLAGATPV--IRKLSVASCS-FGPKAFVAVLRSCPLLEDLSV 189

Query: 1152 RKCTLLSDNGVVS-------FVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAF 994
            ++   L D    +           A S+ S+ L++ +    A  F  LV S+  L++L  
Sbjct: 190  KRLRGLPDTAGATTAITEEILFPPASSLRSVCLKDLY---SALCFVPLVASSPNLRSLKI 246

Query: 993  ENCFGMKDLAF-----------------------GVPALPPCNSLRSLSICNCTGFGDAS 883
              C G  DL                         G+ A+  C +L  L +       DA 
Sbjct: 247  LRCSGSWDLPLEVIAARVPGLVELHLEKLQVGDRGLSAVSACANLEVLFLVKTPECTDAG 306

Query: 882  LVVLSRLCPNLVHLNLSG--LNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIA 709
            ++ ++  C  L  L++ G   N + D+GL+   + C   L ++ L G +N T +++  + 
Sbjct: 307  IISVAEKCHKLRKLHIDGWRTNRIGDHGLMAVARGCP-DLQELVLIG-VNPTVQSLRMLG 364

Query: 708  KLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFS 529
            + H  +LE L L GC  V D  +  +A+ C+ L+ L I    VSD G+ AL GG     S
Sbjct: 365  E-HCRSLERLALCGCETVGDPEIICLAERCAALKKLCIKGCPVSDRGMWALNGGCP---S 420

Query: 528  LQILSLSGCVLASDKCLPYL 469
            L  + L  C   S +C+  L
Sbjct: 421  LVKVKLKRCRGVSYECIENL 440



>gb:LES303342_1684552 Lycopersicon esculentum mRNA for hypothetical
            protein (ORF1), clone 21.>gb:LES303345_1684556
            Lycopersicon esculentum lateral suppressor gene, ORF1 and
            ORF2.
          Length = 607

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 73/274 (26%), Positives = 117/274 (42%), Gaps = 6/274 (2%)
 Frame = -3

Query: 1305 QNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDN 1126
            + +N  G +++  G G  +L S+ +     VTD G   +   C  +K+L +    LLSD 
Sbjct: 303  RRVNNMGMFLLSEGCG--RLESVKLGGFANVTDAGFSTILNSCRKLKKLEVLNSCLLSDL 360

Query: 1125 GVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPAL 946
               +    A S+  L+L  C  ++   + G+ + S                         
Sbjct: 361  AFHNMRGVARSLIELRLLSCRLLTSEALEGLSLLS------------------------- 395

Query: 945  PPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLV 766
                 L  L    C   G+  L V+SR+   L  LNL+  + +TD G L  +   + G+ 
Sbjct: 396  ----KLEVLDTSGCRSIGNPCLFVISRV-TTLTKLNLAEAD-ITDKG-LALLGMGNLGIT 448

Query: 765  KVNLSGCINVTDKTIS----AIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLD 598
            ++ + GC  VTDK I     A  K+ G+TL LL+++    +TDA++  IA     L DL 
Sbjct: 449  QLCIRGCKRVTDKGIERLFCAEGKI-GKTLSLLDVSRMPGITDAAIFTIASAAKALTDLS 507

Query: 597  ISKS-RVSDFGIAALAGGSAIQFS-LQILSLSGC 502
            +     V+D G+  L      + S LQ L L  C
Sbjct: 508  LRYCFHVTDAGVKMLLDRPNHKVSLLQKLDLYKC 541



 Score = 37.4 bits (85), Expect = 0.78
 Identities = 75/332 (22%), Positives = 135/332 (40%), Gaps = 46/332 (13%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            +  L +  C  V+   + A+ + CPN++ L +      S++  +   K AE ++ L L E
Sbjct: 117  IEELSLLKCSRVSYHILSAIRERCPNLRSLLIEFAG--SEDPQLFENKLAEMLQKLTLLE 174

Query: 1068 CHRISQAGVF-------GILVHSAGKLKALAFENCFGMKDLAF--GVPALPPCNSLRSLS 916
               I   G +        + +     L+ L  +   G K + +   +  +P  N L+SLS
Sbjct: 175  VLSIKIRGTYFDVFDIRPLELFLPKSLRKLKLQQTEGDKFVHWLEKIRDIPWFN-LQSLS 233

Query: 915  ICNCTGFGDASLVVLSRLCPNLVHLNLSG-------LNGVTDYGLLPFVQSCDAGLVKVN 757
            +       D+ L  +    P LV L+L         +  +T+ GL   VQSC   +    
Sbjct: 234  LV-LDVISDSLLRTVVNSLPLLVELDLEDRPFMDPTIEDLTNVGLQR-VQSCKHLITLAI 291

Query: 756  LSGCIN-------VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLD 598
            +   +N       V +  +  +++  G  LE + L G   VTDA  + I + C  L+ L+
Sbjct: 292  VRSSMNYRTAFRRVNNMGMFLLSEGCGR-LESVKLGGFANVTDAGFSTILNSCRKLKKLE 350

Query: 597  ISKS-RVSDFGIAALAG----------------------GSAIQFSLQILSLSGCVLASD 487
            +  S  +SD     + G                      G ++   L++L  SGC    +
Sbjct: 351  VLNSCLLSDLAFHNMRGVARSLIELRLLSCRLLTSEALEGLSLLSKLEVLDTSGCRSIGN 410

Query: 486  KCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
             CL  + ++  +L  LN+     I+ +G+ LL
Sbjct: 411  PCLFVISRV-TTLTKLNLAE-ADITDKGLALL 440



>gb:AE006464_1875628 Homo sapiens 16p13.3 sequence section 3 of 8.
          Length = 581

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 75/311 (24%), Positives = 133/311 (42%), Gaps = 2/311 (0%)
 Frame = -3

Query: 1314 INLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLL 1135
            +NLQ    RGF      +G   +    +  C+ + +  +    KG   VK + L++ T+ 
Sbjct: 190  VNLQGFAARGF------EGFCLVGVSDLDICEFIDNYALS--KKG---VKAMSLKRSTI- 237

Query: 1134 SDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGV 955
            +D G+   ++  + +  L+L  C+  ++AG++  L                         
Sbjct: 238  TDAGLEVMLEQMQGVVRLELSGCNDFTEAGLWSSL------------------------- 272

Query: 954  PALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDA 775
                    + SLS+ +C    D ++  +S+L PNL  L+L   + VTD  L  F      
Sbjct: 273  -----SARITSLSVSDCINVADDAIAAISQLLPNLAELSLQAYH-VTDTALAYFTARQGH 326

Query: 774  GLVKVNLSGCINVTDK-TISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLD 598
                + L  C  +T+   ++ +  L    L  L+L+GC  VTD  +  +A+    LR LD
Sbjct: 327  STHTLRLLSCWEITNHGVVNVVHSL--PNLTALSLSGCSKVTDDGVELVAENLRKLRSLD 384

Query: 597  IS-KSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCV 421
            +S   R++D  +  +A        L+ L L  CV  +D  L YL  + +SL  L ++ C 
Sbjct: 385  LSWCPRITDMALEYVA---CDLHRLEELVLDRCVRITDTGLSYLSTM-SSLRSLYLRWCC 440

Query: 420  GISHRGVDLLV 388
             +   G+  L+
Sbjct: 441  QVQDFGLKHLL 451



 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 69/241 (28%), Positives = 114/241 (47%), Gaps = 4/241 (1%)
 Frame = -3

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TD G+E + +    V +L L  C   ++ G+ S + A   I SL + +C  ++   +  
Sbjct: 237  ITDAGLEVMLEQMQGVVRLELSGCNDFTEAGLWSSLSAR--ITSLSVSDCINVADDAIAA 294

Query: 1035 I--LVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRL 862
            I  L+ +  +L   A+     + D A         +S  +L + +C    +  +V +   
Sbjct: 295  ISQLLPNLAELSLQAYH----VTDTALAYFTARQGHSTHTLRLLSCWEITNHGVVNVVHS 350

Query: 861  CPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIA-KLHGETLE 685
             PNL  L+LSG + VTD G +  V      L  ++LS C  +TD  +  +A  LH   LE
Sbjct: 351  LPNLTALSLSGCSKVTDDG-VELVAENLRKLRSLDLSWCPRITDMALEYVACDLH--RLE 407

Query: 684  LLNLNGCGCVTDASLAAIADYCSVLRDLDIS-KSRVSDFGIAALAGGSAIQFSLQILSLS 508
             L L+ C  +TD  L+ ++   S LR L +    +V DFG+  L        SL++LSL+
Sbjct: 408  ELVLDRCVRITDTGLSYLSTMSS-LRSLYLRWCCQVQDFGLKHLLALG----SLRLLSLA 462

Query: 507  G 505
            G
Sbjct: 463  G 463



 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 52/198 (26%), Positives = 92/198 (46%), Gaps = 6/198 (3%)
 Frame = -3

Query: 1437 ASLFSSAGNHLMKVKLQS-LNISDISLAVIGHYGVALTDLALINLQ--NINERGFWVMGS 1267
            A L+SS    +  + +   +N++D ++A I      L +LA ++LQ  ++ +       +
Sbjct: 266  AGLWSSLSARITSLSVSDCINVADDAIAAISQL---LPNLAELSLQAYHVTDTALAYFTA 322

Query: 1266 GQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIE 1087
             QG H   +L + +C  +T+ G+  V    PN+  L L  C+ ++D+GV    +    + 
Sbjct: 323  RQG-HSTHTLRLLSCWEITNHGVVNVVHSLPNLTALSLSGCSKVTDDGVELVAENLRKLR 381

Query: 1086 SLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSI-- 913
            SL L  C RI+   +   +     +L+ L  + C  + D   G+  L   +SLRSL +  
Sbjct: 382  SLDLSWCPRITDMAL-EYVACDLHRLEELVLDRCVRITDT--GLSYLSTMSSLRSLYLRW 438

Query: 912  -CNCTGFGDASLVVLSRL 862
             C    FG   L+ L  L
Sbjct: 439  CCQVQDFGLKHLLALGSL 456



>pir|T41312|T41312 probable DNA excision repair protein - fission
            yeast  (Schizosaccharomyces pombe)>gb:SPCC330_1721270
            S.pombe chromosome III cosmid c330.>gb:SPCC613_1721484
            S.pombe chromosome III cosmid c613.
          Length = 563

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 70/261 (26%), Positives = 112/261 (42%), Gaps = 6/261 (2%)
 Frame = -3

Query: 1356 VIGHYGVALTDLALINLQN--INERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSK 1183
            V+  Y   LT+L  ++ Q   +     W+    +   KL SL +T    +    I A+  
Sbjct: 284  VLHFYADHLTELTDVSFQGAFLVSSSEWINFFKKRGSKLISLELTDTARIHVSVINAIVD 343

Query: 1182 GCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKA 1003
             CPN+  L L +   L D   V  +    ++ SL++E    I   G    +++  G    
Sbjct: 344  CCPNLISLNLSRIFYLDDE-CVRLLAGCRNLVSLKIESPGGIINDGSILDVLNQIG---- 398

Query: 1002 LAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVV-LSRLCPNLVHLNLSGL 826
                                  + L +LS+  CT   D  L   +   C  L HLNLSGL
Sbjct: 399  ----------------------SGLHTLSLSGCTKLTDEVLKQGIGPCCGRLKHLNLSGL 436

Query: 825  NGVTD--YGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT 652
              +TD    ++       +GL  ++L  C+++ DKT+ A+    G TL  L+LNG   VT
Sbjct: 437  ELLTDDEASIVFGEWKIQSGLETLSLRRCLSLGDKTVRAVLVNSGHTLRTLDLNGMSFVT 496

Query: 651  DASLAAIADY-CSVLRDLDIS 592
            D +L  I ++   +L+ LD+S
Sbjct: 497  DEALQYIVNFPLPMLKALDVS 517



 Score = 37.0 bits (84), Expect = 1.0
 Identities = 43/173 (24%), Positives = 64/173 (36%), Gaps = 25/173 (14%)
 Frame = -3

Query: 921 LSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCI 742
           L + +C+     SL  +++ CPNL  L+L+    + D  +L F       L  V+  G  
Sbjct: 246 LKLYDCSKITADSLFQIAQYCPNLQTLHLTYCGQMQDQ-VLHFYADHLTELTDVSFQGAF 304

Query: 741 NVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIA 562
            V+        K  G  L  L L     +  + + AI D C  L  L++S+    D    
Sbjct: 305 LVSSSEWINFFKKRGSKLISLELTDTARIHVSVINAIVDCCPNLISLNLSRIFYLDDECV 364

Query: 561 ALAGGSAIQFSLQI-------------------------LSLSGCVLASDKCL 478
            L  G     SL+I                         LSLSGC   +D+ L
Sbjct: 365 RLLAGCRNLVSLKIESPGGIINDGSILDVLNQIGSGLHTLSLSGCTKLTDEVL 417



>gb:AF459405_1801710 Narcissus pseudonarcissus DAFSAG10 putative
           glucose-induced repressor-like protein mRNA, partial
           cds.
          Length = 85

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 35/85 (41%), Positives = 53/85 (62%)
 Frame = -3

Query: 612 LRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNI 433
           L +L +SK+ ++D+GIA LA  SA   +L+ILS SGC   + + LP    +G +L GLN+
Sbjct: 3   LEELYMSKADITDYGIALLA--SARHLNLRILSFSGCSKVTPRSLPLFGNIGPTLVGLNL 60

Query: 432 QNCVGISHRGVDLLVERLWRCDILS 358
           Q C  I   G   + E++W CDI++
Sbjct: 61  QQCDLIKAHGTAAIEEKMWWCDIIA 85



 Score = 34.7 bits (78), Expect = 5.1
 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 3/73 (4%)
 Frame = -3

Query: 819 VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL 640
           +TDYG+     +    L  ++ SGC  VT +++     + G TL  LNL  C  +     
Sbjct: 13  ITDYGIALLASARHLNLRILSFSGCSKVTPRSLPLFGNI-GPTLVGLNLQQCDLIKAHGT 71

Query: 639 AAIAD---YCSVL 610
           AAI +   +C ++
Sbjct: 72  AAIEEKMWWCDII 84



>gb:BX908798_830549 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 478

 Score = 67.0 bits (162), Expect = 9e-10
 Identities = 72/247 (29%), Positives = 121/247 (48%), Gaps = 4/247 (1%)
 Frame = -3

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TD    A+ K C N+K L    C  L+D+G ++ + +  +++ L L  C +++ AG+  
Sbjct: 238  LTDAHFSAL-KECKNLKILTFETCQALTDDG-LAHLASLTALQHLGLRGCDKVTDAGLAH 295

Query: 1035 ILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCP 856
            +   S   L+ L    C  + D   G+  L P  +L+ L +  C     A L  L+ L  
Sbjct: 296  LT--SLRALQYLDLSFCRNITDA--GLAHLTPLTALQRLLLKKCENLTGAGLAHLTPL-K 350

Query: 855  NLVHLNLSGLNGVTDYGLL---PFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLE 685
             L +L+LS  + +TD GL    P V      L  ++L+ C  +TD  ++ +  L    L 
Sbjct: 351  ALQYLDLSYWDNLTDDGLAHLRPLV-----ALQHLDLANCYELTDAGLAHLTPL--VALT 403

Query: 684  LLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILSLS 508
             L L  C  +TDA LA +    + L+ L++S  R ++D G+A L   +A+Q+    L+LS
Sbjct: 404  HLKLIWCHKLTDAGLAHLRPLVA-LKHLNLSSCRNLTDAGLAHLIPLTALQY----LNLS 458

Query: 507  GCVLASD 487
             C   +D
Sbjct: 459  DCRKLTD 465



 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 65/231 (28%), Positives = 106/231 (45%), Gaps = 26/231 (11%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            L+ L    CQ +TD G+  ++     ++ L LR C  ++D G+ + + +  +++ L L  
Sbjct: 252  LKILTFETCQALTDDGLAHLAS-LTALQHLGLRGCDKVTDAGL-AHLTSLRALQYLDLSF 309

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGMK----------------DLAF-------G 958
            C  I+ AG+  +   +A  L+ L  + C  +                 DL++       G
Sbjct: 310  CRNITDAGLAHLTPLTA--LQRLLLKKCENLTGAGLAHLTPLKALQYLDLSYWDNLTDDG 367

Query: 957  VPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLL---PFVQ 787
            +  L P  +L+ L + NC    DA L  L+ L   L HL L   + +TD GL    P V 
Sbjct: 368  LAHLRPLVALQHLDLANCYELTDAGLAHLTPLVA-LTHLKLIWCHKLTDAGLAHLRPLV- 425

Query: 786  SCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAA 634
                 L  +NLS C N+TD  ++ +  L    L+ LNL+ C  +TD  LA+
Sbjct: 426  ----ALKHLNLSSCRNLTDAGLAHLIPL--TALQYLNLSDCRKLTDTGLAS 470



 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 61/245 (24%), Positives = 101/245 (41%)
 Frame = -3

Query: 1134 SDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGV 955
            ++  ++ F +        QL E     +  +  +L+++  +L    FE    +K L+   
Sbjct: 172  TEESLIEFKELLNFAHCCQLNELKEDLELNIANVLLNATSQLAE--FERT--IKHLS--- 224

Query: 954  PALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDA 775
                  N +  L   N T   DA    L   C NL  L       +TD GL         
Sbjct: 225  ------NEIDILHFSNQTYLTDAHFSALKE-CKNLKILTFETCQALTDDGLAHLASL--T 275

Query: 774  GLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI 595
             L  + L GC  VTD  ++ +  L    L+ L+L+ C  +TDA LA +    ++ R L  
Sbjct: 276  ALQHLGLRGCDKVTDAGLAHLTSLRA--LQYLDLSFCRNITDAGLAHLTPLTALQRLLLK 333

Query: 594  SKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGI 415
                ++  G+A L    A+Q+    L LS     +D  L +L  L  +L  L++ NC  +
Sbjct: 334  KCENLTGAGLAHLTPLKALQY----LDLSYWDNLTDDGLAHLRPL-VALQHLDLANCYEL 388

Query: 414  SHRGV 400
            +  G+
Sbjct: 389  TDAGL 393



 Score = 45.4 bits (106), Expect = 0.003
 Identities = 51/208 (24%), Positives = 89/208 (42%), Gaps = 24/208 (11%)
 Frame = -3

Query: 1335 ALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLC 1156
            AL  L L     + + G   + S   L  L+ L ++ C+ +TD G+  ++     +++L 
Sbjct: 276  ALQHLGLRGCDKVTDAGLAHLTS---LRALQYLDLSFCRNITDAGLAHLTP-LTALQRLL 331

Query: 1155 LRKCTLLSDNGV------------------------VSFVKAAESIESLQLEECHRISQA 1048
            L+KC  L+  G+                        ++ ++   +++ L L  C+ ++ A
Sbjct: 332  LKKCENLTGAGLAHLTPLKALQYLDLSYWDNLTDDGLAHLRPLVALQHLDLANCYELTDA 391

Query: 1047 GVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLS 868
            G+  +    A  L  L    C  + D   G+  L P  +L+ L++ +C    DA L  L 
Sbjct: 392  GLAHLTPLVA--LTHLKLIWCHKLTDA--GLAHLRPLVALKHLNLSSCRNLTDAGLAHLI 447

Query: 867  RLCPNLVHLNLSGLNGVTDYGLLPFVQS 784
             L   L +LNLS    +TD GL  F  S
Sbjct: 448  PLTA-LQYLNLSDCRKLTDTGLASFKAS 474



>pir|T48752|T48752 GRR1 related protein [imported] - Neurospora crassa
             (fragment)
          Length = 364

 Score = 67.0 bits (162), Expect = 9e-10
 Identities = 53/191 (27%), Positives = 100/191 (52%), Gaps = 5/191 (2%)
 Frame = -3

Query: 1131 DNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLA-FGV 955
            ++G V  ++    +E L +  C RI+ AG+  +L ++ G L      +  GM+D+    +
Sbjct: 174  NDGSVESLEMCSRVERLTMTGCKRITDAGLLKLLRNNTGLLAL----DISGMEDITETSI 229

Query: 954  PALPP-CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCD 778
             A+   C+ L+ L+I NCT    ASLV L++ C  +  L L+    VTD  ++ F ++C 
Sbjct: 230  NAVAEKCSRLQGLNISNCTKISIASLVQLAQSCRFIKRLKLNECAQVTDEAVIAFAENC- 288

Query: 777  AGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSV--LRD 604
              +++++L  C  + +  ++A+    G+ L  L L  C  + D++  ++    +   LR 
Sbjct: 289  PNILEIDLHQCRLIGNDPVTALMS-KGKALRELRLASCDLIDDSAFLSLPPNKTYEQLRI 347

Query: 603  LDI-SKSRVSD 574
            LD+ S SR++D
Sbjct: 348  LDLTSCSRLTD 358



 Score = 46.2 bits (108), Expect = 0.002
 Identities = 33/160 (20%), Positives = 69/160 (43%), Gaps = 2/160 (1%)
 Frame = -3

Query: 1437 ASLFSSAGNHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFW-VMGSGQ 1261
            A L     N+   + L    + DI+   I       + L  +N+ N  +     ++   Q
Sbjct: 201  AGLLKLLRNNTGLLALDISGMEDITETSINAVAEKCSRLQGLNISNCTKISIASLVQLAQ 260

Query: 1260 GLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESL 1081
                ++ L +  C  VTD  + A ++ CPN+ ++ L +C L+ ++ V + +   +++  L
Sbjct: 261  SCRFIKRLKLNECAQVTDEAVIAFAENCPNILEIDLHQCRLIGNDPVTALMSKGKALREL 320

Query: 1080 QLEECHRISQAGVFGILVHSA-GKLKALAFENCFGMKDLA 964
            +L  C  I  +    +  +    +L+ L   +C  + D A
Sbjct: 321  RLASCDLIDDSAFLSLPPNKTYEQLRILDLTSCSRLTDRA 360



 Score = 40.8 bits (94), Expect = 0.071
 Identities = 35/208 (16%), Positives = 81/208 (38%), Gaps = 1/208 (0%)
 Frame = -3

Query: 1251 KLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLE 1072
            ++  L +T C+ +TD G+  + +    +  L +     +++  + +  +    ++ L + 
Sbjct: 186  RVERLTMTGCKRITDAGLLKLLRNNTGLLALDISGMEDITETSINAVAEKCSRLQGLNIS 245

Query: 1071 ECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG 892
             C +IS A +                            V     C  ++ L +  C    
Sbjct: 246  NCTKISIASL----------------------------VQLAQSCRFIKRLKLNECAQVT 277

Query: 891  DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKT-ISA 715
            D +++  +  CPN++ ++L     + +  +   +    A L ++ L+ C  + D   +S 
Sbjct: 278  DEAVIAFAENCPNILEIDLHQCRLIGNDPVTALMSKGKA-LRELRLASCDLIDDSAFLSL 336

Query: 714  IAKLHGETLELLNLNGCGCVTDASLAAI 631
                  E L +L+L  C  +TD ++  I
Sbjct: 337  PPNKTYEQLRILDLTSCSRLTDRAVEKI 364



>gb:AE014297_1139487 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003703_1221480 Drosophila melanogaster
            chromosome 3R, section 41 of 118 of the complete
            sequence.
          Length = 632

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 72/297 (24%), Positives = 129/297 (43%), Gaps = 9/297 (3%)
 Frame = -3

Query: 1248 LRSLVITACQGVT-DLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLE 1072
            +R L +T    +T +L +    K    +K L L  C  L+ N + +  + +  +E+L + 
Sbjct: 331  IRQLDLTGMLSLTNELLLYVAGKWQSTLKVLDLMFCVQLNANCIDALRQLSGRLEALTMA 390

Query: 1071 ECHRISQAGVF-GILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCT-G 898
             C  ++  G+  G+       L+ L  E    + + +     L    +LR LS+ NC   
Sbjct: 391  YCRELTGTGLLQGLAGDINYSLQELHLEETIFLDESSM-CQLLERLPNLRRLSLDNCRQA 449

Query: 897  FGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLL-----PFVQSCDAGLVKVNLSGCINVT 733
              D ++  + +    L +LN+     +TD GL+     P+  S   GL ++NL GC NVT
Sbjct: 450  VTDRTMATICQYQTRLRNLNIEYCMKITDQGLMGYGDTPYPISRLRGLKELNLRGCRNVT 509

Query: 732  DKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAAL 556
            D ++    KL    L  L+L  C  +T     A+   C  L  L +S    V D  +  +
Sbjct: 510  DSSLMVGLKL--PELRALSLGYCNRLTSEGFEALTQNCPSLEALCVSSCMAVDDETVLNI 567

Query: 555  AGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVE 385
                     L++L+LS C   + + + ++   G++L  L   +  G+ H     ++E
Sbjct: 568  VSNLK---RLRVLNLSNCTKLTLQSIHHILAHGHNLVQLIACSIDGMDHEQAQRILE 621



 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 30/112 (26%), Positives = 57/112 (50%)
 Frame = -3

Query: 1332 LTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCL 1153
            L +L L   +N+ +    V   G  L +LR+L +  C  +T  G EA+++ CP+++ LC+
Sbjct: 497  LKELNLRGCRNVTDSSLMV---GLKLPELRALSLGYCNRLTSEGFEALTQNCPSLEALCV 553

Query: 1152 RKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALA 997
              C  + D  V++ V   + +  L L  C +++   +  IL H    ++ +A
Sbjct: 554  SSCMAVDDETVLNIVSNLKRLRVLNLSNCTKLTLQSIHHILAHGHNLVQLIA 605



>gb:BC016499_2092332 Mus musculus F-box and leucine-rich repeat
            protein 15, mRNA (cDNA clone MGC:25449 IMAGE:4221584),
            complete cds.
          Length = 296

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 49/173 (28%), Positives = 84/173 (48%), Gaps = 1/173 (0%)
 Frame = -3

Query: 1110 VKAAESIESLQLEECHR-ISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCN 934
            ++ AE ++ L L  CH  +S   +  +L  +  +L+++A   C  +   A G  A   C 
Sbjct: 79   LRDAEGLQELALAPCHEWLSDEDLVPVLARNP-QLRSVALAGCGQLSRRALGALA-EGCP 136

Query: 933  SLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNL 754
             L+ LS+ +C      +L  L+  CP L  L+L+    + D  ++   Q   AGL  ++L
Sbjct: 137  RLQRLSLAHCDWVDGLALRGLADRCPALEELDLTACRQLKDEAIVYLAQRRGAGLRSLSL 196

Query: 753  SGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI 595
            +   NV D  +  +A+ +   LE L+L GC  V    +  +A+YC  LR L +
Sbjct: 197  AVNANVGDTAVQELAR-NCPQLEHLDLTGCLRVGSDGVRTLAEYCPALRSLRV 248



 Score = 57.8 bits (138), Expect = 6e-07
 Identities = 43/182 (23%), Positives = 79/182 (43%)
 Frame = -3

Query: 1251 KLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLE 1072
            +LRS+ +  C  ++   + A+++GCP +++L L  C  +    +        ++E L L 
Sbjct: 111  QLRSVALAGCGQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRGLADRCPALEELDLT 170

Query: 1071 ECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG 892
             C ++    +    V+ A +  A                        LRSLS+      G
Sbjct: 171  ACRQLKDEAI----VYLAQRRGA-----------------------GLRSLSLAVNANVG 203

Query: 891  DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI 712
            D ++  L+R CP L HL+L+G   V   G+    + C A L  + +  C +V + ++S +
Sbjct: 204  DTAVQELARNCPQLEHLDLTGCLRVGSDGVRTLAEYCPA-LRSLRVRHCHHVAEPSLSRL 262

Query: 711  AK 706
             K
Sbjct: 263  RK 264



 Score = 43.9 bits (102), Expect = 0.008
 Identities = 22/95 (23%), Positives = 47/95 (49%)
 Frame = -3

Query: 1335 ALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLC 1156
            AL +L L   + + +     +   +G   LRSL +     V D  ++ +++ CP ++ L 
Sbjct: 163  ALEELDLTACRQLKDEAIVYLAQRRGAG-LRSLSLAVNANVGDTAVQELARNCPQLEHLD 221

Query: 1155 LRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQ 1051
            L  C  +  +GV +  +   ++ SL++  CH +++
Sbjct: 222  LTGCLRVGSDGVRTLAEYCPALRSLRVRHCHHVAE 256



 Score = 42.7 bits (99), Expect = 0.019
 Identities = 48/170 (28%), Positives = 79/170 (46%), Gaps = 2/170 (1%)
 Frame = -3

Query: 888 ASLVVLSRLCPNLVHLNLSGLNG-VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI 712
           A+L  L R    L  L L+  +  ++D  L+P V + +  L  V L+GC  ++ + + A+
Sbjct: 73  AALARLLRDAEGLQELALAPCHEWLSDEDLVP-VLARNPQLRSVALAGCGQLSRRALGAL 131

Query: 711 AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQ 535
           A+     L+ L+L  C  V   +L  +AD C  L +LD++  R + D  I  LA      
Sbjct: 132 AE-GCPRLQRLSLAHCDWVDGLALRGLADRCPALEELDLTACRQLKDEAIVYLAQRRGA- 189

Query: 534 FSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVE 385
             L+ LSL+      D  +  L +    L  L++  C+ +   GV  L E
Sbjct: 190 -GLRSLSLAVNANVGDTAVQELARNCPQLEHLDLTGCLRVGSDGVRTLAE 238



>gb:BC020575_1977070 Homo sapiens F-box and leucine-rich repeat
           protein 13, mRNA (cDNA clone IMAGE:4447876), partial
           cds.
          Length = 247

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 59/201 (29%), Positives = 88/201 (43%), Gaps = 25/201 (12%)
 Frame = -3

Query: 906 CTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSG------- 748
           C    DAS++ LS  CPNL +L+L     +T  G+   V      LV ++LSG       
Sbjct: 1   CVRLSDASVMKLSERCPNLNYLSLRNCEHLTAQGIGYIVNIFS--LVSIDLSGTDISNEG 58

Query: 747 -----------------CINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYC 619
                            C  +TD  I A  K     LE L+++ C  ++D  + A+A YC
Sbjct: 59  LNVLSRHKKLKELSVSECYRITDDGIQAFCK-SSLILEHLDVSYCSQLSDMIIKALAIYC 117

Query: 618 SVLRDLDISKS-RVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAG 442
             L  L I+   +++D  +  L   SA    L IL +SGCVL +D+ L  L      L  
Sbjct: 118 INLTSLSIAGCPKITDSAMEML---SAKCHYLHILDISGCVLLTDQILEDLQIGCKQLRI 174

Query: 441 LNIQNCVGISHRGVDLLVERL 379
           L +Q C  IS +    +  ++
Sbjct: 175 LKMQYCTNISKKAAQRMSSKV 195



 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 47/189 (24%), Positives = 81/189 (42%), Gaps = 23/189 (12%)
 Frame = -3

Query: 1224 CQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGV-----------------------VS 1114
            C  ++D  +  +S+ CPN+  L LR C  L+  G+                       ++
Sbjct: 1    CVRLSDASVMKLSERCPNLNYLSLRNCEHLTAQGIGYIVNIFSLVSIDLSGTDISNEGLN 60

Query: 1113 FVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCN 934
             +   + ++ L + EC+RI+  G+      S   L+ L    C  + D+     A+  C 
Sbjct: 61   VLSRHKKLKELSVSECYRITDDGIQAFCKSSL-ILEHLDVSYCSQLSDMIIKALAIY-CI 118

Query: 933  SLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNL 754
            +L SLSI  C    D+++ +LS  C  L  L++SG   +TD  L      C   L  + +
Sbjct: 119  NLTSLSIAGCPKITDSAMEMLSAKCHYLHILDISGCVLLTDQILEDLQIGCKQ-LRILKM 177

Query: 753  SGCINVTDK 727
              C N++ K
Sbjct: 178  QYCTNISKK 186



 Score = 40.0 bits (92), Expect = 0.12
 Identities = 46/183 (25%), Positives = 80/183 (43%), Gaps = 14/183 (7%)
 Frame = -3

Query: 1407 LMKVKLQSLNISDISLAVIGH-------YGVALTDLALINLQ--NINERGFWVMGSGQGL 1255
            +MK+  +  N++ +SL    H       Y V +  L  I+L   +I+  G  V+   +  
Sbjct: 9    VMKLSERCPNLNYLSLRNCEHLTAQGIGYIVNIFSLVSIDLSGTDISNEGLNVLSRHK-- 66

Query: 1254 HKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQL 1075
             KL+ L ++ C  +TD GI+A  K    ++ L +  C+ LSD  + +      ++ SL +
Sbjct: 67   -KLKELSVSECYRITDDGIQAFCKSSLILEHLDVSYCSQLSDMIIKALAIYCINLTSLSI 125

Query: 1074 EECHRISQAGVFGILVHSAGKLKALAFENCF-----GMKDLAFGVPALPPCNSLRSLSIC 910
              C +I+ + +  +L      L  L    C       ++DL  G      C  LR L + 
Sbjct: 126  AGCPKITDSAM-EMLSAKCHYLHILDISGCVLLTDQILEDLQIG------CKQLRILKMQ 178

Query: 909  NCT 901
             CT
Sbjct: 179  YCT 181



 Score = 34.7 bits (78), Expect = 5.1
 Identities = 19/66 (28%), Positives = 32/66 (48%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            L SL I  C  +TD  +E +S  C  +  L +  C LL+D  +       + +  L+++ 
Sbjct: 120  LTSLSIAGCPKITDSAMEMLSAKCHYLHILDISGCVLLTDQILEDLQIGCKQLRILKMQY 179

Query: 1068 CHRISQ 1051
            C  IS+
Sbjct: 180  CTNISK 185



 Score = 34.7 bits (78), Expect = 5.1
 Identities = 21/82 (25%), Positives = 41/82 (50%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGI 1198
            +SD+ +  +  Y + LT L++     I +    ++ +    H L  L I+ C  +TD  +
Sbjct: 105  LSDMIIKALAIYCINLTSLSIAGCPKITDSAMEMLSAK--CHYLHILDISGCVLLTDQIL 162

Query: 1197 EAVSKGCPNVKQLCLRKCTLLS 1132
            E +  GC  ++ L ++ CT +S
Sbjct: 163  EDLQIGCKQLRILKMQYCTNIS 184



>gb:AE017150_1029536 Trypanosoma brucei chromosome 2, complete
            sequence.>gb:AE017167_1229736 Trypanosoma brucei
            chromosome 2, section 1 of 4 of the complete sequence.
          Length = 1393

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 103/337 (30%), Positives = 150/337 (44%), Gaps = 22/337 (6%)
 Frame = -3

Query: 1335 ALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLC 1156
            AL +L L N   IN  G+  +   Q LH    + I +   +TD GI   SK C N+  L 
Sbjct: 556  ALNELNLSNCIRINA-GWEALEKLQQLH----VAILSNTHITDRGISYFSK-CKNLVTLD 609

Query: 1155 LRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGM 976
            L  C  L D   V+ +    ++E L L+ C  I +    G+ V   G+L  L   N  G+
Sbjct: 610  LSFCNKLLD---VTTLSNITTLEELNLDSCSNIRK----GLSV--LGELPRLCVLNIKGV 660

Query: 975  KDLAFGVPALPPCNSLRSLSICNCTGFGD----ASLVVLSRLCPNLVHLNLSGLNGVTDY 808
            +     + +L    SL  LS+ NC GFGD    ++LV L  L  NL H      +G+   
Sbjct: 661  QLEDSVIGSLGNGKSLVRLSLENCKGFGDVTPLSNLVTLEEL--NL-HYCDKVTSGMGTL 717

Query: 807  GLLPFVQSCDAG------------------LVKVNLSGCINVTDKTISAIAKLHGETLEL 682
            G LP ++  D G                  LV +N S C  +T  +ISAIA L    LE 
Sbjct: 718  GRLPQLRVLDLGRTQVDDNSLENICTSSIPLVSLNFSHCKKIT--SISAIASL--TALEE 773

Query: 681  LNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGC 502
            LN++ C  VT  S   +      LR   +S +R++D  I  ++       SL  L+L+ C
Sbjct: 774  LNIDNCCNVT--SGWNVFGTLHQLRVATLSNTRINDEKIRHVSECK----SLNTLNLAFC 827

Query: 501  VLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
               +D  +  L K+   L  LN+  C  I  +G++ L
Sbjct: 828  KDITD--VTALSKI-TMLEELNLDCCPNI-RKGIETL 860



 Score = 57.4 bits (137), Expect = 7e-07
 Identities = 74/281 (26%), Positives = 135/281 (48%), Gaps = 25/281 (8%)
 Frame = -3

Query: 1179 CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGI-LVHSAGKLKA 1003
            C ++++L +  C  L+D   ++ +  A +IE L L  C RI++    GI +V +  KL+ 
Sbjct: 318  CGSLERLNISYCIQLTD---INPLSNATAIEELNLNGCRRITR----GIDVVWALPKLRV 370

Query: 1002 LAFENCFGMKDLAFGVPALPPCN---SLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS 832
                  F MKD+    P+L       SL  +S+ NC GFGD SL  LS +   L  LN+ 
Sbjct: 371  ------FHMKDVHLSEPSLDSVGTGGSLVKVSLDNCAGFGDMSL--LSSIV-TLEELNIQ 421

Query: 831  G----LNGVTDYGLLPFVQ-----------------SCDAGLVKVNLSGCINVTDKTISA 715
                 ++GV   G LP+++                      L+++N+     +++  + A
Sbjct: 422  KCADIISGVGCLGTLPYLRVLNIKEVHISSLDFTGIGASKSLLQLNMESITGLSN--VEA 479

Query: 714  IAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQ 535
            +A +   TLE L+L+GC  + DA +  + +    L+ LD+S +   +  + +L     + 
Sbjct: 480  LANI--LTLEKLSLHGCTDI-DAGIGCLGN-LPQLKVLDLSGTNTDNESLRSL----CLS 531

Query: 534  FSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGIS 412
             ++  L+LS C   ++  + ++  L  +L  LN+ NC+ I+
Sbjct: 532  QTMVSLNLSHCWKMTN--VSHISSL-EALNELNLSNCIRIN 569



 Score = 52.8 bits (125), Expect = 2e-05
 Identities = 88/341 (25%), Positives = 142/341 (41%), Gaps = 66/341 (19%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGI---------------EAVSKGCPNVKQLCLRKCTLLSDNGV-- 1120
            LRSL ++ C+ VTD+ +                A+ KG  ++ +L L +  +LSD  +  
Sbjct: 963  LRSLNLSHCKWVTDISVLSSLSTLEELNVNCCNAIRKGWESLGKLPLLRVAILSDTNITA 1022

Query: 1119 --VSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCF-GMKDLAFGVPA 949
              ++ + + + +  L+   C ++S   V    V+    L+ L  +NC  G+K    G+ A
Sbjct: 1023 KDIACLSSCKKLVKLKFFRCKKLSDVTV----VYKIQSLEELIVKNCSGGLK----GLNA 1074

Query: 948  LPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL---------------------- 835
            L     LR L + N +G  D S+  +     +LV LN+                      
Sbjct: 1075 LGTLPRLRFLHLRNVSG-SDISVESIG-TSKSLVRLNIETREELTDTTPLSNITSLEELS 1132

Query: 834  -----SGLNGVTDYGLLPFVQSCDAGLVKV-----------------NLSGCINVTDKTI 721
                 + L GV   G LP ++S   GL ++                 NL+    +TD  I
Sbjct: 1133 LRKCGNNLEGVGTLGKLPRLRSLYLGLSRINDSTLYYICLSRSITSLNLASSWKLTD--I 1190

Query: 720  SAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSA 541
            S I+KL    LE LNL GC  +T +   A+++    LR L++  +RV+        GG  
Sbjct: 1191 SHISKL--TALEELNLRGCYPIT-SGWEALSE-LPRLRVLNLESTRVT-----TRYGGYY 1241

Query: 540  IQ--FSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC 424
            I+   SL  LSL  C +    CL  +     +L  L+I  C
Sbjct: 1242 IRRCKSLVTLSLESCDMTDASCLANI----KTLEELHIGRC 1278



 Score = 41.2 bits (95), Expect = 0.054
 Identities = 53/164 (32%), Positives = 81/164 (49%), Gaps = 3/164 (1%)
 Frame = -3

Query: 873 LSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKT-ISAIAKLHG 697
           +SRL  NL+ L L+  +   D   +  + +C A L K+++S C N+TD T IS +A    
Sbjct: 220 ISRLT-NLMCLELNSTD--IDDTCIGEISAC-AKLSKLSVSECNNITDATPISQLA---- 271

Query: 696 ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQIL 517
             LE LNLN C  +T             LR LD+S   V D  +  L        SL+ L
Sbjct: 272 -ALEELNLNSCYHITKG--IGTLGMLLRLRMLDLSGVPVEDNCLKDLCDCG----SLERL 324

Query: 516 SLSGCVLASDKCLPYLHKLGNSLA--GLNIQNCVGISHRGVDLL 391
           ++S C+  +D     ++ L N+ A   LN+  C  I+ RG+D++
Sbjct: 325 NISYCIQLTD-----INPLSNATAIEELNLNGCRRIT-RGIDVV 362



 Score = 39.7 bits (91), Expect = 0.16
 Identities = 69/283 (24%), Positives = 115/283 (40%), Gaps = 5/283 (1%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDL-GIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLE 1072
            L  L IT    +T++ GI  ++        +CL   +   D+  +  + A   +  L + 
Sbjct: 203  LEELAITDTMQLTNIRGISRLTN------LMCLELNSTDIDDTCIGEISACAKLSKLSVS 256

Query: 1071 ECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG 892
            EC+ I+ A      +     L+ L   +C+ +                         G G
Sbjct: 257  ECNNITDA----TPISQLAALEELNLNSCYHI-----------------------TKGIG 289

Query: 891  DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAG-LVKVNLSGCINVTDKTISA 715
               +++  R+      L+LSG+  V D  L      CD G L ++N+S CI +TD  I+ 
Sbjct: 290  TLGMLLRLRM------LDLSGV-PVEDNCLKDL---CDCGSLERLNISYCIQLTD--INP 337

Query: 714  IAKLHGETLELLNLNGCGCVT---DASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGS 544
            ++  +   +E LNLNGC  +T   D   A        ++D+ +S+  +   G     GGS
Sbjct: 338  LS--NATAIEELNLNGCRRITRGIDVVWALPKLRVFHMKDVHLSEPSLDSVG----TGGS 391

Query: 543  AIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGI 415
             ++     +SL  C    D  L  L  +  +L  LNIQ C  I
Sbjct: 392  LVK-----VSLDNCAGFGDMSL--LSSI-VTLEELNIQKCADI 426



>gb:AK030172_1161864 Mus musculus adult male testis cDNA, RIKEN
            full-length enriched library, clone:4933409A11
            product:hypothetical F-box domain containing protein,
            full insert sequence.
          Length = 589

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 56/236 (23%), Positives = 105/236 (44%), Gaps = 2/236 (0%)
 Frame = -3

Query: 1407 LMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVIT 1228
            ++ + L +  I++ ++ ++  Y   L +L+L   +   ++G   +  G G HKL  L ++
Sbjct: 357  VLYLNLSNTTITNRTMRLLPRYFHNLQNLSLAYCRKFTDKGLQYLNLGNGCHKLIYLDLS 416

Query: 1227 ACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQA 1048
             C  ++  G   ++  C  +  L +     L+DN V   V+    I S+ L     IS +
Sbjct: 417  GCTQISVQGFRNIASSCTGIVHLTINDMPTLTDNCVKVLVEKCPRISSVVLIGSPHISDS 476

Query: 1047 GVFGILVHSAGKLKALAFENCFGMKDLAF-GVPALPPCNSLRSLSICNCTGFGDASLVVL 871
                +   S+  LK + FE    + D  F  +    P   +  + + +C G  D+SL  L
Sbjct: 477  AFKAL---SSCDLKKIRFEGNKRISDACFKSIDRNYP--GINHIYMVDCKGLTDSSLKSL 531

Query: 870  SRLCPNLVHLNLSGLNGVTDYGLLPFVQS-CDAGLVKVNLSGCINVTDKTISAIAK 706
            S L   L  LNL+    + D GL  F        L ++NL+ C  + D ++  +++
Sbjct: 532  S-LLKQLTVLNLTNCIRIGDIGLKHFFDGPASIRLRELNLTNCSLLGDSSVIRLSE 586



 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 63/259 (24%), Positives = 115/259 (44%), Gaps = 5/259 (1%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            L+ L ++ CQ  TD  +  +S+GCP V  L L   T +++  +    +   ++++L L  
Sbjct: 331  LQELNVSDCQSFTDESMRHISEGCPGVLYLNLSN-TTITNRTMRLLPRYFHNLQNLSLAY 389

Query: 1068 CHRISQAGV-FGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG 892
            C + +  G+ +  L +   KL  L    C  +    F   A   C  +  L+I +     
Sbjct: 390  CRKFTDKGLQYLNLGNGCHKLIYLDLSGCTQISVQGFRNIA-SSCTGIVHLTINDMPTLT 448

Query: 891  DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI 712
            D  + VL   CP +  + L G   ++D      + SCD  L K+   G   ++D    +I
Sbjct: 449  DNCVKVLVEKCPRISSVVLIGSPHISD-SAFKALSSCD--LKKIRFEGNKRISDACFKSI 505

Query: 711  AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI----SKSRVSDFGIAALAGGS 544
             + +   +  + +  C  +TD+SL ++    S+L+ L +    +  R+ D G+     G 
Sbjct: 506  DRNY-PGINHIYMVDCKGLTDSSLKSL----SLLKQLTVLNLTNCIRIGDIGLKHFFDGP 560

Query: 543  AIQFSLQILSLSGCVLASD 487
            A    L+ L+L+ C L  D
Sbjct: 561  A-SIRLRELNLTNCSLLGD 578



 Score = 52.0 bits (123), Expect = 3e-05
 Identities = 42/150 (28%), Positives = 79/150 (52%), Gaps = 3/150 (2%)
 Frame = -3

Query: 843 LNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGC 664
           ++ S +  + D  ++  +Q     ++++N  GC +   KT+ A++  H + L+ LN++ C
Sbjct: 283 IDFSTVKNIADKCVVTTLQKWRLNVLRLNFRGC-DFRTKTLKAVS--HCKNLQELNVSDC 339

Query: 663 GCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDK 484
              TD S+  I++ C  +  L++S + +++  +  L        +LQ LSL+ C   +DK
Sbjct: 340 QSFTDESMRHISEGCPGVLYLNLSNTTITNRTMRLLP---RYFHNLQNLSLAYCRKFTDK 396

Query: 483 CLPYLHKLGN---SLAGLNIQNCVGISHRG 403
            L YL+ LGN    L  L++  C  IS +G
Sbjct: 397 GLQYLN-LGNGCHKLIYLDLSGCTQISVQG 425



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 33/121 (27%), Positives = 59/121 (48%), Gaps = 1/121 (0%)
 Frame = -3

Query: 951 ALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAG 772
           A+  C +L+ L++ +C  F D S+  +S  CP +++LNLS  N       +  +      
Sbjct: 324 AVSHCKNLQELNVSDCQSFTDESMRHISEGCPGVLYLNLS--NTTITNRTMRLLPRYFHN 381

Query: 771 LVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI 595
           L  ++L+ C   TDK +  +   +G   L  L+L+GC  ++      IA  C+ +  L I
Sbjct: 382 LQNLSLAYCRKFTDKGLQYLNLGNGCHKLIYLDLSGCTQISVQGFRNIASSCTGIVHLTI 441

Query: 594 S 592
           +
Sbjct: 442 N 442



>gb:AE016959_1022420 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC108884_1738679 Oryza sativa
            (japonica cultivar-group) cultivar Nipponbare clone
            OSJNBb0058B20 from chromosome 10, complete
            sequence.>gb:AC122144_1740254 Oryza sativa (japonica
            cultivar-group) chromosome 10 clone OSJNAa0011L09,
            complete sequence.>gb:AE017090_1752239 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 44 of 77
            of the complete sequence.
          Length = 1152

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 78/262 (29%), Positives = 107/262 (40%), Gaps = 27/262 (10%)
 Frame = -3

Query: 1440 IASLFSSAGNHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERG-------- 1285
            + SL       L  V+L S ++ ++SLA  G   + L  L+  NLQN+N  G        
Sbjct: 601  LRSLILDNCESLSTVELNSSSMVNLSLA--GCRSMTLLKLSCPNLQNVNLDGCDHLERAS 658

Query: 1284 FWVMGSGQGLHKLRSLVITACQGVTDLGIEA----------------VSKGCPNVKQLCL 1153
            F  +G       L SL +  C  ++DL IEA                 S  CP +  L  
Sbjct: 659  FCPVG-------LESLNLGICPKLSDLHIEAPKMSLLELKGCGVLSQASINCPRLTSLDA 711

Query: 1152 RKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMK 973
              C  L D+ +    +A   IE+L L  C  I   G+  +  H   KL  L     F   
Sbjct: 712  SFCRKLMDDSLSQTAEACPLIENLILSSCVSIDLNGLSSL--HCLHKLALLDLSYTF--- 766

Query: 972  DLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSR--LCPNLVHLNLSGLN-GVTDYGL 802
             L    P    C  L+ L +  C    D+SL  L R    P LV L+LS  + G T    
Sbjct: 767  -LTNLKPVFDSCPQLKILKLSACKYLSDSSLDALYREGALPMLVELDLSYSSIGQT---A 822

Query: 801  LPFVQSCDAGLVKVNLSGCINV 736
            +  + SC   LV VNL+GC N+
Sbjct: 823  IEELLSCCTNLVNVNLNGCTNL 844



 Score = 57.8 bits (138), Expect = 6e-07
 Identities = 84/347 (24%), Positives = 133/347 (38%), Gaps = 61/347 (17%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKC----------------TLLSDNGVV 1117
            L SL +++C  VTD  +  ++  CPN+  L    C                 LLS  G+ 
Sbjct: 417  LASLDMSSCSCVTDETLREIANSCPNLSVLDASNCPNISFESVRLPMLVDLRLLSCEGIT 476

Query: 1116 SFVKAA----ESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPA 949
            S   AA      +E+LQL+ C  ++   +          LK ++  +     +L    P 
Sbjct: 477  SASMAAIAYSRLLEALQLDNCSLLTSVSL------DLPHLKNISLVHLRKFAELTLRSPV 530

Query: 948  L-----PPCNSLRSLSICN-----CTGFGDASLVVLSRLCPNLVHLNLSGLNGVT----- 814
            L       C+ L  +SI +            SL  LS LC NL+ ++LS    +T     
Sbjct: 531  LSYIKVSRCSVLHRVSITSNALQKLVLQKQESLSSLSLLCNNLIDVDLSDCESLTNAVCE 590

Query: 813  ---DYGLLPFVQS-----CD---------AGLVKVNLSGCINVTDKTISAIAKLHGETLE 685
               D G  P ++S     C+         + +V ++L+GC ++T      + KL    L+
Sbjct: 591  VFSDGGGCPLLRSLILDNCESLSTVELNSSSMVNLSLAGCRSMT------LLKLSCPNLQ 644

Query: 684  LLNLNGCGCVTDASLAAIA------DYCSVLRDLDISKSRVSDF---GIAALAGGSAIQF 532
             +NL+GC  +  AS   +         C  L DL I   ++S     G   L+  S    
Sbjct: 645  NVNLDGCDHLERASFCPVGLESLNLGICPKLSDLHIEAPKMSLLELKGCGVLSQASINCP 704

Query: 531  SLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
             L  L  S C    D  L    +    +  L + +CV I   G+  L
Sbjct: 705  RLTSLDASFCRKLMDDSLSQTAEACPLIENLILSSCVSIDLNGLSSL 751



>pir|E96838|E96838 hypothetical protein T21F11.4 [imported] -
            Arabidopsis thaliana>gb:AE005173_895575 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC018849_1538414 Arabidopsis thaliana
            chromosome 1 BAC T21F11 genomic sequence, complete
            sequence.>gb:AY086192_1571247 Arabidopsis thaliana clone
            22321 mRNA, complete sequence.
          Length = 578

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 50/160 (31%), Positives = 78/160 (48%), Gaps = 4/160 (2%)
 Frame = -3

Query: 1212 TDLGIEAVSKGCPN----VKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAG 1045
            T+ G+E  +K   +    VK L L +   L D  +    +    IESL + +C  I++ G
Sbjct: 355  TNFGVEEYTKDTKDFKSGVKFLYLSRNHNLLDECLEKISRHCPFIESLDVAQCPGITRDG 414

Query: 1044 VFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSR 865
            +  +   + GKL++L    C G+K L      LP   SLR+      T   D +L ++S+
Sbjct: 415  ILEVW-RNCGKLRSLDISRCTGIKSLGVVDFELPKLESLRACG----TWIDDEALDMISK 469

Query: 864  LCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGC 745
             C  L+HL+L G   V+  G+   VQSC   L ++NL  C
Sbjct: 470  KCRGLLHLDLQGCLNVSSRGVKEVVQSC-IRLREINLKYC 508



 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 81/353 (22%), Positives = 141/353 (39%), Gaps = 55/353 (15%)
 Frame = -3

Query: 1278 VMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAA 1099
            V+     L  L  + I+    +TD  + A+S+ C  ++++  R C  +S + +   ++ +
Sbjct: 155  VIELSSNLKGLLKINISGNSFITDKSLIALSQNCLLLREIIFRDCDFISSDCIKFVLRNS 214

Query: 1098 ESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPA--LPPCNSLR 925
             ++ESL +       +  +       A  L  L   + F   DL   + +  LP    L+
Sbjct: 215  RNLESLAINGIGLRPRESLLTDAFLFARCLTELDLSDSFLSDDLLCLIASAKLP----LK 270

Query: 924  SLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDY--------------------- 808
             L + +C GF    ++ L     +LVHLNL G N ++D                      
Sbjct: 271  KLLLSDCHGFTFDGILYLLDKYQSLVHLNLKGANFLSDEMVMKLGMFFRRLTFLNLSFCS 330

Query: 807  ---GLLPF--VQSC-------------------------DAGLVKVNLSGCINVTDKTIS 718
               GL  F  ++ C                          +G+  + LS   N+ D+ + 
Sbjct: 331  KLTGLAFFSIIERCVSLRCMIMVGTNFGVEEYTKDTKDFKSGVKFLYLSRNHNLLDECLE 390

Query: 717  AIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAI 538
             I++ H   +E L++  C  +T   +  +   C  LR LDIS+      GI +L     +
Sbjct: 391  KISR-HCPFIESLDVAQCPGITRDGILEVWRNCGKLRSLDISRCT----GIKSLG---VV 442

Query: 537  QFSLQIL-SLSGC-VLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVE 385
             F L  L SL  C     D+ L  + K    L  L++Q C+ +S RGV  +V+
Sbjct: 443  DFELPKLESLRACGTWIDDEALDMISKKCRGLLHLDLQGCLNVSSRGVKEVVQ 495



 Score = 43.1 bits (100), Expect = 0.014
 Identities = 43/155 (27%), Positives = 74/155 (47%), Gaps = 1/155 (0%)
 Frame = -3

Query: 891 DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI 712
           D+ ++ LS     L+ +N+SG + +TD  L+   Q+C   L ++    C  ++   I  +
Sbjct: 152 DSGVIELSSNLKGLLKINISGNSFITDKSLIALSQNC-LLLREIIFRDCDFISSDCIKFV 210

Query: 711 AKLHGETLELLNLNGCGCVTDASLAAIAD-YCSVLRDLDISKSRVSDFGIAALAGGSAIQ 535
            + +   LE L +NG G     SL   A  +   L +LD+S S +SD  +  +A   + +
Sbjct: 211 LR-NSRNLESLAINGIGLRPRESLLTDAFLFARCLTELDLSDSFLSDDLLCLIA---SAK 266

Query: 534 FSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQ 430
             L+ L LS C   +   + YL     SL  LN++
Sbjct: 267 LPLKKLLLSDCHGFTFDGILYLLDKYQSLVHLNLK 301



 Score = 37.7 bits (86), Expect = 0.60
 Identities = 34/135 (25%), Positives = 53/135 (39%), Gaps = 31/135 (22%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSF-------------- 1111
            + SL +  C G+T  GI  V + C  ++ L + +CT +   GVV F              
Sbjct: 399  IESLDVAQCPGITRDGILEVWRNCGKLRSLDISRCTGIKSLGVVDFELPKLESLRACGTW 458

Query: 1110 ---------VKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKD---- 970
                      K    +  L L+ C  +S  GV  + V S  +L+ +  + C   K     
Sbjct: 459  IDDEALDMISKKCRGLLHLDLQGCLNVSSRGVKEV-VQSCIRLREINLKYCEADKKMYTW 517

Query: 969  LAFGVPAL----PPC 937
            + F  P+L    PPC
Sbjct: 518  MVFANPSLRKIVPPC 532



>gb:TBBCHR1A1_1398482 Trypanosoma brucei DNA chromosome 1, segment
            1/4.
          Length = 1448

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 100/354 (28%), Positives = 153/354 (43%), Gaps = 22/354 (6%)
 Frame = -3

Query: 1386 SLNISDI-SLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQG-- 1216
            SLN+S    +  + H   +L  L  +NL N     F +    + L KL+ L +       
Sbjct: 590  SLNLSHCWKMTNVSHIS-SLEALNELNLSNC----FGINAGWEALEKLQQLHVAILSNTH 644

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TD  I   S  C N+  L L  C  L D   V+ +    ++E L L+ C  I +    G
Sbjct: 645  ITDRDISHFSN-CKNLITLDLSFCNKLLD---VTALSNITTLEELNLDSCSNIRK----G 696

Query: 1035 ILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGD----ASLVVLS 868
            + V   G+L  L   N  G++     + +L   NS   LS+ NC GFGD    ++LV L 
Sbjct: 697  LSV--LGELPRLCVLNIKGVQLEDSVIVSLGNGNSFVRLSLENCKGFGDVAPLSNLVTLE 754

Query: 867  RLCPNLVHLNLSGLNGV---------------TDYGLLPFVQSCDAGLVKVNLSGCINVT 733
             L  +      SG+  +                D   L  + +C + LV +NLS C  +T
Sbjct: 755  ELNLHYCDKVTSGMGTLGRLPQLRVLDLGRTQVDDNSLENICTCSSPLVSLNLSNCKKIT 814

Query: 732  DKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALA 553
              +ISAIA L    LE LN++ C  VT  S   +      LR   +S +R +D  +  ++
Sbjct: 815  --SISAIASL--TALEELNIDNCCNVT--SGWNVFGTLHQLRVATLSNTRTNDENVRHVS 868

Query: 552  GGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
                   SL  L+L+ C   +D  +  L K+   L  LN+  C  I  +G++ L
Sbjct: 869  ECK----SLNTLNLAFCKDITD--VTALSKI-TMLEELNLDCCHNI-RKGIETL 914



 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 94/362 (25%), Positives = 149/362 (41%), Gaps = 31/362 (8%)
 Frame = -3

Query: 1407 LMKVKLQSLNISDISLAVIGHYGVALTDLALIN-LQNINERGFWVMGSGQGLHKLRSLVI 1231
            L ++ L+S NI +     + + G  L +LA+ + +Q  N RG         L  L+ L +
Sbjct: 234  LKRLCLRSNNIDNNDGRHLFNIGT-LEELAITDTMQLTNIRGI------SRLTNLKCLEL 286

Query: 1230 TACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQ 1051
             +   + D  +E +S  C  + +LC+ KC  ++D   +S + A   +E L L  CH    
Sbjct: 287  NSTN-IDDSCVEEIS-ACAKLSKLCISKCNNITDATPISQLAA---LEELNLSNCHITKG 341

Query: 1050 AGVFGILVHSAGKLKALAF------ENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGD 889
             G  G+L+    +L+ L        +NC  +KDL         C SL  L+I       D
Sbjct: 342  IGTLGMLL----RLRMLDLSGVPVEDNC--LKDLC-------DCGSLERLNISYRIQLTD 388

Query: 888  ASLVVLSRLCPNLVHLNLSGLNGVT-DYGLL------------------PFVQSCDAG-- 772
             +   LS     +  LNL+G   +T   G++                  P + S   G  
Sbjct: 389  IN--PLSN-ATAIEELNLNGCRRITRGIGVVWALPKLRVLHMKDVHLSEPSLDSVGTGGP 445

Query: 771  LVKVNLSGCINVTDKT-ISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI 595
            LVKV+L  C    D T +S+I      TLE LN+  C  +   S          LR L+I
Sbjct: 446  LVKVSLDNCAGFGDMTLLSSIV-----TLEELNIQKCADI--ISGVGCLGTLPYLRVLNI 498

Query: 594  SKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGN--SLAGLNIQNCV 421
             ++ +S      + G S     L + S++G        L  +  L N  +L  L++  C 
Sbjct: 499  KEAHISSLDFTGI-GASKSLLQLNMESITG--------LSNVEALANILTLEKLSLHGCT 549

Query: 420  GI 415
            GI
Sbjct: 550  GI 551



 Score = 38.5 bits (88), Expect = 0.35
 Identities = 74/320 (23%), Positives = 129/320 (40%), Gaps = 59/320 (18%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGI---------------EAVSKGCPNVKQLCLRKCTLLSDNGV-- 1120
            LRSL ++ C+ VTD+ +                 + KG  ++ +L L +  +LSD  +  
Sbjct: 1017 LRSLNLSHCKWVTDISVLSSLLTLEELNVNCCNGIRKGWESLGKLPLLRVAILSDTKITA 1076

Query: 1119 --VSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCF-GMKDL-AFGVP 952
              ++ + + + +  L+  +C ++S   V    V+    L+ L   +C  G+K L A G  
Sbjct: 1077 KDIACLSSCKKLVKLKFFQCEKLSDVTV----VYKIQSLEELIVTSCSDGLKGLNALGTL 1132

Query: 951  ALPPCNSLRSL--SICNCTGFGDASLVV---------LSRLCP--NLVHLNLSGL----- 826
                 + LR++  S  +    G +  +V         L+ + P  N+  L    L     
Sbjct: 1133 PRLRFHHLRNVRGSDISVESIGTSKSLVRLHIEVGEELTDITPLSNITSLEELSLRDYRK 1192

Query: 825  --NGVTDYGLLPFVQSCDAGLVKV-----------------NLSGCINVTDKTISAIAKL 703
               GV   G LP ++S D GL ++                 NL     +TD  IS I+ L
Sbjct: 1193 PPEGVGTLGKLPRLKSLDLGLSRISDSTLYCICLSRSITSLNLDSSWKLTD--ISHISNL 1250

Query: 702  HGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQ 523
                LE LNL GC  +T    A        + +L+ +++   D G         +  +L+
Sbjct: 1251 --TALEELNLGGCYYITSGWEALSELPRLRVLNLEFTRATTRDGGYYISRCKYLVTLNLE 1308

Query: 522  ILSLS-GCVLASDKCLPYLH 466
            +  ++    LA+ K L  LH
Sbjct: 1309 LCDMTDASCLANIKTLEELH 1328



 Score = 34.3 bits (77), Expect = 6.6
 Identities = 59/254 (23%), Positives = 104/254 (40%), Gaps = 3/254 (1%)
 Frame = -3

Query: 1392 LQSLNISDISLAVIGHYGVALTDLALINLQNI-NERGFW-VMGSGQGLHKLRSLVITACQ 1219
            L SLN+S+           +LT L  +N+ N  N    W V G+   LH+LR   ++  +
Sbjct: 802  LVSLNLSNCKKITSISAIASLTALEELNIDNCCNVTSGWNVFGT---LHQLRVATLSNTR 858

Query: 1218 GVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVF 1039
               D  +  VS+ C ++  L L  C  ++D   V+ +     +E L L+ CH I +    
Sbjct: 859  -TNDENVRHVSE-CKSLNTLNLAFCKDITD---VTALSKITMLEELNLDCCHNIRK---- 909

Query: 1038 GI-LVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRL 862
            GI  + +  K + L+ + C+     A     L    SL  L++    G      +     
Sbjct: 910  GIETLGTLPKARILSMKECYMGDGYAQQCSILGNSKSLVKLNLERSRGRISVKALSNVAT 969

Query: 861  CPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLEL 682
               LV  +   +  +  +  LP ++  +     +N     N+++           ++L  
Sbjct: 970  LEELVLDHARKVCCIPSFSCLPRLRVLNLKYTDINGDVTKNISES----------KSLRS 1019

Query: 681  LNLNGCGCVTDASL 640
            LNL+ C  VTD S+
Sbjct: 1020 LNLSHCKWVTDISV 1033



>gb:AP005709_1856455 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, PAC
            clone:P0646B04.>gb:AP005860_1859154 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 9, BAC
            clone:OJ1134_E08.
          Length = 530

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 77/317 (24%), Positives = 128/317 (40%), Gaps = 45/317 (14%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            LR L + + + VTD G+ A++    N+++L +  CT     G+ + +++   +E L ++ 
Sbjct: 143  LRRLKLRSIRLVTDDGVAALAAAATNLRKLSVGSCT-FGAKGIEAVLRSCLHLEELSIKR 201

Query: 1068 CHRISQA---------------------GVFGILVHSAGKLKALAFENCFG-----MKDL 967
               ++Q+                       F  L+ ++  LK L    C G     ++DL
Sbjct: 202  LRGLAQSEPVAVSSLCLHSLCLKELYNGQCFSSLITNSPNLKTLKIIRCSGDWDPVLQDL 261

Query: 966  A-----------------FGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN 838
                               GV AL   + L  L +       D  L  L+   P L  L+
Sbjct: 262  PQDAMLAELHLEKLQVSDRGVSAL---SGLEVLYLAKAPEVTDVGLGKLATRSPRLRKLH 318

Query: 837  LSG--LNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGC 664
            + G   N + D GL    Q C A L ++ L G +N+T  ++  IA  +   LE L L G 
Sbjct: 319  VDGWKANRIGDRGLAAVAQKC-AALQELVLIG-VNLTSASLELIA-ANCPALERLALCGS 375

Query: 663  GCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDK 484
                DA ++ +A  C+ LR L I    VSD G+  LA G      +++    G    + +
Sbjct: 376  DTFGDAEISCVATKCAALRKLCIKACPVSDAGMDKLAQGCPRLVKVKVKKCQG---VTPE 432

Query: 483  CLPYLHKLGNSLAGLNI 433
            C   L    N    +N+
Sbjct: 433  CAERLRASRNGALAVNV 449



 Score = 38.5 bits (88), Expect = 0.35
 Identities = 43/177 (24%), Positives = 79/177 (44%), Gaps = 4/177 (2%)
 Frame = -3

Query: 1332 LTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCL 1153
            L +L L  LQ +++RG         L  L  L +     VTD+G+  ++   P +++L +
Sbjct: 267  LAELHLEKLQ-VSDRGV------SALSGLEVLYLAKAPEVTDVGLGKLATRSPRLRKLHV 319

Query: 1152 R--KCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAF--ENC 985
               K   + D G+ +  +   +++ L L   +  S +    ++  +   L+ LA    + 
Sbjct: 320  DGWKANRIGDRGLAAVAQKCAALQELVLIGVNLTSAS--LELIAANCPALERLALCGSDT 377

Query: 984  FGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVT 814
            FG  +++        C +LR L I  C    DA +  L++ CP LV + +    GVT
Sbjct: 378  FGDAEISC---VATKCAALRKLCIKACP-VSDAGMDKLAQGCPRLVKVKVKKCQGVT 430



 Score = 36.2 bits (82), Expect = 1.7
 Identities = 25/88 (28%), Positives = 45/88 (51%)
 Frame = -3

Query: 1407 LMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVIT 1228
            L ++ L  +N++  SL +I     AL  LAL       +     + +      LR L I 
Sbjct: 342  LQELVLIGVNLTSASLELIAANCPALERLALCGSDTFGDAEISCVATKCAA--LRKLCIK 399

Query: 1227 ACQGVTDLGIEAVSKGCPNVKQLCLRKC 1144
            AC  V+D G++ +++GCP + ++ ++KC
Sbjct: 400  ACP-VSDAGMDKLAQGCPRLVKVKVKKC 426



>gb:TBH25N7_1399044 Trypanosoma brucei 221 VSG expression site BAC.
          Length = 1393

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 100/354 (28%), Positives = 153/354 (43%), Gaps = 22/354 (6%)
 Frame = -3

Query: 1386 SLNISDI-SLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQG-- 1216
            SLN+S    +  + H   +L  L  +NL N     F +    + + KL+ L +       
Sbjct: 535  SLNLSHCWKMTNVSHIS-SLEALNELNLSNC----FGINAGWEAIEKLQQLHVAILSNTH 589

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TD  I   S  C N+  L L  C  L D   V+ +    ++E L L+ C  I +    G
Sbjct: 590  ITDRDISHFSN-CKNLITLDLSFCNKLLD---VTALSNITTLEELNLDSCSNIRK----G 641

Query: 1035 ILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGD----ASLVVLS 868
            + V   G+L  L   N  G++     + +L   NS   LS+ NC GFGD    ++LV L 
Sbjct: 642  LSV--LGELPRLCVLNIKGVQLEDSVIVSLGNGNSFVRLSLENCKGFGDVAPLSNLVTLE 699

Query: 867  RLCPNLVHLNLSGLNGV---------------TDYGLLPFVQSCDAGLVKVNLSGCINVT 733
             L  +      SG+  +                D   L  + +C + LV +NLS C  +T
Sbjct: 700  ELNLHYCDKVTSGMGTLGRLLQLRVLDLGRTQVDDNSLENICTCSSPLVSLNLSNCKKIT 759

Query: 732  DKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALA 553
              +ISAIA L    LE LN++ C  VT  S   +      LR   +S +R +D  I  ++
Sbjct: 760  --SISAIASL--TALEELNIDNCCNVT--SGWNVFGTLHQLRVATLSNTRTNDENIRHVS 813

Query: 552  GGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
                   SL  L+L+ C   +D  +  L K+   L  LN+  C  I  +G++ L
Sbjct: 814  ECK----SLNTLNLAFCKDITD--VTALSKI-TMLEELNLDCCHNI-RKGIETL 859



 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 89/354 (25%), Positives = 166/354 (46%), Gaps = 25/354 (7%)
 Frame = -3

Query: 1398 VKLQSLNISDISLAVIGHYGVALTDLALINLQNIN-ERGFWVMGSGQGLHKLRSLVITAC 1222
            VKL  L++S+ +          L+ L  +NL N +  +G   +G    L +LR L ++  
Sbjct: 248  VKLSKLSVSECNNITDATPISQLSALEELNLSNCHITKGIGTLGM---LLRLRILDLSGV 304

Query: 1221 QGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV 1042
              V D  ++ +   C ++++L +     L+D   ++ +  A +IE L L  C RI++   
Sbjct: 305  P-VEDNCLKDLCD-CGSLERLNISYRIQLTD---INPLSNATAIEELNLNGCRRITRG-- 357

Query: 1041 FGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNS---LRSLSICNCTGFGDASLVVL 871
             G+ V +  KL+ L       MKD+    P+L    +   L  +S+ NC GFGD +L  L
Sbjct: 358  IGV-VWALPKLRVLH------MKDVHLSEPSLDSVGTGGPLVKVSLDNCAGFGDMTL--L 408

Query: 870  SRLCPNLVHLNLSG----LNGVTDYGLLPFVQ-----------------SCDAGLVKVNL 754
            S +   L  LN+      ++GV   G LP+++                      L+++N+
Sbjct: 409  SSIV-TLEELNIQKCADIISGVGCLGTLPYLRVLNIKEAHISSLDFTGIGASKSLLQLNM 467

Query: 753  SGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSD 574
                 +++  + A+A +   TLE L+L+GC  + DA +  + +    L+ LD+S +   +
Sbjct: 468  ESITGLSN--VEALANI--LTLEKLSLHGCTGI-DAGIGCLGN-LPQLKMLDLSGTNTDN 521

Query: 573  FGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGIS 412
              + +L     +  ++  L+LS C   ++  + ++  L  +L  LN+ NC GI+
Sbjct: 522  ESLRSL----CLSQTVVSLNLSHCWKMTN--VSHISSL-EALNELNLSNCFGIN 568



 Score = 37.0 bits (84), Expect = 1.0
 Identities = 78/322 (24%), Positives = 130/322 (40%), Gaps = 61/322 (18%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGI---------------EAVSKGCPNVKQLCLRKCTLLSDNGV-- 1120
            LRSL ++ C+ VTD+ +                 + KG  ++ +L L +  +LSD  +  
Sbjct: 962  LRSLNLSHCKWVTDISVLSSLLTLEELNVNCCNGIRKGWESLGKLPLLRVAILSDTKITA 1021

Query: 1119 --VSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCF-GMKDL-AFGVP 952
              ++ + + + +  L+   C ++S   V    V+    L+ L   +C  G+K L A G  
Sbjct: 1022 KDIACLSSCKKLVKLKFFRCKKLSDVTV----VYKIQSLEELIVTSCSDGLKGLNALGTL 1077

Query: 951  ALPPCNSLRSL--SICNCTGFGDASLVV---------LSRLCP--NLVHLNLSGL----- 826
                 + LR++  S  +    G +  +V         L+ + P  N+  L    L     
Sbjct: 1078 PRLRFHHLRNVRGSDISVESIGTSKSLVRLHIEVGEELTDITPLSNITSLEELSLRDYRK 1137

Query: 825  --NGVTDYGLLPFVQSCDAGLVKV-----------------NLSGCINVTDKTISAIAKL 703
               GV   G LP ++S D GL ++                 NL     +TD  IS I+ L
Sbjct: 1138 PPEGVGTLGKLPRLKSLDLGLSRISDSTLYCICLSRSITSLNLDSSWKLTD--ISHISNL 1195

Query: 702  HGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVS--DFGIAALAGGSAIQFS 529
                LE LNL GC  +T    A        LR L++  +RV+  D G         +  +
Sbjct: 1196 --TALEELNLGGCYYITSGWKA--LSELPRLRVLNLEFTRVTTRDGGYYISRCKYLVTLN 1251

Query: 528  LQILSLS-GCVLASDKCLPYLH 466
            L++  ++    LA+ K L  LH
Sbjct: 1252 LELCDMTDASCLANIKTLEELH 1273



 Score = 37.0 bits (84), Expect = 1.0
 Identities = 78/344 (22%), Positives = 129/344 (37%), Gaps = 45/344 (13%)
 Frame = -3

Query: 1311 NLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDL-GIEAVSKGCPNVKQLCLRKCTLL 1135
            N+ N + R  + +G+ + L    ++ +T  +G++ L  ++ +     N+   C+R+    
Sbjct: 188  NIDNNDARHLFNIGTLEELAITDTMQLTNIRGISRLTNLKCLELNSTNIDDSCVRR---- 243

Query: 1134 SDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLA--- 964
                    + A   +  L + EC+ I+ A      +     L+ L   NC   K +    
Sbjct: 244  --------ICACVKLSKLSVSECNNITDA----TPISQLSALEELNLSNCHITKGIGTLG 291

Query: 963  ----------FGVPA-------LPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL 835
                       GVP        L  C SL  L+I       D +   LS     +  LNL
Sbjct: 292  MLLRLRILDLSGVPVEDNCLKDLCDCGSLERLNISYRIQLTDIN--PLSN-ATAIEELNL 348

Query: 834  SGLNGVT-DYGLL------------------PFVQSCDAG--LVKVNLSGCINVTDKT-I 721
            +G   +T   G++                  P + S   G  LVKV+L  C    D T +
Sbjct: 349  NGCRRITRGIGVVWALPKLRVLHMKDVHLSEPSLDSVGTGGPLVKVSLDNCAGFGDMTLL 408

Query: 720  SAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSA 541
            S+I      TLE LN+  C  +   S          LR L+I ++ +S      + G S 
Sbjct: 409  SSIV-----TLEELNIQKCADI--ISGVGCLGTLPYLRVLNIKEAHISSLDFTGI-GASK 460

Query: 540  IQFSLQILSLSGCVLASDKCLPYLHKLGN--SLAGLNIQNCVGI 415
                L + S++G        L  +  L N  +L  L++  C GI
Sbjct: 461  SLLQLNMESITG--------LSNVEALANILTLEKLSLHGCTGI 496



 Score = 34.7 bits (78), Expect = 5.1
 Identities = 60/254 (23%), Positives = 104/254 (40%), Gaps = 3/254 (1%)
 Frame = -3

Query: 1392 LQSLNISDISLAVIGHYGVALTDLALINLQNI-NERGFW-VMGSGQGLHKLRSLVITACQ 1219
            L SLN+S+           +LT L  +N+ N  N    W V G+   LH+LR   ++  +
Sbjct: 747  LVSLNLSNCKKITSISAIASLTALEELNIDNCCNVTSGWNVFGT---LHQLRVATLSNTR 803

Query: 1218 GVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVF 1039
               D  I  VS+ C ++  L L  C  ++D   V+ +     +E L L+ CH I +    
Sbjct: 804  -TNDENIRHVSE-CKSLNTLNLAFCKDITD---VTALSKITMLEELNLDCCHNIRK---- 854

Query: 1038 GI-LVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRL 862
            GI  + +  K + L+ + C+     A     L    SL  L++    G      +     
Sbjct: 855  GIETLGTLPKARILSMKECYMGDGYAQQCSILGNSKSLVKLNLERSRGRISVKALSNVAT 914

Query: 861  CPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLEL 682
               LV  +   +  +  +  LP ++  +     +N     N+++           ++L  
Sbjct: 915  LEELVLDHARKVCCIPSFSCLPRLRVLNLKYTDINGDVTKNISES----------KSLRS 964

Query: 681  LNLNGCGCVTDASL 640
            LNL+ C  VTD S+
Sbjct: 965  LNLSHCKWVTDISV 978



>gb:TBBCHR1A3_1398818 Trypanosoma brucei DNA chromosome 1, segment
            3/4.
          Length = 713

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 87/294 (29%), Positives = 127/294 (43%), Gaps = 8/294 (2%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            L SL ++ C  +TDL  +A+ +GC +++ L L  C  L+D   ++ ++    +++L L  
Sbjct: 412  LVSLNLSGCLEMTDL--DAI-EGCMSLESLSLCDCRDLAD---ITSLRECRFLKTLDLSG 465

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGD 889
            C  +         +    +LK L    C G++DL+     L  C +L SL +  C     
Sbjct: 466  CSSLCDISA----LRECARLKTLVLSRCTGLRDLS----GLGECATLVSLDLSEC----- 512

Query: 888  ASLVVLSRL--CPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISA 715
             SLV +S L  C NLV L L G NG+ D   L   +S    L  ++LSG   + D T   
Sbjct: 513  HSLVDISALGGCVNLVALYLRGCNGLQDLNALKEWKS----LRMLDLSGFRKLEDVT--- 565

Query: 714  IAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK----SRVSDFGIAALAGG 547
             A   G     LNL+ C  + +A L      C  L  LD+S       V   G   LA  
Sbjct: 566  -ALRGGRNWLTLNLSNCENLKEAWLD--GHDCRDLLALDLSNCENLKEVWLDGCRQLAN- 621

Query: 546  SAIQFSLQILSLSGCVLASDKCLPYLHKLG--NSLAGLNIQNCVGISHRGVDLL 391
                     L+LS C     K + Y+H       L  LN+ NC  I +   DLL
Sbjct: 622  ---------LNLSNC-----KNMWYIHGQTECKGLVTLNLYNCGTIQNGIGDLL 661



 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 65/269 (24%), Positives = 111/269 (41%), Gaps = 27/269 (10%)
 Frame = -3

Query: 1224 CQGVTDLGIEAVSK--------GCPNVKQLCLRKCTL-----------LSDNGVVSFVKA 1102
            C  +TD+   A SK        GC N+ +  +  C L            +DN  +S +  
Sbjct: 278  CLEITDVKPLAKSKKLEVLTLEGCENIIRGLVDLCALPDVRQMNFSGTAADNACISKLGK 337

Query: 1101 AESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRS 922
            ++ + SL  E+C R++        +    K+K L F +  G  +++ GV  +     +R 
Sbjct: 338  SKKLVSLFCEQCPRVTN-------IRPLAKIKTLEFLSLSGSINISRGVGRICDNQWIRG 390

Query: 921  LSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCI 742
            L+  +     +  ++ L+  C  LV LNLSG   +TD   L  ++ C   L  ++L  C 
Sbjct: 391  LNFSD-VDVRETDVMALAD-CDYLVSLNLSGCLEMTD---LDAIEGC-MSLESLSLCDCR 444

Query: 741  NVTDKTISAIAKLHGETLELLNLNGCGCVTDASL--------AAIADYCSVLRDLDISKS 586
            ++ D T     +     L+ L+L+GC  + D S           +   C+ LRDL    S
Sbjct: 445  DLADITSLRECRF----LKTLDLSGCSSLCDISALRECARLKTLVLSRCTGLRDL----S 496

Query: 585  RVSDFGIAALAGGSAIQFSLQILSLSGCV 499
             + +         S     + I +L GCV
Sbjct: 497  GLGECATLVSLDLSECHSLVDISALGGCV 525



>gb:CR382125_1657482 Kluyveromyces lactis strain NRRL Y-1140
            chromosome E of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 1239

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 54/267 (20%), Positives = 116/267 (43%), Gaps = 2/267 (0%)
 Frame = -3

Query: 1182 GCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKA 1003
            GCPN+++L L  C  ++   V   +K  + ++S+ +   H I +  +F +L     +++ 
Sbjct: 547  GCPNLERLTLVFCKYITTKSVAKVLKGCQYLQSVDITGIHHI-RDDLFEVLASDCERIQG 605

Query: 1002 LAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLN 823
            L   +   +   A     +     L+ + I       +  ++ + + CP LV ++L+   
Sbjct: 606  LYVPHSNDVSPNAIS-NFITHAPMLKRVKITFNQSIENDLVMKMVKCCPFLVEVDLTSTP 664

Query: 822  GVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAK--LHGETLELLNLNGCGCVTD 649
             + ++GL+    S    L ++ ++   N+TD+ + A+++  +    L L++ +GC  +TD
Sbjct: 665  NIDNHGLVTLFTSLPQ-LREIRVTHNTNITDEFMLAVSQETMGLPALRLVDFSGCENITD 723

Query: 648  ASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYL 469
             ++  +      LR+L + K                            C   +D  L  L
Sbjct: 724  KTIDKLVTLAPKLRNLFLGK----------------------------CSRITDSALKSL 755

Query: 468  HKLGNSLAGLNIQNCVGISHRGVDLLV 388
             +LG ++  ++  +C  IS  GV +LV
Sbjct: 756  ARLGKNIQTMHFGHCFNISDEGVRVLV 782



 Score = 57.8 bits (138), Expect = 6e-07
 Identities = 50/205 (24%), Positives = 97/205 (47%), Gaps = 5/205 (2%)
 Frame = -3

Query: 1332 LTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSK---GCPNVKQ 1162
            L ++ L +  NI+  G   + +   L +LR + +T    +TD  + AVS+   G P ++ 
Sbjct: 655  LVEVDLTSTPNIDNHGLVTLFTS--LPQLREIRVTHNTNITDEFMLAVSQETMGLPALRL 712

Query: 1161 LCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCF 982
            +    C  ++D  +   V  A  + +L L +C RI+ + +   L      ++ + F +CF
Sbjct: 713  VDFSGCENITDKTIDKLVTLAPKLRNLFLGKCSRITDSALKS-LARLGKNIQTMHFGHCF 771

Query: 981  GMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGL 802
             + D    V  +  C  ++ +    CT   + +L  L+ L P L  + +   + +TD GL
Sbjct: 772  NISDEGVRV-LVSNCPKIQYIDFACCTNLTNKTLYELAEL-PKLKRIGMVKCSQITDEGL 829

Query: 801  LPF--VQSCDAGLVKVNLSGCINVT 733
            L    ++  +  L +V+LS C ++T
Sbjct: 830  LTMISIRGRNDTLERVHLSYCTSLT 854



 Score = 57.4 bits (137), Expect = 7e-07
 Identities = 36/161 (22%), Positives = 76/161 (47%), Gaps = 1/161 (0%)
 Frame = -3

Query: 1260 GLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESL 1081
            GL  LR +  + C+ +TD  I+ +    P ++ L L KC+ ++D+ + S  +  ++I+++
Sbjct: 706  GLPALRLVDFSGCENITDKTIDKLVTLAPKLRNLFLGKCSRITDSALKSLARLGKNIQTM 765

Query: 1080 QLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKD-LAFGVPALPPCNSLRSLSICNC 904
                C  IS  GV  +LV +  K++ + F  C  + +   + +  LP    +  +     
Sbjct: 766  HFGHCFNISDEGV-RVLVSNCPKIQYIDFACCTNLTNKTLYELAELPKLKRIGMVKCSQI 824

Query: 903  TGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSC 781
            T  G  +++ +      L  ++LS    +T Y +   + +C
Sbjct: 825  TDEGLLTMISIRGRNDTLERVHLSYCTSLTIYPIYELLMAC 865



 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 44/206 (21%), Positives = 97/206 (47%), Gaps = 3/206 (1%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            L+ + IT  Q + +  +  + K CP + ++ L     + ++G+V+   +   +  +++  
Sbjct: 629  LKRVKITFNQSIENDLVMKMVKCCPFLVEVDLTSTPNIDNHGLVTLFTSLPQLREIRVTH 688

Query: 1068 CHRISQAGVFGILVHSAG--KLKALAFENCFGMKDLAFG-VPALPPCNSLRSLSICNCTG 898
               I+   +  +   + G   L+ + F  C  + D     +  L P   LR+L +  C+ 
Sbjct: 689  NTNITDEFMLAVSQETMGLPALRLVDFSGCENITDKTIDKLVTLAP--KLRNLFLGKCSR 746

Query: 897  FGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTIS 718
              D++L  L+RL  N+  ++      ++D G+   V +C   +  ++ + C N+T+KT+ 
Sbjct: 747  ITDSALKSLARLGKNIQTMHFGHCFNISDEGVRVLVSNCPK-IQYIDFACCTNLTNKTLY 805

Query: 717  AIAKLHGETLELLNLNGCGCVTDASL 640
             +A+L    L+ + +  C  +TD  L
Sbjct: 806  ELAEL--PKLKRIGMVKCSQITDEGL 829



>gb:CR382122_1655008 Kluyveromyces lactis strain NRRL Y-1140
            chromosome B of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 1095

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 56/227 (24%), Positives = 100/227 (44%), Gaps = 2/227 (0%)
 Frame = -3

Query: 1176 PNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALA 997
            P +++   +  T  S N V+   K  + I    L  C  ++   ++ + +++  +L  L 
Sbjct: 865  PGMEEYSTQTSTKASHNDVIGCGKLHKMI----LRHCKNLTDLTLYHMSLYAKDRLTYLD 920

Query: 996  FENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGV 817
            F  C G+ D+ F   A     +L++L +  C    D S+  +   CPNL HL        
Sbjct: 921  FTRCSGLTDVGFSYWAYQSFPNLKTLIVSECIFLTDNSIRSIVNGCPNLSHL-------- 972

Query: 816  TDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCG-CVTDASL 640
                               NLS C ++TD  I  +  + G+ LE L+++ CG  V+D SL
Sbjct: 973  -------------------NLSFCCSLTDVAIELLC-VGGQNLEELDISFCGRAVSDISL 1012

Query: 639  AAIADYCSVLRDLDISKS-RVSDFGIAALAGGSAIQFSLQILSLSGC 502
              I+ +   L+++ +    R +  G+ +L GG A    L+ + +S C
Sbjct: 1013 LNISMHLRKLQNISLKGCLRATRSGVDSLLGGYA---PLKRIDVSQC 1056



 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 36/136 (26%), Positives = 65/136 (47%), Gaps = 4/136 (2%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGV-ALTDLALINLQNINERGF--WVMGSGQGLHKLRSLVITACQGVT 1210
            N++D++L  +  Y    LT L       + + GF  W     Q    L++L+++ C  +T
Sbjct: 899  NLTDLTLYHMSLYAKDRLTYLDFTRCSGLTDVGFSYWAY---QSFPNLKTLIVSECIFLT 955

Query: 1209 DLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHR-ISQAGVFGI 1033
            D  I ++  GCPN+  L L  C  L+D  +       +++E L +  C R +S   +  I
Sbjct: 956  DNSIRSIVNGCPNLSHLNLSFCCSLTDVAIELLCVGGQNLEELDISFCGRAVSDISLLNI 1015

Query: 1032 LVHSAGKLKALAFENC 985
             +H   KL+ ++ + C
Sbjct: 1016 SMH-LRKLQNISLKGC 1030



 Score = 34.3 bits (77), Expect = 6.6
 Identities = 48/237 (20%), Positives = 97/237 (40%), Gaps = 6/237 (2%)
 Frame = -3

Query: 1083 LQLEECHRISQAGVFGILVHS---AGKLKALAFENCFGMKDLAFGVPALPPCNSL-RSLS 916
            + +  C  ++  G F  +V+     G++K+L   +C+ +  ++    A+P    L   + 
Sbjct: 760  INVSNCFHVTDEG-FSYMVNEIGIGGQIKSLKMSSCWDISAMSIMDIAVPSIGKLLEEID 818

Query: 915  ICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINV 736
            + NC    D  +  L       V  N    N +     L  +     G+ + +       
Sbjct: 819  LSNCRKVRDDVIQRLIGWDVYQVGSNNEFFNDINKISSLYPLDEPIPGMEEYSTQTSTKA 878

Query: 735  TDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSV-LRDLDISK-SRVSDFGIA 562
            +   +    KLH      + L  C  +TD +L  ++ Y    L  LD ++ S ++D G +
Sbjct: 879  SHNDVIGCGKLHK-----MILRHCKNLTDLTLYHMSLYAKDRLTYLDFTRCSGLTDVGFS 933

Query: 561  ALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
              A  S    +L+ L +S C+  +D  +  +     +L+ LN+  C  ++   ++LL
Sbjct: 934  YWAYQSFP--NLKTLIVSECIFLTDNSIRSIVNGCPNLSHLNLSFCCSLTDVAIELL 988



>gb:BX908798_829890 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 616

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 64/235 (27%), Positives = 110/235 (46%), Gaps = 10/235 (4%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLA----LINLQNINERGFWVMGSGQGLHKLRSLV------IT 1228
            ++DI L  +  + +    LA    L+NL+++N  G     +  GL  L  LV      + 
Sbjct: 318  LTDIHLLALKSWELTDARLAHLAPLVNLRHLNLSGDMSNLTDAGLAHLTPLVNLQHLNLH 377

Query: 1227 ACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQA 1048
             C  +TD G+ A  +   N++ L L  C  L+D G+ + ++   +++ L L +C +++ A
Sbjct: 378  WCDKLTDDGL-AHLRSLVNLQHLNLHCCNKLTDAGL-AHLRPLVNLQHLNLSKCPKLTDA 435

Query: 1047 GVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLS 868
            G+  +       L+ L    C  +     G+  L P   L+ L++C C    D  L+ L+
Sbjct: 436  GLAHLT--PLVNLQHLDLSWC-PLNFTGAGLAYLAPLIDLQYLNLCCCNELTDIGLMHLT 492

Query: 867  RLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKL 703
             L  NL HL+LSG + +TD GL+         L  +NL  C N+T   +  +  L
Sbjct: 493  PLV-NLQHLDLSGCDNLTDAGLMHLTSL--VNLQHLNLRCCDNLTKTGLMHLTSL 544



 Score = 49.7 bits (117), Expect = 2e-04
 Identities = 49/134 (36%), Positives = 72/134 (53%), Gaps = 2/134 (1%)
 Frame = -3

Query: 891 DASLVVLSRLCPNLVHLNLSG-LNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISA 715
           DA L  L+ L  NL HLNLSG ++ +TD GL       +  L  +NL  C  +TD  ++ 
Sbjct: 333 DARLAHLAPLV-NLRHLNLSGDMSNLTDAGLAHLTPLVN--LQHLNLHWCDKLTDDGLAH 389

Query: 714 IAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAI 538
           +  L    L+ LNL+ C  +TDA LA +    + L+ L++SK  +++D G+A L      
Sbjct: 390 LRSL--VNLQHLNLHCCNKLTDAGLAHLRPLVN-LQHLNLSKCPKLTDAGLAHLTP---- 442

Query: 537 QFSLQILSLSGCVL 496
             +LQ L LS C L
Sbjct: 443 LVNLQHLDLSWCPL 456



 Score = 47.0 bits (110), Expect = 0.001
 Identities = 63/238 (26%), Positives = 105/238 (44%), Gaps = 7/238 (2%)
 Frame = -3

Query: 1332 LTDLALINLQNINERGFWVMGSGQGLH-----KLRSLVITA-CQGVTDLGIEAVSKGCPN 1171
            LTD+ L+ L++      W +   +  H      LR L ++     +TD G+  ++    N
Sbjct: 318  LTDIHLLALKS------WELTDARLAHLAPLVNLRHLNLSGDMSNLTDAGLAHLTP-LVN 370

Query: 1170 VKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFE 991
            ++ L L  C  L+D+G+ + +++  +++ L L  C++++ AG    L H           
Sbjct: 371  LQHLNLHWCDKLTDDGL-AHLRSLVNLQHLNLHCCNKLTDAG----LAH----------- 414

Query: 990  NCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLN-GVT 814
                          L P  +L+ L++  C    DA L  L+ L  NL HL+LS      T
Sbjct: 415  --------------LRPLVNLQHLNLSKCPKLTDAGLAHLTPLV-NLQHLDLSWCPLNFT 459

Query: 813  DYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL 640
              GL       D  L  +NL  C  +TD  +  +  L    L+ L+L+GC  +TDA L
Sbjct: 460  GAGLAYLAPLID--LQYLNLCCCNELTDIGLMHLTPL--VNLQHLDLSGCDNLTDAGL 513



>pir|B84547|B84547 hypothetical protein At2g17020 [imported] -
            Arabidopsis thaliana>gb:AC002354_1530563 Arabidopsis
            thaliana chromosome II section 98 of 255 of the complete
            sequence. Sequence from clones F12A24,
            F6P23.>gb:AY133615_1581438 Arabidopsis thaliana
            At2g17020/At2g17020 mRNA, complete
            cds.>gb:AF367303_1791755 Arabidopsis thaliana At2g17020
            mRNA, complete cds.
          Length = 656

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 76/314 (24%), Positives = 139/314 (44%), Gaps = 7/314 (2%)
 Frame = -3

Query: 1332 LTDLALINLQNINERGFWVMGSGQGLHKLRSLVI--TACQGVTDLGIEAVSKGCPNVKQL 1159
            ++DL    L  IN+ G       + L  +RS     T  + V+D G+  ++  C  ++ +
Sbjct: 277  VSDLTDFGLHEINQNG-----KLKHLSLIRSQEFHPTYFRRVSDQGMLFLADKCLGMETI 331

Query: 1158 CLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFG 979
            CL     ++D G  + + +  S+    +    +++   VF  ++ +   L  ++   C  
Sbjct: 332  CLGGFCRVTDAGFKTILHSCASLSKFSIYHGPKLTDL-VFHDILATTLSLSHVSLRRCHL 390

Query: 978  MKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLL 799
            + D A  +  L     L +L +  C    D +L  +S L P L  L L G + ++D GL 
Sbjct: 391  LTDHA--IQKLASSLKLENLDLRGCRNLRDETLTAVSHL-PKLKVLLLDGAD-ISDTGLS 446

Query: 798  PFVQSCDAGLVKVNLSGCINVTDKTISAI----AKLHGETLELLNLNGCGCVTDASLAAI 631
               +     LV +++ GC N+TDK +S +    +KL    L+L NL     +TDA++ A+
Sbjct: 447  YLKEGVLDSLVSLSVRGCRNLTDKFMSTLFDGSSKLALRELDLSNLPN---LTDAAIFAL 503

Query: 630  ADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGN 454
            A   + +  L + + R + D  + ALA     +               D+C       G+
Sbjct: 504  AKSGAPITKLQLRECRLIGDASVMALASTRVYE---------------DEC------PGS 542

Query: 453  SLAGLNIQNCVGIS 412
            SL  L++ +C GI+
Sbjct: 543  SLCLLDLYDCGGIT 556



 Score = 42.4 bits (98), Expect = 0.024
 Identities = 36/136 (26%), Positives = 66/136 (48%), Gaps = 12/136 (8%)
 Frame = -3

Query: 1422 SAGNHLMKVKLQSLNISDISLAVIGHY--GV--ALTDLALINLQNINERGFWVMGSGQGL 1255
            +A +HL K+K+  L+ +DIS   + +   GV  +L  L++   +N+ ++    +  G   
Sbjct: 422  TAVSHLPKLKVLLLDGADISDTGLSYLKEGVLDSLVSLSVRGCRNLTDKFMSTLFDGSSK 481

Query: 1254 HKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKA--------A 1099
              LR L ++    +TD  I A++K    + +L LR+C L+ D  V++             
Sbjct: 482  LALRELDLSNLPNLTDAAIFALAKSGAPITKLQLRECRLIGDASVMALASTRVYEDECPG 541

Query: 1098 ESIESLQLEECHRISQ 1051
             S+  L L +C  I+Q
Sbjct: 542  SSLCLLDLYDCGGITQ 557



 Score = 40.8 bits (94), Expect = 0.071
 Identities = 47/187 (25%), Positives = 79/187 (42%), Gaps = 10/187 (5%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLG 1201
            N+ D +L  + H  +    + L++  +I++ G   +  G  L  L SL +  C+ +TD  
Sbjct: 415  NLRDETLTAVSH--LPKLKVLLLDGADISDTGLSYLKEGV-LDSLVSLSVRGCRNLTDKF 471

Query: 1200 IEAVSKGCPNV--KQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILV 1027
            +  +  G   +  ++L L     L+D  + +  K+   I  LQL EC  I  A V  +  
Sbjct: 472  MSTLFDGSSKLALRELDLSNLPNLTDAAIFALAKSGAPITKLQLRECRLIGDASVMALAS 531

Query: 1026 H-------SAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLV-VL 871
                        L  L   +C G+  L+F     P    L+ L I   TG  +  +V  L
Sbjct: 532  TRVYEDECPGSSLCLLDLYDCGGITQLSFKWLKKPFFPRLKWLGI---TGSVNRDIVDAL 588

Query: 870  SRLCPNL 850
            +R  P+L
Sbjct: 589  ARRRPHL 595



>sp|Q9UF56|FX13_HUMAN F-box only protein 13 (Fragment).
          Length = 370

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 64/319 (20%), Positives = 123/319 (38%), Gaps = 31/319 (9%)
 Frame = -3

Query: 1245 RSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEEC 1066
            + L +++ Q VTD  +E ++    N+ ++ +  C  +SDNGV         +       C
Sbjct: 32   KQLDLSSRQQVTDELLEKIASRSQNIIEINISDCRSMSDNGVCVLAFKCPGLLRYTAYRC 91

Query: 1065 HRISQAGVFGILVH-------SAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICN 907
             ++S   +  +  H         G    L  E   G+K L         C  L+ +    
Sbjct: 92   KQLSDTSIIAVASHCPLLQKVHVGNQDKLTDE---GLKQLG------SKCRELKDIHFGQ 142

Query: 906  CTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDK 727
            C    D  ++V+++ C  L  + +     VTD  +  F + C   L  V   GC +VT K
Sbjct: 143  CYKISDEGMIVIAKGCLKLQRIYMQENKLVTDQSVKAFAEHCPE-LQYVGFMGC-SVTSK 200

Query: 726  TISAIAKLHG------------------------ETLELLNLNGCGCVTDASLAAIADYC 619
             +  + KL                          + L  LNL     + D  +  IA   
Sbjct: 201  GVIHLTKLRNLSSLDLRHITELDNETVMEIVKRCKNLSSLNLCLNWIINDRCVEVIAKEG 260

Query: 618  SVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGL 439
              L++L +   +++D+ + A+   S    +++ + +  C   +D+    + +   SL  L
Sbjct: 261  QNLKELYLVSCKITDYALIAIGRYS---MTIETVDVGWCKEITDQGATLIAQSSKSLRYL 317

Query: 438  NIQNCVGISHRGVDLLVER 382
             +  C  ++   V+ LV++
Sbjct: 318  GLMRCDKVNEVTVEQLVQQ 336



 Score = 46.2 bits (108), Expect = 0.002
 Identities = 58/276 (21%), Positives = 111/276 (40%), Gaps = 6/276 (2%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGI 1198
            ++D  L  +G     L D+       I++ G  V+   +G  KL+ + +   + VTD  +
Sbjct: 120  LTDEGLKQLGSKCRELKDIHFGQCYKISDEGMIVIA--KGCLKLQRIYMQENKLVTDQSV 177

Query: 1197 EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSA 1018
            +A ++ CP ++ +    C++ S  GV+   K   ++ SL L     +    V  I+    
Sbjct: 178  KAFAEHCPELQYVGFMGCSVTS-KGVIHLTK-LRNLSSLDLRHITELDNETVMEIVKR-- 233

Query: 1017 GKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN 838
                                      C +L SL++C      D  + V+++   NL  L 
Sbjct: 234  --------------------------CKNLSSLNLCLNWIINDRCVEVIAKEGQNLKELY 267

Query: 837  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGC 658
            L     +TDY L+  +      +  V++  C  +TD+  + IA+   ++L  L L  C  
Sbjct: 268  LVSCK-ITDYALIA-IGRYSMTIETVDVGWCKEITDQGATLIAQ-SSKSLRYLGLMRCDK 324

Query: 657  VTDASLAAIAD------YCSVLRDLDISKSRVSDFG 568
            V + ++  +        + +VL+D   +  R    G
Sbjct: 325  VNEVTVEQLVQQYPHITFSTVLQDCKRTLERAYQMG 360



>gb:AF176529_2057845 Mus musculus F-box protein FBX13 mRNA, partial
            cds.
          Length = 435

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 64/319 (20%), Positives = 123/319 (38%), Gaps = 31/319 (9%)
 Frame = -3

Query: 1245 RSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEEC 1066
            + L +++ Q VTD  +E ++    N+ ++ +  C  LSD+GV         +       C
Sbjct: 124  KQLDLSSRQQVTDELLEKIASRSQNIIEINISDCRSLSDSGVCVLAFKCPGLLRYTAYRC 183

Query: 1065 HRISQAGVFGILVH-------SAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICN 907
             ++S   +  +  H         G    L  E   G+K L         C  L+ +    
Sbjct: 184  KQLSDTSIIAVASHCPLLQKVHVGNQDKLTDE---GLKQLG------SRCRELKDIHFGQ 234

Query: 906  CTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDK 727
            C    D  ++V+++ C  L  + +     VTD  +  F + C   L  V   GC +VT K
Sbjct: 235  CYKISDEGMIVIAKSCLKLQRIYMQENKLVTDQSVKAFAEHCPE-LQYVGFMGC-SVTSK 292

Query: 726  TISAIAKLHG------------------------ETLELLNLNGCGCVTDASLAAIADYC 619
             +  + KL                          + L  LNL     + D  +  IA   
Sbjct: 293  GVIHLTKLRNLSSLDLRHITELDNETVMEIVKRCKNLSSLNLCLNWIINDRCVEVIAKEG 352

Query: 618  SVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGL 439
              L++L +   +++D+ + A+   S    +++ + +  C   +D+    + +   SL  L
Sbjct: 353  QNLKELYLVSCKITDYALIAIGRYSV---TIETVDVGWCKEITDQGATLIAQSSKSLRYL 409

Query: 438  NIQNCVGISHRGVDLLVER 382
             +  C  ++   V+ LV++
Sbjct: 410  GLMRCDKVNELTVEQLVQQ 428



 Score = 42.4 bits (98), Expect = 0.024
 Identities = 52/246 (21%), Positives = 100/246 (40%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGI 1198
            ++D  L  +G     L D+       I++ G  V+   +   KL+ + +   + VTD  +
Sbjct: 212  LTDEGLKQLGSRCRELKDIHFGQCYKISDEGMIVIA--KSCLKLQRIYMQENKLVTDQSV 269

Query: 1197 EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSA 1018
            +A ++ CP ++ +    C++ S  GV+   K   ++ SL L     +    V  I+    
Sbjct: 270  KAFAEHCPELQYVGFMGCSVTS-KGVIHLTK-LRNLSSLDLRHITELDNETVMEIVKR-- 325

Query: 1017 GKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN 838
                                      C +L SL++C      D  + V+++   NL  L 
Sbjct: 326  --------------------------CKNLSSLNLCLNWIINDRCVEVIAKEGQNLKELY 359

Query: 837  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGC 658
            L     +TDY L+  +      +  V++  C  +TD+  + IA+   ++L  L L  C  
Sbjct: 360  LVSCK-ITDYALIA-IGRYSVTIETVDVGWCKEITDQGATLIAQ-SSKSLRYLGLMRCDK 416

Query: 657  VTDASL 640
            V + ++
Sbjct: 417  VNELTV 422



>gb:AY220479_1590513 Nicotiana tabacum Avr9/Cf-9 rapidly elicited
            protein 189 (ACRE189) mRNA, complete cds.
          Length = 550

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 83/351 (23%), Positives = 137/351 (39%), Gaps = 53/351 (15%)
 Frame = -3

Query: 1440 IASLFSSAGNHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQ 1261
            I S F S     ++   +S++I+D +L +I         L  +NL  +  RG        
Sbjct: 116  IFSRFDSGTKLALRCDRKSVSINDEALTLIS--------LRCVNLTRLKLRG-------- 159

Query: 1260 GLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQL--------------CLRKCTLLSDNG 1123
                        C+ VTD+G+ A +K C ++K+                L  C+ L +  
Sbjct: 160  ------------CRDVTDVGMSAFAKNCKSLKKFSCGSCMFGAKGMNALLDHCSTLEELS 207

Query: 1122 V--------------VSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENC 985
            V              +    AA S++S+ L+E +       F  L+  +  L+ L    C
Sbjct: 208  VKRLRGINDGFAADPIGPGAAASSLKSICLKELY---NGQCFEPLIIGSKNLRTLKLLRC 264

Query: 984  FGMKDLAF-----------------------GVPALPPCNSLRSLSICNCTGFGDASLVV 874
             G  D  F                       G+ A+  C +L  L +       DA +V 
Sbjct: 265  LGDWDRLFETIGSRENHVAEIHLERLQVSDTGLNAISNCPNLEILHLVKTPECTDAGVVA 324

Query: 873  LSRLCPNLVHLNLSG--LNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLH 700
            ++R C  L  L++ G   N + D GL+   ++    L ++ L G +N T  ++ AIA  +
Sbjct: 325  VARKCKLLRKLHIDGWRTNRIGDEGLVAIAEN-SLNLKELVLIG-LNPTSPSLLAIAS-N 381

Query: 699  GETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGG 547
             + LE L L G   + D  ++ IA  C  L+ L I    V+D G  + A G
Sbjct: 382  CQKLERLALCGSDTIGDPEVSCIATKCMALKKLCIKGCEVTDEGFESFAWG 432



 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 64/240 (26%), Positives = 108/240 (45%), Gaps = 4/240 (1%)
 Frame = -3

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            + D  +  +S  C N+ +L LR C  ++D G+ +F K  +S++      C      G+  
Sbjct: 137  INDEALTLISLRCVNLTRLKLRGCRDVTDVGMSAFAKNCKSLKKFSCGSC-MFGAKGMNA 195

Query: 1035 ILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSL-SICNCTGFGDASLVVLSRLC 859
            +L H    L+ L+ +   G+ D  F    + P  +  SL SIC    +       L    
Sbjct: 196  LLDH-CSTLEELSVKRLRGIND-GFAADPIGPGAAASSLKSICLKELYNGQCFEPLIIGS 253

Query: 858  PNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELL 679
             NL  L L    G  D  L   + S +  + +++L   + V+D  ++AI+      LE+L
Sbjct: 254  KNLRTLKLLRCLGDWD-RLFETIGSRENHVAEIHLER-LQVSDTGLNAISNC--PNLEIL 309

Query: 678  NLNGCGCVTDASLAAIADYCSVLRDLDIS---KSRVSDFGIAALAGGSAIQFSLQILSLS 508
            +L      TDA + A+A  C +LR L I     +R+ D G+ A+A  S     L ++ L+
Sbjct: 310  HLVKTPECTDAGVVAVARKCKLLRKLHIDGWRTNRIGDEGLVAIAENSLNLKELVLIGLN 369



 Score = 34.7 bits (78), Expect = 5.1
 Identities = 27/89 (30%), Positives = 43/89 (48%)
 Frame = -3

Query: 1410 HLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVI 1231
            +L ++ L  LN +  SL  I      L  LAL     I +     + +      L+ L I
Sbjct: 359  NLKELVLIGLNPTSPSLLAIASNCQKLERLALCGSDTIGDPEVSCIATK--CMALKKLCI 416

Query: 1230 TACQGVTDLGIEAVSKGCPNVKQLCLRKC 1144
              C+ VTD G E+ + GCPN+ ++ ++KC
Sbjct: 417  KGCE-VTDEGFESFAWGCPNLVKIKVKKC 444



>sp|Q9QZN1|FX13_MOUSE F-box only protein 13 (Fragment).
          Length = 462

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 64/319 (20%), Positives = 123/319 (38%), Gaps = 31/319 (9%)
 Frame = -3

Query: 1245 RSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEEC 1066
            + L +++ Q VTD  +E ++    N+ ++ +  C  LSD+GV         +       C
Sbjct: 124  KQLDLSSRQQVTDELLEKIASRSQNIIEINISDCRSLSDSGVCVLAFKCPGLLRYTAYRC 183

Query: 1065 HRISQAGVFGILVH-------SAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICN 907
             ++S   +  +  H         G    L  E   G+K L         C  L+ +    
Sbjct: 184  KQLSDTSIIAVASHCPLLQKVHVGNQDKLTDE---GLKQLG------SRCRELKDIHFGQ 234

Query: 906  CTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDK 727
            C    D  ++V+++ C  L  + +     VTD  +  F + C   L  V   GC +VT K
Sbjct: 235  CYKISDEGMIVIAKSCLKLQRIYMQENKLVTDQSVKAFAEHCPE-LQYVGFMGC-SVTSK 292

Query: 726  TISAIAKLHG------------------------ETLELLNLNGCGCVTDASLAAIADYC 619
             +  + KL                          + L  LNL     + D  +  IA   
Sbjct: 293  GVIHLTKLRNLSSLDLRHITELDNETVMEIVKRCKNLSSLNLCLNWIINDRCVEVIAKEG 352

Query: 618  SVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGL 439
              L++L +   +++D+ + A+   S    +++ + +  C   +D+    + +   SL  L
Sbjct: 353  QNLKELYLVSCKITDYALIAIGRYSV---TIETVDVGWCKEITDQGATLIAQSSKSLRYL 409

Query: 438  NIQNCVGISHRGVDLLVER 382
             +  C  ++   V+ LV++
Sbjct: 410  GLMRCDKVNELTVEQLVQQ 428



 Score = 43.9 bits (102), Expect = 0.008
 Identities = 57/276 (20%), Positives = 110/276 (39%), Gaps = 6/276 (2%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGI 1198
            ++D  L  +G     L D+       I++ G  V+   +   KL+ + +   + VTD  +
Sbjct: 212  LTDEGLKQLGSRCRELKDIHFGQCYKISDEGMIVIA--KSCLKLQRIYMQENKLVTDQSV 269

Query: 1197 EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSA 1018
            +A ++ CP ++ +    C++ S  GV+   K   ++ SL L     +    V  I+    
Sbjct: 270  KAFAEHCPELQYVGFMGCSVTS-KGVIHLTK-LRNLSSLDLRHITELDNETVMEIVKR-- 325

Query: 1017 GKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN 838
                                      C +L SL++C      D  + V+++   NL  L 
Sbjct: 326  --------------------------CKNLSSLNLCLNWIINDRCVEVIAKEGQNLKELY 359

Query: 837  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGC 658
            L     +TDY L+  +      +  V++  C  +TD+  + IA+   ++L  L L  C  
Sbjct: 360  LVSCK-ITDYALIA-IGRYSVTIETVDVGWCKEITDQGATLIAQ-SSKSLRYLGLMRCDK 416

Query: 657  VTDASLAAIAD------YCSVLRDLDISKSRVSDFG 568
            V + ++  +        + +VL+D   +  R    G
Sbjct: 417  VNELTVEQLVQQYPHITFSTVLQDCKRTLERAYQMG 452



>gb:TBN19B2_1399113 Trypanosoma brucei VO2 VSG expression site BAC.
          Length = 1394

 Score = 61.2 bits (147), Expect = 5e-08
 Identities = 101/356 (28%), Positives = 154/356 (43%), Gaps = 24/356 (6%)
 Frame = -3

Query: 1386 SLNISDI-SLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQG-- 1216
            SLN+S    +  + H   +L  L  +NL N     F +    + + KL+ L +       
Sbjct: 536  SLNLSHCWKMTNVSHIS-SLEALNELNLSNC----FGINAGWEAIEKLQQLHVAILPNTH 590

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TD  I   S  C N+  L L  C  L D   V+ +    ++E L L+ C  I +    G
Sbjct: 591  ITDRDISHFSN-CKNLVTLDLSFCNKLLD---VTTLSNITTLEDLNLDNCSNIRK----G 642

Query: 1035 ILVHSAGKLKALAFENCFG--MKDLAFGVPALPPCNSLRSLSICNCTGFGD----ASLVV 874
            + V   G+L  L   N  G  +KD   G  +L   NS   LS+ NC GFGD    ++LV 
Sbjct: 643  LSV--LGELPRLCVLNIKGVHLKDSVIG--SLGNGNSFVKLSLENCKGFGDVKPLSNLVT 698

Query: 873  LSRLCPNLVHLNLSGLNGV---------------TDYGLLPFVQSCDAGLVKVNLSGCIN 739
            L  L  +      SG+  +                D   L  + +  + LV +NLS C  
Sbjct: 699  LEELNLHYCDKVTSGMGTLGRLLQLRVLDLGRTQVDNNSLENICTSSSPLVSLNLSHCKK 758

Query: 738  VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAA 559
            +T  +ISAIA L    LE LN++ C  VT  S   +      LR   +S +R++D  +  
Sbjct: 759  IT--SISAIASL--TALEELNIDNCCNVT--SGWNVFGTLHQLRVATLSNTRINDENVRH 812

Query: 558  LAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
            ++       SL  L+L+ C   +D  +  L K+   L  LN+  C  I  +G++ L
Sbjct: 813  VSECK----SLNTLNLAFCKDITD--VTALSKI-TMLEELNLDCCPNI-RKGIETL 860



 Score = 53.5 bits (127), Expect = 1e-05
 Identities = 71/280 (25%), Positives = 132/280 (47%), Gaps = 24/280 (8%)
 Frame = -3

Query: 1179 CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL 1000
            C ++++L +  C  L D   ++ +  A + E L L  C RI++    G+ V +  KL+ L
Sbjct: 318  CGSLERLNISYCIQLKD---INPLSNATATEELNLNGCRRITRG--IGV-VWALPKLRVL 371

Query: 999  AFENCFGMKDLAFGVPALPPCNS---LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSG 829
                   MKD+    P+L    +   L  +S+ NC GFGD +L  LS +   L  LN+  
Sbjct: 372  H------MKDVHLSEPSLDSVGTGGPLVKVSLDNCAGFGDMTL--LSSIV-TLEELNIQK 422

Query: 828  ----LNGVTDYGLLPFVQ-----------------SCDAGLVKVNLSGCINVTDKTISAI 712
                ++GV   G LP+++                      L+++N+     +++  + A+
Sbjct: 423  CADIISGVGCLGTLPYLRVLNIKEAHISSLDFTGIGASKSLLQLNMESITGLSN--VEAL 480

Query: 711  AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQF 532
            A +   TLE L+L+GC  + DA +  + +    L+ LD+S +   +  + +L     +  
Sbjct: 481  ANI--LTLEKLSLHGCTDI-DAGIGCLGN-LPQLKMLDLSGTNTDNESLRSL----CLSQ 532

Query: 531  SLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGIS 412
            ++  L+LS C   ++  + ++  L  +L  LN+ NC GI+
Sbjct: 533  TMVSLNLSHCWKMTN--VSHISSL-EALNELNLSNCFGIN 569



 Score = 44.3 bits (103), Expect = 0.006
 Identities = 76/323 (23%), Positives = 134/323 (41%), Gaps = 3/323 (0%)
 Frame = -3

Query: 1395 KLQSLNISDISL--AVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITAC 1222
            +L  LNI  + L  +VIG  G      + + L   N +GF  +     L  L  L +  C
Sbjct: 651  RLCVLNIKGVHLKDSVIGSLG---NGNSFVKLSLENCKGFGDVKPLSNLVTLEELNLHYC 707

Query: 1221 QGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV 1042
              VT  G+  + +    ++ L L + T + +N + +   ++  + SL L  C +I+    
Sbjct: 708  DKVTS-GMGTLGR-LLQLRVLDLGR-TQVDNNSLENICTSSSPLVSLNLSHCKKITSISA 764

Query: 1041 FGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRL 862
               L      L+ L  +NC  +     G       + LR  ++ N T   D ++  +S  
Sbjct: 765  IASLT----ALEELNIDNCCNVTS---GWNVFGTLHQLRVATLSN-TRINDENVRHVSE- 815

Query: 861  CPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLEL 682
            C +L  LNL+    +TD   L  +      L ++NL  C N+  K I  +  L      +
Sbjct: 816  CKSLNTLNLAFCKDITDVTALSKITM----LEELNLDCCPNIR-KGIETLGTL--PKARI 868

Query: 681  LNLNGCGCV-TDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSG 505
            L++  C    +DA   +I      L  L++ +SR     + AL+  + ++  +   +   
Sbjct: 869  LSMKECQIGDSDAQQCSILGNSKSLVKLNLERSR-GRISVKALSNIATLEELVLDHAQEV 927

Query: 504  CVLASDKCLPYLHKLGNSLAGLN 436
            C + S  CLP+L  L      +N
Sbjct: 928  CCIPSFSCLPHLRVLNVKYTDIN 950



 Score = 40.0 bits (92), Expect = 0.12
 Identities = 52/163 (31%), Positives = 80/163 (49%), Gaps = 2/163 (1%)
 Frame = -3

Query: 873 LSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGE 694
           +SRL  NL+ L+L+  N   D   +  + +C   L K+++S C N+TD T   I++L  E
Sbjct: 220 ISRLT-NLMCLDLNSTN--IDDSCVRRICAC-VKLSKLSVSECNNITDAT--PISQL--E 271

Query: 693 TLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILS 514
            LE LNLN C  +T             LR LD+S   V D  +  L        SL+ L+
Sbjct: 272 ALEELNLNSCYHITKG--IGTLGMLLRLRILDLSGVPVEDNCLKGLCDCG----SLERLN 325

Query: 513 LSGCVLASDKCLPYLHKLGNSLA--GLNIQNCVGISHRGVDLL 391
           +S C+   D     ++ L N+ A   LN+  C  I+ RG+ ++
Sbjct: 326 ISYCIQLKD-----INPLSNATATEELNLNGCRRIT-RGIGVV 362



 Score = 35.8 bits (81), Expect = 2.3
 Identities = 89/380 (23%), Positives = 141/380 (37%), Gaps = 67/380 (17%)
 Frame = -3

Query: 1311 NLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLS 1132
            N+ N + R  + +G+ + L    ++ +T  +G++ L              +CL   +   
Sbjct: 188  NIDNNDARHLFNIGTLEKLAITDTMQLTNIRGISRL-----------TNLMCLDLNSTNI 236

Query: 1131 DNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCF----GMKDLA 964
            D+  V  + A   +  L + EC+ I+ A      +     L+ L   +C+    G+  L 
Sbjct: 237  DDSCVRRICACVKLSKLSVSECNNITDA----TPISQLEALEELNLNSCYHITKGIGTLG 292

Query: 963  F----------GVP-------ALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL 835
                       GVP        L  C SL  L+I  C    D +   LS        LNL
Sbjct: 293  MLLRLRILDLSGVPVEDNCLKGLCDCGSLERLNISYCIQLKDIN--PLSNATAT-EELNL 349

Query: 834  SGLNGVT-DYGLL------------------PFVQSCDAG--LVKVNLSGCINVTDKT-I 721
            +G   +T   G++                  P + S   G  LVKV+L  C    D T +
Sbjct: 350  NGCRRITRGIGVVWALPKLRVLHMKDVHLSEPSLDSVGTGGPLVKVSLDNCAGFGDMTLL 409

Query: 720  SAIAKLHGETLELLNLNGCG-CVTDASLAAIADYCSVLRDLDISKSRVSDFGIAA----- 559
            S+I      TLE LN+  C   ++         Y  VL   +   S +   GI A     
Sbjct: 410  SSIV-----TLEELNIQKCADIISGVGCLGTLPYLRVLNIKEAHISSLDFTGIGASKSLL 464

Query: 558  ------LAGGSAIQ-----FSLQILSLSGC--VLASDKCLPYLHKLGN-SLAGLNIQN-- 427
                  + G S ++      +L+ LSL GC  + A   CL  L +L    L+G N  N  
Sbjct: 465  QLNMESITGLSNVEALANILTLEKLSLHGCTDIDAGIGCLGNLPQLKMLDLSGTNTDNES 524

Query: 426  --CVGISHRGVDLLVERLWR 373
               + +S   V L +   W+
Sbjct: 525  LRSLCLSQTMVSLNLSHCWK 544



>gb:CR382134_1667309 Debaryomyces hansenii chromosome B of strain
            CBS767 of Debaryomyces hansenii.
          Length = 919

 Score = 60.8 bits (146), Expect = 7e-08
 Identities = 64/221 (28%), Positives = 97/221 (43%), Gaps = 2/221 (0%)
 Frame = -3

Query: 1395 KLQSLNISDISLAVIGHYGVALTDLALINL-QNINERGFWVMGSGQGLHKLRSLVITACQ 1219
            K+  +   ++ +  +G Y   LTD  + ++ QN N R             L SL +T C 
Sbjct: 704  KMSDVGCKNLKIIDVG-YCKHLTDKIMYHISQNANTR-------------LESLNLTRCT 749

Query: 1218 GVTDLGIEAVSK-GCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV 1042
             +TD G E  +K   PN+K+L L+ CT L+D  ++S   +A ++E L L+ C  +S   +
Sbjct: 750  TITDQGFEHWNKRSFPNLKKLSLKDCTFLTDKSIISIANSANNLEILDLKFCCALSDVSI 809

Query: 1041 FGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRL 862
              +L     KLK L         DL+F       C S  S          D SLV +S  
Sbjct: 810  -DMLCLGCPKLKHL---------DLSF-------CGSAVS----------DFSLVAISLH 842

Query: 861  CPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCIN 739
               L  + L G   VT  G+   +  C + L  +N+S C N
Sbjct: 843  LRFLERIILKGCIRVTRSGIDSLLSGC-SPLNYLNISQCKN 882



 Score = 57.8 bits (138), Expect = 6e-07
 Identities = 70/283 (24%), Positives = 116/283 (40%), Gaps = 12/283 (4%)
 Frame = -3

Query: 1395 KLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQG 1216
            ++  + I D+SL+++G +      L  I+L N                K+R  V+    G
Sbjct: 647  EISGMAIMDLSLSIVGRH------LEKIDLANCR--------------KVRDDVLERLTG 686

Query: 1215 -------VTDLGIEAVSK----GCPNVKQLCLRKCTLLSDNGVVSFVKAAES-IESLQLE 1072
                    T+ G++   K    GC N+K + +  C  L+D  +    + A + +ESL L 
Sbjct: 687  WNPSEINQTNNGLKEDDKMSDVGCKNLKIIDVGYCKHLTDKIMYHISQNANTRLESLNLT 746

Query: 1071 ECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG 892
             C  I+  G       S   LK L+ ++C  + D +  +      N+L  L +  C    
Sbjct: 747  RCTTITDQGFEHWNKRSFPNLKKLSLKDCTFLTDKSI-ISIANSANNLEILDLKFCCALS 805

Query: 891  DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI 712
            D S+ +L   CP L HL+LS                               V+D ++ AI
Sbjct: 806  DVSIDMLCLGCPKLKHLDLSFCGSA--------------------------VSDFSLVAI 839

Query: 711  AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR 583
            + LH   LE + L GC  VT + + ++   CS L  L+IS+ +
Sbjct: 840  S-LHLRFLERIILKGCIRVTRSGIDSLLSGCSPLNYLNISQCK 881



 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 65/263 (24%), Positives = 116/263 (44%), Gaps = 7/263 (2%)
 Frame = -3

Query: 1155 LRKCTLLSDNG---VVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK-LKALAFEN 988
            +  C  ++D G   +V+ +  +  I+ L++E    IS   +  + +   G+ L+ +   N
Sbjct: 613  ISNCFHVTDEGFTYMVNEIGISGEIKDLKMESNWEISGMAIMDLSLSIVGRHLEKIDLAN 672

Query: 987  CFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRL-CPNLVHLNLSGLNGVTD 811
            C  ++D    +  L   N     S  N T  G      +S + C NL  +++     +TD
Sbjct: 673  CRKVRDDV--LERLTGWNP----SEINQTNNGLKEDDKMSDVGCKNLKIIDVGYCKHLTD 726

Query: 810  YGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI 631
              +    Q+ +  L  +NL+ C  +TD+      K     L+ L+L  C  +TD S+ +I
Sbjct: 727  KIMYHISQNANTRLESLNLTRCTTITDQGFEHWNKRSFPNLKKLSLKDCTFLTDKSIISI 786

Query: 630  ADYCSVLRDLDIS-KSRVSDFGIAALAGGSAIQFSLQILSLSGCVLA-SDKCLPYLHKLG 457
            A+  + L  LD+     +SD  I  L  G      L+ L LS C  A SD  L  +    
Sbjct: 787  ANSANNLEILDLKFCCALSDVSIDMLCLGCP---KLKHLDLSFCGSAVSDFSLVAISLHL 843

Query: 456  NSLAGLNIQNCVGISHRGVDLLV 388
              L  + ++ C+ ++  G+D L+
Sbjct: 844  RFLERIILKGCIRVTRSGIDSLL 866



>gb:AY142631_1583047 Arabidopsis thaliana unknown protein
           (At1g15740) mRNA, complete cds.
          Length = 585

 Score = 60.8 bits (146), Expect = 7e-08
 Identities = 55/179 (30%), Positives = 82/179 (45%)
 Frame = -3

Query: 960 GVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSC 781
           G+ +L  C +L SL+   C    +  LV LS L  NL  L+      +T  G+     S 
Sbjct: 154 GLVSLKGCTNLESLNFNFCDQISNRGLVHLSGLS-NLTSLSFRRNAAITAQGMRAL--SN 210

Query: 780 DAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDL 601
              L K++L  C  +    +   A      LE LN+  C C+TDA +  ++   + LR L
Sbjct: 211 LVNLKKLDLEKCPGIDGGLVHLRALTK---LESLNIKWCNCITDADMEPLS-VLTNLRSL 266

Query: 600 DISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC 424
            I  S+++D GI+ L G +     L +L+L GC   +  CL  L  L   L  LN+  C
Sbjct: 267 QICCSKITDIGISYLKGLN----KLNLLNLEGCRHVTAACLDTLTALA-GLMYLNLNRC 320



 Score = 43.5 bits (101), Expect = 0.011
 Identities = 93/373 (24%), Positives = 135/373 (36%), Gaps = 90/373 (24%)
 Frame = -3

Query: 1335 ALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVS---------- 1186
            ALT L  +N++  N      M     L  LRSL I  C  +TD+GI  +           
Sbjct: 234  ALTKLESLNIKWCNCITDADMEPLSVLTNLRSLQI-CCSKITDIGISYLKGLNKLNLLNL 292

Query: 1185 KGCPNVKQLCLRKCTLL-------------SDNGVVSF---------------------- 1111
            +GC +V   CL   T L             SD+G   F                      
Sbjct: 293  EGCRHVTAACLDTLTALAGLMYLNLNRCNFSDSGCEKFSDLINLKILNLGMNNITNSCLV 352

Query: 1110 -VKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFE------------NCFGMKD 970
             +K    +ESL L+ C RI   G    LVH +G L+  + E            +  G+ +
Sbjct: 353  HLKGLTKLESLNLDSC-RIGDEG----LVHLSGMLELKSLELSDTEVGSNGLRHLSGLSN 407

Query: 969  LAF-----------GVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL---- 835
            L             G+  L    SLR+L++ +     DA L  L+ L   L HL+L    
Sbjct: 408  LESINLSFTVVTDSGLRKLSGLTSLRTLNL-DARHVTDAGLSALTSLT-GLTHLDLFGAR 465

Query: 834  ---SGLNGVTDYGLLPFVQSCDAGLVK--------------VNLSGCINVTDKTISAIAK 706
               SG N + +   L  ++ C  GL                +NLS   N+TDKT+  I+ 
Sbjct: 466  ITDSGTNHLRNLKKLQSLEICGGGLTDTGVKNIKDLSSLTLLNLSQNSNLTDKTLELISG 525

Query: 705  LHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSL 526
            L G                            L  L++S SRVS  G+  L        +L
Sbjct: 526  LTG----------------------------LVSLNVSNSRVSSSGLRHLKPLK----NL 553

Query: 525  QILSLSGCVLASD 487
            + L+L  C L+++
Sbjct: 554  RSLTLESCKLSAN 566



>gb:AC099399_1737109 Oryza sativa (japonica cultivar-group) chromosome
            3 clone OJ1006F06, complete sequence.
          Length = 622

 Score = 60.5 bits (145), Expect = 9e-08
 Identities = 68/282 (24%), Positives = 134/282 (47%), Gaps = 6/282 (2%)
 Frame = -3

Query: 1329 TDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLR 1150
            +DL    LQ IN  G     S   L + +  + T+ + V DLGI  +++ C +++ +CL 
Sbjct: 257  SDLTNAGLQQINPNGKLKHIS---LMRSQEFLFTSFRRVNDLGILLMAEKCSSLESVCLG 313

Query: 1149 KCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKD 970
              + ++D G  + + +   +  L++    + +   VF  ++ ++  L  ++   C  + D
Sbjct: 314  GFSRVTDTGFRAIIHSCSGLHKLRVSHGSQFTDL-VFHDIIATSLCLTHVSLRWCNLLTD 372

Query: 969  LAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFV 790
            +  G+  L     L  L + +C   GD ++  LS L P L  L L G + ++D   L ++
Sbjct: 373  V--GIERLSFNKDLNVLDLRDCRSLGDEAVRSLSCL-PKLQILFLDG-SDISDQA-LKYL 427

Query: 789  QSCDAGLVKVNLSGCINVTDKTISAI-AKLHGETLELLNLNGCGCVTDASLAAIADYCSV 613
                  L  ++L GC  +T+  I  + A    ++L++L+L+    +TD  +  +A   + 
Sbjct: 428  GLGTCPLASLSLRGCRKLTNDCIPLLFAGSVKQSLQVLDLSRIPGITDDGIMLLARSRTP 487

Query: 612  LRDLDISKS-RVSDFGIAALAG----GSAIQFSLQILSLSGC 502
            + +L + ++ ++ D  + ALA     G     SLQ+L L  C
Sbjct: 488  IIELRMRENPKIGDAAVMALASMLVDGGTHGSSLQLLDLYDC 529



 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 63/257 (24%), Positives = 117/257 (45%), Gaps = 11/257 (4%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFW-VMGSGQGLHKLRSLVITACQGVTDLG 1201
            ++D+ + ++     +L  + L     + + GF  ++ S  GLHKLR   ++     TDL 
Sbjct: 292  VNDLGILLMAEKCSSLESVCLGGFSRVTDTGFRAIIHSCSGLHKLR---VSHGSQFTDLV 348

Query: 1200 IEAVSKGCPNVKQLCLRKCTLLSDNGV--VSFVKAAESIESLQLEECHRISQAGVFGILV 1027
               +      +  + LR C LL+D G+  +SF K    +  L L +C  +    V  +  
Sbjct: 349  FHDIIATSLCLTHVSLRWCNLLTDVGIERLSFNK---DLNVLDLRDCRSLGDEAVRSL-- 403

Query: 1026 HSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVL--SRLCPN 853
                KL+ L  +    + D A     L  C  L SLS+  C    +  + +L    +  +
Sbjct: 404  SCLPKLQILFLDGS-DISDQALKYLGLGTC-PLASLSLRGCRKLTNDCIPLLFAGSVKQS 461

Query: 852  LVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKL------HGET 691
            L  L+LS + G+TD G++   +S    ++++ +     + D  + A+A +      HG +
Sbjct: 462  LQVLDLSRIPGITDDGIMLLARS-RTPIIELRMRENPKIGDAAVMALASMLVDGGTHGSS 520

Query: 690  LELLNLNGCGCVTDASL 640
            L+LL+L  CG +T  ++
Sbjct: 521  LQLLDLYDCGAITPLAI 537



 Score = 47.8 bits (112), Expect = 6e-04
 Identities = 66/278 (23%), Positives = 120/278 (43%), Gaps = 16/278 (5%)
 Frame = -3

Query: 1176 PNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGIL------VHSAG 1015
            P++++LCL     ++D+ + S   A  S+  L L++   I       +       ++  G
Sbjct: 213  PSLQKLCLT-VDFITDHLIGSLSTALPSLTHLDLQDAPIIEPTTSSDLTNAGLQQINPNG 271

Query: 1014 KLKALA--------FENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLC 859
            KLK ++        F +   + DL   + A   C+SL S+ +   +   D     +   C
Sbjct: 272  KLKHISLMRSQEFLFTSFRRVNDLGILLMA-EKCSSLESVCLGGFSRVTDTGFRAIIHSC 330

Query: 858  PNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELL 679
              L  L +S  +  TD      + +    L  V+L  C  +TD  I  ++    + L +L
Sbjct: 331  SGLHKLRVSHGSQFTDLVFHDIIAT-SLCLTHVSLRWCNLLTDVGIERLS--FNKDLNVL 387

Query: 678  NLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCV 499
            +L  C  + D ++ +++     L+ L +  S +SD  +  L  G+     L  LSL GC 
Sbjct: 388  DLRDCRSLGDEAVRSLS-CLPKLQILFLDGSDISDQALKYLGLGTC---PLASLSLRGCR 443

Query: 498  LASDKCLPYLH--KLGNSLAGLNIQNCVGISHRGVDLL 391
              ++ C+P L    +  SL  L++    GI+  G+ LL
Sbjct: 444  KLTNDCIPLLFAGSVKQSLQVLDLSRIPGITDDGIMLL 481



>gb:ATAC009853_1543062 Arabidopsis thaliana chromosome III BAC F21O3
            genomic sequence, complete sequence.>gb:BT008530_1639747
            Arabidopsis thaliana clone U51342 putative F-box protein
            family, AtFBL12 (At3g07550) mRNA, complete
            cds.>gb:AK118929_1816879 Arabidopsis thaliana At3g07550
            mRNA for unknown protein, complete cds, clone:
            RAFL21-26-L05.
          Length = 395

 Score = 60.5 bits (145), Expect = 9e-08
 Identities = 55/222 (24%), Positives = 99/222 (44%), Gaps = 2/222 (0%)
 Frame = -3

Query: 1251 KLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLE 1072
            +L +L +  C G++D GI  ++  CPN+  + L +C + SD G+ +  +A+ S++ + L 
Sbjct: 118  RLHTLYLDCCFGISDDGISTIASFCPNLSVVSLYRCNI-SDIGLETLARASLSLKCVNLS 176

Query: 1071 ECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCT-GF 895
             C  +S  G+   L  +  +L+++   NC  +  + F              S C+ T G+
Sbjct: 177  YCPLVSDFGIKA-LSQACLQLESVKISNCKSITGVGF--------------SGCSPTLGY 221

Query: 894  GDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKT-IS 718
             DA          +   L   G+ G+   G + F+          N+SG      K  + 
Sbjct: 222  VDA----------DSCQLEPKGITGIISGGGIEFL----------NISGVSCYIRKDGLV 261

Query: 717  AIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS 592
             I       L +LNL  C  V D S+ AIA  C +L++ +++
Sbjct: 262  PIGSGIASKLRILNLRMCRTVGDESIEAIAKGCPLLQEWNLA 303



 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 37/123 (30%), Positives = 63/123 (51%)
 Frame = -3

Query: 771 LVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS 592
           L  ++LSGC  + D ++ ++ +  G  L  L L+ C  ++D  ++ IA +C  L  + + 
Sbjct: 93  LEHLSLSGCTVLNDSSLDSL-RYPGARLHTLYLDCCFGISDDGISTIASFCPNLSVVSLY 151

Query: 591 KSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGIS 412
           +  +SD G+  LA  S    SL+ ++LS C L SD  +  L +    L  + I NC  I+
Sbjct: 152 RCNISDIGLETLARAS---LSLKCVNLSYCPLVSDFGIKALSQACLQLESVKISNCKSIT 208

Query: 411 HRG 403
             G
Sbjct: 209 GVG 211



 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 60/272 (22%), Positives = 122/272 (44%), Gaps = 26/272 (9%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGI 1198
            ++D SL  + + G  L  L L     I++ G   + S      L  + +  C  ++D+G+
Sbjct: 104  LNDSSLDSLRYPGARLHTLYLDCCFGISDDGISTIASF--CPNLSVVSLYRCN-ISDIGL 160

Query: 1197 EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRIS------------ 1054
            E +++   ++K + L  C L+SD G+ +  +A   +ES+++  C  I+            
Sbjct: 161  ETLARASLSLKCVNLSYCPLVSDFGIKALSQACLQLESVKISNCKSITGVGFSGCSPTLG 220

Query: 1053 ----------QAGVFGILVHSAGKLKALAFENCFGMKD----LAFGVPALPPCNSLRSLS 916
                        G+ GI+     +   ++  +C+  KD    +  G+      + LR L+
Sbjct: 221  YVDADSCQLEPKGITGIISGGGIEFLNISGVSCYIRKDGLVPIGSGI-----ASKLRILN 275

Query: 915  ICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINV 736
            +  C   GD S+  +++ CP L   NL+  + V   G     + C   L K++++ C N+
Sbjct: 276  LRMCRTVGDESIEAIAKGCPLLQEWNLALCHEVKISGWEAVGKWC-RNLKKLHVNRCRNL 334

Query: 735  TDKTISAIAKLHGETLELLNLNGCGCVTDASL 640
             D+ + A+ +     L++L +NG   +T  ++
Sbjct: 335  CDQGLLAL-RCGCMNLQILYMNGNARLTPTAI 365



 Score = 39.7 bits (91), Expect = 0.16
 Identities = 35/142 (24%), Positives = 62/142 (43%), Gaps = 1/142 (0%)
 Frame = -3

Query: 1440 IASLFSSAGNHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFW-VMGSG 1264
            I  + S  G   + +   S  I    L  IG  G+A + L ++NL+     G   +    
Sbjct: 234  ITGIISGGGIEFLNISGVSCYIRKDGLVPIGS-GIA-SKLRILNLRMCRTVGDESIEAIA 291

Query: 1263 QGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIES 1084
            +G   L+   +  C  V   G EAV K C N+K+L + +C  L D G+++      +++ 
Sbjct: 292  KGCPLLQEWNLALCHEVKISGWEAVGKWCRNLKKLHVNRCRNLCDQGLLALRCGCMNLQI 351

Query: 1083 LQLEECHRISQAGVFGILVHSA 1018
            L +    R++   +    +H A
Sbjct: 352  LYMNGNARLTPTAIEMFRLHRA 373



 Score = 36.2 bits (82), Expect = 1.7
 Identities = 24/63 (38%), Positives = 32/63 (50%), Gaps = 8/63 (12%)
 Frame = -3

Query: 528 LQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV--------DLLVERLWR 373
           L+ LSLSGC + +D  L  L   G  L  L +  C GIS  G+        +L V  L+R
Sbjct: 93  LEHLSLSGCTVLNDSSLDSLRYPGARLHTLYLDCCFGISDDGISTIASFCPNLSVVSLYR 152

Query: 372 CDI 364
           C+I
Sbjct: 153 CNI 155



>gb:TBBCHR1A1_1398490 Trypanosoma brucei DNA chromosome 1, segment
            1/4.
          Length = 1448

 Score = 60.5 bits (145), Expect = 9e-08
 Identities = 88/297 (29%), Positives = 130/297 (43%), Gaps = 19/297 (6%)
 Frame = -3

Query: 1335 ALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLC 1156
            AL +L L N   IN  G+  +   Q LH    + I +   +TD  I   SK C N+  L 
Sbjct: 610  ALNELNLSNCIRINA-GWEAIEKLQQLH----VAILSNTHITDRDISHFSK-CKNLVTLD 663

Query: 1155 LRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGM 976
            L  C  L D   V+ +    ++E L L+ C  I +    G+ V   G+L  L   N  G+
Sbjct: 664  LSFCNKLLD---VTTLSNITTLEELNLDSCSNIRK----GLSV--LGELPRLCVLNIKGV 714

Query: 975  KDLAFGVPALPPCNSLRSLSICNCTGFGD----ASLVVLSRLCPNLVHLNLSGLNGV--- 817
            +     + +L   NS   LS+ NC GFG     ++LV L  L  +      SG+  +   
Sbjct: 715  QLEDSVIGSLGNGNSFVRLSLENCKGFGGVTPLSNLVTLEELNLHYCDKVTSGMGTLGRL 774

Query: 816  ------------TDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNL 673
                         D   L  + +C + LV +NLS C  +T  +ISAIA L    LE LN+
Sbjct: 775  LQLRVLDLGRTQVDDNSLENICTCSSPLVSLNLSHCKKIT--SISAIASL--TALEELNI 830

Query: 672  NGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGC 502
            + C  VT  S   +      LR   +S +R++D  I  ++       SL  L+L+ C
Sbjct: 831  DNCCNVT--SGWNVFGTLHQLRVATLSNTRINDENIQHVSECK----SLNTLNLAFC 881



 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 85/350 (24%), Positives = 161/350 (46%), Gaps = 21/350 (6%)
 Frame = -3

Query: 1398 VKLQSLNISDISLAVIGHYGVALTDLALINLQNIN-ERGFWVMGSGQGLHKLRSLVITAC 1222
            VKL  L++S+ +          L  L  +NL N +  +G   +G    L +LR L ++  
Sbjct: 303  VKLSKLSVSECNNVTDATPISQLAALEELNLSNCHITKGIGTLGM---LLRLRILDLSGV 359

Query: 1221 QGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV 1042
              V D  ++ +   C ++++L +  C  L+D   ++ +  A +IE L L  C RI++   
Sbjct: 360  P-VEDNCLKDLCD-CGSLERLNISYCIQLTD---INPLSNATAIEELNLNGCRRITRG-- 412

Query: 1041 FGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNS---LRSLSICNCTGFGDASLVVL 871
                    G + AL       MKD+    P+L    +   L  +S+ NC GFGD +L  L
Sbjct: 413  -------IGVVWALPRLRILHMKDVHLSEPSLDSVGTGGLLVKVSLDNCAGFGDMTL--L 463

Query: 870  SRLCPNLVHLNLSG----LNGVTDYGLLPFVQSCDAGLVKVN---------LSGCINVTD 730
            S +   L  LN+      ++GV   G LP+++  +   V ++             + +T 
Sbjct: 464  SSIV-TLEELNIQKCADIISGVGCLGTLPYLRVLNVKEVHISSLDFIGIGASKSLLQLTL 522

Query: 729  KTISAIAKLHG----ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIA 562
            ++ + ++ +       TLE L+L+GC  + DA +  + +    L+ LD+S +   +  + 
Sbjct: 523  ESFTGLSNVEALANILTLEKLSLHGCTGI-DAGIGCLGN-LPQLKMLDLSGTNTDNESLR 580

Query: 561  ALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGIS 412
            +L     +  ++  L+LS C   ++  + ++  L  +L  LN+ NC+ I+
Sbjct: 581  SL----CLSQTVVSLNLSHCWKMTN--VSHISSL-EALNELNLSNCIRIN 623



 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 75/272 (27%), Positives = 123/272 (45%), Gaps = 5/272 (1%)
 Frame = -3

Query: 1392 LQSLNISDISLAVIGHYGVALTDLALINLQNI-NERGFW-VMGSGQGLHKLRSLVITACQ 1219
            L SLN+S            +LT L  +N+ N  N    W V G+   LH+LR   ++  +
Sbjct: 802  LVSLNLSHCKKITSISAIASLTALEELNIDNCCNVTSGWNVFGT---LHQLRVATLSNTR 858

Query: 1218 GVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVF 1039
             + D  I+ VS+ C ++  L L  C  ++D   V+ +     +E L L+ CH I +    
Sbjct: 859  -INDENIQHVSE-CKSLNTLNLAFCKDITD---VTALSTITMLEELNLDCCHNIRKG--- 910

Query: 1038 GILVHSAGKL---KALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLS 868
               + + GKL   + L+ + C+     A     L    SL  L++    GF   S+  LS
Sbjct: 911  ---IETLGKLPKVRILSMKECYMGDSDAQQCSILGNSKSLVKLNLERSMGF--ISVKALS 965

Query: 867  RLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETL 688
             +   L  L L  + G+  Y +L F  SC   L  +NL    ++ D     I++   ++L
Sbjct: 966  NIA-TLEELVLDSVCGI--YDVLSF--SCLPRLRVLNLK-YTDINDDVTKNISE--SKSL 1017

Query: 687  ELLNLNGCGCVTDASLAAIADYCSVLRDLDIS 592
            + LNL+ C  VTD S   +    S L +L+++
Sbjct: 1018 QSLNLSHCKWVTDIS---VLSSLSTLEELNVN 1046



 Score = 42.0 bits (97), Expect = 0.032
 Identities = 93/379 (24%), Positives = 142/379 (37%), Gaps = 66/379 (17%)
 Frame = -3

Query: 1311 NLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLS 1132
            N+ N + R  + +G+      L  L IT    +T+  I  +S+   N+K  CL   +   
Sbjct: 243  NIDNNDARHLFSVGT------LEELAITDTMQLTN--IREISR-LTNLK--CLELNSTNI 291

Query: 1131 DNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLA---- 964
            D+  V  + A   +  L + EC+ ++ A      +     L+ L   NC   K +     
Sbjct: 292  DDSCVEEISACVKLSKLSVSECNNVTDA----TPISQLAALEELNLSNCHITKGIGTLGM 347

Query: 963  ---------FGVPA-------LPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS 832
                      GVP        L  C SL  L+I  C    D +   LS     +  LNL+
Sbjct: 348  LLRLRILDLSGVPVEDNCLKDLCDCGSLERLNISYCIQLTDIN--PLSN-ATAIEELNLN 404

Query: 831  GLNGVT-DYGLL------------------PFVQSCDAG--LVKVNLSGCINVTDKT-IS 718
            G   +T   G++                  P + S   G  LVKV+L  C    D T +S
Sbjct: 405  GCRRITRGIGVVWALPRLRILHMKDVHLSEPSLDSVGTGGLLVKVSLDNCAGFGDMTLLS 464

Query: 717  AIAKLHGETLELLNLNGCG-CVTDASLAAIADYCSVLRDLDISKSRVSDFGIAA------ 559
            +I      TLE LN+  C   ++         Y  VL   ++  S +   GI A      
Sbjct: 465  SIV-----TLEELNIQKCADIISGVGCLGTLPYLRVLNVKEVHISSLDFIGIGASKSLLQ 519

Query: 558  -----LAGGSAIQ-----FSLQILSLSGC--VLASDKCLPYLHKLGN-SLAGLNIQN--- 427
                   G S ++      +L+ LSL GC  + A   CL  L +L    L+G N  N   
Sbjct: 520  LTLESFTGLSNVEALANILTLEKLSLHGCTGIDAGIGCLGNLPQLKMLDLSGTNTDNESL 579

Query: 426  -CVGISHRGVDLLVERLWR 373
              + +S   V L +   W+
Sbjct: 580  RSLCLSQTVVSLNLSHCWK 598



>gb:BX908798_831205 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 521

 Score = 60.5 bits (145), Expect = 9e-08
 Identities = 57/201 (28%), Positives = 99/201 (49%)
 Frame = -3

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TD  + A+ K C N+K L L+ C  L+D G+   + +  +++ L L  C +++ AG   
Sbjct: 303  LTDAHLLAL-KNCKNLKVLQLQSCHHLTDTGLAC-LPSLTNLQYLNLNGCKKLTDAG--- 357

Query: 1035 ILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCP 856
             L H    +     +  F  K  + G+       +L+ L++  C    D  L  L+ L  
Sbjct: 358  -LAHLTPLVNLQYLDLGFCDKLTSKGLGHFKSLIALQHLNLSGCKFIRDNGLAHLTPLVA 416

Query: 855  NLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLN 676
             L +LNLS    +TD GL   V      L  ++LS C ++T+  ++ +  +H   L+ LN
Sbjct: 417  -LQYLNLSQCTFLTDAGLAHLVPL--VALKHLDLSWCNSLTNAGLAHL--VHLVALQYLN 471

Query: 675  LNGCGCVTDASLAAIADYCSV 613
            L+GC  +++A LA +A   S+
Sbjct: 472  LSGCIYLSEAGLAHLAPLTSL 492



 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 50/164 (30%), Positives = 81/164 (49%), Gaps = 1/164 (0%)
 Frame = -3

Query: 876 VLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG 697
           +L+     +  LN S    +TD  LL  +++C   L  + L  C ++TD  ++ +  L  
Sbjct: 284 ILNYFSNEIEGLNFSENAYLTDAHLLA-LKNCK-NLKVLQLQSCHHLTDTGLACLPSL-- 339

Query: 696 ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS-KSRVSDFGIAALAGGSAIQFSLQI 520
             L+ LNLNGC  +TDA LA +    + L+ LD+    +++  G+    G      +LQ 
Sbjct: 340 TNLQYLNLNGCKKLTDAGLAHLTPLVN-LQYLDLGFCDKLTSKGL----GHFKSLIALQH 394

Query: 519 LSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLV 388
           L+LSGC    D  L +L  L  +L  LN+  C  ++  G+  LV
Sbjct: 395 LNLSGCKFIRDNGLAHLTPL-VALQYLNLSQCTFLTDAGLAHLV 437



>gb:AF360339_1791285 Arabidopsis thaliana unknown protein
           (At1g15740) mRNA, complete cds.
          Length = 585

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 55/179 (30%), Positives = 82/179 (45%)
 Frame = -3

Query: 960 GVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSC 781
           G+ +L  C +L SL+   C    +  LV LS L  NL  L+      +T  G+     S 
Sbjct: 154 GLVSLKGCTNLESLNFNFCDQISNRGLVHLSGLS-NLTSLSFRRNAAITAQGMRAL--SN 210

Query: 780 DAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDL 601
              L K++L  C  +    +   A      LE LN+  C C+TDA +  ++   + LR L
Sbjct: 211 LVNLKKLDLEKCPGIDGGLVHLRALTK---LESLNIKWCNCITDADMEPLS-VLTNLRRL 266

Query: 600 DISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC 424
            I  S+++D GI+ L G +     L +L+L GC   +  CL  L  L   L  LN+  C
Sbjct: 267 QICCSKITDIGISYLKGLN----KLNLLNLEGCRHVTAACLDTLTALA-GLMYLNLNRC 320



 Score = 43.1 bits (100), Expect = 0.014
 Identities = 78/324 (24%), Positives = 121/324 (37%), Gaps = 65/324 (20%)
 Frame = -3

Query: 1263 QGLHKLRSLVITACQGVTDLGIEAVS-----------------KGCPNVKQLCLRKCTLL 1135
            +GL+KL  L +  C+ VT   ++ ++                  GC     L   K   L
Sbjct: 282  KGLNKLNLLNLEGCRHVTAACLDTLTALAGLMYLNLNRCNFSDSGCEKFSDLINLKILNL 341

Query: 1134 SDNGVVS----FVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFE-------- 991
              N + +     +K    +ESL L+ C RI   G    LVH +G L+  + E        
Sbjct: 342  GMNNITNSCLVHLKGLTKLESLNLDSC-RIGDEG----LVHLSGMLELKSLELSDTEVGS 396

Query: 990  ----NCFGMKDLAF-----------GVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCP 856
                +  G+ +L             G+  L    SLR+L++ +     DA L  L+ L  
Sbjct: 397  NGLRHLSGLSNLESINLSFTVVTDSGLRKLSGLTSLRTLNL-DARHVTDAGLSALTSLT- 454

Query: 855  NLVHLNL-------SGLNGVTDYGLLPFVQSCDAGLVK--------------VNLSGCIN 739
             L HL+L       SG N + +   L  ++ C  GL                +NLS   N
Sbjct: 455  GLTHLDLFGARITDSGTNHLRNLKKLQSLEICGGGLTDTGVKNIKDLSSLTLLNLSQNSN 514

Query: 738  VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAA 559
            +TDKT+  I+ L G                            L  L++S SRVS  G+  
Sbjct: 515  LTDKTLELISGLTG----------------------------LVSLNVSNSRVSSSGLRH 546

Query: 558  LAGGSAIQFSLQILSLSGCVLASD 487
            L        +L+ L+L  C L+++
Sbjct: 547  LKPLK----NLRSLTLESCKLSAN 566



>gb:AE016816_1746604 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome III, complete sequence.
          Length = 548

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 76/344 (22%), Positives = 152/344 (44%), Gaps = 15/344 (4%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLV--ITACQGVTDL 1204
            + D+ +AVIG   +   + +L    ++N+    V+G G  +H +  L   ++  + + D 
Sbjct: 154  LQDVCVAVIGESIMKHKEHSL----SVNKHILDVLG-GVSVHNMNKLADALSKSRALNDR 208

Query: 1203 GIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVH 1024
             ++       N++ +    C+ +S +G  S       + ++ L+ C +++   +  ++  
Sbjct: 209  TLQLFLN--VNLETITFHDCSNISADGYKSLAAFTPHLRAVSLQMCGQLNNEALL-LMAE 265

Query: 1023 SAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCP-NLV 847
                L+ L  +  F + D  +G+      + L +  + N   F D SL  L   C  +L 
Sbjct: 266  KLTNLRELYLDGPFLINDETWGIFFERMGDKLEAFHVSNTHRFTDDSLQKLLLHCGGSLR 325

Query: 846  HLNLSGLNGVTDYGLLPFVQSCDAG-LVKVNLSGCINVTDKTISAIAKLHGETLELLNLN 670
             L LS L+ +++Y LLP     D   L+    S   ++TD+ +  +  + G +L++LNL+
Sbjct: 326  SLKLSRLDSISNYALLPRYLHQDVHTLILQYPSNEEDITDEIMINLLGVVGNSLKVLNLD 385

Query: 669  GCGCVTDASLA--------AIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQF-SLQIL 517
            GC  +TD+ L         + +D CS+ R       +V+  G       S++Q   L  L
Sbjct: 386  GCTGITDSFLVNGLASNVRSGSDSCSLERLSLEELDQVTSDGFITFF--SSVQLPRLHYL 443

Query: 516  SLSGCVLASDKCLP--YLHKLGNSLAGLNIQNCVGISHRGVDLL 391
            +L  C    D  +   +L+     L  LN+ +   ++  G  L+
Sbjct: 444  NLRRCHQLDDASIAEIWLNPCSKFLKELNLNSARNLTAAGFQLM 487



>gb:CR382130_1663187 Yarrowia lipolytica chromosome D of strain CLIB99
            of Yarrowia lipolytica.
          Length = 568

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 56/236 (23%), Positives = 98/236 (41%), Gaps = 4/236 (1%)
 Frame = -3

Query: 1251 KLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLE 1072
            +L++L    C  +    +  +   CPN+++L L  C  L    ++   +  +S+ SL ++
Sbjct: 242  QLKNLEFWDCSNIDSESLRMIGSFCPNLEELVLGMCGRLRKEDLLYLGEKLKSLASLYID 301

Query: 1071 ECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG 892
                IS            G    + F+   G                L+ L+I N     
Sbjct: 302  GAFLIS------------GDTWNVFFDMVGG---------------GLKELTIKNSHRIS 334

Query: 891  DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCIN---VTDKTI 721
              ++V +   CP L  L LS L G TD             L ++ +S   +   V+D  I
Sbjct: 335  SENIVYMCEKCPKLEKLVLSRLEGCTDPMGYEMAALTLGNLKEIEISYPQDESLVSDDLI 394

Query: 720  SAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAAL 556
            S +    G  L+ +NL+GC  +TD +L  +   C+ L  L +S   +++D G+A+L
Sbjct: 395  SGLVSTCGPQLKSINLDGCSALTDKTLGTLR-ACTALESLSLSHVDQLTDNGVASL 449



 Score = 44.3 bits (103), Expect = 0.006
 Identities = 37/152 (24%), Positives = 73/152 (48%), Gaps = 5/152 (3%)
 Frame = -3

Query: 1251 KLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAES--IESLQ 1078
            +L+S+ +  C  +TD  +  + + C  ++ L L     L+DNGV S     E+  +  + 
Sbjct: 404  QLKSINLDGCSALTDKTLGTL-RACTALESLSLSHVDQLTDNGVASLFYQWENPGLSEIH 462

Query: 1077 LEECHRISQAGVFGILVHSAGK-LKALAFENC--FGMKDLAFGVPALPPCNSLRSLSICN 907
            + +C  +     F +LV ++G  LK+++  +    G+  +     +LP    L+ + +  
Sbjct: 463  MRKCIALGDDS-FRVLVDNSGPTLKSISVNSWAEIGVDTVKTVCKSLP---GLQDIDLGF 518

Query: 906  CTGFGDASLVVLSRLCPNLVHLNLSGLNGVTD 811
            C G  D  + +L+  CP L  + + G  GVT+
Sbjct: 519  CKGINDECVELLAENCPLLQKIEVYGDPGVTE 550



>gb:BT010706_1640652 Arabidopsis thaliana At2g06030 mRNA, complete
            cds.>gb:BT010997_1640943 Arabidopsis thaliana At2g06030
            mRNA, partial cds.
          Length = 233

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 51/207 (24%), Positives = 93/207 (44%), Gaps = 2/207 (0%)
 Frame = -3

Query: 1284 FWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVK 1105
            F +  S + L  L +L I+    ++D+G+  +    P +  + L +C+LL+ + +     
Sbjct: 8    FTLARSPKVLPMLSTLSISGACRLSDVGLRQLVSSAPAITSINLNQCSLLTSSSIDMLSD 67

Query: 1104 AAESI-ESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSL 928
            +  S+   L + EC  I    +   L     KL+ L+  +   +K             +L
Sbjct: 68   SLGSVLRELYINECQNIDMKHILAAL-KKFEKLEVLSLADLPSVKGRFLKEFVTAKGQTL 126

Query: 927  RSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSG 748
            + L + N     D+S+ V+S  CPNL  L+L+ +  +TD  L      C A      L  
Sbjct: 127  KQLILTNSRKLSDSSIKVISENCPNLSVLDLANVCKLTDSSLGYLANGCQA---LEKLIF 183

Query: 747  CIN-VTDKTISAIAKLHGETLELLNLN 670
            C N  +D+ ++A  +  G +L+ L+LN
Sbjct: 184  CRNPFSDEAVAAFVETAGGSLKELSLN 210



 Score = 35.8 bits (81), Expect = 2.3
 Identities = 42/195 (21%), Positives = 77/195 (39%), Gaps = 27/195 (13%)
 Frame = -3

Query: 930 LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLS 751
           L +LSI       D  L  L    P +  +NL+  + +T   +     S  + L ++ ++
Sbjct: 20  LSTLSISGACRLSDVGLRQLVSSAPAITSINLNQCSLLTSSSIDMLSDSLGSVLRELYIN 79

Query: 750 GCINVTDKTISAIAK--------------------------LHGETLELLNLNGCGCVTD 649
            C N+  K I A  K                            G+TL+ L L     ++D
Sbjct: 80  ECQNIDMKHILAALKKFEKLEVLSLADLPSVKGRFLKEFVTAKGQTLKQLILTNSRKLSD 139

Query: 648 ASLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPY 472
           +S+  I++ C  L  LD++   +++D  +  LA G     +L+ L       + +    +
Sbjct: 140 SSIKVISENCPNLSVLDLANVCKLTDSSLGYLANGCQ---ALEKLIFCRNPFSDEAVAAF 196

Query: 471 LHKLGNSLAGLNIQN 427
           +   G SL  L++ N
Sbjct: 197 VETAGGSLKELSLNN 211



>gb:TBBCHR1A1_1398501 Trypanosoma brucei DNA chromosome 1, segment
            1/4.
          Length = 1449

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 97/354 (27%), Positives = 154/354 (43%), Gaps = 22/354 (6%)
 Frame = -3

Query: 1386 SLNISDI-SLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQG-- 1216
            SLN+S    +  + H    ++ L  +N  N+N   F +    + + KL+ L +       
Sbjct: 591  SLNLSHCWKMTNVSH----ISSLEALNELNLNNC-FGINAGWEAIEKLQQLHVAILSNTH 645

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TD  I   SK C N+  L L  C  L D   V+ +    ++E L L+ C  I +    G
Sbjct: 646  ITDRDISHFSK-CKNLVTLDLSFCNKLLD---VTTLSNITTLEELNLDSCSNIRK----G 697

Query: 1035 ILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGD----ASLVVLS 868
            + V   G+L  L   N  G++     + +L   NS   LS+ +C GFGD    ++LV L 
Sbjct: 698  LSV--LGELPRLCVLNIKGVELEDSVIGSLGNGNSFVRLSLEHCKGFGDVTPLSNLVTLE 755

Query: 867  RLCPNLVHLNLSGLNGV---------------TDYGLLPFVQSCDAGLVKVNLSGCINVT 733
             L  +      SG+  +                D   L  + +    LV +NLS C  +T
Sbjct: 756  ELNLHYCDKVTSGMGTLGRLLQLRVLDLGRTQVDNNSLENICTSSIPLVLLNLSHCKKIT 815

Query: 732  DKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALA 553
              +ISAIA L    LE LN++ C  VT  S   +      LR   +S +R++D  +  ++
Sbjct: 816  --SISAIASL--TALEELNIDNCCNVT--SGWNVFGTLHQLRVATLSNTRINDENVRYVS 869

Query: 552  GGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
                   SL  L+L+ C   +D  +  L K+   L  LN+  C  I  +G++ L
Sbjct: 870  ECK----SLNTLNLAFCKDITD--VTALSKI-TMLEELNLDCCHNI-RKGIETL 915



 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 91/355 (25%), Positives = 167/355 (47%), Gaps = 26/355 (7%)
 Frame = -3

Query: 1398 VKLQSLNISDISLAVIGHYGVALTDLALINLQNINE-----RGFWVMGSGQGLHKLRSLV 1234
            VKL  L++S+ +          ++ LA +   N+N      +G   +G    L +LR L 
Sbjct: 303  VKLSKLSVSECNNITDA---TPISQLAALEELNVNSCYHITKGIGTLGM---LLRLRMLD 356

Query: 1233 ITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRIS 1054
            ++    V D  ++ +   C ++++L L  C  L+D   ++ + +A +IE L L  C RI+
Sbjct: 357  LSGVP-VEDNCLKDLCD-CGSLERLNLSYCIQLTD---INPLSSATAIEELNLNGCRRIT 411

Query: 1053 QAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVV 874
            +    G+ V +  KL+ L  ++   ++D   G  +L   NS   LS+ NC GFGD +L  
Sbjct: 412  RG--IGV-VWALPKLRVLHMKDV-QLEDSVIG--SLGNGNSFVRLSLENCAGFGDMTL-- 463

Query: 873  LSRLCPNLVHLNLSG----LNGVTDYGLLPFVQ-----------------SCDAGLVKVN 757
            LS +   L  LN+      ++GV   G LP+++                      L+++ 
Sbjct: 464  LSSIV-TLEELNIQKCADIISGVGCLGTLPYLRVLNVKEVHISSLDFTGIGASKSLLQLT 522

Query: 756  LSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVS 577
            L     + D  + A+A +   TLE L+L+GC  + DA +  + +    L+ LD+S +   
Sbjct: 523  LESITGLID--VEALANI--LTLEKLSLHGCTGI-DAGIGCLGN-LPQLKMLDLSGTNTD 576

Query: 576  DFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGIS 412
            +  + +L     +  ++  L+LS C   ++  + ++  L  +L  LN+ NC GI+
Sbjct: 577  NESLRSL----CLSQTMVSLNLSHCWKMTN--VSHISSL-EALNELNLNNCFGIN 624



 Score = 42.7 bits (99), Expect = 0.019
 Identities = 59/251 (23%), Positives = 107/251 (42%), Gaps = 3/251 (1%)
 Frame = -3

Query: 1335 ALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLC 1156
            AL +L + N  N+   G+ V G+   LH+LR   ++  + + D  +  VS+ C ++  L 
Sbjct: 825  ALEELNIDNCCNVTS-GWNVFGT---LHQLRVATLSNTR-INDENVRYVSE-CKSLNTLN 878

Query: 1155 LRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKL---KALAFENC 985
            L  C  ++D   V+ +     +E L L+ CH I +       + + GKL   + L+ + C
Sbjct: 879  LAFCKDITD---VTALSKITMLEELNLDCCHNIRKG------IETLGKLPKARILSMKEC 929

Query: 984  FGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYG 805
            +     A     L    SL  L++    GF     +        LV  +   +  +  + 
Sbjct: 930  YMGDSDAQQCSILGNSKSLVKLNLERSMGFISVKALSNIATLEELVLDHAREVCCIPSFS 989

Query: 804  LLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIAD 625
             LP ++  +     +N     N+++           ++L LLNL+ C  VTD S   +  
Sbjct: 990  CLPRLRVLNLKYTDINGDVTKNISES----------KSLRLLNLSHCKWVTDIS---VLS 1036

Query: 624  YCSVLRDLDIS 592
              S L +L++S
Sbjct: 1037 SLSTLEELNVS 1047



>sp|P24814|GRR1_YEAST Ubiquitin ligase complex F-box protein
            GRR1.>pir|A41529|A41529 GRR1 protein - yeast
            (Saccharomyces cerevisiae)>gb:SCYJR090C_1712885
            S.cerevisiae chromosome X reading frame ORF
            YJR090c.>gb:YSCGRR1_1728980 Saccharomyces cerevisiae GRR1
            gene, complete cds.>gb:YSCORFSAA_1730095 Saccharomyces
            cerevisiae ORF genes, complete cds.
          Length = 1151

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 48/207 (23%), Positives = 95/207 (45%), Gaps = 5/207 (2%)
 Frame = -3

Query: 1386 SLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSG-QGLHKLRSLVITACQGVT 1210
            S N++D SL  +    V L +  + +  NI +  F  +      +  LR + ++ C+ +T
Sbjct: 528  SPNVTDSSLLKLLTRLVQLREFRITHNTNITDNLFQELSKVVDDMPSLRLIDLSGCENIT 587

Query: 1209 DLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGIL 1030
            D  IE++    P ++ + L KC+ ++D  +    K  ++++++    C  I+  GV   L
Sbjct: 588  DKTIESIVNLAPKLRNVFLGKCSRITDASLFQLSKLGKNLQTVHFGHCFNITDNGV-RAL 646

Query: 1029 VHSAGKLKALAFENCFGMKD-LAFGVPALPPCNSLRSLSICNCTGFGDASL---VVLSRL 862
             HS  +++ + F  C  + +   + +  LP    L+ + +  CT   D  L   V L   
Sbjct: 647  FHSCTRIQYVDFACCTNLTNRTLYELADLP---KLKRIGLVKCTQMTDEGLLNMVSLRGR 703

Query: 861  CPNLVHLNLSGLNGVTDYGLLPFVQSC 781
               L  ++LS  + +T Y +   + SC
Sbjct: 704  NDTLERVHLSYCSNLTIYPIYELLMSC 730



 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 70/303 (23%), Positives = 124/303 (40%), Gaps = 3/303 (0%)
 Frame = -3

Query: 1260 GLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESL 1081
            G   L  L +  C+ +T + I AV +GC  ++ + +     +SD+   +       ++  
Sbjct: 412  GCKNLERLTLVFCKHITSVPISAVLRGCKFLQSVDITGIRDVSDDVFDTLATYCPRVQGF 471

Query: 1080 QLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCT 901
             + +   ++   +   +VHS   LK +       M D    + A   C  L  + I    
Sbjct: 472  YVPQARNVTFDSLRNFIVHSP-MLKRIKITANNNMNDELVELLA-NKCPLLVEVDITLSP 529

Query: 900  GFGDASLVVLSRLCPNLVHLNLSGLNGVTD--YGLLPFVQSCDAGLVKVNLSGCINVTDK 727
               D+SL+ L      L    ++    +TD  +  L  V      L  ++LSGC N+TDK
Sbjct: 530  NVTDSSLLKLLTRLVQLREFRITHNTNITDNLFQELSKVVDDMPSLRLIDLSGCENITDK 589

Query: 726  TISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKS-RVSDFGIAALAG 550
            TI +I  L    L  + L  C  +TDASL  ++     L+ +       ++D G+ AL  
Sbjct: 590  TIESIVNL-APKLRNVFLGKCSRITDASLFQLSKLGKNLQTVHFGHCFNITDNGVRALFH 648

Query: 549  GSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVERLWRC 370
                   +Q +  + C   +++ L  L  L   L  + +  C  ++  G+  +V    R 
Sbjct: 649  SCT---RIQYVDFACCTNLTNRTLYELADL-PKLKRIGLVKCTQMTDEGLLNMVSLRGRN 704

Query: 369  DIL 361
            D L
Sbjct: 705  DTL 707



>gb:AK126722_1916426 Homo sapiens cDNA FLJ44768 fis, clone
            BRACE3032631, highly similar to Mus musculus F-box
            protein FBX13.
          Length = 303

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 59/244 (24%), Positives = 115/244 (47%), Gaps = 3/244 (1%)
 Frame = -3

Query: 1224 CQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAG 1045
            C+ ++D  I AV+  CP ++++ +     L+D G+         ++ +   +C++IS  G
Sbjct: 24   CKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSKCRELKDIHFGQCYKISDEG 83

Query: 1044 VFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSR 865
            +  ++     KL+ +  +    + D +    A   C  L+ +    C+      ++ L++
Sbjct: 84   MI-VIAKGCLKLQRIYMQENKLVTDQSVKAFA-EHCPELQYVGFMGCS-VTSKGVIHLTK 140

Query: 864  LCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCIN--VTDKTISAIAKLHGET 691
            L  NL  L+L  +  + +  ++  V+ C   L  +NL  C+N  + D+ +  IAK  G+ 
Sbjct: 141  L-RNLSSLDLRHITELDNETVMEIVKRC-KNLSSLNL--CLNWIINDRCVEVIAK-EGQN 195

Query: 690  LELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILS 514
            L+ L L  C  +TD +L AI  Y   +  +D+   + ++D G   +A  S    SL+ L 
Sbjct: 196  LKELYLVSCK-ITDYALIAIGRYSMTIETVDVGWCKEITDQGATLIAQSSK---SLRYLG 251

Query: 513  LSGC 502
            L  C
Sbjct: 252  LMRC 255



 Score = 53.5 bits (127), Expect = 1e-05
 Identities = 54/278 (19%), Positives = 121/278 (43%)
 Frame = -3

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            ++D G+  ++  CP + +    +C  LSD  +++       ++ + +    +++  G+  
Sbjct: 1    MSDNGVCVLAFKCPGLLRYTAYRCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGL-K 59

Query: 1035 ILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCP 856
             L     +LK + F  C+ + D    V A   C  L+ + +       D S+   +  CP
Sbjct: 60   QLGSKCRELKDIHFGQCYKISDEGMIVIA-KGCLKLQRIYMQENKLVTDQSVKAFAEHCP 118

Query: 855  NLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLN 676
             L ++   G + VT  G++   +     L  ++L     + ++T+  I K   + L  LN
Sbjct: 119  ELQYVGFMGCS-VTSKGVIHLTKL--RNLSSLDLRHITELDNETVMEIVK-RCKNLSSLN 174

Query: 675  LNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVL 496
            L     + D  +  IA     L++L +   +++D+ + A+   S    +++ + +  C  
Sbjct: 175  LCLNWIINDRCVEVIAKEGQNLKELYLVSCKITDYALIAIGRYS---MTIETVDVGWCKE 231

Query: 495  ASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVER 382
             +D+    + +   SL  L +  C  ++   V+ LV++
Sbjct: 232  ITDQGATLIAQSSKSLRYLGLMRCDKVNEVTVEQLVQQ 269



 Score = 46.2 bits (108), Expect = 0.002
 Identities = 58/276 (21%), Positives = 111/276 (40%), Gaps = 6/276 (2%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGI 1198
            ++D  L  +G     L D+       I++ G  V+   +G  KL+ + +   + VTD  +
Sbjct: 53   LTDEGLKQLGSKCRELKDIHFGQCYKISDEGMIVIA--KGCLKLQRIYMQENKLVTDQSV 110

Query: 1197 EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSA 1018
            +A ++ CP ++ +    C++ S  GV+   K   ++ SL L     +    V  I+    
Sbjct: 111  KAFAEHCPELQYVGFMGCSVTS-KGVIHLTK-LRNLSSLDLRHITELDNETVMEIVKR-- 166

Query: 1017 GKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN 838
                                      C +L SL++C      D  + V+++   NL  L 
Sbjct: 167  --------------------------CKNLSSLNLCLNWIINDRCVEVIAKEGQNLKELY 200

Query: 837  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGC 658
            L     +TDY L+  +      +  V++  C  +TD+  + IA+   ++L  L L  C  
Sbjct: 201  LVSCK-ITDYALIA-IGRYSMTIETVDVGWCKEITDQGATLIAQ-SSKSLRYLGLMRCDK 257

Query: 657  VTDASLAAIAD------YCSVLRDLDISKSRVSDFG 568
            V + ++  +        + +VL+D   +  R    G
Sbjct: 258  VNEVTVEQLVQQYPHITFSTVLQDCKRTLERAYQMG 293



>gb:AC084884_1733896 Oryza sativa chromosome 10 clone OSJNBa0031A07,
           complete sequence.
          Length = 299

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 43/145 (29%), Positives = 74/145 (51%), Gaps = 2/145 (1%)
 Frame = -3

Query: 939 CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKV 760
           C  L  L++       +  LV ++  C NL  L LSG   V ++GL+   + C+  L ++
Sbjct: 152 CKGLEKLTLNWFLHISEKGLVGIANRCRNLQSLALSG-GYVQNHGLITLAEGCN--LSEL 208

Query: 759 NLSGCINVTDKTISAIAKLHGETLELLNLNGC-GCVTDASLAAIADYCSVLRDLDISKSR 583
            L G   +TD+ +    K+  ++L  L+++ C GC+T  SL AI  YC  L  L +    
Sbjct: 209 KLCGVQELTDEGLVEFVKIRSKSLVSLDISFCNGCITYRSLYAIGTYCHNLEVLSVESKH 268

Query: 582 VSD-FGIAALAGGSAIQFSLQILSL 511
           V++  G+ ++A G     SL+++ L
Sbjct: 269 VNENKGMISVAKGCQYLKSLKMVWL 293



>gb:AY484589_1608337 Musa acuminata clone MuH9, genomic sequence.
          Length = 313

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 65/266 (24%), Positives = 106/266 (39%), Gaps = 3/266 (1%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLG 1201
            ++S ISLA        L D AL+ L++                 +R L +  C G+++ G
Sbjct: 78   HLSSISLAGC----TELPDSALLRLRDFGSN-------------IRYLSLYCCFGISEHG 120

Query: 1200 IEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHS 1021
            +  VS GCP++  + L +C + +D G+    K  + +E++ L  C +IS  G+   L   
Sbjct: 121  LAHVSTGCPHLVSITLYRCNI-TDIGLRILAKHCKVLENIDLSYCMQISDRGI-NALSSE 178

Query: 1020 AGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHL 841
              KL  L    C                 ++R +    C+         L+ L  +   L
Sbjct: 179  CTKLHCLVISYC----------------KAIRGIGFAGCSS-------TLTYLEADSCML 215

Query: 840  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSG---CINVTDKTISAIAKLHGETLELLNLN 670
               GL+     G          GL  +N+S    C+ V    ++ I       L  LNL 
Sbjct: 216  TPEGLSEAVSGG----------GLEYLNISNPRICVGVDG--LAMIGAGSATKLRYLNLR 263

Query: 669  GCGCVTDASLAAIADYCSVLRDLDIS 592
             C  V+D S+ AIA  C +L +  +S
Sbjct: 264  MCRFVSDDSVIAIAQGCPLLEEWSLS 289



 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 51/176 (28%), Positives = 85/176 (48%), Gaps = 4/176 (2%)
 Frame = -3

Query: 930 LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLS 751
           L S+S+  CT   D++L+ L     N+ +L+L    G++++GL      C   LV + L 
Sbjct: 79  LSSISLAGCTELPDSALLRLRDFGSNIRYLSLYCCFGISEHGLAHVSTGC-PHLVSITLY 137

Query: 750 GCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSD 574
            C N+TD  +  +AK H + LE ++L+ C  ++D  + A++  C+ L  L IS  + +  
Sbjct: 138 RC-NITDIGLRILAK-HCKVLENIDLSYCMQISDRGINALSSECTKLHCLVISYCKAIRG 195

Query: 573 FGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQN---CVGI 415
            G A  +       +L  L    C+L  +     +   G  L  LNI N   CVG+
Sbjct: 196 IGFAGCSS------TLTYLEADSCMLTPEGLSEAVS--GGGLEYLNISNPRICVGV 243



 Score = 46.6 bits (109), Expect = 0.001
 Identities = 50/217 (23%), Positives = 86/217 (39%), Gaps = 24/217 (11%)
 Frame = -3

Query: 1410 HLMKVKLQSLN-ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLV 1234
            HL  + L     + D +L  +  +G  +  L+L     I+E G   + +G     L S+ 
Sbjct: 78   HLSSISLAGCTELPDSALLRLRDFGSNIRYLSLYCCFGISEHGLAHVSTG--CPHLVSIT 135

Query: 1233 ITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRIS 1054
            +  C  +TD+G+  ++K C  ++ + L  C  +SD G+ +       +  L +  C  I 
Sbjct: 136  LYRCN-ITDIGLRILAKHCKVLENIDLSYCMQISDRGINALSSECTKLHCLVISYCKAIR 194

Query: 1053 QAGVFGIL--------------------VHSAGKLKALAFEN---CFGMKDLAFGVPALP 943
              G  G                        S G L+ L   N   C G+  LA  +    
Sbjct: 195  GIGFAGCSSTLTYLEADSCMLTPEGLSEAVSGGGLEYLNISNPRICVGVDGLA--MIGAG 252

Query: 942  PCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS 832
                LR L++  C    D S++ +++ CP L   +LS
Sbjct: 253  SATKLRYLNLRMCRFVSDDSVIAIAQGCPLLEEWSLS 289



>gb:HSM801456_1186185 Homo sapiens mRNA; cDNA DKFZp434C1715 (from
            clone DKFZp434C1715).
          Length = 314

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 59/244 (24%), Positives = 115/244 (47%), Gaps = 3/244 (1%)
 Frame = -3

Query: 1224 CQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAG 1045
            C+ ++D  I AV+  CP ++++ +     L+D G+         ++ +   +C++IS  G
Sbjct: 24   CKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSKCRELKDIHFGQCYKISDEG 83

Query: 1044 VFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSR 865
            +  ++     KL+ +  +    + D +    A   C  L+ +    C+      ++ L++
Sbjct: 84   MI-VIAKGCLKLQRIYMQENKLVTDQSVKAFA-EHCPELQYVGFMGCS-VTSKGVIHLTK 140

Query: 864  LCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCIN--VTDKTISAIAKLHGET 691
            L  NL  L+L  +  + +  ++  V+ C   L  +NL  C+N  + D+ +  IAK  G+ 
Sbjct: 141  L-RNLSSLDLRHITELDNETVMEIVKRC-KNLSSLNL--CLNWIINDRCVEVIAK-EGQN 195

Query: 690  LELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILS 514
            L+ L L  C  +TD +L AI  Y   +  +D+   + ++D G   +A  S    SL+ L 
Sbjct: 196  LKELYLVSCK-ITDYALIAIGRYSMTIETVDVGWCKEITDQGATLIAQSSK---SLRYLG 251

Query: 513  LSGC 502
            L  C
Sbjct: 252  LMRC 255



 Score = 44.3 bits (103), Expect = 0.006
 Identities = 41/194 (21%), Positives = 80/194 (41%), Gaps = 22/194 (11%)
 Frame = -3

Query: 939 CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKV 760
           C  L   +   C    D S++ ++  CP L  +++   + +TD GL      C   L  +
Sbjct: 13  CPGLLRYTAYRCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSKC-RELKDI 71

Query: 759 NLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRV 580
           +   C  ++D+ +  IAK     L+ + +     VTD S+ A A++C  L+ +      V
Sbjct: 72  HFGQCYKISDEGMIVIAK-GCLKLQRIYMQENKLVTDQSVKAFAEHCPELQYVGFMGCSV 130

Query: 579 SDFGIAALAG--------------------GSAIQFSLQILSLSGCV--LASDKCLPYLH 466
           +  G+  L                         ++    + SL+ C+  + +D+C+  + 
Sbjct: 131 TSKGVIHLTKLRNLSSLDLRHITELDNETVMEIVKRCKNLSSLNLCLNWIINDRCVEVIA 190

Query: 465 KLGNSLAGLNIQNC 424
           K G +L  L + +C
Sbjct: 191 KEGQNLKELYLVSC 204



 Score = 43.1 bits (100), Expect = 0.014
 Identities = 52/238 (21%), Positives = 97/238 (40%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGI 1198
            ++D  L  +G     L D+       I++ G  V+   +G  KL+ + +   + VTD  +
Sbjct: 53   LTDEGLKQLGSKCRELKDIHFGQCYKISDEGMIVIA--KGCLKLQRIYMQENKLVTDQSV 110

Query: 1197 EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSA 1018
            +A ++ CP ++ +    C++ S  GV+   K   ++ SL L     +    V  I+    
Sbjct: 111  KAFAEHCPELQYVGFMGCSVTS-KGVIHLTK-LRNLSSLDLRHITELDNETVMEIVKR-- 166

Query: 1017 GKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN 838
                                      C +L SL++C      D  + V+++   NL  L 
Sbjct: 167  --------------------------CKNLSSLNLCLNWIINDRCVEVIAKEGQNLKELY 200

Query: 837  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGC 664
            L     +TDY L+  +      +  V++  C  +TD+  + IA+   ++L  L L  C
Sbjct: 201  LVSCK-ITDYALIA-IGRYSMTIETVDVGWCKEITDQGATLIAQ-SSKSLRYLGLMRC 255



>gb:AE017150_1029600 Trypanosoma brucei chromosome 2, complete
            sequence.>gb:AE017167_1229800 Trypanosoma brucei
            chromosome 2, section 1 of 4 of the complete sequence.
          Length = 1394

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 100/358 (27%), Positives = 156/358 (43%), Gaps = 26/358 (7%)
 Frame = -3

Query: 1386 SLNISDI-SLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQG-- 1216
            SLN+S    +  + H   +L  L  +NL N     F +    + + KL+ L +       
Sbjct: 536  SLNLSHCWKMTNVSHIS-SLEALNELNLSNC----FGINAGWEAIEKLQQLHVAILSNTH 590

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFG 1036
            +TD  I   SK C N+  L L  C  L D   V+ +    ++E L L+ C  I +    G
Sbjct: 591  ITDRNISHFSK-CKNLVTLDLSFCNKLLD---VTALSNITTLEELNLDSCSNIRK----G 642

Query: 1035 ILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGD----ASLVVLS 868
            + V   G+L  L   N  G++     + +L    SL  +S+ +C GFGD    ++LV L 
Sbjct: 643  LSV--LGELPRLCVLNIKGVQLEDSVIVSLGNGGSLVKVSLDDCAGFGDVTPLSNLVTLE 700

Query: 867  RLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAG------------------LVKVNLSGCI 742
             L  NL H      +G+   G LP ++  D G                  LV +NLS C 
Sbjct: 701  EL--NL-HYCDKVTSGMGTLGRLPQLRVLDLGRTQVDNNSLENICTSSIPLVSLNLSHCK 757

Query: 741  NVTDKTISAIAKLHGETLELLNL-NGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGI 565
             +T  +IS+IA L    LE LN+ N C   +  ++         LR   +S +R++D  I
Sbjct: 758  KIT--SISSIASL--TALEELNIDNSCNVTSGWNVFGTLHQ---LRVATLSNTRINDENI 810

Query: 564  AALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
              ++       SL  L+L+ C   +D  +  L K+   L  LN+  C  I  +G++ L
Sbjct: 811  RYVSECK----SLNTLNLAFCKDITD--VTALSKI-TMLEELNLDCCPNI-RKGIETL 860



 Score = 57.8 bits (138), Expect = 6e-07
 Identities = 73/280 (26%), Positives = 133/280 (47%), Gaps = 24/280 (8%)
 Frame = -3

Query: 1179 CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL 1000
            C ++++L +  C  L+D   ++ +  A +IE L L  C RI++    G+ V +  KL+ L
Sbjct: 318  CGSLERLNISYCIQLTD---INPLSNATAIEELNLNGCRRITRG--IGV-VWALPKLRVL 371

Query: 999  AFENCFGMKDLAFGVPALPPCNS---LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSG 829
                   MKD+    P+L    +   L  +S+ NC GFGD +L  LS +   L  LN+  
Sbjct: 372  H------MKDVHLSEPSLDSVGTGGPLVKVSLDNCAGFGDMTL--LSSIV-TLEELNIQK 422

Query: 828  ----LNGVTDYGLLPFVQ-----------------SCDAGLVKVNLSGCINVTDKTISAI 712
                ++GV   G LP+++                      L+++N+     + D  + A+
Sbjct: 423  CADIISGVGSLGTLPYLRVLNIKEAHISSLDFTGIGASKSLLQLNMESITGLID--VEAL 480

Query: 711  AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQF 532
            A +   TLE L+L+GC  + DA +  + +    L+ LD+S +   +  + +L     +  
Sbjct: 481  ANI--LTLEKLSLHGCTGI-DAGIGCLGN-LPQLKMLDLSGTNTDNESLRSL----CLSQ 532

Query: 531  SLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGIS 412
            ++  L+LS C   ++  + ++  L  +L  LN+ NC GI+
Sbjct: 533  TVVSLNLSHCWKMTN--VSHISSL-EALNELNLSNCFGIN 569



 Score = 40.4 bits (93), Expect = 0.092
 Identities = 81/346 (23%), Positives = 134/346 (38%), Gaps = 47/346 (13%)
 Frame = -3

Query: 1311 NLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLS 1132
            N+ N + R  + +G+ + L    ++ +T  +G++ L          N+K  CL   +   
Sbjct: 188  NIDNNDARHLFNIGTLEELAITDTMQLTNIRGISRL---------TNLK--CLELNSTDI 236

Query: 1131 DNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCF----GMKDLA 964
            D+  +  + A   +  L + EC+ I+ A      +     L+ L   +C+    G+  L 
Sbjct: 237  DDSCIGEISACAKLSKLSVSECNNITDA----TPISQLSALEELNLNSCYHITKGIGTLG 292

Query: 963  F----------GVPA-------LPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL 835
                       GVP        L  C SL  L+I  C    D +   LS     +  LNL
Sbjct: 293  MLLRLRILDLSGVPVEDNCLKDLCDCGSLERLNISYCIQLTDIN--PLSN-ATAIEELNL 349

Query: 834  SGLNGVT-DYGLL------------------PFVQSCDAG--LVKVNLSGCINVTDKT-I 721
            +G   +T   G++                  P + S   G  LVKV+L  C    D T +
Sbjct: 350  NGCRRITRGIGVVWALPKLRVLHMKDVHLSEPSLDSVGTGGPLVKVSLDNCAGFGDMTLL 409

Query: 720  SAIAKLHGETLELLNLNGCGCVTD--ASLAAIADYCSVLRDLDISKSRVSDFGIAALAGG 547
            S+I      TLE LN+  C  +     SL  +      LR L+I ++ +S      + G 
Sbjct: 410  SSIV-----TLEELNIQKCADIISGVGSLGTL----PYLRVLNIKEAHISSLDFTGI-GA 459

Query: 546  SAIQFSLQILSLSGCVLASDKCLPYLHKLGN--SLAGLNIQNCVGI 415
            S     L + S++G +         +  L N  +L  L++  C GI
Sbjct: 460  SKSLLQLNMESITGLI--------DVEALANILTLEKLSLHGCTGI 497



 Score = 37.4 bits (85), Expect = 0.78
 Identities = 51/163 (31%), Positives = 79/163 (48%), Gaps = 2/163 (1%)
 Frame = -3

Query: 873 LSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGE 694
           +SRL  NL  L L+  +   D   +  + +C A L K+++S C N+TD T   I++L   
Sbjct: 220 ISRLT-NLKCLELNSTD--IDDSCIGEISAC-AKLSKLSVSECNNITDAT--PISQL--S 271

Query: 693 TLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILS 514
            LE LNLN C  +T             LR LD+S   V D  +  L        SL+ L+
Sbjct: 272 ALEELNLNSCYHITKG--IGTLGMLLRLRILDLSGVPVEDNCLKDLCDCG----SLERLN 325

Query: 513 LSGCVLASDKCLPYLHKLGNSLA--GLNIQNCVGISHRGVDLL 391
           +S C+  +D     ++ L N+ A   LN+  C  I+ RG+ ++
Sbjct: 326 ISYCIQLTD-----INPLSNATAIEELNLNGCRRIT-RGIGVV 362



>pir|T43444|T43444 hypothetical protein DKFZp434C1715.1 - human
            (fragment)
          Length = 381

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 59/244 (24%), Positives = 115/244 (47%), Gaps = 3/244 (1%)
 Frame = -3

Query: 1224 CQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAG 1045
            C+ ++D  I AV+  CP ++++ +     L+D G+         ++ +   +C++IS  G
Sbjct: 91   CKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSKCRELKDIHFGQCYKISDEG 150

Query: 1044 VFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSR 865
            +  ++     KL+ +  +    + D +    A   C  L+ +    C+      ++ L++
Sbjct: 151  MI-VIAKGCLKLQRIYMQENKLVTDQSVKAFA-EHCPELQYVGFMGCS-VTSKGVIHLTK 207

Query: 864  LCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCIN--VTDKTISAIAKLHGET 691
            L  NL  L+L  +  + +  ++  V+ C   L  +NL  C+N  + D+ +  IAK  G+ 
Sbjct: 208  L-RNLSSLDLRHITELDNETVMEIVKRC-KNLSSLNL--CLNWIINDRCVEVIAK-EGQN 262

Query: 690  LELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILS 514
            L+ L L  C  +TD +L AI  Y   +  +D+   + ++D G   +A  S    SL+ L 
Sbjct: 263  LKELYLVSCK-ITDYALIAIGRYSMTIETVDVGWCKEITDQGATLIAQSSK---SLRYLG 318

Query: 513  LSGC 502
            L  C
Sbjct: 319  LMRC 322



 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 61/305 (20%), Positives = 115/305 (37%), Gaps = 31/305 (10%)
 Frame = -3

Query: 1245 RSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEEC 1066
            + L +++ Q VTD  +E ++    N+ ++ +  C  +SDNGV         +       C
Sbjct: 32   KQLDLSSRQQVTDELLEKIASRSQNIIEINISDCRSMSDNGVCVLAFKCPGLLRYTAYRC 91

Query: 1065 HRISQAGVFGILVH-------SAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICN 907
             ++S   +  +  H         G    L  E   G+K L         C  L+ +    
Sbjct: 92   KQLSDTSIIAVASHCPLLQKVHVGNQDKLTDE---GLKQLG------SKCRELKDIHFGQ 142

Query: 906  CTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDK 727
            C    D  ++V+++ C  L  + +     VTD  +  F + C   L  V   GC +VT K
Sbjct: 143  CYKISDEGMIVIAKGCLKLQRIYMQENKLVTDQSVKAFAEHCPE-LQYVGFMGC-SVTSK 200

Query: 726  TISAIAKLHG------------------------ETLELLNLNGCGCVTDASLAAIADYC 619
             +  + KL                          + L  LNL     + D  +  IA   
Sbjct: 201  GVIHLTKLRNLSSLDLRHITELDNETVMEIVKRCKNLSSLNLCLNWIINDRCVEVIAKEG 260

Query: 618  SVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGL 439
              L++L +   +++D+ + A+   S    +++ + +  C   +D+    + +   SL  L
Sbjct: 261  QNLKELYLVSCKITDYALIAIGRYS---MTIETVDVGWCKEITDQGATLIAQSSKSLRYL 317

Query: 438  NIQNC 424
             +  C
Sbjct: 318  GLMRC 322



 Score = 43.1 bits (100), Expect = 0.014
 Identities = 52/238 (21%), Positives = 97/238 (40%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGI 1198
            ++D  L  +G     L D+       I++ G  V+   +G  KL+ + +   + VTD  +
Sbjct: 120  LTDEGLKQLGSKCRELKDIHFGQCYKISDEGMIVIA--KGCLKLQRIYMQENKLVTDQSV 177

Query: 1197 EAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSA 1018
            +A ++ CP ++ +    C++ S  GV+   K   ++ SL L     +    V  I+    
Sbjct: 178  KAFAEHCPELQYVGFMGCSVTS-KGVIHLTK-LRNLSSLDLRHITELDNETVMEIVKR-- 233

Query: 1017 GKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN 838
                                      C +L SL++C      D  + V+++   NL  L 
Sbjct: 234  --------------------------CKNLSSLNLCLNWIINDRCVEVIAKEGQNLKELY 267

Query: 837  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGC 664
            L     +TDY L+  +      +  V++  C  +TD+  + IA+   ++L  L L  C
Sbjct: 268  LVSCK-ITDYALIA-IGRYSMTIETVDVGWCKEITDQGATLIAQ-SSKSLRYLGLMRC 322



>gb:BC067674_2554845 Danio rerio zgc:85882, mRNA (cDNA clone MGC:85882
            IMAGE:6968485), complete cds.
          Length = 296

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 42/181 (23%), Positives = 92/181 (50%), Gaps = 1/181 (0%)
 Frame = -3

Query: 1170 VKQLCLRKCT-LLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAF 994
            ++ L +  C+  ++D  ++  +   + ++ + L  C ++S+  +  + + S  +L+ L+ 
Sbjct: 86   LQHLSVTNCSDWITDTDLLPVIGQNQQLQHVDLRGCAQLSRRALVAVSL-SCPRLQHLSL 144

Query: 993  ENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVT 814
             +C  +  LA    A   C  LRSL +  C    D ++  L+  CP L  L+++    +T
Sbjct: 145  AHCEWVDSLALRSLA-DHCPMLRSLDLTACRQLKDPAVCYLAGKCPELRALSVAVNANIT 203

Query: 813  DYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAA 634
            D  +    + C   + +++L+GC+ V ++ I  +A+ +   L+ L +N C  VT++SL  
Sbjct: 204  DTAVEEVAKKC-REMERLDLTGCLRVRNEAIRTLAE-YCPKLQSLKVNHCHNVTESSLGV 261

Query: 633  I 631
            +
Sbjct: 262  L 262



 Score = 52.0 bits (123), Expect = 3e-05
 Identities = 42/158 (26%), Positives = 80/158 (50%), Gaps = 2/158 (1%)
 Frame = -3

Query: 852 LVHLNLSGLNG-VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLN 676
           L HL+++  +  +TD  LLP +   +  L  V+L GC  ++ + + A++ L    L+ L+
Sbjct: 86  LQHLSVTNCSDWITDTDLLPVIGQ-NQQLQHVDLRGCAQLSRRALVAVS-LSCPRLQHLS 143

Query: 675 LNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILSLSGCV 499
           L  C  V   +L ++AD+C +LR LD++  R + D  +  LAG       L+ LS++   
Sbjct: 144 LAHCEWVDSLALRSLADHCPMLRSLDLTACRQLKDPAVCYLAGKCP---ELRALSVAVNA 200

Query: 498 LASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVE 385
             +D  +  + K    +  L++  C+ + +  +  L E
Sbjct: 201 NITDTAVEEVAKKCREMERLDLTGCLRVRNEAIRTLAE 238



 Score = 47.0 bits (110), Expect = 0.001
 Identities = 37/159 (23%), Positives = 66/159 (41%)
 Frame = -3

Query: 1278 VMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAA 1099
            V+G  Q   +L+ + +  C  ++   + AVS  CP ++ L L  C  +    + S     
Sbjct: 106  VIGQNQ---QLQHVDLRGCAQLSRRALVAVSLSCPRLQHLSLAHCEWVDSLALRSLADHC 162

Query: 1098 ESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSL 919
              + SL L  C ++    V   L     +L+AL+      + D A    A   C  +  L
Sbjct: 163  PMLRSLDLTACRQLKDPAVC-YLAGKCPELRALSVAVNANITDTAVEEVA-KKCREMERL 220

Query: 918  SICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGL 802
             +  C    + ++  L+  CP L  L ++  + VT+  L
Sbjct: 221  DLTGCLRVRNEAIRTLAEYCPKLQSLKVNHCHNVTESSL 259



 Score = 43.5 bits (101), Expect = 0.011
 Identities = 26/98 (26%), Positives = 46/98 (46%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            LRSL +TAC+ + D  +  ++  CP ++ L +     ++D  V    K    +E L L  
Sbjct: 165  LRSLDLTACRQLKDPAVCYLAGKCPELRALSVAVNANITDTAVEEVAKKCREMERLDLTG 224

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGV 955
            C R+    +   L     KL++L   +C  + + + GV
Sbjct: 225  CLRVRNEAI-RTLAEYCPKLQSLKVNHCHNVTESSLGV 261



 Score = 42.4 bits (98), Expect = 0.024
 Identities = 18/74 (24%), Positives = 42/74 (56%)
 Frame = -3

Query: 1251 KLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLE 1072
            +LR+L +     +TD  +E V+K C  +++L L  C  + +  + +  +    ++SL++ 
Sbjct: 190  ELRALSVAVNANITDTAVEEVAKKCREMERLDLTGCLRVRNEAIRTLAEYCPKLQSLKVN 249

Query: 1071 ECHRISQAGVFGIL 1030
             CH ++++ + G+L
Sbjct: 250  HCHNVTESSL-GVL 262



>gb:AP004586_1841932 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, PAC clone:P0493A04.
          Length = 901

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 61/252 (24%), Positives = 103/252 (40%), Gaps = 53/252 (21%)
 Frame = -3

Query: 1191 VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK 1012
            V    P +K++ L+    LSD+G+ + + AA S+ SL L EC  ++  G+  +    +  
Sbjct: 617  VPNSMPLLKKISLKGNYRLSDSGLDTIISAAPSLSSLNLCECSLLTSTGIENLANKLSLV 676

Query: 1011 LKALAFENCFGMKDLAFGVPALPPC---------------------------NSLRSLSI 913
            L  L  ++C  + D    +P+L                              ++L+ L+ 
Sbjct: 677  LTELYIDDCLNV-DAMMILPSLQKIKHLEVLSMSGIQSVSNKFVNELIPVHGSNLKELAF 735

Query: 912  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNL------- 754
              C     +S+  ++  CP L  L+L  LN + D  +      C   + K+ L       
Sbjct: 736  AGCLQLTSSSIKTIAGNCPQLSSLDLRNLNRLRDSAMRHLRNGCRL-IKKIKLQRNTFSD 794

Query: 753  ---------SG------CINVTDK----TISAIAKLHGETLELLNLNGCGCVTDASLAAI 631
                     SG      C+N  +K    T  AIA+     LE+L+L+ C  +T+ +L  I
Sbjct: 795  EAVYRFLEQSGGYLTELCLNNVEKAGNLTAYAIARNCSTHLEVLDLSFCRELTNEALGLI 854

Query: 630  ADYCSVLRDLDI 595
             D CS LR L +
Sbjct: 855  VDSCSSLRILKL 866



 Score = 54.3 bits (129), Expect = 6e-06
 Identities = 68/273 (24%), Positives = 119/273 (43%), Gaps = 21/273 (7%)
 Frame = -3

Query: 1179 CPNVKQLCLRKCTLLSDNGVVS-FVKA-AESIESLQLEECHRISQ----AGVFGILVHSA 1018
            C N   + L +C+ LS++   + F K   E ++ LQL+   R             + +S 
Sbjct: 562  CDNPVTVQLSECSWLSEDDFETIFGKCRTEILQVLQLDLSGRCMPDYMLPATLAKVPNSM 621

Query: 1017 GKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLS-RLCPNLVHL 841
              LK ++ +  + + D       +    SL SL++C C+      +  L+ +L   L  L
Sbjct: 622  PLLKKISLKGNYRLSDSGLDT-IISAAPSLSSLNLCECSLLTSTGIENLANKLSLVLTEL 680

Query: 840  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCG 661
             +     V    +LP +Q     L  +++SG  +V++K ++ +  +HG  L+ L   GC 
Sbjct: 681  YIDDCLNVDAMMILPSLQKIKH-LEVLSMSGIQSVSNKFVNELIPVHGSNLKELAFAGCL 739

Query: 660  CVTDASLAAIADYCSVLRDLDI-SKSRVSDFGIAALAGGSAI--QFSLQ----------- 523
             +T +S+  IA  C  L  LD+ + +R+ D  +  L  G  +  +  LQ           
Sbjct: 740  QLTSSSIKTIAGNCPQLSSLDLRNLNRLRDSAMRHLRNGCRLIKKIKLQRNTFSDEAVYR 799

Query: 522  ILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNC 424
             L  SG  L ++ CL  + K GN  A    +NC
Sbjct: 800  FLEQSGGYL-TELCLNNVEKAGNLTAYAIARNC 831



 Score = 38.9 bits (89), Expect = 0.27
 Identities = 34/150 (22%), Positives = 54/150 (36%), Gaps = 27/150 (18%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            L+ L    C  +T   I+ ++  CP +  L LR    L D+ +         I+ ++L+ 
Sbjct: 730  LKELAFAGCLQLTSSSIKTIAGNCPQLSSLDLRNLNRLRDSAMRHLRNGCRLIKKIKLQR 789

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFEN---------------------------CFGMKD 970
             +  S   V+  L  S G L  L   N                           C  + +
Sbjct: 790  -NTFSDEAVYRFLEQSGGYLTELCLNNVEKAGNLTAYAIARNCSTHLEVLDLSFCRELTN 848

Query: 969  LAFGVPALPPCNSLRSLSICNCTGFGDASL 880
             A G+  +  C+SLR L +  CT   D  L
Sbjct: 849  EALGL-IVDSCSSLRILKLFGCTQITDVFL 877



>gb:AE013599_1130713 Drosophila melanogaster chromosome 2R, complete
            sequence.>gb:AE003835_1226946 Drosophila melanogaster
            chromosome 2R, section 15 of 74 of the complete
            sequence.>gb:AY069552_1294282 Drosophila melanogaster
            LD27656 full length cDNA.
          Length = 689

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 86/325 (26%), Positives = 144/325 (44%), Gaps = 41/325 (12%)
 Frame = -3

Query: 1434 SLFSSAGNHLMKVK-LQSLNISDI----SLAVIGHYGVALTDLALINLQNINERGFW--- 1279
            S+ ++   HL K+K L+SL+IS+     S  +I   G+A  +  +I   N++        
Sbjct: 332  SITNAGAIHLAKLKCLKSLDISNCDNLTSSGIIE--GIASEENPVIQELNVSYLQICEEC 389

Query: 1278 VMGSGQGLHKLRSLVITAC-QGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGV----VS 1114
            +      L  LRSL +  C  G TD  I++V      +++L L  C+ L+D  +    +S
Sbjct: 390  IKAIASNLRCLRSLHLNHCVNGATDEAIQSVIGQLRWLRELSLEHCSGLTDAALTGINIS 449

Query: 1113 FVKAAESIESLQLEE------------CHRISQAGVFGIL------------VHSAGKLK 1006
             ++ +      Q+                R S AG    +            V  A + +
Sbjct: 450  KLEMSRKQSGSQVSSMDNFYPPYSNTLAERDSLAGSLQSIKISLRSKAEDEIVRDARRKQ 509

Query: 1005 AL--AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVV-LSRLCPNLVHLNL 835
            A+  A+E     +D  F    +     LRSL++  C    D SL   L  +   L  L L
Sbjct: 510  AMLAAYEMNLIRED-DFEGHNIQQLRGLRSLNLRGCNKISDVSLKYGLKHI--ELRRLML 566

Query: 834  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI-AKLHGETLELLNLNGCGC 658
            S    ++  G+     SC + + +++LS C N+TDKTI  + +KL    L+ L+++GC  
Sbjct: 567  SNCQQISLLGMEAMASSCPS-IEELDLSDCYNITDKTIQVVTSKL--PRLKALHISGCSQ 623

Query: 657  VTDASLAAIADYCSVLRDLDISKSR 583
            +T+ +L AI   CS L+ L I + R
Sbjct: 624  LTEHTLDAIITNCSCLQTLSIYRCR 648



 Score = 53.5 bits (127), Expect = 1e-05
 Identities = 40/163 (24%), Positives = 79/163 (48%), Gaps = 1/163 (0%)
 Frame = -3

Query: 1350 GHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPN 1171
            GH    L  L  +NL+  N+     +  G    +LR L+++ CQ ++ LG+EA++  CP+
Sbjct: 527  GHNIQQLRGLRSLNLRGCNKISDVSLKYGLKHIELRRLMLSNCQQISLLGMEAMASSCPS 586

Query: 1170 VKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFE 991
            +++L L  C  ++D  +         +++L +  C ++++  +  I+  +   L+ L+  
Sbjct: 587  IEELDLSDCYNITDKTIQVVTSKLPRLKALHISGCSQLTEHTLDAIIT-NCSCLQTLSIY 645

Query: 990  NCFGM-KDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSR 865
             C  M  DL      L    +LR+L++ N T   +A    L +
Sbjct: 646  RCRSMYTDLE---ERLSGVKTLRNLNMDNLTSIDNAEFFRLKK 685



 Score = 43.9 bits (102), Expect = 0.008
 Identities = 82/406 (20%), Positives = 160/406 (39%), Gaps = 66/406 (16%)
 Frame = -3

Query: 1407 LMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLH------KL 1246
            ++ ++ ++L + + S  +IG   +AL DL L  LQ +   G   +     L+      +L
Sbjct: 238  ILNLQRRTLRVLNFSHTLIGQALLALCDLNL-QLQRLYLAGCRQLNCTTILNFLATQPQL 296

Query: 1245 RSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEEC 1066
             +L ++A   V D  + A+ +  P ++ L +  C  +++ G +   K  + ++SL +  C
Sbjct: 297  CALDLSATMCVNDENLAALVQTNPQLEHLKVNGCLSITNAGAIHLAKL-KCLKSLDISNC 355

Query: 1065 HRISQAGVF-GI-------------------------LVHSAGKLKALAFENCF-GMKDL 967
              ++ +G+  GI                         +  +   L++L   +C  G  D 
Sbjct: 356  DNLTSSGIIEGIASEENPVIQELNVSYLQICEECIKAIASNLRCLRSLHLNHCVNGATDE 415

Query: 966  AFGVPALPPCNSLRSLSICNCTGFGDASLVVLS--------------------------- 868
            A     +     LR LS+ +C+G  DA+L  ++                           
Sbjct: 416  AIQ-SVIGQLRWLRELSLEHCSGLTDAALTGINISKLEMSRKQSGSQVSSMDNFYPPYSN 474

Query: 867  ------RLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAK 706
                   L  +L  + +S L    +  ++   +   A L    ++  I   D     I +
Sbjct: 475  TLAERDSLAGSLQSIKIS-LRSKAEDEIVRDARRKQAMLAAYEMN-LIREDDFEGHNIQQ 532

Query: 705  LHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSL 526
            L G  L  LNL GC  ++D SL     +  + R +  +  ++S  G+ A+A       S+
Sbjct: 533  LRG--LRSLNLRGCNKISDVSLKYGLKHIELRRLMLSNCQQISLLGMEAMASSCP---SI 587

Query: 525  QILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLV 388
            + L LS C   +DK +  +      L  L+I  C  ++   +D ++
Sbjct: 588  EELDLSDCYNITDKTIQVVTSKLPRLKALHISGCSQLTEHTLDAII 633



 Score = 41.6 bits (96), Expect = 0.042
 Identities = 56/249 (22%), Positives = 97/249 (38%), Gaps = 4/249 (1%)
 Frame = -3

Query: 1137 LSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFG 958
            L+D      +     + SL L+ C  +  +G F    +++          C  + DLA  
Sbjct: 114  LNDKQFYGMLGVLPHLHSLSLKRCLPLFMSGSFLDSYNNS----------CPDLNDLASN 163

Query: 957  VPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSG----LNGVTDYGLLPFV 790
            +  +      + L++C      DA L+ L+   P+L  +N+SG     +        P  
Sbjct: 164  LAGI------KELTLCENQYLTDAILMRLTSFMPSLEAINMSGCHIAFHNAIHRRFYPAT 217

Query: 789  QSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVL 610
             S D  L   ++     +T K I  I  L   TL +LN +    +   +L A+ D    L
Sbjct: 218  SSSDHVLPSESV-----LTFKFILTILNLQRRTLRVLNFS--HTLIGQALLALCDLNLQL 270

Query: 609  RDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQ 430
            + L ++  R        +    A Q  L  L LS  +  +D+ L  L +    L  L + 
Sbjct: 271  QRLYLAGCR--QLNCTTILNFLATQPQLCALDLSATMCVNDENLAALVQTNPQLEHLKVN 328

Query: 429  NCVGISHRG 403
             C+ I++ G
Sbjct: 329  GCLSITNAG 337



>gb:AE017150_1029578 Trypanosoma brucei chromosome 2, complete
            sequence.>gb:AE017167_1229778 Trypanosoma brucei
            chromosome 2, section 1 of 4 of the complete sequence.
          Length = 1110

 Score = 57.8 bits (138), Expect = 6e-07
 Identities = 106/392 (27%), Positives = 164/392 (41%), Gaps = 51/392 (13%)
 Frame = -3

Query: 1413 NHLMKVKLQSLNISDISLAVIGHYGVA--LTDLALINLQNINERGFWVMGSGQGLHKLRS 1240
            + L  +K   LN +DI  + IG       L+ L++    NI +           L  L  
Sbjct: 221  SRLTNLKCLELNSTDIDDSCIGEISACAKLSKLSVSECNNITDAT-----PISQLAALEE 275

Query: 1239 LVITACQGVTDLGIEAVSK-----------------------GCPNVKQLCLRKCTLLSD 1129
            L + +C  +T  GIE +                          C ++++L +  C  L+D
Sbjct: 276  LNLNSCYHITK-GIETLGMLLRLRMLDLSGVPVEDNCLKDLCDCGSLERLNISYCIQLTD 334

Query: 1128 NGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPA 949
               ++ +  A +IE L L  C RI++    G+ V +  KL+ L       MKD+    P+
Sbjct: 335  ---INPLSNATAIEELNLNGCRRITRG--IGV-VWALPKLRVLH------MKDVHLSEPS 382

Query: 948  LPPCN---SLRSLSICNCTGFGD----ASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFV 790
            L       SL  LS+ NC GFGD    ++LV L  L  NL H      +G+   G LP +
Sbjct: 383  LDSVGTGGSLVRLSLENCKGFGDVKPLSNLVTLEEL--NL-HYCDKVTSGMGTLGRLPQL 439

Query: 789  QSCDAG------------------LVKVNLSGCINVTDKTISAIAKLHGETLELLNL-NG 667
            +  D G                  LV +NLS C  +T  +ISAIA L    LE LN+ N 
Sbjct: 440  RVLDLGRTQVDNNSLENICTSSIPLVSLNLSHCKKIT--SISAIASL--TALEELNIDNS 495

Query: 666  CGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASD 487
            C   +  ++         LR   +S +R++D  I  ++       SL  L+L+ C   +D
Sbjct: 496  CNVTSGWNVFGTLHQ---LRVATLSNTRINDENIRHVSECK----SLNTLNLAFCKDITD 548

Query: 486  KCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
              +  L K+   L  LN+  C  I  +G++ L
Sbjct: 549  --VTALSKI-TMLEELNLDCCPNI-RKGIETL 576



 Score = 38.5 bits (88), Expect = 0.35
 Identities = 63/274 (22%), Positives = 112/274 (40%), Gaps = 5/274 (1%)
 Frame = -3

Query: 1398 VKLQSLNISDISLAVIGHYGVALTDLALINLQN-INERGFW-VMGSGQGLHKLRSLVITA 1225
            + L SLN+S            +LT L  +N+ N  N    W V G+   LH+LR   ++ 
Sbjct: 462  IPLVSLNLSHCKKITSISAIASLTALEELNIDNSCNVTSGWNVFGT---LHQLRVATLSN 518

Query: 1224 CQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAG 1045
             + + D  I  VS+ C ++  L L  C  ++D   V+ +     +E L L+ C  I +  
Sbjct: 519  TR-INDENIRHVSE-CKSLNTLNLAFCKDITD---VTALSKITMLEELNLDCCPNIRKG- 572

Query: 1044 VFGILVHSAGKL---KALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVV 874
                 + + GKL   + L+ + C+     A     L    SL  L++    GF     + 
Sbjct: 573  -----IETLGKLPKARILSMKECYMGDGYAQQCSILGNSKSLVKLNLERSMGFISVKALS 627

Query: 873  LSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGE 694
                   LV  +   +  +  +  LP ++  +     +N     N+++           +
Sbjct: 628  NIATLEELVLDHAEEVCCIPSFSCLPRLRVLNLKYTDINGDVTKNISES----------K 677

Query: 693  TLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS 592
            +L  LNL+ C  VTD S   +    S L +L+++
Sbjct: 678  SLRSLNLSHCKWVTDIS---VLSSLSTLEELNVN 708



 Score = 36.6 bits (83), Expect = 1.3
 Identities = 63/260 (24%), Positives = 103/260 (39%), Gaps = 61/260 (23%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGI---------------EAVSKGCPNVKQLCLRKCTLLSDNGV-- 1120
            LRSL ++ C+ VTD+ +                 + KG  ++ +L L +  +LSD  +  
Sbjct: 679  LRSLNLSHCKWVTDISVLSSLSTLEELNVNCCNGIRKGWESLGKLPLLRVAILSDTNIAA 738

Query: 1119 --VSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPAL 946
              ++ + + +++  L+   C ++S   V    V+    L+ L   +C    D   G+  L
Sbjct: 739  KDIACLSSCKTLVKLKFFRCEKLSDVTV----VYKIQSLEELIVRSC---SDGLKGLNDL 791

Query: 945  PPCNSLRSLSICNCTG-------FGDASLVV---------LSRLCP-----NLVHLNL-- 835
                 LR L + N  G        G +  +V         L+ + P     +L  L+L  
Sbjct: 792  GTLPRLRFLLLRNVRGSDISVESIGTSKSLVRLHIEMRKELTDITPLSNITSLEELSLRE 851

Query: 834  --SGLNGVTDYGLLPFVQSCDAGL-----------------VKVNLSGCINVTDKTISAI 712
                L GV   G LP ++S D GL                   +NL+    +TD  IS I
Sbjct: 852  CGDNLEGVGTLGKLPRLKSLDLGLSDISNSALNDIFLSRSITSLNLASSWKLTD--ISHI 909

Query: 711  AKLHGETLELLNLNGCGCVT 652
            + L    LE LNL  C  +T
Sbjct: 910  SNL--TALEELNLRRCYPIT 927



>gb:BC053821_2550768 Xenopus laevis hypothetical protein MGC64561,
            mRNA (cDNA clone MGC:64561 IMAGE:6880228), complete cds.
          Length = 292

 Score = 57.4 bits (137), Expect = 7e-07
 Identities = 36/151 (23%), Positives = 68/151 (45%)
 Frame = -3

Query: 1254 HKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQL 1075
            H L  + + +C  +T   + A+S  CP+++ +CL  C  +    + S     + +E++ L
Sbjct: 107  HHLTYINLNSCGQLTRQSLVAISLSCPHLQNICLGHCDWVDCLSMRSLADHCKCLEAIDL 166

Query: 1074 EECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGF 895
              C ++    +   LV  + +LK+L+      + D+A    A   C  L  L +  C   
Sbjct: 167  TACRQLKDDAI-SYLVQKSTRLKSLSLAVNANISDIAVEETA-KSCRDLEHLDLTGCLRV 224

Query: 894  GDASLVVLSRLCPNLVHLNLSGLNGVTDYGL 802
             + S+  L+  C NL  L +   + VT+  L
Sbjct: 225  KNDSIRTLAEYCNNLKSLKVKHCHNVTESSL 255



 Score = 39.7 bits (91), Expect = 0.16
 Identities = 30/115 (26%), Positives = 57/115 (49%)
 Frame = -3

Query: 939 CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKV 760
           C  L+++ + +C      S+  L+  C  L  ++L+    + D  +   VQ     L  +
Sbjct: 132 CPHLQNICLGHCDWVDCLSMRSLADHCKCLEAIDLTACRQLKDDAISYLVQK-STRLKSL 190

Query: 759 NLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI 595
           +L+   N++D  +   AK   + LE L+L GC  V + S+  +A+YC+ L+ L +
Sbjct: 191 SLAVNANISDIAVEETAKSCRD-LEHLDLTGCLRVKNDSIRTLAEYCNNLKSLKV 244



 Score = 39.3 bits (90), Expect = 0.21
 Identities = 47/184 (25%), Positives = 75/184 (40%), Gaps = 2/184 (1%)
 Frame = -3

Query: 942 PCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVK 763
           P +SL  + +CNC  F        ++L P L     S L               +  L K
Sbjct: 43  PFHSLVHIYLCNCRHFDS------TQLGPQLPKTTFSEL------------LKNNTVLQK 84

Query: 762 VNLSGCIN-VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK- 589
           ++L  C + +TDK +  I       L  +NLN CG +T  SL AI+  C  L+++ +   
Sbjct: 85  LDLQSCSDWLTDKELLPIIG-QNHHLTYINLNSCGQLTRQSLVAISLSCPHLQNICLGHC 143

Query: 588 SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISH 409
             V    + +LA        L+ + L+ C    D  + YL +    L  L++     IS 
Sbjct: 144 DWVDCLSMRSLADHCK---CLEAIDLTACRQLKDDAISYLVQKSTRLKSLSLAVNANISD 200

Query: 408 RGVD 397
             V+
Sbjct: 201 IAVE 204



>gb:AP005295_1850048 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1695_D07.
          Length = 281

 Score = 57.4 bits (137), Expect = 7e-07
 Identities = 38/117 (32%), Positives = 60/117 (51%)
 Frame = -3

Query: 1323 LALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKC 1144
            L L    N ++ G   + S + L  L    +  C  + DLG+ ++++  PN++ L LRKC
Sbjct: 164  LMLNGASNFDDEGMKGLSSSRSLETLE---LVDCMFIGDLGMRSIAR-TPNLRNLTLRKC 219

Query: 1143 TLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMK 973
              ++DNGV   V  A+++ESL +  CHRIS   V G         ++   E+  GMK
Sbjct: 220  VCVTDNGVSELVH-AQNLESLTIIGCHRISLKAVQGAARSVYYSAESEKHESLKGMK 275



>gb:AK175607_1817595 Arabidopsis thaliana mRNA, partial cds, clone:
            RAFL22-08-D10.>gb:AK175925_1817913 Arabidopsis thaliana
            mRNA, partial cds, clone: RAFL22-58-M23.
          Length = 169

 Score = 57.4 bits (137), Expect = 7e-07
 Identities = 49/189 (25%), Positives = 84/189 (44%)
 Frame = -3

Query: 1266 GQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIE 1087
            G+  ++L+SL +  C+ ++D G+ +++ GCP+++ L L  C L++D  VV+       + 
Sbjct: 1    GENCNQLQSLNLGWCENISDDGVMSLAYGCPDLRTLDLCSCVLITDESVVALANRCIHLR 60

Query: 1086 SLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICN 907
            SL L  C  I+   ++  L  S  K K    E    +K   F          LRSL+I  
Sbjct: 61   SLGLYYCRNITDRAMYS-LAQSGVKNK---HEMWRAVKKGKFDE------EGLRSLNISQ 110

Query: 906  CTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDK 727
            CT                  +L  S +  V D    P + +C +G   + +SGC+N+   
Sbjct: 111  CT------------------YLTPSAVQAVCD--TFPALHTC-SGRHSLVMSGCLNLQSV 149

Query: 726  TISAIAKLH 700
              + I + H
Sbjct: 150  HCACILQAH 158



>gb:BX908798_829754 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 329

 Score = 57.4 bits (137), Expect = 7e-07
 Identities = 42/128 (32%), Positives = 66/128 (51%)
 Frame = -3

Query: 1185 KGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLK 1006
            K C N+K L L+ C  L+D G ++ +   E+++ L L EC  ++ AG+  + +  A  L+
Sbjct: 206  KNCKNLKVLQLQACRNLTDVG-LAHLAPLEALKHLNLSECDNLTDAGLAHLTLLIA--LQ 262

Query: 1005 ALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGL 826
             L  + C  + D   G+  L P  +L+ L++  C    D  L  L  L   L HL+L G 
Sbjct: 263  YLDLKGCAKLTDA--GLARLRPLVALQHLNLKGCDNLTDIGLAHLRPLVA-LQHLDLDGC 319

Query: 825  NGVTDYGL 802
            N +TD GL
Sbjct: 320  NNLTDAGL 327



 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 47/156 (30%), Positives = 72/156 (46%), Gaps = 1/156 (0%)
 Frame = -3

Query: 936 NSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVN 757
           N + ++   +     DA L+ L   C NL  L L     +TD GL          L  +N
Sbjct: 184 NEIEAIHFSDNVYLTDAHLLTLKN-CKNLKVLQLQACRNLTDVGLAHLAPL--EALKHLN 240

Query: 756 LSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRV 580
           LS C N+TD  ++ +  L    L+ L+L GC  +TDA LA +    + L+ L++     +
Sbjct: 241 LSECDNLTDAGLAHLTLLIA--LQYLDLKGCAKLTDAGLARLRPLVA-LQHLNLKGCDNL 297

Query: 579 SDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPY 472
           +D G+A L        +LQ L L GC   +D  L +
Sbjct: 298 TDIGLAHLRP----LVALQHLDLDGCNNLTDAGLAH 329



>gb:AB025621_1516430 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MFG13.>gb:BT020276_1642671 Arabidopsis thaliana
            At5g51380 mRNA, complete cds.>gb:BT020447_1642841
            Arabidopsis thaliana At5g51380 mRNA, complete cds.
          Length = 479

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 58/267 (21%), Positives = 118/267 (44%), Gaps = 1/267 (0%)
 Frame = -3

Query: 1398 VKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQ 1219
            +KL  +N +++ L  +      L +L L    +   RG     + +GL  + S+      
Sbjct: 190  IKLVVINATELGLLSLAEDCSDLQELELHKCSDNLLRGIAACENLRGLRLVGSVDGLYSS 249

Query: 1218 GVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVF 1039
             V+D+G+  +++GC  + +L L  C   S +G+ +  +  E +E L + + HR+    + 
Sbjct: 250  SVSDIGLTILAQGCKRLVKLELSGCE-GSFDGIKAIGQCCEVLEELSICD-HRMDDGWIA 307

Query: 1038 GILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLC 859
             +    +  LK L   +C  +         L  C +L SL +  C       +  L ++C
Sbjct: 308  ALSYFES--LKTLLISSCRKIDSSPGPGKLLGSCPALESLQLRRCCLNDKEGMRALFKVC 365

Query: 858  PNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELL 679
              +  +N+    G+ D      +      +  ++L GC  +T   + ++  LH E LE +
Sbjct: 366  DGVTKVNIQDCWGLDDDSF--SLAKAFRRVRFLSLEGCSILTTSGLESVI-LHWEELESM 422

Query: 678  NLNGCGCVTDASL-AAIADYCSVLRDL 601
             +  C  + D+ + AA++   S+L++L
Sbjct: 423  RVVSCKNIKDSEISAALSSLFSLLKEL 449



 Score = 41.6 bits (96), Expect = 0.042
 Identities = 50/204 (24%), Positives = 76/204 (37%), Gaps = 29/204 (14%)
 Frame = -3

Query: 939 CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGL------NGVTDYGLLPFVQSCD 778
           C+ L+ L +  C+     +L+     C NL  L L G       + V+D GL    Q C 
Sbjct: 209 CSDLQELELHKCSD----NLLRGIAACENLRGLRLVGSVDGLYSSSVSDIGLTILAQGCK 264

Query: 777 AGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLD 598
             LVK+ LSGC    D                             + AI   C VL +L 
Sbjct: 265 R-LVKLELSGCEGSFD----------------------------GIKAIGQCCEVLEELS 295

Query: 597 ISKSRVSDFGIAALAGGSAIQF-----------------------SLQILSLSGCVLASD 487
           I   R+ D  IAAL+   +++                        +L+ L L  C L   
Sbjct: 296 ICDHRMDDGWIAALSYFESLKTLLISSCRKIDSSPGPGKLLGSCPALESLQLRRCCLNDK 355

Query: 486 KCLPYLHKLGNSLAGLNIQNCVGI 415
           + +  L K+ + +  +NIQ+C G+
Sbjct: 356 EGMRALFKVCDGVTKVNIQDCWGL 379



 Score = 35.8 bits (81), Expect = 2.3
 Identities = 28/151 (18%), Positives = 68/151 (45%), Gaps = 1/151 (0%)
 Frame = -3

Query: 1434 SLFSSAGNHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGL 1255
            ++ +     L+K++L     S   +  IG     L +L++ + +  +    W+       
Sbjct: 257  TILAQGCKRLVKLELSGCEGSFDGIKAIGQCCEVLEELSICDHRMDDG---WIAALSY-F 312

Query: 1254 HKLRSLVITACQGV-TDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQ 1078
              L++L+I++C+ + +  G   +   CP ++ L LR+C L    G+ +  K  + +  + 
Sbjct: 313  ESLKTLLISSCRKIDSSPGPGKLLGSCPALESLQLRRCCLNDKEGMRALFKVCDGVTKVN 372

Query: 1077 LEECHRISQAGVFGILVHSAGKLKALAFENC 985
            +++C  +        L  +  +++ L+ E C
Sbjct: 373  IQDCWGLDDDSF--SLAKAFRRVRFLSLEGC 401



>gb:AC116305_1206202 Dictyostelium discoideum chromosome 2 map
            1005175-1418323 strain AX4, complete sequence.
          Length = 638

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 48/211 (22%), Positives = 98/211 (46%), Gaps = 5/211 (2%)
 Frame = -3

Query: 1398 VKLQSLN---ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVIT 1228
            VKL+S+N   + +I+   I H  +  T+L+ +N   I+  G+ +           S+ + 
Sbjct: 180  VKLKSINLHKVENITTTGICHI-IKNTNLSFLNFNGIS--GWDIRTLAPYCAHFTSMDLG 236

Query: 1227 ACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQA 1048
            +   ++D  ++A+++ C  +K + L+ C L++D+GV+  +     +  L L  C ++++ 
Sbjct: 237  SSNNLSDDDLKALTRQCKKLKFISLKSCKLITDHGVLELIHDCPQLMDLNLASCSKVTRT 296

Query: 1047 GVFGIL--VHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVV 874
             V  +L  +H+   L   +F+N   +  + F        N+L ++ + + T   D  +  
Sbjct: 297  SVQHVLQNLHNLTTLNLSSFKN---IHPITFPKNPYRLLNTLTTIDL-SFTDVKDEDIFQ 352

Query: 873  LSRLCPNLVHLNLSGLNGVTDYGLLPFVQSC 781
            L+    NL  L L     VTD  +L     C
Sbjct: 353  LTEYAANLKSLRLVACVEVTDESMLMIATHC 383



 Score = 55.1 bits (131), Expect = 4e-06
 Identities = 73/327 (22%), Positives = 122/327 (37%), Gaps = 59/327 (18%)
 Frame = -3

Query: 1332 LTDLALINLQNINER----GFWVMGSGQ----GLHKLRSLVITACQGVTDLGIEAVSKGC 1177
            L  + LINL N+N +     + V  + Q     LH LR         +T+   + +   C
Sbjct: 104  LASVRLINLNNLNIKQKTIDYIVTHTPQLKEIRLHNLR---------LTEKTSKLLVAKC 154

Query: 1176 PNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALA 997
            PN++Q+ +      SD  +      A  ++S+ L +   I+  G+  I+     K   L+
Sbjct: 155  PNLEQVYMDGGRT-SDECLELLANGAVKLKSINLHKVENITTTGICHII-----KNTNLS 208

Query: 996  FENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGV 817
            F N  G+        A P C    S+ + +     D  L  L+R C  L  ++L     +
Sbjct: 209  FLNFNGISGWDIRTLA-PYCAHFTSMDLGSSNNLSDDDLKALTRQCKKLKFISLKSCKLI 267

Query: 816  TDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAK-LHGET----------------- 691
            TD+G+L  +  C   L+ +NL+ C  VT  ++  + + LH  T                 
Sbjct: 268  TDHGVLELIHDCPQ-LMDLNLASCSKVTRTSVQHVLQNLHNLTTLNLSSFKNIHPITFPK 326

Query: 690  ---------------------------------LELLNLNGCGCVTDASLAAIADYCSVL 610
                                             L+ L L  C  VTD S+  IA +C  L
Sbjct: 327  NPYRLLNTLTTIDLSFTDVKDEDIFQLTEYAANLKSLRLVACVEVTDESMLMIATHCKKL 386

Query: 609  RDLDISKSRVSDFGIAALAGGSAIQFS 529
              +D+S+ +      +   G   I F+
Sbjct: 387  FCVDLSRDQQQSSNYSTSKGPMKITFA 413



>gb:OSJN00216_1696873 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0076A22, complete sequence.
          Length = 479

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 93/413 (22%), Positives = 148/413 (35%), Gaps = 89/413 (21%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLG 1201
            +I +  L V+      L D+ L     IN+ G   +   +   KL SL + +   VT  G
Sbjct: 81   HIDNQGLFVLTSCCTLLNDITLSFCSKINDAGIACLTYCK---KLMSLKLNSIPEVTSSG 137

Query: 1200 IEAVSKGCPNVKQLCLRKCT-LLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVH 1024
            +  V+ GC  +  L L  C  +      + ++ +  S+E L +  C  +SQ   +  L  
Sbjct: 138  LLMVAFGCKALSSLYLNDCKGIAGSTEWLEYLGSDGSLEELIVSNCKGVSQ---YNFLKF 194

Query: 1023 SAG--KLKALAFEN-------------------------CFGMKDLAFGVPALPP----- 940
              G  KLK   +EN                         C  +KDL        P     
Sbjct: 195  GPGWMKLKTFEYENKENFFSIHPRYGSSVKANTHRYELCCENLKDLKLVRLVTEPDGPEI 254

Query: 939  --------CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL----------------- 835
                    C +L  L +   TG  D  ++VLS+ C NL  ++L                 
Sbjct: 255  GLRFLLGKCKALEKLCLEYVTGVIDNDMIVLSQACKNLKSISLWLKPEHYVVGGHIEFRT 314

Query: 834  ---------SGLN----------------------GVTDYGLLPFVQSCDAGLVKVNLSG 748
                       LN                      G T  GL+ FV+SC   ++ +N  G
Sbjct: 315  GFTDESLKALALNCPLLQDVELTFTGCAHWDPPEIGFTQEGLVSFVESCPIRVLVLN--G 372

Query: 747  CINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFG 568
             +   +K + A++    + LE L+L  C  VTD  +  I  + S++         V++ G
Sbjct: 373  ALFFNNKGMKALSS--AQFLETLSLIDCNEVTDHGMRFIVHFPSLINLTLRFCHNVTNAG 430

Query: 567  IAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISH 409
            ++ LA        LQ L + GC   S K +     LG + +     NC  + H
Sbjct: 431  LSELAHAQ----KLQSLDVGGCGYISQKGV-----LGAAKSVYYEVNCKSLGH 474



>pir|T05201|T05201 hypothetical protein F4I10.140 - Arabidopsis
            thaliana>gb:ATCHRIV79_1547241 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 79.>gb:ATF4I10_1550703
            Arabidopsis thaliana DNA chromosome 4, BAC clone F4I10
            (ESSA project).
          Length = 934

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 71/284 (25%), Positives = 119/284 (41%), Gaps = 33/284 (11%)
 Frame = -3

Query: 1182 GCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQ-LEECHRISQAGVFGIL-------V 1027
            G P V  L ++  T L +  V++  K   S    Q L EC+ +    V   +       +
Sbjct: 265  GAPAVNALAMKAATTLRNLEVLTIGKGHISESFFQALGECNMLRSVTVSDAILGNGAQEI 324

Query: 1026 H-SAGKLKALAFENCFGMKDLAFGVP--------------ALPPCNSLRSLSICNCTGFG 892
            H S  +L+ L    C  M+ L+   P              A+  C  L+ L I +C    
Sbjct: 325  HLSHDRLRELKITKCRVMR-LSIRCPQLRSLSLKRSNMSQAMLNCPLLQLLDIASCHKLL 383

Query: 891  DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI 712
            DA++   +  CP L  L++S  + V+D  L    Q+C A L  +N S C N+      ++
Sbjct: 384  DAAIRSAAISCPQLESLDVSNCSCVSDETLREIAQAC-ANLHILNASYCPNI------SL 436

Query: 711  AKLHGETLELLNLNGCGCVTDASLAAIA----------DYCSVLRDLDISKSRVSDFGIA 562
              +H   L +L L+ C  +T AS+  IA          D C++L  + +  SR+    I+
Sbjct: 437  ESVHLPMLTVLKLHSCEGITSASMTWIANSPALEVLELDNCNLLTTVSLHLSRLQ--SIS 494

Query: 561  ALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQ 430
             +        +LQ + LS   +++   L  +    N+L  L +Q
Sbjct: 495  LVHCRKFTDLNLQSIMLSSITVSNCPALRRITITSNALRRLALQ 538



 Score = 51.2 bits (121), Expect = 5e-05
 Identities = 70/263 (26%), Positives = 110/263 (41%), Gaps = 9/263 (3%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            L SL +  C+ VT L ++     CP ++Q+CL  C    D+   +F +   ++ SL L  
Sbjct: 602  LASLSLVGCRAVTSLELK-----CPRIEQICLDGC----DHLETAFFQPV-ALRSLNLGI 651

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPP-----CNSLRS--LSIC 910
            C ++S      +L   A  + +L  + C  + + +   P L       C+ LR   LS  
Sbjct: 652  CPKLS------VLNIEAPYMVSLELKGCGVLSEASIMCPLLTSLDASFCSQLRDDCLSAT 705

Query: 909  NCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTD 730
              +     SLV++S  CP++    LS LNG+ +  +L    +    L  V    CI    
Sbjct: 706  TASCPLIESLVLMS--CPSIGSDGLSSLNGLPNLTVLDLSYTFLMNLEPV-FKSCIQ--- 759

Query: 729  KTISAIAKLHGETLELLNLNGCGCVTDASLAAI--ADYCSVLRDLDISKSRVSDFGIAAL 556
                         L++L L  C  +TD+SL  +        L +LD+S   +    I  L
Sbjct: 760  -------------LKVLKLQACKYLTDSSLEPLYKEGALPALEELDLSYGTLCQTAIDDL 806

Query: 555  AGGSAIQFSLQILSLSGCVLASD 487
                A    L  LSL+GCV   D
Sbjct: 807  L---ACCTHLTHLSLNGCVNMHD 826



>gb:AE014134_1127557 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003608_1217664 Drosophila melanogaster
           chromosome 2L, section 17 of 83 of the complete
           sequence.
          Length = 319

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 49/172 (28%), Positives = 79/172 (45%), Gaps = 5/172 (2%)
 Frame = -3

Query: 891 DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI 712
           D +  VL+R C  L  L+L+    +TD  LLP + +    L  VNL+ C+N+T  ++  I
Sbjct: 98  DVAFRVLARCCQRLEVLHLACCRWLTDELLLPLLANNKKRLWAVNLNECVNITALSLQPI 157

Query: 711 AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQF 532
             +  + L +L L+ C  +T  ++ A+  + S L + DIS          A+     I F
Sbjct: 158 I-VECKELRVLKLSKCQWLTTGAVDALTLHQSKLVEFDISY-------CGAIGERCLIIF 209

Query: 531 -----SLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
                 L +LSL+     +D+ L  +      L  +N+  C  IS  GV  L
Sbjct: 210 FRKLNKLTVLSLANTPSVTDQVLIQIGNYCRELEHINVIGCAAISDYGVHAL 261



 Score = 45.1 bits (105), Expect = 0.004
 Identities = 36/181 (19%), Positives = 77/181 (42%), Gaps = 1/181 (0%)
 Frame = -3

Query: 1251 KLRSLVITACQGVTD-LGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQL 1075
            +L  L +  C+ +TD L +  ++     +  + L +C  ++   +   +   + +  L+L
Sbjct: 110  RLEVLHLACCRWLTDELLLPLLANNKKRLWAVNLNECVNITALSLQPIIVECKELRVLKL 169

Query: 1074 EECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGF 895
             +C  ++   V  + +H + KL       C  + +    +      N L  LS+ N    
Sbjct: 170  SKCQWLTTGAVDALTLHQS-KLVEFDISYCGAIGERCL-IIFFRKLNKLTVLSLANTPSV 227

Query: 894  GDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISA 715
             D  L+ +   C  L H+N+ G   ++DYG+      C   L  + +  C  VT+ +++ 
Sbjct: 228  TDQVLIQIGNYCRELEHINVIGCAAISDYGVHALTVHC-LRLRTLLIRRCPRVTELSLAP 286

Query: 714  I 712
            +
Sbjct: 287  L 287



>gb:BC084522_2563893 Xenopus tropicalis hypothetical LOC496536, mRNA
            (cDNA clone MGC:89812 IMAGE:7028351), complete cds.
          Length = 292

 Score = 55.5 bits (132), Expect = 3e-06
 Identities = 36/151 (23%), Positives = 67/151 (44%)
 Frame = -3

Query: 1254 HKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQL 1075
            H L  + + +C  +T   + A+S  CP+++ +CL  C  +    + S V   + +E++ L
Sbjct: 107  HHLIHINLNSCGQLTRQSLVAISLSCPHLQNICLGHCEWVDCLSLRSLVDHCKCLEAIDL 166

Query: 1074 EECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGF 895
              C ++        LV  + +LK+L+      + D+A    A   C  L  L +  C   
Sbjct: 167  TACRQLKD-DTISYLVQKSTRLKSLSLAVNANISDIAVEETA-KNCRDLEHLDLTGCLRV 224

Query: 894  GDASLVVLSRLCPNLVHLNLSGLNGVTDYGL 802
             + S+  L+  C  L  L +   + VT+  L
Sbjct: 225  KNDSIRTLAEYCTKLKSLKVKHCHNVTESSL 255



 Score = 43.9 bits (102), Expect = 0.008
 Identities = 45/204 (22%), Positives = 78/204 (38%), Gaps = 33/204 (16%)
 Frame = -3

Query: 1107 KAAESIESLQLEECHRISQA--------GVFGILVHSAGKLKALAFENCFGMKDLAFGVP 952
            K  +S+  L L  C                F  L+ +   L+ L  ++C         +P
Sbjct: 42   KPFQSLVHLYLANCRHFDSTQLGSQLPKSTFSELLRNNTVLQKLDLQSCCDWLTDKELLP 101

Query: 951  ALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAG 772
             +   + L  +++ +C      SLV +S  CP+L ++ L     V    L   V  C   
Sbjct: 102  VIGQNHHLIHINLNSCGQLTRQSLVAISLSCPHLQNICLGHCEWVDCLSLRSLVDHCKC- 160

Query: 771  LVKVNLSGCINVTDKTISAIAKL-------------------------HGETLELLNLNG 667
            L  ++L+ C  + D TIS + +                          +   LE L+L G
Sbjct: 161  LEAIDLTACRQLKDDTISYLVQKSTRLKSLSLAVNANISDIAVEETAKNCRDLEHLDLTG 220

Query: 666  CGCVTDASLAAIADYCSVLRDLDI 595
            C  V + S+  +A+YC+ L+ L +
Sbjct: 221  CLRVKNDSIRTLAEYCTKLKSLKV 244



>gb:AY359238_1948007 Homo sapiens F-box and leucine-rich repeat
           protein 13 transcript variant 1 (FBXL13) mRNA, complete
           cds.
          Length = 453

 Score = 55.5 bits (132), Expect = 3e-06
 Identities = 48/188 (25%), Positives = 80/188 (42%), Gaps = 1/188 (0%)
 Frame = -3

Query: 939 CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKV 760
           C +L+ L++ +C  F D S+  +S  CP ++ LNLS  N       +  +      L  +
Sbjct: 244 CRNLQELNVSDCPTFTDESMRHISEGCPGVLCLNLS--NTTITNRTMRLLPRHFHNLQNL 301

Query: 759 NLSGCINVTDKTISAIAKLHG-ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR 583
           +L+ C   TDK +  +   +G   L  L+L+GC  +TD+++  ++  C  L  LDI    
Sbjct: 302 SLAYCRRFTDKGLQYLNLGNGCHKLIYLDLSGCTQITDSAMEMLSAKCHYLHILDI---- 357

Query: 582 VSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRG 403
                                   SGCVL +D+ L  L      L  L +Q C  IS + 
Sbjct: 358 ------------------------SGCVLLTDQILEDLQIGCKQLRILKMQYCTNISKKA 393

Query: 402 VDLLVERL 379
              +  ++
Sbjct: 394 AQRMSSKV 401



 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 27/116 (23%), Positives = 57/116 (49%)
 Frame = -3

Query: 1398 VKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQ 1219
            + L +  I++ ++ ++  +   L +L+L   +   ++G   +  G G HKL  L ++ C 
Sbjct: 276  LNLSNTTITNRTMRLLPRHFHNLQNLSLAYCRRFTDKGLQYLNLGNGCHKLIYLDLSGCT 335

Query: 1218 GVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQ 1051
             +TD  +E +S  C  +  L +  C LL+D  +       + +  L+++ C  IS+
Sbjct: 336  QITDSAMEMLSAKCHYLHILDISGCVLLTDQILEDLQIGCKQLRILKMQYCTNISK 391



 Score = 44.7 bits (104), Expect = 0.005
 Identities = 51/225 (22%), Positives = 89/225 (39%), Gaps = 5/225 (2%)
 Frame = -3

Query: 1386 SLNISDISLAVIGHYGVALTDLALINLQNINERGFWV----MGSGQGLHKLRSLVITACQ 1219
            +++ S +   +   Y V+      +N+  +N RG  +      S      L+ L ++ C 
Sbjct: 197  AIDFSSVKNVIPDKYIVSTLQRWRLNVLRLNFRGCLLRPKTFRSVSHCRNLQELNVSDCP 256

Query: 1218 GVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFV-KAAESIESLQLEECHRISQAGV 1042
              TD  +  +S+GCP V  LCL        N  +  + +   ++++L L  C R +  G 
Sbjct: 257  TFTDESMRHISEGCPGV--LCLNLSNTTITNRTMRLLPRHFHNLQNLSLAYCRRFTDKG- 313

Query: 1041 FGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRL 862
                      L+ L   N                C+ L  L +  CT   D+++ +LS  
Sbjct: 314  ----------LQYLNLGN---------------GCHKLIYLDLSGCTQITDSAMEMLSAK 348

Query: 861  CPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDK 727
            C  L  L++SG   +TD  L      C   L  + +  C N++ K
Sbjct: 349  CHYLHILDISGCVLLTDQILEDLQIGCKQ-LRILKMQYCTNISKK 392



>gb:AE016818_1748292 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome V, complete sequence.
          Length = 1112

 Score = 55.1 bits (131), Expect = 4e-06
 Identities = 41/171 (23%), Positives = 74/171 (43%)
 Frame = -3

Query: 1095 SIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLS 916
            S+  L L  C  I+   ++ I +++  +L  L    C G+ D+ F   +     +L +L 
Sbjct: 905  SLHKLVLRYCKNITDTTLYHISIYAKERLTYLDLTRCTGLTDMGFSYWSSQLFMNLHTLI 964

Query: 915  ICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINV 736
            +  C    D  +  +    PNL HLNLS    +T+  +      C   L  ++LS C   
Sbjct: 965  LTECIFLTDVGIRSIVNCAPNLEHLNLSFCCSLTELAVELLWIGC-LHLRTLDLSFCGRA 1023

Query: 735  TDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR 583
             +        +H   L+ + L GC  +T + + ++    + L  +DIS+ R
Sbjct: 1024 VNNVSLLGISMHLRKLQRIILKGCPRITRSGVDSLLGGFAPLAYIDISQCR 1074



 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 40/136 (29%), Positives = 64/136 (47%), Gaps = 4/136 (2%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVA-LTDLALINLQNINERGF--WVMGSGQGLHKLRSLVITACQGVT 1210
            NI+D +L  I  Y    LT L L     + + GF  W   S Q    L +L++T C  +T
Sbjct: 916  NITDTTLYHISIYAKERLTYLDLTRCTGLTDMGFSYW---SSQLFMNLHTLILTECIFLT 972

Query: 1209 DLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHR-ISQAGVFGI 1033
            D+GI ++    PN++ L L  C  L++  V         + +L L  C R ++   + GI
Sbjct: 973  DVGIRSIVNCAPNLEHLNLSFCCSLTELAVELLWIGCLHLRTLDLSFCGRAVNNVSLLGI 1032

Query: 1032 LVHSAGKLKALAFENC 985
             +H   KL+ +  + C
Sbjct: 1033 SMH-LRKLQRIILKGC 1047



>gb:CR382139_1672396 Debaryomyces hansenii chromosome G of strain
            CBS767 of Debaryomyces hansenii.
          Length = 536

 Score = 55.1 bits (131), Expect = 4e-06
 Identities = 40/153 (26%), Positives = 76/153 (49%), Gaps = 5/153 (3%)
 Frame = -3

Query: 1251 KLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLE 1072
            K++ +VIT  + + D  +  V+K CPN++ L +R C L+SD+G+    K    + ++   
Sbjct: 314  KIKKIVITGSKVIDDGFLSMVAKKCPNLEVLDIRACELISDSGIYQIAKRCTKLTTVNFG 373

Query: 1071 ECHR---ISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCT 901
              ++   I+ + +  IL+ +   LK +    C  + D      A+   + L+ LS+ NC 
Sbjct: 374  RKNKGNLITDSSIC-ILIRNNPNLKTVGLAGCH-ITDKTLWDLAIRCSDHLQRLSLNNCP 431

Query: 900  GFGDAS--LVVLSRLCPNLVHLNLSGLNGVTDY 808
               + S  L++ S L  N+  L L   N +T++
Sbjct: 432  HITNQSIPLILHSNLFKNISVLELRFANQITNF 464



 Score = 45.1 bits (105), Expect = 0.004
 Identities = 31/125 (24%), Positives = 65/125 (52%), Gaps = 3/125 (2%)
 Frame = -3

Query: 939 CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG---VTDYGLLPFVQSCDAGL 769
           C +L  L I  C    D+ +  +++ C  L  +N    N    +TD  +   +++ +  L
Sbjct: 338 CPNLEVLDIRACELISDSGIYQIAKRCTKLTTVNFGRKNKGNLITDSSICILIRN-NPNL 396

Query: 768 VKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK 589
             V L+GC ++TDKT+  +A    + L+ L+LN C  +T+ S+  I  + ++ +++ + +
Sbjct: 397 KTVGLAGC-HITDKTLWDLAIRCSDHLQRLSLNNCPHITNQSIPLIL-HSNLFKNISVLE 454

Query: 588 SRVSD 574
            R ++
Sbjct: 455 LRFAN 459



 Score = 45.1 bits (105), Expect = 0.004
 Identities = 36/162 (22%), Positives = 76/162 (46%), Gaps = 9/162 (5%)
 Frame = -3

Query: 846 HLNLSGLNGVTDY---GLLPFVQS--CDAGLVKVNLSGCINVTDKTISAIAKLHGETLEL 682
           H++ S L  +  Y    LLP  +   C   + K+ ++G   + D  +S +AK     LE+
Sbjct: 285 HMDFSNLQWLEFYMCPKLLPTPEFLLCGTKIKKIVITGSKVIDDGFLSMVAK-KCPNLEV 343

Query: 681 LNLNGCGCVTDASLAAIADYCSVLRDLDISKSR----VSDFGIAALAGGSAIQFSLQILS 514
           L++  C  ++D+ +  IA  C+ L  ++  +      ++D  I  L   +    +L+ + 
Sbjct: 344 LDIRACELISDSGIYQIAKRCTKLTTVNFGRKNKGNLITDSSICILIRNNP---NLKTVG 400

Query: 513 LSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLV 388
           L+GC +          +  + L  L++ NC  I+++ + L++
Sbjct: 401 LAGCHITDKTLWDLAIRCSDHLQRLSLNNCPHITNQSIPLIL 442



>gb:AE016818_1748541 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome V, complete sequence.
          Length = 1150

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 34/162 (20%), Positives = 78/162 (48%), Gaps = 3/162 (1%)
 Frame = -3

Query: 1257 LHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQ 1078
            L  LR + ++AC+ +TD  +  + +  P ++ + L KC+ ++DN +++  K  ++++++ 
Sbjct: 622  LPALRLVDLSACESITDKTVVKLVQLAPKLRNVYLGKCSRITDNSLIALSKLGKNLQTVH 681

Query: 1077 LEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTG 898
               C  I+  GV  +L+ +  +++ + F  C  + +    +  L     L+ + +  C+ 
Sbjct: 682  FGHCFNITDEGV-KVLIQNCPRIQYVDFACCTNLTN--HTLYELGDLTKLKRIGLVKCSQ 738

Query: 897  FGDASL---VVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSC 781
              D  L   + L      L  ++LS    +T Y +   V +C
Sbjct: 739  MTDEGLLNMIALRGRNDTLERVHLSYCTNLTIYPIYELVMAC 780



 Score = 46.6 bits (109), Expect = 0.001
 Identities = 51/274 (18%), Positives = 112/274 (40%), Gaps = 8/274 (2%)
 Frame = -3

Query: 1182 GCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKA 1003
            GCPN+++L L  C  ++   +   +K    ++S+ +     +    +F +L     +++ 
Sbjct: 462  GCPNLERLTLVFCKQVTTKSIAKVLKGCRFLQSVDITGVREVGNE-LFNVLSTDCKRIQG 520

Query: 1002 L-----AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN 838
            L        +C  ++      P L       + +I N        L+ ++  CP LV ++
Sbjct: 521  LYVPRADLVSCEAIEQFVENAPMLKRVKITFNKNITN------NLLIKMAHSCPLLVEVD 574

Query: 837  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTD--KTISAIAKLHGETLELLNLNGC 664
            L+    + +  ++  +      L +  L+  + ++D   T  A+       L L++L+ C
Sbjct: 575  LTSTPQINNDSIVTLMTELPQ-LREFRLTQNMLLSDAFATQLALNVTSLPALRLVDLSAC 633

Query: 663  GCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASD 487
              +TD ++  +      LR++ + K SR++D  + AL+                      
Sbjct: 634  ESITDKTVVKLVQLAPKLRNVYLGKCSRITDNSLIALS---------------------- 671

Query: 486  KCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVE 385
                   KLG +L  ++  +C  I+  GV +L++
Sbjct: 672  -------KLGKNLQTVHFGHCFNITDEGVKVLIQ 698



>pir|B85072|B85072 hypothetical protein AT4g07400 [imported] -
            Arabidopsis thaliana>gb:ATCHRIV17_1544418 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            17.>gb:F28D6_1678101 Arabidopsis thaliana BAC F28D6.
          Length = 554

 Score = 54.7 bits (130), Expect = 5e-06
 Identities = 81/355 (22%), Positives = 120/355 (33%), Gaps = 76/355 (21%)
 Frame = -3

Query: 1218 GVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEEC--------- 1066
            G+ D     +S  C N+ +L LR C  +SD G++ F +   S++ +    C         
Sbjct: 150  GICDNAFVMISVRCRNLTRLKLRGCPEISDLGIIGFTENCRSLKKVSFGSCGFGVKGMNA 209

Query: 1065 -------------HRISQAGVFGILV---HSAGKLKALAFENCFGMKDLAFGVPALPPCN 934
                          R+   G    L+    +AG LK +  +     +  A   P L    
Sbjct: 210  LLNTCLGLEELSVKRLRGIGAGAELIGPGGAAGSLKVICLKELHNGQCFA---PLLSGAK 266

Query: 933  SLRSLSICNCTG-------------------------FGDASLVVLSRLCPNLVHLNLSG 829
             LR L I  C+G                           D  L  LS+ C  +  L+L  
Sbjct: 267  GLRILKIFRCSGDWDRVFEAVRDKVNAIVEIHLERIQMSDLGLTALSK-CSGVEVLHLVK 325

Query: 828  LNGVTDYGLLPFVQSC-----------------DAGLVKV-----NLSGC----INVTDK 727
                T+ GL    + C                 D GL+ V     NL       +N T  
Sbjct: 326  TPDCTNVGLALVAERCKLLRKLHIDGWKTNRIGDEGLIVVAKYCWNLQELVLIGVNPTKL 385

Query: 726  TISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGG 547
            ++ AI   +   LE L L G   V D  L  IA+ C  LR L I    ++D GI AL  G
Sbjct: 386  SLEAIVS-NCLNLERLALCGSDTVGDTELCCIAEKCLALRKLCIKNCPITDDGIKALGNG 444

Query: 546  SAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVER 382
                                           +L  + ++ C G++ +G DLL +R
Sbjct: 445  CP-----------------------------NLLKVKVKKCRGVTTQGADLLRKR 470



>gb:AE017352_1759671 Cryptococcus neoformans var. neoformans JEC21
            chromosome 12, complete sequence.
          Length = 600

 Score = 53.9 bits (128), Expect = 8e-06
 Identities = 35/141 (24%), Positives = 69/141 (48%), Gaps = 6/141 (4%)
 Frame = -3

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSF-----VKAAESIESLQLEECHRISQ 1051
            +TD  + A+ K CP ++ LCLR  T L+D GV +F      K  + +  + +E+ H +  
Sbjct: 445  LTDAILPAIVKYCPRLQSLCLRNLTELTDEGVTAFFGSLQAKGHQGLRCIDMEKGHELRD 504

Query: 1050 AGVFGILVHSAGKLKALAFENCFGMKDLAF-GVPALPPCNSLRSLSICNCTGFGDASLVV 874
            + +  ++ HS   ++ L+     G K++A   + AL  C +L+ L +  C    +  +  
Sbjct: 505  SALGALIAHSGETIEWLSL---LGWKEVALEALNALVRCKNLKYLDVGWCRAVNNFWVKD 561

Query: 873  LSRLCPNLVHLNLSGLNGVTD 811
            +   C  +  + + G N ++D
Sbjct: 562  VLDGCHAIEQVRVWGCNELSD 582



 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 65/304 (21%), Positives = 121/304 (39%), Gaps = 7/304 (2%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQN--INERGFWVMGSGQGLHKLRSLVITACQGVTDL 1204
            +  +S  V+ H+  +L  L  I L    +  +  W+        +L   ++T    +   
Sbjct: 310  VGQMSTEVVSHWAKSLKQLKRIELHAPFLVRKEAWIELFQAAGERLEGFLVTQSPRIDRE 369

Query: 1203 GIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVH 1024
             +  + K CPN+ +L L +   L D+ ++  +K  + +  L +              L+ 
Sbjct: 370  TVHQLVKNCPNLTELRLAEIGRL-DSEMLKELKPLKKLRLLDISSPADSLTDDAIVDLLE 428

Query: 1023 SAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVH 844
            + G                          +S+  L++ +     DA L  + + CP L  
Sbjct: 429  AVG--------------------------DSIEDLNLADNFDLTDAILPAIVKYCPRLQS 462

Query: 843  LNLSGLNGVTDYGLLPFVQSCDA----GLVKVNLSGCINVTDKTISAIAKLHGETLELLN 676
            L L  L  +TD G+  F  S  A    GL  +++     + D  + A+    GET+E L+
Sbjct: 463  LCLRNLTELTDEGVTAFFGSLQAKGHQGLRCIDMEKGHELRDSALGALIAHSGETIEWLS 522

Query: 675  LNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQFSLQILSLSGCV 499
            L G   V   +L A+   C  L+ LD+   R V++F +  +  G     +++ + + GC 
Sbjct: 523  LLGWKEVALEALNALV-RCKNLKYLDVGWCRAVNNFWVKDVLDGC---HAIEQVRVWGCN 578

Query: 498  LASD 487
              SD
Sbjct: 579  ELSD 582



 Score = 40.8 bits (94), Expect = 0.071
 Identities = 52/204 (25%), Positives = 86/204 (42%), Gaps = 22/204 (10%)
 Frame = -3

Query: 873 LSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGE 694
           L + CPNL  L L+ +  +    L          L+ ++ S   ++TD  I  + +  G+
Sbjct: 374 LVKNCPNLTELRLAEIGRLDSEMLKELKPLKKLRLLDIS-SPADSLTDDAIVDLLEAVGD 432

Query: 693 TLELLNLNGCGCVTDASLAAIADYCSVLRDLDI-SKSRVSDFGIAALAGGSAIQ------ 535
           ++E LNL     +TDA L AI  YC  L+ L + + + ++D G+ A  G    +      
Sbjct: 433 SIEDLNLADNFDLTDAILPAIVKYCPRLQSLCLRNLTELTDEGVTAFFGSLQAKGHQGLR 492

Query: 534 -------FSLQILSLSGCVLASDKCLPYLHKLG---NSLAGLN-IQNCVGISHRGVD--L 394
                    L+  +L   +  S + + +L  LG    +L  LN +  C  + +  V    
Sbjct: 493 CIDMEKGHELRDSALGALIAHSGETIEWLSLLGWKEVALEALNALVRCKNLKYLDVGWCR 552

Query: 393 LVERLWRCDILS--*T*SAVRVWG 328
            V   W  D+L        VRVWG
Sbjct: 553 AVNNFWVKDVLDGCHAIEQVRVWG 576



>gb:AB050981_1867876 Homo sapiens skp2-gamma mRNA for SKP2-like
           protein type gamma, complete cds.
          Length = 442

 Score = 53.5 bits (127), Expect = 1e-05
 Identities = 55/188 (29%), Positives = 88/188 (46%), Gaps = 6/188 (3%)
 Frame = -3

Query: 948 LPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGL 769
           L  C+ L++LS+       D  +  L++   NLV LNLSG +G +++ L   + SC   L
Sbjct: 202 LSQCSKLQNLSLEGLR-LSDPIVNTLAKNS-NLVRLNLSGCSGFSEFALQTLLSSCSR-L 258

Query: 768 VKVNLSGCINVTDKTISAIAKLHGETLELLNLNGC-GCVTDASLAAIADYCSVLRDLDIS 592
            ++NLS C + T+K +        ET+  LNL+G    +  + L+ +   C  L  LD+S
Sbjct: 259 DELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLS 318

Query: 591 KSRVSDFGIAALAGGSAIQF----SLQILSLSGCV-LASDKCLPYLHKLGNSLAGLNIQN 427
            S         L      +F     LQ LSLS C  +  +  L  +++  NS +  N+  
Sbjct: 319 DS-------VMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLAGIYQNQNSHSNYNVSQ 371

Query: 426 CVGISHRG 403
              +SH G
Sbjct: 372 ---VSHEG 376



>gb:CR380959_1654044 Candida glabrata strain CBS138 chromosome M
            complete sequence.
          Length = 1125

 Score = 53.5 bits (127), Expect = 1e-05
 Identities = 55/238 (23%), Positives = 99/238 (41%), Gaps = 3/238 (1%)
 Frame = -3

Query: 1260 GLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESL 1081
            G   L  L +  C+ +T   + AV KGC  ++ + +     + DN   +  ++ + ++  
Sbjct: 424  GCRNLERLTLVFCKHITSDPVAAVLKGCKYLQSVDITGIKEIYDNVFDTLAESCKRVQGF 483

Query: 1080 QLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCT 901
             + +   +S   +    V +A  LK +       + D    + A   C  L  + I    
Sbjct: 484  YVPQAKLVSYNALTNF-VSNAPMLKRIKVTANANVNDEFLDLLA-EKCPLLVEVDITLSA 541

Query: 900  GFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDA--GLVKVNLSGCINVTDK 727
               D+SL  L      L    ++    VTD   L   ++ +    L  ++LSGC N+TDK
Sbjct: 542  NVHDSSLTKLFMKLTQLREFRITHNANVTDKFFLDLSKNVNQLPSLRLLDLSGCENITDK 601

Query: 726  TISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKS-RVSDFGIAAL 556
            TI  + +L    L  + L  C  +TD SL  ++     L+ +       ++D G+ AL
Sbjct: 602  TIDRVVQL-SPKLRNIFLGKCSRITDLSLFHLSTLGKNLQTVHFGHCFNITDRGVRAL 658



 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 41/206 (19%), Positives = 93/206 (45%), Gaps = 4/206 (1%)
 Frame = -3

Query: 1386 SLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQG-LHKLRSLVITACQGVT 1210
            S N+ D SL  +      L +  + +  N+ ++ F  +      L  LR L ++ C+ +T
Sbjct: 540  SANVHDSSLTKLFMKLTQLREFRITHNANVTDKFFLDLSKNVNQLPSLRLLDLSGCENIT 599

Query: 1209 DLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGIL 1030
            D  I+ V +  P ++ + L KC+ ++D  +       ++++++    C  I+  GV   L
Sbjct: 600  DKTIDRVVQLSPKLRNIFLGKCSRITDLSLFHLSTLGKNLQTVHFGHCFNITDRGV-RAL 658

Query: 1029 VHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNC---TGFGDASLVVLSRLC 859
            + S  +++ + F  C  + +    +  L   + L+ + +  C   T  G  +++ L    
Sbjct: 659  IKSCPRIQYVDFACCTNLTN--HTLYELSYLSRLKRIGLVKCSQMTDDGLLNMIALRGRN 716

Query: 858  PNLVHLNLSGLNGVTDYGLLPFVQSC 781
             +L  ++ S  + +T Y +   + +C
Sbjct: 717  DSLERVHFSYCSNLTIYPIYELLMAC 742



 Score = 35.0 bits (79), Expect = 3.9
 Identities = 50/236 (21%), Positives = 92/236 (38%), Gaps = 51/236 (21%)
 Frame = -3

Query: 939  CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSC------- 781
            C +L  L++  C       +  + + C  L  ++++G+  + D       +SC       
Sbjct: 425  CRNLERLTLVFCKHITSDPVAAVLKGCKYLQSVDITGIKEIYDNVFDTLAESCKRVQGFY 484

Query: 780  --DAGLVKVN-----LSGCINVTDKTISAIAKLHGETLELL----------NLNGCGCVT 652
               A LV  N     +S    +    ++A A ++ E L+LL          ++     V 
Sbjct: 485  VPQAKLVSYNALTNFVSNAPMLKRIKVTANANVNDEFLDLLAEKCPLLVEVDITLSANVH 544

Query: 651  DASLAAIADYCSVLRDLDIS-KSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLP 475
            D+SL  +    + LR+  I+  + V+D     L+       SL++L LSGC   +DK + 
Sbjct: 545  DSSLTKLFMKLTQLREFRITHNANVTDKFFLDLSKNVNQLPSLRLLDLSGCENITDKTID 604

Query: 474  --------------------------YLHKLGNSLAGLNIQNCVGISHRGVDLLVE 385
                                      +L  LG +L  ++  +C  I+ RGV  L++
Sbjct: 605  RVVQLSPKLRNIFLGKCSRITDLSLFHLSTLGKNLQTVHFGHCFNITDRGVRALIK 660



>gb:AY069367_1294097 Drosophila melanogaster LD07444 full length
           cDNA.
          Length = 319

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 48/172 (27%), Positives = 78/172 (45%), Gaps = 5/172 (2%)
 Frame = -3

Query: 891 DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI 712
           D +  VL+R C  L  L+L+    +TD  LLP + +    L  VNL+ C+N+T  ++  I
Sbjct: 98  DVAFRVLARCCQRLEVLHLACCRWLTDELLLPLLANNKKRLWAVNLNECVNITALSLQPI 157

Query: 711 AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQF 532
             +  + L +L L+ C  +T  ++ A+  + S L + DIS          A+     I F
Sbjct: 158 I-VECKELRVLKLSKCQWLTTGAVDALTLHQSKLVEFDISY-------CGAIGERCLIIF 209

Query: 531 -----SLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLL 391
                 L +LSL+     + + L  +      L  +N+  C  IS  GV  L
Sbjct: 210 FRKLNKLTVLSLANTPSVTHQVLIQIGNYCRELEHINVIGCAAISDYGVHAL 261



 Score = 42.4 bits (98), Expect = 0.024
 Identities = 35/181 (19%), Positives = 76/181 (41%), Gaps = 1/181 (0%)
 Frame = -3

Query: 1251 KLRSLVITACQGVTD-LGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQL 1075
            +L  L +  C+ +TD L +  ++     +  + L +C  ++   +   +   + +  L+L
Sbjct: 110  RLEVLHLACCRWLTDELLLPLLANNKKRLWAVNLNECVNITALSLQPIIVECKELRVLKL 169

Query: 1074 EECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGF 895
             +C  ++   V  + +H + KL       C  + +    +      N L  LS+ N    
Sbjct: 170  SKCQWLTTGAVDALTLHQS-KLVEFDISYCGAIGERCL-IIFFRKLNKLTVLSLANTPSV 227

Query: 894  GDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISA 715
                L+ +   C  L H+N+ G   ++DYG+      C   L  + +  C  VT+ +++ 
Sbjct: 228  THQVLIQIGNYCRELEHINVIGCAAISDYGVHALTVHC-LRLRTLLIRRCPRVTELSLAP 286

Query: 714  I 712
            +
Sbjct: 287  L 287



>gb:AY653733_2371392 Mimivirus, complete genome.
          Length = 558

 Score = 52.8 bits (125), Expect = 2e-05
 Identities = 76/338 (22%), Positives = 146/338 (43%), Gaps = 16/338 (4%)
 Frame = -3

Query: 1386 SLNISDISLAVIGHYGVA-LTDLALINLQ---NINERGFWVMGSGQGLHKLRSLVITACQ 1219
            SLNIS+     I   G++ LT +  +N+    NI + G       +   +++ + +  C 
Sbjct: 89   SLNISNCKS--ITDRGLSFLTQVVKLNVSYNGNITDNGL------KNFQRIKKINLCFCG 140

Query: 1218 GVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVF 1039
             +TD GIE +  G            TL SD  + + +    +I  + L+ C RI+     
Sbjct: 141  KITDKGIENLVYGK-----------TLNSDEPIPTVIN---TIRKINLQCCMRITSK--- 183

Query: 1038 GILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLR----SLSICNCTGFGDASLVVL 871
              L H     +A +    +G +     +  +P   +L+     +S  N T       +  
Sbjct: 184  -CLQHLR---RARSINMLYGPQTYNEDLQYIPNIETLKIDGLDVSDKNLTNLKYVKYIFF 239

Query: 870  SRLCPNLVHLNLSGLNGVTDYGLLPFVQSCD----AGLVKVNLSGCINVTDKTISAIAKL 703
             R  P +   +L  L  +    +   ++  D      LVK +LSGCIN+ D+ +  ++K 
Sbjct: 240  GRNYPVIFMSHLDKLTKLILPNVPEHIEYIDFNKMPNLVKADLSGCINLLDEQLKGLSK- 298

Query: 702  HGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKS-RVSDFGIAALAGGSAIQFSL 526
                +  LNL  C  +TD  L+    Y ++++ ++IS   R++D G+  L+    +    
Sbjct: 299  ----VRKLNLKECYDITDVGLS----YLTMVKKINISYCFRITDSGLKYLSNADYV---- 346

Query: 525  QILSLSGCVLASDKCLPYLHKLGNSLAG---LNIQNCV 421
               ++ GC+  +++   YL K+   + G   L++ +C+
Sbjct: 347  ---NICGCLKITNEGFFYLKKVPKLVVGYTTLSLYDCM 381



>gb:AB025621_1516429 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MFG13.>gb:BT020245_1642640 Arabidopsis thaliana
            At5g51370 gene, complete cds.
          Length = 446

 Score = 52.8 bits (125), Expect = 2e-05
 Identities = 59/277 (21%), Positives = 124/277 (44%), Gaps = 8/277 (2%)
 Frame = -3

Query: 1407 LMKVKLQSLNISDISLAVIGHYGVA--LTDLALINLQNINER---GFWVMGSGQGLHKLR 1243
            L +     LN+  I+ + +G   +A   +DL  + L   N+    G     + +GL  + 
Sbjct: 146  LSRESFDLLNLKVINASELGLLSLAGDCSDLQELELHKCNDNLLHGIAACKNLKGLRLVG 205

Query: 1242 SLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECH 1063
            S+       V+D+G+  +++GC ++ +L L  C   S +G+ +  +  E +E L + + H
Sbjct: 206  SVDGLYSSSVSDIGLTFLAQGCRSLVKLELSGCE-GSFDGIKAIGQCCEVLEELSICD-H 263

Query: 1062 RISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDAS 883
            R+    +  +    +  LK L   +C  +         L  C ++ SL +  C       
Sbjct: 264  RMDDGWIAALSYFES--LKILRISSCRKIDASPGPEKLLRSCPAMESLQLKRCCLNDKEG 321

Query: 882  LVVLSRLCPNLVHLNLSGLNGVTD--YGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIA 709
            +  L ++C     +N+    G++D  + L    +     +  ++L GC  +T   + ++ 
Sbjct: 322  IKALFKVCDGATEVNIQDCWGLSDDCFSLAKAFRR----VRFLSLEGCSVLTSGGLESVI 377

Query: 708  KLHGETLELLNLNGCGCVTDASLA-AIADYCSVLRDL 601
             LH E LE + +  C  + D+ ++ A++   S+L++L
Sbjct: 378  -LHWEELESMRVVSCKSIKDSEISPALSSLFSLLKEL 413



 Score = 43.1 bits (100), Expect = 0.014
 Identities = 50/205 (24%), Positives = 76/205 (37%), Gaps = 29/205 (14%)
 Frame = -3

Query: 939 CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGL------NGVTDYGLLPFVQSCD 778
           C+ L+ L +  C      +L+     C NL  L L G       + V+D GL    Q C 
Sbjct: 173 CSDLQELELHKCND----NLLHGIAACKNLKGLRLVGSVDGLYSSSVSDIGLTFLAQGCR 228

Query: 777 AGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLD 598
           + LVK+ LSGC    D                             + AI   C VL +L 
Sbjct: 229 S-LVKLELSGCEGSFD----------------------------GIKAIGQCCEVLEELS 259

Query: 597 ISKSRVSDFGIAALAGGSAIQF-----------------------SLQILSLSGCVLASD 487
           I   R+ D  IAAL+   +++                        +++ L L  C L   
Sbjct: 260 ICDHRMDDGWIAALSYFESLKILRISSCRKIDASPGPEKLLRSCPAMESLQLKRCCLNDK 319

Query: 486 KCLPYLHKLGNSLAGLNIQNCVGIS 412
           + +  L K+ +    +NIQ+C G+S
Sbjct: 320 EGIKALFKVCDGATEVNIQDCWGLS 344



>pir|H84779|H84779 hypothetical protein At2g36370 [imported] -
            Arabidopsis thaliana
          Length = 593

 Score = 52.8 bits (125), Expect = 2e-05
 Identities = 55/205 (26%), Positives = 98/205 (47%), Gaps = 13/205 (6%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            L++L ++ C+G+++  +  +      +K LCLR  T +SD+ +  F     ++E+L +  
Sbjct: 381  LQTLHMSKCEGISETSLLNLITHSQKMKSLCLRD-TKVSDSVLCEF--PGSTLEALDISN 437

Query: 1068 CHRISQAGVFGILVHSAGKLKALAFENCFG---MKDLAFGVPALPPCNSLRSLSICNCTG 898
               IS + +  +L  S   L+ LA   CFG   ++   F +P      +LR L +   T 
Sbjct: 438  TTEISDSALTSVLT-SLKHLQELALSYCFGEISLQSFKFSMP------NLRKLRLERVTR 490

Query: 897  F-GDASLVVLSRLCPNLVHLNLS----GLNGVTD-YGLLP----FVQSCDAGLVKVNLSG 748
            +  +  L+VL++ CPNL  L+L       NGV   YG +     F++   +G+ K   S 
Sbjct: 491  WMTNDDLLVLTQSCPNLTELSLECGSITENGVASLYGCIALEDLFLRHNGSGIQK---SF 547

Query: 747  CINVTDKTISAIAKLHGETLELLNL 673
             ++ T K    +  L+ E   +L L
Sbjct: 548  LLDATLKRFFCLIHLNNEQFPMLRL 572



>gb:HSBA18I14_2010886 Human DNA sequence from clone RP11-18I14 on
            chromosome 10 Contains the GBF1 gene for golgi-specific
            brefeldin A resistance factor 1 (SEC7 domain family
            member, Myeloblast KIAA0248), the NFKB2 gene for the
            nuclear factor of kappa light polypeptide gene enhancer
            in B-cells 2 (p49/p100), the PSD gene for a pleckstrin
            and Sec7 domain protein, four novel genes, a novel gene
            (FLJ22529) the ACTR1A gene for ARP1 actin-related protein
            1 homolog A, centractin alpha (yeast), the 5' end of the
            SUFU gene for suppressor of fused homolog (Drosophila)
            and eight CpG islands, complete sequence.
          Length = 311

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 42/150 (28%), Positives = 72/150 (48%), Gaps = 1/150 (0%)
 Frame = -3

Query: 1110 VKAAESIESLQLEECHR-ISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCN 934
            ++ AE ++ L L  CH  +S   +  +L  +  +L+++A   C  +   A G  A   C 
Sbjct: 79   LRDAEGLQELALAPCHEWLSDEDLVPVLARNP-QLRSVALGGCGQLSRRALGALA-EGCP 136

Query: 933  SLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNL 754
             L+ LS+ +C      +L  L+  CP L  L+L+    + D  ++   Q   AGL  ++L
Sbjct: 137  RLQRLSLAHCDWVDGLALRGLADRCPALEELDLTACRQLKDEAIVYLAQRRGAGLRSLSL 196

Query: 753  SGCINVTDKTISAIAKLHGETLELLNLNGC 664
            +   NV D  +  +A+   E L  L+L GC
Sbjct: 197  AVNANVGDAAVQELARNCPE-LHHLDLTGC 225



 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 35/141 (24%), Positives = 62/141 (43%)
 Frame = -3

Query: 1251 KLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLE 1072
            +LRS+ +  C  ++   + A+++GCP +++L L  C  +    +        ++E L L 
Sbjct: 111  QLRSVALGGCGQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRGLADRCPALEELDLT 170

Query: 1071 ECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG 892
             C ++    +    V+ A +  A                        LRSLS+      G
Sbjct: 171  ACRQLKDEAI----VYLAQRRGA-----------------------GLRSLSLAVNANVG 203

Query: 891  DASLVVLSRLCPNLVHLNLSG 829
            DA++  L+R CP L HL+L+G
Sbjct: 204  DAAVQELARNCPELHHLDLTG 224



 Score = 42.7 bits (99), Expect = 0.019
 Identities = 47/167 (28%), Positives = 78/167 (46%), Gaps = 2/167 (1%)
 Frame = -3

Query: 888 ASLVVLSRLCPNLVHLNLSGLNG-VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI 712
           A+L  L R    L  L L+  +  ++D  L+P V + +  L  V L GC  ++ + + A+
Sbjct: 73  AALARLLRDAEGLQELALAPCHEWLSDEDLVP-VLARNPQLRSVALGGCGQLSRRALGAL 131

Query: 711 AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQ 535
           A+     L+ L+L  C  V   +L  +AD C  L +LD++  R + D  I  LA      
Sbjct: 132 AE-GCPRLQRLSLAHCDWVDGLALRGLADRCPALEELDLTACRQLKDEAIVYLAQRRGA- 189

Query: 534 FSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDL 394
             L+ LSL+      D  +  L +    L  L++  C+ +   GVD+
Sbjct: 190 -GLRSLSLAVNANVGDAAVQELARNCPELHHLDLTGCLRVGSDGVDI 235



>gb:HSBA18I14_2010882 Human DNA sequence from clone RP11-18I14 on
            chromosome 10 Contains the GBF1 gene for golgi-specific
            brefeldin A resistance factor 1 (SEC7 domain family
            member, Myeloblast KIAA0248), the NFKB2 gene for the
            nuclear factor of kappa light polypeptide gene enhancer
            in B-cells 2 (p49/p100), the PSD gene for a pleckstrin
            and Sec7 domain protein, four novel genes, a novel gene
            (FLJ22529) the ACTR1A gene for ARP1 actin-related protein
            1 homolog A, centractin alpha (yeast), the 5' end of the
            SUFU gene for suppressor of fused homolog (Drosophila)
            and eight CpG islands, complete sequence.
          Length = 315

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 42/150 (28%), Positives = 72/150 (48%), Gaps = 1/150 (0%)
 Frame = -3

Query: 1110 VKAAESIESLQLEECHR-ISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCN 934
            ++ AE ++ L L  CH  +S   +  +L  +  +L+++A   C  +   A G  A   C 
Sbjct: 83   LRDAEGLQELALAPCHEWLSDEDLVPVLARNP-QLRSVALGGCGQLSRRALGALA-EGCP 140

Query: 933  SLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNL 754
             L+ LS+ +C      +L  L+  CP L  L+L+    + D  ++   Q   AGL  ++L
Sbjct: 141  RLQRLSLAHCDWVDGLALRGLADRCPALEELDLTACRQLKDEAIVYLAQRRGAGLRSLSL 200

Query: 753  SGCINVTDKTISAIAKLHGETLELLNLNGC 664
            +   NV D  +  +A+   E L  L+L GC
Sbjct: 201  AVNANVGDAAVQELARNCPE-LHHLDLTGC 229



 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 35/141 (24%), Positives = 62/141 (43%)
 Frame = -3

Query: 1251 KLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLE 1072
            +LRS+ +  C  ++   + A+++GCP +++L L  C  +    +        ++E L L 
Sbjct: 115  QLRSVALGGCGQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRGLADRCPALEELDLT 174

Query: 1071 ECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG 892
             C ++    +    V+ A +  A                        LRSLS+      G
Sbjct: 175  ACRQLKDEAI----VYLAQRRGA-----------------------GLRSLSLAVNANVG 207

Query: 891  DASLVVLSRLCPNLVHLNLSG 829
            DA++  L+R CP L HL+L+G
Sbjct: 208  DAAVQELARNCPELHHLDLTG 228



 Score = 42.7 bits (99), Expect = 0.019
 Identities = 47/167 (28%), Positives = 78/167 (46%), Gaps = 2/167 (1%)
 Frame = -3

Query: 888 ASLVVLSRLCPNLVHLNLSGLNG-VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI 712
           A+L  L R    L  L L+  +  ++D  L+P V + +  L  V L GC  ++ + + A+
Sbjct: 77  AALARLLRDAEGLQELALAPCHEWLSDEDLVP-VLARNPQLRSVALGGCGQLSRRALGAL 135

Query: 711 AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSR-VSDFGIAALAGGSAIQ 535
           A+     L+ L+L  C  V   +L  +AD C  L +LD++  R + D  I  LA      
Sbjct: 136 AE-GCPRLQRLSLAHCDWVDGLALRGLADRCPALEELDLTACRQLKDEAIVYLAQRRGA- 193

Query: 534 FSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDL 394
             L+ LSL+      D  +  L +    L  L++  C+ +   GVD+
Sbjct: 194 -GLRSLSLAVNANVGDAAVQELARNCPELHHLDLTGCLRVGSDGVDI 239



>gb:OSJN00275_1697800 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0042I07, complete sequence.
          Length = 440

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 75/348 (21%), Positives = 131/348 (37%), Gaps = 70/348 (20%)
 Frame = -3

Query: 1311 NLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLS 1132
            N  +I+ +G +V+ S   L  L  + +T C  + D GI  +S  C  +  L L     ++
Sbjct: 78   NGNHIDNQGLFVLSSCCTL--LNDITLTFCSKINDAGIVCLSY-CKKLISLKLNSLPEVT 134

Query: 1131 DNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCF---------- 982
             +G++      +++ SL + +C  I+ +  +   + + G L+ L   NC           
Sbjct: 135  SSGLLMLFFGCKALSSLFINDCKGIAGSTEWLEYLGTDGSLEELVVNNCQEISQYDLCCQ 194

Query: 981  GMKDLAFGVPALPP-------------CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHL 841
             ++DL        P             C +L  L +    G  D  ++VLS+ C NL  +
Sbjct: 195  NLEDLRLARVITEPEGPETGLRFLLRKCKALERLCLEYVNGVIDKDMIVLSQSCKNLKSI 254

Query: 840  NLSGLNG-------------VTDYGLLPFVQSC------------------------DAG 772
            +L  + G             +TD  L     +C                          G
Sbjct: 255  SLWMIPGLYHEPDGIVFRTDLTDESLEALTNNCPLLQDVELAFTGVDHWEPPEIGFIQEG 314

Query: 771  LVK---------VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYC 619
            LVK         + L+G +   DK +  ++      +E L+L  C  +TD+ +  +  Y 
Sbjct: 315  LVKLMHYCPIRTLTLNGALFFNDKGMKGLSS--APFMETLSLVDCKEITDSGMCFLVQY- 371

Query: 618  SVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCL 478
              L DL +     ++D GIA L         LQ L + GC   S+  +
Sbjct: 372  PCLTDLKLQHCPGLTDVGIAELVHAQ----KLQSLVVDGCCNISENAV 415



>gb:AK085980_1174634 Mus musculus 16 days neonate heart cDNA, RIKEN
           full-length enriched library, clone:D830037K07
           product:hypothetical F-box domain containing protein,
           full insert sequence.
          Length = 230

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 33/92 (35%), Positives = 49/92 (53%)
 Frame = -3

Query: 882 LVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKL 703
           L+ +   CPNL  + LSG   VTD  L   + SC   L  + L  C  VT++T++A+A  
Sbjct: 100 LLQVCNRCPNLTSVTLSGCGHVTDDCLARLLLSCPR-LRTLRLENCARVTNRTLAAVA-A 157

Query: 702 HGETLELLNLNGCGCVTDASLAAIADYCSVLR 607
           HG  L+ L+++ C  V+ A L  +   C  LR
Sbjct: 158 HGRALQTLHVDFCRNVSAAGLLRLRAACPNLR 189



 Score = 37.7 bits (86), Expect = 0.60
 Identities = 16/69 (23%), Positives = 36/69 (52%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            L S+ ++ C  VTD  +  +   CP ++ L L  C  +++  + +      ++++L ++ 
Sbjct: 110  LTSVTLSGCGHVTDDCLARLLLSCPRLRTLRLENCARVTNRTLAAVAAHGRALQTLHVDF 169

Query: 1068 CHRISQAGV 1042
            C  +S AG+
Sbjct: 170  CRNVSAAGL 178



>gb:AK084845_1174342 Mus musculus 13 days embryo heart cDNA, RIKEN
           full-length enriched library, clone:D330050P14
           product:hypothetical F-box domain containing protein,
           full insert sequence.
          Length = 221

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 33/92 (35%), Positives = 49/92 (53%)
 Frame = -3

Query: 882 LVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKL 703
           L+ +   CPNL  + LSG   VTD  L   + SC   L  + L  C  VT++T++A+A  
Sbjct: 91  LLQVCNRCPNLTSVTLSGCGHVTDDCLARLLLSCPR-LRTLRLENCARVTNRTLAAVA-A 148

Query: 702 HGETLELLNLNGCGCVTDASLAAIADYCSVLR 607
           HG  L+ L+++ C  V+ A L  +   C  LR
Sbjct: 149 HGRALQTLHVDFCRNVSAAGLLRLRAACPNLR 180



 Score = 37.7 bits (86), Expect = 0.60
 Identities = 16/69 (23%), Positives = 36/69 (52%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            L S+ ++ C  VTD  +  +   CP ++ L L  C  +++  + +      ++++L ++ 
Sbjct: 101  LTSVTLSGCGHVTDDCLARLLLSCPRLRTLRLENCARVTNRTLAAVAAHGRALQTLHVDF 160

Query: 1068 CHRISQAGV 1042
            C  +S AG+
Sbjct: 161  CRNVSAAGL 169



>gb:AK052175_1169918 Mus musculus 13 days embryo heart cDNA, RIKEN
           full-length enriched library, clone:D330003E11
           product:hypothetical F-box domain containing protein,
           full insert sequence.
          Length = 236

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 33/92 (35%), Positives = 49/92 (53%)
 Frame = -3

Query: 882 LVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKL 703
           L+ +   CPNL  + LSG   VTD  L   + SC   L  + L  C  VT++T++A+A  
Sbjct: 106 LLQVCNRCPNLTSVTLSGCGHVTDDCLARLLLSCPR-LRTLRLENCARVTNRTLAAVA-A 163

Query: 702 HGETLELLNLNGCGCVTDASLAAIADYCSVLR 607
           HG  L+ L+++ C  V+ A L  +   C  LR
Sbjct: 164 HGRALQTLHVDFCRNVSAAGLLRLRAACPNLR 195



 Score = 37.7 bits (86), Expect = 0.60
 Identities = 16/69 (23%), Positives = 36/69 (52%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
            L S+ ++ C  VTD  +  +   CP ++ L L  C  +++  + +      ++++L ++ 
Sbjct: 116  LTSVTLSGCGHVTDDCLARLLLSCPRLRTLRLENCARVTNRTLAAVAAHGRALQTLHVDF 175

Query: 1068 CHRISQAGV 1042
            C  +S AG+
Sbjct: 176  CRNVSAAGL 184



>gb:BX908798_831491 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 504

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 82/295 (27%), Positives = 128/295 (43%), Gaps = 37/295 (12%)
 Frame = -3

Query: 1395 KLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGS--GQGLHKLRSLV---- 1234
            K+++LN S+ +     H       LAL + +N+    F    +    GL  LR LV    
Sbjct: 226  KIEALNFSNQAYLTDVHL------LALKDCKNLKALYFRKCPNLTAAGLAYLRPLVALQH 279

Query: 1233 --ITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEEC-- 1066
              +  C  +TD G+  ++     +K L L     L+D G+ + +    +++ L L EC  
Sbjct: 280  LDLNYCYNLTDAGLAHLAP-LVALKHLNLSGHGYLTDAGL-AHLSPLTALQHLNLSECCN 337

Query: 1065 HRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG-- 892
            ++++ AG+  +    A  LK L    C   K    G+  L P  +L+ L++  C G G  
Sbjct: 338  YKLTDAGLAHLRPLVA--LKYLNLSRC--SKFTGAGLAHLRPLTALQHLNLSGCGGIGAG 393

Query: 891  --DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPF----------VQSC----DAGLVKV 760
               A L  L  L   L HLNLS   GVTD  L             + +C    DAGL  +
Sbjct: 394  LASAGLAHLRPLTA-LQHLNLSWC-GVTDDELAHLTPLEALQYLDLSNCWHLTDAGLAHL 451

Query: 759  N---------LSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADY 622
            N         LS C  +T+  ++ +  L    L+ LNL+GC  +TD  LA +  +
Sbjct: 452  NPLIALQHLNLSKCDQLTNAGLAHLIPL--TALQHLNLSGCSNLTDDGLARLRPF 504



>gb:OSJN00038_1693705 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0014K14, complete sequence.
          Length = 581

 Score = 52.0 bits (123), Expect = 3e-05
 Identities = 94/334 (28%), Positives = 150/334 (44%), Gaps = 31/334 (9%)
 Frame = -3

Query: 1410 HLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVI 1231
            +L +++L    ISD+ ++    Y   L+ LA +NL+         +    GL  L  L +
Sbjct: 259  NLRELQLSCCKISDLGVS----YLRGLSKLAHLNLEGCAVTAA-CLEVISGLASLVLLNL 313

Query: 1230 TACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVS----FVKAAESIESLQLEECH 1063
            + C GV D       +GC +++ L   K   L  N +       +K   ++E L L+ C 
Sbjct: 314  SRC-GVYD-------EGCEHLEGLVKLKVLNLGFNYITDACLVHLKELINLECLNLDSC- 364

Query: 1062 RISQAGVFGILVHSAGKLKALAFE------------NCFGMKDLA-----------FGVP 952
            +I   G    L H  G LK  + E            +  G+++L             G+ 
Sbjct: 365  KIGDEG----LAHLKGLLKLRSLELSDTEVGSNGLRHLSGLRNLQSINLSFTLVTDIGLK 420

Query: 951  ALPPCNSLRSLSICN--CTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGL--LPFVQS 784
             +   NSLRSL++ N   T  G A+L  L+     L HL+L G   +TD G   L + ++
Sbjct: 421  KISGLNSLRSLNLDNRQITDNGLAALTCLT----GLTHLDLFGAR-ITDAGTNCLKYFKN 475

Query: 783  CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRD 604
                L  + + G + +TD  +  I  L  + L LLNL+  G +TD SL  I+   + L  
Sbjct: 476  ----LQSLEVCGGL-ITDAGVKNIKDL--KALTLLNLSQNGNLTDKSLELIS-RLTALVS 527

Query: 603  LDISKSRVSDFGIAALAGGSAIQFSLQILSLSGC 502
            L++S SRVS+ G+  L     +Q +L+ LSL  C
Sbjct: 528  LNVSNSRVSNSGLHHL---KPLQ-NLRSLSLESC 557



 Score = 48.1 bits (113), Expect = 4e-04
 Identities = 89/325 (27%), Positives = 132/325 (40%), Gaps = 46/325 (14%)
 Frame = -3

Query: 1263 QGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIES 1084
            +GL KL  L +  C G+TD  ++ +S    N+++L L  C  +SD G VS+++    +  
Sbjct: 230  KGLRKLEKLNLRYCNGITDSDMKHLS-DLTNLRELQL-SCCKISDLG-VSYLRGLSKLAH 286

Query: 1083 LQLEECH------------------RISQAGVF-------------------------GI 1033
            L LE C                    +S+ GV+                           
Sbjct: 287  LNLEGCAVTAACLEVISGLASLVLLNLSRCGVYDEGCEHLEGLVKLKVLNLGFNYITDAC 346

Query: 1032 LVHSAGKLKALAFENCFGMKDLAFGVPALPPCN---SLRSLSICNCTGFGDASLVVLSRL 862
            LVH    LK L    C  +     G   L        LRSL + + T  G   L  LS L
Sbjct: 347  LVH----LKELINLECLNLDSCKIGDEGLAHLKGLLKLRSLELSD-TEVGSNGLRHLSGL 401

Query: 861  CPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLEL 682
              NL  +NLS    VTD GL     S    L  +NL     +TD  ++A+  L G  L  
Sbjct: 402  -RNLQSINLS-FTLVTDIGLKKI--SGLNSLRSLNLDN-RQITDNGLAALTCLTG--LTH 454

Query: 681  LNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGC 502
            L+L G   +TDA    +  Y   L+ L++    ++D G+  +    A    L +L+LS  
Sbjct: 455  LDLFGAR-ITDAGTNCL-KYFKNLQSLEVCGGLITDAGVKNIKDLKA----LTLLNLSQN 508

Query: 501  VLASDKCLPYLHKLGNSLAGLNIQN 427
               +DK L  + +L  +L  LN+ N
Sbjct: 509  GNLTDKSLELISRL-TALVSLNVSN 532



>gb:BX908798_831549 Parachlamydia-related symbiont UWE25, complete
           genome.
          Length = 129

 Score = 52.0 bits (123), Expect = 3e-05
 Identities = 36/90 (40%), Positives = 47/90 (52%)
 Frame = -3

Query: 906 CTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDK 727
           CT   DA L  L  L   L HL LS  + +TD GL          L ++NLSGC  +TD 
Sbjct: 8   CTNITDAGLAHLKPLV-TLTHLRLSECDNLTDAGLAHLTPL--VALQQLNLSGCKKLTDA 64

Query: 726 TISAIAKLHGETLELLNLNGCGCVTDASLA 637
            ++ +  L    L+ LNL+GC  +TDA LA
Sbjct: 65  GLAHLTSL--VALQQLNLSGCKKLTDAGLA 92



 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 39/107 (36%), Positives = 51/107 (47%)
 Frame = -3

Query: 960 GVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSC 781
           G+  L P  +L  L +  C    DA L  L+ L   L  LNLSG   +TD GL       
Sbjct: 15  GLAHLKPLVTLTHLRLSECDNLTDAGLAHLTPLVA-LQQLNLSGCKKLTDAGLAHLTSL- 72

Query: 780 DAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL 640
              L ++NLSGC  +TD  ++ +  L    L+ L L GC   TDA L
Sbjct: 73  -VALQQLNLSGCKKLTDAGLAHLTPL--VALQHLELTGCYNFTDAGL 116



>gb:CR382121_1654617 Kluyveromyces lactis strain NRRL Y-1140
            chromosome A of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 575

 Score = 51.6 bits (122), Expect = 4e-05
 Identities = 60/226 (26%), Positives = 99/226 (43%), Gaps = 15/226 (6%)
 Frame = -3

Query: 1011 LKALAFENCF-----GMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLV 847
            L  L F +C      G K LA   P       L SLS+  C    + +L+ L+   PNL 
Sbjct: 245  LTTLTFYDCSKLSYEGYKRLAIFSP------HLESLSLQMCGQLNNEALLYLAEKLPNLK 298

Query: 846  HLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNG 667
             L L G   + +   + F +     L   ++S      D  +SA+ +  G +LE L L  
Sbjct: 299  ELYLDGPFLINEDTWVQFFELLKGRLTAFHVSNTHRFNDNALSAMLRNCGSSLESLGLAT 358

Query: 666  CGCVTDASLAA----IADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCV 499
               VT+ +L        ++ +++ +    ++ ++D  I +L G  +I  +L+ LSL+ C 
Sbjct: 359  LDTVTNYALLPQYLNSPNFHTLILEEPSRETDINDEVIISLLG--SIGQNLRKLSLNRCT 416

Query: 498  LASDKC-----LPYLHKLGNS-LAGLNIQNCVGISHRGVDLLVERL 379
              +D C     LP+L   G S L  L ++    I+  G+ LL   L
Sbjct: 417  GLTDSCIINGFLPFLSNSGQSILTDLELEELDQITTDGIVLLFSSL 462



 Score = 45.4 bits (106), Expect = 0.003
 Identities = 65/295 (22%), Positives = 114/295 (38%), Gaps = 37/295 (12%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAES-IESLQLE 1072
            L SL +  C  + +  +  +++  PN+K+L L    L++++  V F +  +  + +  + 
Sbjct: 271  LESLSLQMCGQLNNEALLYLAEKLPNLKELYLDGPFLINEDTWVQFFELLKGRLTAFHVS 330

Query: 1071 ECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCN-------------- 934
              HR +   +  +L +    L++L       + + A     L   N              
Sbjct: 331  NTHRFNDNALSAMLRNCGSSLESLGLATLDTVTNYALLPQYLNSPNFHTLILEEPSRETD 390

Query: 933  ---------------SLRSLSICNCTGFGDASLV-----VLSRLCPN-LVHLNLSGLNGV 817
                           +LR LS+  CTG  D+ ++      LS    + L  L L  L+ +
Sbjct: 391  INDEVIISLLGSIGQNLRKLSLNRCTGLTDSCIINGFLPFLSNSGQSILTDLELEELDQI 450

Query: 816  TDYGLLPFVQSCDAGLVK-VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL 640
            T  G++    S    L+K  +L  C  + D  +  +      TLE LNLNG   +T  + 
Sbjct: 451  TTDGIVLLFSSLQFPLLKRCSLKRCFALEDAAVVELLLNSSSTLEELNLNGLKSLTSKTF 510

Query: 639  AAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLP 475
              +A  C  L+ L+I      D  I      S     L I+ + G    + KC P
Sbjct: 511  TFMA--CPNLKQLNIGFVHCVDNEIVEKI--SKDNEKLTIIEVYGDNQVTGKCSP 561



>gb:AY056152_1563483 Arabidopsis thaliana putative SKP1 interacting
            partner SKIP2 (At5g67250) mRNA, complete cds.
          Length = 304

 Score = 51.6 bits (122), Expect = 4e-05
 Identities = 53/217 (24%), Positives = 96/217 (44%), Gaps = 8/217 (3%)
 Frame = -3

Query: 1428 FSSAGNHLMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHK 1249
            F S     ++   +S+++SD +LA+I         +  +NL  +  RG            
Sbjct: 103  FDSVTKLALRCDRKSVSLSDEALAMIS--------VRCLNLTRVKLRG------------ 142

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEE 1069
                    C+ +TDLG+E  +K C N+K+L +  C      GV + ++  + +E L ++ 
Sbjct: 143  --------CREITDLGMEDFAKNCKNLKKLSVGSCN-FGAKGVNAMLEHCKLLEELSVKR 193

Query: 1068 CHRISQAGVFGILVH-----SAGKLKALAFENCFGMKDLAFG---VPALPPCNSLRSLSI 913
               I +A     L+H     S+  L+++       +K+L  G    P L    +L++L I
Sbjct: 194  LRGIHEAAE---LIHLPDDASSSSLRSIC------LKELVNGQVFEPLLATTRTLKTLKI 244

Query: 912  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGL 802
              C G  D  L +++    +L  ++L  L  V+D GL
Sbjct: 245  IRCLGDWDKVLQMIANGKSSLSEIHLERLQ-VSDIGL 280



 Score = 38.5 bits (88), Expect = 0.35
 Identities = 41/161 (25%), Positives = 73/161 (45%), Gaps = 7/161 (4%)
 Frame = -3

Query: 891 DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI 712
           D +L ++S  C NL  + L G   +TD G+  F ++C   L K+++  C N   K ++A+
Sbjct: 122 DEALAMISVRCLNLTRVKLRGCREITDLGMEDFAKNC-KNLKKLSVGSC-NFGAKGVNAM 179

Query: 711 AKLHGETLELLNLNGC-GCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGS--- 544
            + H + LE L++    G    A L  + D        D S S +    +  L  G    
Sbjct: 180 LE-HCKLLEELSVKRLRGIHEAAELIHLPD--------DASSSSLRSICLKELVNGQVFE 230

Query: 543 ---AIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQ 430
              A   +L+ L +  C+   DK L  +    +SL+ ++++
Sbjct: 231 PLLATTRTLKTLKIIRCLGDWDKVLQMIANGKSSLSEIHLE 271



>gb:BC085657_2564534 Danio rerio zgc:92297, mRNA (cDNA clone MGC:92297
            IMAGE:7054126), complete cds.
          Length = 607

 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 53/218 (24%), Positives = 93/218 (42%), Gaps = 2/218 (0%)
 Frame = -3

Query: 1239 LVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHR 1060
            L ++ C  +T+  +E +++ CP +++L L  C  L         K    +  L L    +
Sbjct: 366  LEVSCCHFLTEACLEVITQTCPCLQELNLASCDRLQPQAFNHIAKLTH-LRRLVLYRT-K 423

Query: 1059 ISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDAS 883
            + Q+ +  IL     +L+ L   +C  ++D    V  L   C SLRSL +  C    +  
Sbjct: 424  VEQSAILSILTFCP-ELRHLNLGSCVMIEDYDVVVSMLSARCRSLRSLDLWRCRNLSERG 482

Query: 882  LVVLSRLCPNLVHLNLSGLNGV-TDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAK 706
            L  L   C  L  L+L   + + +       +      L K+ L+    V D  +  +A 
Sbjct: 483  LAELVSGCRLLEELDLGWCSTLQSSSACFQHLARSLPRLRKLFLTANRTVCDADLEELA- 541

Query: 705  LHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS 592
             +   L+ L++ G   V+ ASL  +   C  L+ LD+S
Sbjct: 542  ANCSALQHLDILGTRMVSSASLRKLLQCCPRLKLLDVS 579



 Score = 37.4 bits (85), Expect = 0.78
 Identities = 54/204 (26%), Positives = 87/204 (42%), Gaps = 19/204 (9%)
 Frame = -3

Query: 933 SLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNL 754
           SL  L +  C    +A L V+++ CP L  LNL+  +      L P   +  A L  +  
Sbjct: 362 SLVCLEVSCCHFLTEACLEVITQTCPCLQELNLASCD-----RLQPQAFNHIAKLTHLRR 416

Query: 753 SGCINVTDKTISAIAKLHGETLELLNLNGCGCVT----DASLAAIADYCSVLRDLDISKS 586
              +  T    SAI  +     EL +LN   CV     D  ++ ++  C  LR LD+ + 
Sbjct: 417 L-VLYRTKVEQSAILSILTFCPELRHLNLGSCVMIEDYDVVVSMLSARCRSLRSLDLWRC 475

Query: 585 R-VSDFGIAALAGGSAIQFSLQ------ILSLSGCVLASDKCLPYLHKL----GNSLAGL 439
           R +S+ G+A L  G  +   L       + S S C     + LP L KL      ++   
Sbjct: 476 RNLSERGLAELVSGCRLLEELDLGWCSTLQSSSACFQHLARSLPRLRKLFLTANRTVCDA 535

Query: 438 NIQ----NCVGISHRGVDLLVERL 379
           +++    NC  + H  +D+L  R+
Sbjct: 536 DLEELAANCSALQH--LDILGTRM 557



>sp|P38285|YB08_YEAST Hypothetical 62.7 kDa protein in CNS1-CDC28
            intergenic region.>pir|S46029|S46029 hypothetical protein
            YBR158w - yeast (Saccharomyces
            cerevisiae)>gb:AY723760_1624166 Saccharomyces cerevisiae
            clone FLH000921.01X YBR158W gene, complete
            cds.>gb:SCYBR158W_1711395 S.cerevisiae chromosome II
            reading frame ORF YBR158w.
          Length = 549

 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 43/154 (27%), Positives = 72/154 (46%), Gaps = 5/154 (3%)
 Frame = -3

Query: 1257 LHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQ 1078
            LHKL  L+I   + + D  +  +S+  PN+K L LR C  +SD+GVV        +++  
Sbjct: 335  LHKLEKLIIPGNKNIDDNFLLRLSQSIPNLKHLVLRACDNVSDSGVVCIALNCPKLKTFN 394

Query: 1077 LEECHRISQAGVFGILVHSAGK---LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICN 907
            +   HR     +  + + + GK   ++ + F  C  + D      A     ++  LS+ +
Sbjct: 395  IGR-HRRGNL-ITSVSLVALGKYTQVETVGFAGC-DVDDAGIWEFARLNGKNVERLSLNS 451

Query: 906  CTGFGDASLVVLSRL--CPNLVHLNLSGLNGVTD 811
            C    D SL +L  L   PNL  L +  L+ +TD
Sbjct: 452  CRLLTDYSLPILFALNSFPNLAVLEIRNLDKITD 485



 Score = 43.1 bits (100), Expect = 0.014
 Identities = 45/159 (28%), Positives = 66/159 (41%), Gaps = 35/159 (22%)
 Frame = -3

Query: 1011 LKALAFENCFGMKDLAFGV-PALPP-------CNSLRSLSICNCTGFGDASLVVLSRLCP 856
            ++ L+   C  +K L F V P + P        + L  L I       D  L+ LS+  P
Sbjct: 303  IERLSRMECQNLKWLEFYVCPRITPPLSWFDNLHKLEKLIIPGNKNIDDNFLLRLSQSIP 362

Query: 855  NLVHLNLSGLNGVTDYGLLPFVQSC------------------DAGLVK---------VN 757
            NL HL L   + V+D G++    +C                     LV          V 
Sbjct: 363  NLKHLVLRACDNVSDSGVVCIALNCPKLKTFNIGRHRRGNLITSVSLVALGKYTQVETVG 422

Query: 756  LSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL 640
             +GC +V D  I   A+L+G+ +E L+LN C  +TD SL
Sbjct: 423  FAGC-DVDDAGIWEFARLNGKNVERLSLNSCRLLTDYSL 460



 Score = 42.4 bits (98), Expect = 0.024
 Identities = 32/143 (22%), Positives = 71/143 (49%), Gaps = 3/143 (2%)
 Frame = -3

Query: 1332 LTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCL 1153
            L  L +   +NI++   +++   Q +  L+ LV+ AC  V+D G+  ++  CP +K   +
Sbjct: 338  LEKLIIPGNKNIDDN--FLLRLSQSIPNLKHLVLRACDNVSDSGVVCIALNCPKLKTFNI 395

Query: 1152 ---RKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCF 982
               R+  L++   +V+  K  + +E++    C  +  AG++     +   ++ L+  +C 
Sbjct: 396  GRHRRGNLITSVSLVALGKYTQ-VETVGFAGCD-VDDAGIWEFARLNGKNVERLSLNSCR 453

Query: 981  GMKDLAFGVPALPPCNSLRSLSI 913
             + D  + +P L   NS  +L++
Sbjct: 454  LLTD--YSLPILFALNSFPNLAV 474



>gb:OSJN00054_1693991 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0072K14, complete sequence.
          Length = 575

 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 54/179 (30%), Positives = 85/179 (47%), Gaps = 9/179 (5%)
 Frame = -3

Query: 939 CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG-----VT----DYGLLPFVQ 787
           C  L SL +  C    +A+LV +++ CPN     L  L       VT    D G    V+
Sbjct: 366 CPKLNSL-LYFCHQMTNAALVTVAKNCPNFTRFRLCILEPGKPDVVTSQPLDEGFGAIVR 424

Query: 786 SCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLR 607
            C  GL ++++SG +  TDK    I K + + LE+L++   G  +D  +  + + C  LR
Sbjct: 425 ECK-GLQRLSISGLL--TDKVFMYIGK-YAKQLEMLSIAFAGD-SDKGMMHVMNGCKNLR 479

Query: 606 DLDISKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQ 430
            L+I   R S FG AAL G  A   +++ L +S C +    C      L + +  LN++
Sbjct: 480 KLEI---RDSPFGDAALLGNFARYETMRSLWMSSCNVTLKGC----QVLASKMPMLNVE 531



 Score = 40.8 bits (94), Expect = 0.071
 Identities = 55/200 (27%), Positives = 87/200 (43%), Gaps = 10/200 (5%)
 Frame = -3

Query: 927 RSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYG---LLPFVQSCDAGLVKVN 757
           R+L + +C GF    L  ++  C  L  L+L   N V D G   L  F  SC + LV +N
Sbjct: 128 RALVLISCEGFSTDGLAAVASHCKLLRELDLQE-NEVEDRGPRWLSCFPDSCTS-LVSLN 185

Query: 756 LSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVS 577
            + CI   +    ++ +L   +  L +L     V+  +LA I      L DL    +   
Sbjct: 186 FA-CIK-GEVNAGSLERLVSRSPNLRSLRLNRSVSVDTLAKILLRTPNLEDLGTG-NLTD 242

Query: 576 DFGIAALAG-GSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGV 400
           DF   +     SA++    + SLSG   AS  CL +++ L   L GLN+     +    +
Sbjct: 243 DFQTESYFKLTSALEKCKMLRSLSGFWDASPVCLSFIYPLCAQLTGLNLSYAPTLDASDL 302

Query: 399 DLLV------ERLWRCDILS 358
             ++      +RLW  D +S
Sbjct: 303 TKMISRCVKLQRLWVLDCIS 322



 Score = 38.1 bits (87), Expect = 0.46
 Identities = 30/108 (27%), Positives = 53/108 (49%), Gaps = 11/108 (10%)
 Frame = -3

Query: 858 PNLVHLNLSGLNGVTDYGLLPFVQSCDAG-LVKVNLSGC----------INVTDKTISAI 712
           PN+  L + G     D+ L+P      AG  ++    GC          + V+D+++  +
Sbjct: 61  PNVRALTVKGKPHFADFNLVPPDWGGYAGPWIEAAARGCHGLEELRMKRMVVSDESLELL 120

Query: 711 AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFG 568
           A+       L+ ++  G  TD  LAA+A +C +LR+LD+ ++ V D G
Sbjct: 121 ARSFPRFRALVLISCEGFSTDG-LAAVASHCKLLRELDLQENEVEDRG 167



>gb:CR382131_1663636 Yarrowia lipolytica chromosome E of strain CLIB99
            of Yarrowia lipolytica.
          Length = 717

 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 52/185 (28%), Positives = 83/185 (44%), Gaps = 6/185 (3%)
 Frame = -3

Query: 1107 KAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSL 928
            K   ++E L+   C  I      G+L  + G L+ +    C  + D AF       C  L
Sbjct: 431  KIGGALEWLEFYTCAAIVPP--LGLL--AGGSLQKIVLPGCTKVDD-AFLKLVAENCPRL 485

Query: 927  RSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLS- 751
            +   +  C    +  LV L+  CP L  LN+    G T  G L   +   A   K  ++ 
Sbjct: 486  QIADLRACEKVSNEGLVALAGKCPQLKLLNV----GRTQMGHLISYRGISAIARKTQVNT 541

Query: 750  ----GCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI-SKS 586
                GC  V DK++  +A   G +L+ L+LNGC  +T+ S+  I  Y S L  L++   +
Sbjct: 542  LGAAGCF-VCDKSMWELAWYRGHSLDRLSLNGCTLLTNDSIPRILPYTSNLAVLELRGCT 600

Query: 585  RVSDF 571
            +++DF
Sbjct: 601  QITDF 605



 Score = 47.4 bits (111), Expect = 8e-04
 Identities = 39/150 (26%), Positives = 69/150 (46%), Gaps = 3/150 (2%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQL-- 1075
            L+ +V+  C  V D  ++ V++ CP ++   LR C  +S+ G+V+       ++ L +  
Sbjct: 459  LQKIVLPGCTKVDDAFLKLVAENCPRLQIADLRACEKVSNEGLVALAGKCPQLKLLNVGR 518

Query: 1074 -EECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTG 898
             +  H IS  G+  I   +  ++  L    CF + D +    A    +SL  LS+  CT 
Sbjct: 519  TQMGHLISYRGISAIARKT--QVNTLGAAGCF-VCDKSMWELAWYRGHSLDRLSLNGCTL 575

Query: 897  FGDASLVVLSRLCPNLVHLNLSGLNGVTDY 808
              + S+  +     NL  L L G   +TD+
Sbjct: 576  LTNDSIPRILPYTSNLAVLELRGCTQITDF 605



 Score = 47.4 bits (111), Expect = 8e-04
 Identities = 37/146 (25%), Positives = 69/146 (47%), Gaps = 26/146 (17%)
 Frame = -3

Query: 771 LVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS 592
           L K+ L GC  V D  +  +A+ +   L++ +L  C  V++  L A+A  C  L+ L++ 
Sbjct: 459 LQKIVLPGCTKVDDAFLKLVAE-NCPRLQIADLRACEKVSNEGLVALAGKCPQLKLLNVG 517

Query: 591 KSR----VSDFGIAALAGGSAIQ----------------------FSLQILSLSGCVLAS 490
           +++    +S  GI+A+A  + +                        SL  LSL+GC L +
Sbjct: 518 RTQMGHLISYRGISAIARKTQVNTLGAAGCFVCDKSMWELAWYRGHSLDRLSLNGCTLLT 577

Query: 489 DKCLPYLHKLGNSLAGLNIQNCVGIS 412
           +  +P +    ++LA L ++ C  I+
Sbjct: 578 NDSIPRILPYTSNLAVLELRGCTQIT 603



>sp|Q8WV35|FXL9_HUMAN F-box/LRR-repeat protein 9 (F-box and
            leucine-rich repeat protein 9) (F-box protein
            FBL9).>gb:AX399882_1467195 Sequence 53 from Patent
            WO0218424.>gb:BC018785_1976641 Homo sapiens leucine rich
            repeat containing 29, transcript variant 1, mRNA (cDNA
            clone MGC:32109 IMAGE:4875646), complete cds.
          Length = 223

 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 36/126 (28%), Positives = 58/126 (46%)
 Frame = -3

Query: 1257 LHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQ 1078
            L  L+ L +TAC  +TD  +  V +    ++QL L     L+DNG+V+  +   S+E L 
Sbjct: 74   LRALQELDLTACSKLTDASLAKVLQFL-QLRQLSLSLLPELTDNGLVAVARGCPSLEHLA 132

Query: 1077 LEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTG 898
            L  C R+S  G +     S  +L+ L   +C  + +          C  LR L +  C G
Sbjct: 133  LSHCSRLSDKG-WAQAASSWPRLQHLNLSSCSQLIEQTLDAIG-QACRQLRVLDVATCPG 190

Query: 897  FGDASL 880
               A++
Sbjct: 191  INMAAV 196



 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 39/121 (32%), Positives = 62/121 (51%)
 Frame = -3

Query: 954 PALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDA 775
           P+L    +L+ L +  C+   DASL  + +    L  L+LS L  +TD GL+   + C +
Sbjct: 69  PSLLTLRALQELDLTACSKLTDASLAKVLQFL-QLRQLSLSLLPELTDNGLVAVARGCPS 127

Query: 774 GLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI 595
            L  + LS C  ++DK  +  A      L+ LNL+ C  + + +L AI   C  LR LD+
Sbjct: 128 -LEHLALSHCSRLSDKGWAQAAS-SWPRLQHLNLSSCSQLIEQTLDAIGQACRQLRVLDV 185

Query: 594 S 592
           +
Sbjct: 186 A 186



 Score = 42.0 bits (97), Expect = 0.032
 Identities = 38/125 (30%), Positives = 61/125 (48%), Gaps = 1/125 (0%)
 Frame = -3

Query: 771 LVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS 592
           L +++L+ C  +TD +++ +  L    L  L+L+    +TD  L A+A  C  L  L +S
Sbjct: 77  LQELDLTACSKLTDASLAKV--LQFLQLRQLSLSLLPELTDNGLVAVARGCPSLEHLALS 134

Query: 591 K-SRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGI 415
             SR+SD G A  A        LQ L+LS C    ++ L  + +    L  L++  C GI
Sbjct: 135 HCSRLSDKGWAQAASSWP---RLQHLNLSSCSQLIEQTLDAIGQACRQLRVLDVATCPGI 191

Query: 414 SHRGV 400
           +   V
Sbjct: 192 NMAAV 196



>gb:AF199355_1889695 Homo sapiens F-box protein FBL5 (FBL5) mRNA,
            complete cds.
          Length = 621

 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 64/257 (24%), Positives = 108/257 (42%), Gaps = 16/257 (6%)
 Frame = -3

Query: 1314 INLQNINERGFW-VMGSGQGLH----KLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLR 1150
            +NL     RGF  V G  + L     +L  L ++    + +  +E +S+ CPN++ L L 
Sbjct: 350  LNLSWTGNRGFISVAGFSRFLKVCGSELVRLELSCSHFLNETCLEVISEMCPNLQALNLS 409

Query: 1149 KCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKD 970
             C  L         K   S++ L L    ++ Q  +  IL +   +L+ L+  +C  ++D
Sbjct: 410  SCDKLPPQAFNHIAKLC-SLKRLVLYRT-KVEQTALLSIL-NFCSELQHLSLGSCVMIED 466

Query: 969  LAFGVPAL-PPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPF 793
                   +   C  LR+L +  C    +  +  L+  CP L  L+L         G  P 
Sbjct: 467  YDVIASMIGAKCKKLRTLDLWRCKNITENGIAELASGCPLLEELDL---------GWCPT 517

Query: 792  VQSCDA----------GLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDAS 643
            +QS              L K+ L+   +V D  I  +A  +   L+ L++ G   V+ AS
Sbjct: 518  LQSSTGCFTRLAHQLPNLQKLFLTANRSVCDTDIDELA-CNCTRLQQLDILGTRMVSPAS 576

Query: 642  LAAIADYCSVLRDLDIS 592
            L  + + C  L  LD+S
Sbjct: 577  LRKLLESCKDLSLLDVS 593



 Score = 43.5 bits (101), Expect = 0.011
 Identities = 43/165 (26%), Positives = 73/165 (44%), Gaps = 17/165 (10%)
 Frame = -3

Query: 1407 LMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVIT 1228
            L ++ L    +   +L  I ++   L  L+L +   I +        G    KLR+L + 
Sbjct: 428  LKRLVLYRTKVEQTALLSILNFCSELQHLSLGSCVMIEDYDVIASMIGAKCKKLRTLDLW 487

Query: 1227 ACQGVTDLGIEAVSKGCPNVKQLCLRKC-TLLSDNGVVS------------FVKAAESIE 1087
             C+ +T+ GI  ++ GCP +++L L  C TL S  G  +            F+ A  S+ 
Sbjct: 488  RCKNITENGIAELASGCPLLEELDLGWCPTLQSSTGCFTRLAHQLPNLQKLFLTANRSVC 547

Query: 1086 SLQLEE----CHRISQAGVFGILVHSAGKLKALAFENCFGMKDLA 964
               ++E    C R+ Q  + G  + S   L+ L  E+C   KDL+
Sbjct: 548  DTDIDELACNCTRLQQLDILGTRMVSPASLRKL-LESC---KDLS 588



 Score = 43.5 bits (101), Expect = 0.011
 Identities = 45/160 (28%), Positives = 70/160 (43%), Gaps = 10/160 (6%)
 Frame = -3

Query: 909 NCTGF-GDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVT 733
           +C+ F  +  L V+S +CPNL  LNLS  + +         + C    +K  +     V 
Sbjct: 383 SCSHFLNETCLEVISEMCPNLQALNLSSCDKLPPQAFNHIAKLCS---LKRLVLYRTKVE 439

Query: 732 DKTISAIAKLHGETLELLNLNGCGCVTDASLAA--IADYCSVLRDLDISKSR-VSDFGIA 562
              + +I     E L+ L+L  C  + D  + A  I   C  LR LD+ + + +++ GIA
Sbjct: 440 QTALLSILNFCSE-LQHLSLGSCVMIEDYDVIASMIGAKCKKLRTLDLWRCKNITENGIA 498

Query: 561 ALAGGSAIQFSLQ------ILSLSGCVLASDKCLPYLHKL 460
            LA G  +   L       + S +GC       LP L KL
Sbjct: 499 ELASGCPLLEELDLGWCPTLQSSTGCFTRLAHQLPNLQKL 538



>gb:AF176699_1888026 Homo sapiens F-box protein FBL4 mRNA, complete
            cds.
          Length = 621

 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 64/257 (24%), Positives = 108/257 (42%), Gaps = 16/257 (6%)
 Frame = -3

Query: 1314 INLQNINERGFW-VMGSGQGLH----KLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLR 1150
            +NL     RGF  V G  + L     +L  L ++    + +  +E +S+ CPN++ L L 
Sbjct: 350  LNLSWTGNRGFISVAGFSRFLKVCGSELVRLELSCSHFLNETCLEVISEMCPNLQALNLS 409

Query: 1149 KCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKD 970
             C  L         K   S++ L L    ++ Q  +  IL +   +L+ L+  +C  ++D
Sbjct: 410  SCDKLPPQAFNHIAKLC-SLKRLVLYRT-KVEQTALLSIL-NFCSELQHLSLGSCVMIED 466

Query: 969  LAFGVPAL-PPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPF 793
                   +   C  LR+L +  C    +  +  L+  CP L  L+L         G  P 
Sbjct: 467  YDVIASMIGAKCKKLRTLDLWRCKNITENGIAELASGCPLLEELDL---------GWCPT 517

Query: 792  VQSCDA----------GLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDAS 643
            +QS              L K+ L+   +V D  I  +A  +   L+ L++ G   V+ AS
Sbjct: 518  LQSSTGCFTRLAHQLPNLQKLFLTANRSVCDTDIDELA-CNCTRLQQLDILGTRMVSPAS 576

Query: 642  LAAIADYCSVLRDLDIS 592
            L  + + C  L  LD+S
Sbjct: 577  LRKLLESCKDLSLLDVS 593



 Score = 43.5 bits (101), Expect = 0.011
 Identities = 43/165 (26%), Positives = 73/165 (44%), Gaps = 17/165 (10%)
 Frame = -3

Query: 1407 LMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVIT 1228
            L ++ L    +   +L  I ++   L  L+L +   I +        G    KLR+L + 
Sbjct: 428  LKRLVLYRTKVEQTALLSILNFCSELQHLSLGSCVMIEDYDVIASMIGAKCKKLRTLDLW 487

Query: 1227 ACQGVTDLGIEAVSKGCPNVKQLCLRKC-TLLSDNGVVS------------FVKAAESIE 1087
             C+ +T+ GI  ++ GCP +++L L  C TL S  G  +            F+ A  S+ 
Sbjct: 488  RCKNITENGIAELASGCPLLEELDLGWCPTLQSSTGCFTRLAHQLPNLQKLFLTANRSVC 547

Query: 1086 SLQLEE----CHRISQAGVFGILVHSAGKLKALAFENCFGMKDLA 964
               ++E    C R+ Q  + G  + S   L+ L  E+C   KDL+
Sbjct: 548  DTDIDELACNCTRLQQLDILGTRMVSPASLRKL-LESC---KDLS 588



 Score = 43.5 bits (101), Expect = 0.011
 Identities = 45/160 (28%), Positives = 70/160 (43%), Gaps = 10/160 (6%)
 Frame = -3

Query: 909 NCTGF-GDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVT 733
           +C+ F  +  L V+S +CPNL  LNLS  + +         + C    +K  +     V 
Sbjct: 383 SCSHFLNETCLEVISEMCPNLQALNLSSCDKLPPQAFNHIAKLCS---LKRLVLYRTKVE 439

Query: 732 DKTISAIAKLHGETLELLNLNGCGCVTDASLAA--IADYCSVLRDLDISKSR-VSDFGIA 562
              + +I     E L+ L+L  C  + D  + A  I   C  LR LD+ + + +++ GIA
Sbjct: 440 QTALLSILNFCSE-LQHLSLGSCVMIEDYDVIASMIGAKCKKLRTLDLWRCKNITENGIA 498

Query: 561 ALAGGSAIQFSLQ------ILSLSGCVLASDKCLPYLHKL 460
            LA G  +   L       + S +GC       LP L KL
Sbjct: 499 ELASGCPLLEELDLGWCPTLQSSTGCFTRLAHQLPNLQKL 538



>sp|Q9UKA2|FXL4_HUMAN F-box/LRR-repeat protein 4 (F-box and
            leucine-rich repeat protein 4) (F-box protein
            FBL5).>gb:AF174590_1887908 Homo sapiens F-box protein
            Fbl4 (FBL4) mRNA, partial cds.>gb:BC055010_1985225 Homo
            sapiens F-box and leucine-rich repeat protein 4, mRNA
            (cDNA clone MGC:61641 IMAGE:6137889), complete
            cds.>gb:HS273N12_1997838 Human DNA sequence from clone
            RP1-273N12 on chromosome 6q16.1-16.3 Contains the FBXL4
            gene for F-box and leucine-rich repeat protein 4 and the
            POU3F2 gene for POU domain class 3 transcription factor 2
            and a CpG island, complete sequence.
          Length = 621

 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 64/257 (24%), Positives = 108/257 (42%), Gaps = 16/257 (6%)
 Frame = -3

Query: 1314 INLQNINERGFW-VMGSGQGLH----KLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLR 1150
            +NL     RGF  V G  + L     +L  L ++    + +  +E +S+ CPN++ L L 
Sbjct: 350  LNLSWTGNRGFISVAGFSRFLKVCGSELVRLELSCSHFLNETCLEVISEMCPNLQALNLS 409

Query: 1149 KCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKD 970
             C  L         K   S++ L L    ++ Q  +  IL +   +L+ L+  +C  ++D
Sbjct: 410  SCDKLPPQAFNHIAKLC-SLKRLVLYRT-KVEQTALLSIL-NFCSELQHLSLGSCVMIED 466

Query: 969  LAFGVPAL-PPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPF 793
                   +   C  LR+L +  C    +  +  L+  CP L  L+L         G  P 
Sbjct: 467  YDVIASMIGAKCKKLRTLDLWRCKNITENGIAELASGCPLLEELDL---------GWCPT 517

Query: 792  VQSCDA----------GLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDAS 643
            +QS              L K+ L+   +V D  I  +A  +   L+ L++ G   V+ AS
Sbjct: 518  LQSSTGCFTRLAHQLPNLQKLFLTANRSVCDTDIDELA-CNCTRLQQLDILGTRMVSPAS 576

Query: 642  LAAIADYCSVLRDLDIS 592
            L  + + C  L  LD+S
Sbjct: 577  LRKLLESCKDLSLLDVS 593



 Score = 43.5 bits (101), Expect = 0.011
 Identities = 43/165 (26%), Positives = 73/165 (44%), Gaps = 17/165 (10%)
 Frame = -3

Query: 1407 LMKVKLQSLNISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVIT 1228
            L ++ L    +   +L  I ++   L  L+L +   I +        G    KLR+L + 
Sbjct: 428  LKRLVLYRTKVEQTALLSILNFCSELQHLSLGSCVMIEDYDVIASMIGAKCKKLRTLDLW 487

Query: 1227 ACQGVTDLGIEAVSKGCPNVKQLCLRKC-TLLSDNGVVS------------FVKAAESIE 1087
             C+ +T+ GI  ++ GCP +++L L  C TL S  G  +            F+ A  S+ 
Sbjct: 488  RCKNITENGIAELASGCPLLEELDLGWCPTLQSSTGCFTRLAHQLPNLQKLFLTANRSVC 547

Query: 1086 SLQLEE----CHRISQAGVFGILVHSAGKLKALAFENCFGMKDLA 964
               ++E    C R+ Q  + G  + S   L+ L  E+C   KDL+
Sbjct: 548  DTDIDELACNCTRLQQLDILGTRMVSPASLRKL-LESC---KDLS 588



 Score = 43.5 bits (101), Expect = 0.011
 Identities = 45/160 (28%), Positives = 70/160 (43%), Gaps = 10/160 (6%)
 Frame = -3

Query: 909 NCTGF-GDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVT 733
           +C+ F  +  L V+S +CPNL  LNLS  + +         + C    +K  +     V 
Sbjct: 383 SCSHFLNETCLEVISEMCPNLQALNLSSCDKLPPQAFNHIAKLCS---LKRLVLYRTKVE 439

Query: 732 DKTISAIAKLHGETLELLNLNGCGCVTDASLAA--IADYCSVLRDLDISKSR-VSDFGIA 562
              + +I     E L+ L+L  C  + D  + A  I   C  LR LD+ + + +++ GIA
Sbjct: 440 QTALLSILNFCSE-LQHLSLGSCVMIEDYDVIASMIGAKCKKLRTLDLWRCKNITENGIA 498

Query: 561 ALAGGSAIQFSLQ------ILSLSGCVLASDKCLPYLHKL 460
            LA G  +   L       + S +GC       LP L KL
Sbjct: 499 ELASGCPLLEELDLGWCPTLQSSTGCFTRLAHQLPNLQKL 538



>gb:AE016817_1747445 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 392

 Score = 49.7 bits (117), Expect = 2e-04
 Identities = 36/130 (27%), Positives = 63/130 (48%)
 Frame = -3

Query: 774 GLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI 595
           GL ++ L G   V+D  +   A +H   L++L+L  C  V+DA + A+A  C  L  +++
Sbjct: 186 GLRRLALPGNKLVSDDFLIE-ACVHLPRLQVLDLRACDRVSDAGVVAVATNCPRLHTVNL 244

Query: 594 SKSRVSDFGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGI 415
            + R      +      A    L+ L ++GC ++           G SLA L++ NC  +
Sbjct: 245 GRHRNGHLITSVAVVALARHVQLETLGVAGCDVSDAGLWELAAVCGPSLARLSLNNCRYL 304

Query: 414 SHRGVDLLVE 385
           ++R V  L+E
Sbjct: 305 TNRSVPALLE 314



 Score = 43.9 bits (102), Expect = 0.008
 Identities = 34/118 (28%), Positives = 61/118 (51%), Gaps = 3/118 (2%)
 Frame = -3

Query: 1257 LHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCL---RKCTLLSDNGVVSFVKAAESIE 1087
            L +L+ L + AC  V+D G+ AV+  CP +  + L   R   L++   VV+  +  + +E
Sbjct: 210  LPRLQVLDLRACDRVSDAGVVAVATNCPRLHTVNLGRHRNGHLITSVAVVALARHVQ-LE 268

Query: 1086 SLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSI 913
            +L +  C  +S AG++ +       L  L+  NC  + + +  VPAL   N+  +LS+
Sbjct: 269  TLGVAGCD-VSDAGLWELAAVCGPSLARLSLNNCRYLTNRS--VPALLELNAFPNLSV 323



 Score = 35.8 bits (81), Expect = 2.3
 Identities = 46/175 (26%), Positives = 68/175 (38%), Gaps = 18/175 (10%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQL-- 1075
            LR L +   + V+D  +       P ++ L LR C  +SD GVV+       + ++ L  
Sbjct: 187  LRRLALPGNKLVSDDFLIEACVHLPRLQVLDLRACDRVSDAGVVAVATNCPRLHTVNLGR 246

Query: 1074 -EECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTG 898
                H I+   V  +  H   +L+ L    C  + D      A     SL  LS+ NC  
Sbjct: 247  HRNGHLITSVAVVALARHV--QLETLGVAGC-DVSDAGLWELAAVCGPSLARLSLNNCRY 303

Query: 897  FGDASLVVLSRL--CPNLVHLNLSGLNGVTDY-------------GLLPFVQSCD 778
              + S+  L  L   PNL  L L  +  +TD              GL   V+ CD
Sbjct: 304  LTNRSVPALLELNAFPNLSVLELRNIPHLTDVRAVVRYRQWKRACGLPVLVEGCD 358



>gb:CR382122_1655229 Kluyveromyces lactis strain NRRL Y-1140
            chromosome B of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 424

 Score = 49.7 bits (117), Expect = 2e-04
 Identities = 40/188 (21%), Positives = 79/188 (42%), Gaps = 4/188 (2%)
 Frame = -3

Query: 1173 NVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAF 994
            N+ +L +     ++D  ++S +    ++  L L  C +IS   +  I+ H          
Sbjct: 218  NLTKLTIAGNKKINDEELISLILGLPNLIDLDLRACSQISDISIVSIVTH---------- 267

Query: 993  ENCFGMKDLAFGVPALPPCNSLRSLSIC---NCTGFGDASLVVLSRLCPNLVHLNLSGLN 823
                              C  L+S+++    N     D S++ LS L  +L  +  SG +
Sbjct: 268  ------------------CPKLQSINLGRHENSHLITDLSIMALSEL-EHLTTVGFSGCD 308

Query: 822  GVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCGCVTDA 646
             ++D  +          LV+++++GC  ++D +IS I   HG   L++L++  C  V   
Sbjct: 309  KISDVSIWQLYSKHSTTLVRLSINGCTQISDSSISDIVAKHGFPNLKVLDIRNCQLVRFK 368

Query: 645  SLAAIADY 622
            +L    D+
Sbjct: 369  NLIQYRDW 376



 Score = 47.8 bits (112), Expect = 6e-04
 Identities = 38/145 (26%), Positives = 64/145 (44%), Gaps = 5/145 (3%)
 Frame = -3

Query: 1254 HKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQL 1075
            + L  L I   + + D  + ++  G PN+  L LR C+ +SD  +VS V     ++S+ L
Sbjct: 217  NNLTKLTIAGNKKINDEELISLILGLPNLIDLDLRACSQISDISIVSIVTHCPKLQSINL 276

Query: 1074 ---EECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNC 904
               E  H I+   +  +       L  + F  C  + D++          +L  LSI  C
Sbjct: 277  GRHENSHLITDLSIMAL--SELEHLTTVGFSGCDKISDVSIWQLYSKHSTTLVRLSINGC 334

Query: 903  TGFGDASL--VVLSRLCPNLVHLNL 835
            T   D+S+  +V     PNL  L++
Sbjct: 335  TQISDSSISDIVAKHGFPNLKVLDI 359



 Score = 39.7 bits (91), Expect = 0.16
 Identities = 39/172 (22%), Positives = 78/172 (45%), Gaps = 8/172 (4%)
 Frame = -3

Query: 1395 KLQSLN--ISDISLAVIGHYGVA--LTDLALINLQNINERGFWVMGSGQGLHKLRSLVIT 1228
            +L SLN  IS +  A+     ++  LT L +   + IN+    ++    GL  L  L + 
Sbjct: 194  RLNSLNFYISPVLPAIFDDVTISNNLTKLTIAGNKKINDEE--LISLILGLPNLIDLDLR 251

Query: 1227 ACQGVTDLGIEAVSKGCPNVKQLCL---RKCTLLSDNGVVSFVKAAESIESLQLEECHRI 1057
            AC  ++D+ I ++   CP ++ + L       L++D  +++ +   E + ++    C +I
Sbjct: 252  ACSQISDISIVSIVTHCPKLQSINLGRHENSHLITDLSIMA-LSELEHLTTVGFSGCDKI 310

Query: 1056 SQAGVFGILVHSAGKLKALAFENCFGMKDLAFG-VPALPPCNSLRSLSICNC 904
            S   ++ +    +  L  L+   C  + D +   + A     +L+ L I NC
Sbjct: 311  SDVSIWQLYSKHSTTLVRLSINGCTQISDSSISDIVAKHGFPNLKVLDIRNC 362



>gb:AY045799_1561315 Arabidopsis thaliana putative F-box protein GRR1
            protein 1, AtFBL18 (At4g03190) mRNA, complete cds.
          Length = 585

 Score = 49.7 bits (117), Expect = 2e-04
 Identities = 66/257 (25%), Positives = 108/257 (42%), Gaps = 18/257 (7%)
 Frame = -3

Query: 1239 LVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTL--LSDNGVVSFVKAAESIESLQLEEC 1066
            LV+T+C+G +  GI A++  C N++ L LR+C +  L  + +  F +++ S+ SL     
Sbjct: 131  LVLTSCEGFSTDGIAAIAATCRNLRVLELRECIVEDLGGDWLSYFPESSTSLVSLDFSCL 190

Query: 1065 HRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDA 886
                +      LV  +  LK+L       +  L   +   P    L + S          
Sbjct: 191  DSEVKISDLERLVSRSPNLKSLKLNPAVTLDGLVSLLRCAPQLTELGTGSF--AAQLKPE 248

Query: 885  SLVVLSRLCPNLVHL-NLSGLNGVTDYGLLPFVQSCDAGLVKVNLS-GCINVTDKTISAI 712
            +   LS    N   L +LSGL  V     LP + S   GL  +NLS   + + D     +
Sbjct: 249  AFSKLSEAFSNCKQLQSLSGLWDVLP-EYLPALYSVCPGLTSLNLSYATVRMPD-----L 302

Query: 711  AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLR---------DLDISKSRVSDFGIAA 559
             +L     +L  L     + D  L A+A YC  LR         DLD +   +++ G+  
Sbjct: 303  VELLRRCSKLQKLWVMDLIEDKGLEAVASYCKELRELRVFPSEPDLDATNIPLTEQGLVF 362

Query: 558  LAGG-----SAIQFSLQ 523
            ++ G     S + FS+Q
Sbjct: 363  VSKGCRKLESVLYFSVQ 379



>gb:AX057148_1458353 Sequence 24 from Patent WO0075184.
          Length = 448

 Score = 49.7 bits (117), Expect = 2e-04
 Identities = 43/123 (34%), Positives = 57/123 (46%), Gaps = 5/123 (4%)
 Frame = -3

Query: 855 NLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLN 676
           NLV LNL G  G   + L  F+ SC   L ++NLS C N T+K +        ET+  LN
Sbjct: 255 NLVRLNLPGCPGFPKFPLQTFLSSCPR-LDELNLSWCFNFTEKHVQVAVAHVSETMTQLN 313

Query: 675 LNGC-GCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFS----LQILSL 511
           L+G    +  + L+ +   C  L  LD+S S         L      +FS    LQ LSL
Sbjct: 314 LSGYRKNLQKSDLSTLVRRCPNLVHLDLSNS-------VMLKNDCFQEFSQLNYLQHLSL 366

Query: 510 SGC 502
           S C
Sbjct: 367 SRC 369



>gb:TBH25N7_1399057 Trypanosoma brucei 221 VSG expression site BAC.
          Length = 630

 Score = 49.7 bits (117), Expect = 2e-04
 Identities = 64/224 (28%), Positives = 97/224 (43%), Gaps = 27/224 (12%)
 Frame = -3

Query: 1251 KLRSLVITACQGVTDL----GIEAVSK----GCPNVKQLCLRKCTLLSDNGVVSFVKAAE 1096
            KL+ L I++C  +TDL    G+ ++ K    GC NV +     C L              
Sbjct: 255  KLKVLDISSCHEITDLTAIGGVRSLEKLSLSGCWNVTKGLEELCKL-------------S 301

Query: 1095 SIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLS 916
            S+  L +  C  +  A V   L++    LK L+  NC   KDL      L    +L  L+
Sbjct: 302  SLRELDISGCPVLGSAVVLRNLIN----LKVLSVSNCKNFKDL----NGLERLVNLEKLN 353

Query: 915  ICNCTGFGDASLVVLSRLCPNLVHLNLSG------LNGVTDYGLLPFVQSCD------AG 772
            +  C G   +SL  ++ L  NL  LN+SG       +G+ D   L  +   D       G
Sbjct: 354  LSGCHGV--SSLGFVANL-SNLKELNISGCESLVCFDGLQDLNNLEVLYLRDVKSFTNVG 410

Query: 771  LVK-------VNLSGCINVTDKTISAIAKLHGETLELLNLNGCG 661
             +K       ++LSGC  +T  ++S +  L  + LE L+L GCG
Sbjct: 411  AIKNLSKMRELDLSGCERIT--SLSGLETL--KRLEELSLEGCG 450



 Score = 40.0 bits (92), Expect = 0.12
 Identities = 51/144 (35%), Positives = 69/144 (47%), Gaps = 1/144 (0%)
 Frame = -3

Query: 852 LVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNL 673
           LVHL + G  GVTD   L  +++ +A    ++L  CIN+T       A     +L L   
Sbjct: 185 LVHLEVDGSRGVTDITGLCRLKTLEA----LSLDSCINITKGFDKICALPQLTSLSLCQT 240

Query: 672 NGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALAGGSAIQFSLQILSLSGCVL 496
           N    VTD  L  I      L+ LDIS    ++D  + A+ G      SL+ LSLSGC  
Sbjct: 241 N----VTDKDLRCIHP-DGKLKVLDISSCHEITD--LTAIGGVR----SLEKLSLSGCWN 289

Query: 495 ASDKCLPYLHKLGNSLAGLNIQNC 424
            + K L  L KL +SL  L+I  C
Sbjct: 290 VT-KGLEELCKL-SSLRELDISGC 311



>gb:BX908798_830555 Parachlamydia-related symbiont UWE25, complete
           genome.
          Length = 89

 Score = 49.7 bits (117), Expect = 2e-04
 Identities = 36/89 (40%), Positives = 49/89 (55%), Gaps = 3/89 (3%)
 Frame = -3

Query: 846 HLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNG 667
           HLNL G N +TD GL          L  +NLS CINVTD  ++ +  L    L+ L+L G
Sbjct: 3   HLNLFGCNNLTDDGLAHLTPLI--ALQHLNLSYCINVTDDGLAHLTPL--TALQYLDLFG 58

Query: 666 CGCVTDASLA---AIADYCSVLRDLDISK 589
           C  +TDA LA    +A   ++L + DI+K
Sbjct: 59  CNKLTDAGLARFKILAASLNLLINKDINK 87



>pir|I39171|I39171 cyclin A/CDK2-associated p45 -
           human>gb:HSU33761_2023638 Human cyclin A/CDK2-associated
           p45 (Skp2) mRNA, complete cds.
          Length = 435

 Score = 49.7 bits (117), Expect = 2e-04
 Identities = 43/123 (34%), Positives = 57/123 (46%), Gaps = 5/123 (4%)
 Frame = -3

Query: 855 NLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLN 676
           NLV LNL G  G   + L  F+ SC   L ++NLS C N T+K +        ET+  LN
Sbjct: 242 NLVRLNLPGCPGFPKFPLQTFLSSCPR-LDELNLSWCFNFTEKHVQVAVAHVSETMTQLN 300

Query: 675 LNGC-GCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSAIQFS----LQILSL 511
           L+G    +  + L+ +   C  L  LD+S S         L      +FS    LQ LSL
Sbjct: 301 LSGYRKNLQKSDLSTLVRRCPNLVHLDLSNS-------VMLKNDCFQEFSQLNYLQHLSL 353

Query: 510 SGC 502
           S C
Sbjct: 354 SRC 356



>gb:OSJN00275_1697802 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0042I07, complete sequence.
          Length = 482

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 86/354 (24%), Positives = 141/354 (39%), Gaps = 23/354 (6%)
 Frame = -3

Query: 1380 NISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLG 1201
            +I +  L V+     +L DL L     IN+ G   + S     KL SL + +   VT  G
Sbjct: 81   HIDNQGLFVLSSSCNSLNDLTLSFCSKINDAG---IASLTYCKKLMSLKLNSIPDVTSSG 137

Query: 1200 IEAVSKGCPNVKQLCLRKCT-LLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVH 1024
            +  V+ GC  +  L L  C  + +    + ++ +  S+E L +  C  ISQ   +  L  
Sbjct: 138  LLLVAFGCKALSSLYLNDCKGIAASTEWLEYLGSDGSLEELVVNNCPGISQ---YDFLKF 194

Query: 1023 SAG--KLKALAFENCFGM-------KDLAFGVPALPP----CNSLRSLSICNCTGFGDA- 886
              G  KLK   F N   M        D ++    +      C +L  L +       +  
Sbjct: 195  GRGWMKLKKFVFVNKETMVNHFITRHDPSYNANCVYKYDLCCENLEDLRLARLRTEPEGP 254

Query: 885  --SLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI 712
               L  L R C  L  L L  + G+ D  ++   QSC             N+   ++  +
Sbjct: 255  EIGLRFLLRKCKALEKLCLEYVGGLIDKDMIVLSQSCK------------NLKSISLWMM 302

Query: 711  AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALA----GGS 544
             +   E  E+L +      TD SL  +A  C +L+DL+++ + V D     +     G  
Sbjct: 303  PRRFHEH-EVLRMG----FTDESLEMLAHNCPLLQDLELTFAGVEDLEYPEIGFTQEGLV 357

Query: 543  AIQFSLQI--LSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLV 388
             +  S  I  L+L+G +  +DK +  L      L  L + +C  I+  G+  LV
Sbjct: 358  KLMHSCPIRSLTLNGTLFFNDKGMKGLSS-APFLKTLRLVDCKKITDYGMCFLV 410



>gb:TBH25N7_1399062 Trypanosoma brucei 221 VSG expression site BAC.
          Length = 630

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 61/213 (28%), Positives = 96/213 (45%), Gaps = 16/213 (7%)
 Frame = -3

Query: 1251 KLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLE 1072
            KL+ L I++C  +TDL   AV +   ++++L L  C  ++  G+    K + S+  L + 
Sbjct: 255  KLKVLDISSCHEITDLTAIAVVR---SLEKLSLSGCWNVT-KGLEELCKLS-SLRELDIS 309

Query: 1071 ECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG 892
             C  +  A V   L++    LK L+  NC   KDL      L    +L  L++  C G  
Sbjct: 310  GCPVLGSAVVLRNLIN----LKVLSVSNCKNFKDL----NGLERLVNLEKLNLSGCHGVS 361

Query: 891  DASLVV-LSRL-------CPNLVHLN-LSGLNGVTDYGLLPFVQSCDAGLVK-------V 760
                V  LS L       C +LV  + L  LN +    L       + G +K       +
Sbjct: 362  SLGFVANLSNLKELDISGCESLVCFDGLQDLNNLEVLYLRDVKSFTNVGAIKNLSKMREL 421

Query: 759  NLSGCINVTDKTISAIAKLHGETLELLNLNGCG 661
            +LSGC  +T  ++S +  L  + LE L+L GCG
Sbjct: 422  DLSGCERIT--SLSGLETL--KRLEELSLEGCG 450



 Score = 42.4 bits (98), Expect = 0.024
 Identities = 59/211 (27%), Positives = 84/211 (39%), Gaps = 48/211 (22%)
 Frame = -3

Query: 852 LVHLNLSGLNGVTDY-GLLPF-------VQSC---------------------------- 781
           LVHL + G  GVTD  GL          + SC                            
Sbjct: 185 LVHLEVDGSRGVTDITGLCRLKTLEALSLDSCINITKGFDKICALPQLTSLSLCQTNVTD 244

Query: 780 --------DAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIAD 625
                   D  L  +++S C  +TD T  A+ +    +LE L+L+GC  VT      + +
Sbjct: 245 KDLRCIHPDGKLKVLDISSCHEITDLTAIAVVR----SLEKLSLSGCWNVT----KGLEE 296

Query: 624 YC--SVLRDLDISKSRVSDFGIAALAGGSAIQ--FSLQILSLSGCVLASDKCLPYLHKLG 457
            C  S LR+LDIS       G   L     ++   +L++LS+S C   + K L  L +L 
Sbjct: 297 LCKLSSLRELDIS-------GCPVLGSAVVLRNLINLKVLSVSNC--KNFKDLNGLERLV 347

Query: 456 NSLAGLNIQNCVGISHRGVDLLVERLWRCDI 364
           N L  LN+  C G+S  G    +  L   DI
Sbjct: 348 N-LEKLNLSGCHGVSSLGFVANLSNLKELDI 377



>gb:AK032391_1162894 Mus musculus adult male olfactory brain cDNA,
            RIKEN full-length enriched library, clone:6430536M17
            product:F-BOX PROTEIN FBL5 homolog [Homo sapiens], full
            insert sequence.>gb:AK051429_1169684 Mus musculus 12 days
            embryo spinal ganglion cDNA, RIKEN full-length enriched
            library, clone:D130048H07 product:F-BOX PROTEIN FBL5
            homolog [Homo sapiens], full insert sequence.
          Length = 621

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 65/257 (25%), Positives = 108/257 (42%), Gaps = 16/257 (6%)
 Frame = -3

Query: 1314 INLQNINERGFW-VMGSGQGLH----KLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLR 1150
            +NL     RGF  V G  + L     +L  L ++    + D  +E +S+ CPN++ L L 
Sbjct: 350  LNLSWTGNRGFISVSGFSRFLKVCGSELVRLELSCSHFLNDTCLEVISEMCPNLQDLNLS 409

Query: 1149 KCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKD 970
             C  L         K   S++ L L    ++ Q  +  IL   A +L+ L+  +C  ++D
Sbjct: 410  SCDKLPPQAFGHIAKLC-SLKRLVLYRT-KVEQTALLSILNFCA-ELQHLSLGSCVMIED 466

Query: 969  LAFGVPAL-PPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPF 793
                   +   C +LR+L +  C    +  +  L+  C  L  L+L         G  P 
Sbjct: 467  YDVIASMIGAKCKNLRTLDLWRCKNITENGIAELASGCVLLEELDL---------GWCPT 517

Query: 792  VQSCDA----------GLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDAS 643
            +QS              L K+ L+   +V D  I  +A  +   L+ L++ G   V+ AS
Sbjct: 518  LQSSTGCFVRLARQLPNLQKLFLTANRSVCDTDIEELAS-NCTRLQQLDILGTRMVSPAS 576

Query: 642  LAAIADYCSVLRDLDIS 592
            L  + + C  L  LD+S
Sbjct: 577  LRKLLESCKDLSLLDVS 593



 Score = 47.0 bits (110), Expect = 0.001
 Identities = 46/160 (28%), Positives = 72/160 (45%), Gaps = 10/160 (6%)
 Frame = -3

Query: 909 NCTGF-GDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVT 733
           +C+ F  D  L V+S +CPNL  LNLS  + +         + C    +K  +     V 
Sbjct: 383 SCSHFLNDTCLEVISEMCPNLQDLNLSSCDKLPPQAFGHIAKLCS---LKRLVLYRTKVE 439

Query: 732 DKTISAIAKLHGETLELLNLNGCGCVTDASLAA--IADYCSVLRDLDISKSR-VSDFGIA 562
              + +I     E L+ L+L  C  + D  + A  I   C  LR LD+ + + +++ GIA
Sbjct: 440 QTALLSILNFCAE-LQHLSLGSCVMIEDYDVIASMIGAKCKNLRTLDLWRCKNITENGIA 498

Query: 561 ALAGGSAIQFSLQ------ILSLSGCVLASDKCLPYLHKL 460
            LA G  +   L       + S +GC +   + LP L KL
Sbjct: 499 ELASGCVLLEELDLGWCPTLQSSTGCFVRLARQLPNLQKL 538



 Score = 38.1 bits (87), Expect = 0.46
 Identities = 39/179 (21%), Positives = 71/179 (39%), Gaps = 2/179 (1%)
 Frame = -3

Query: 1251 KLRSLVITACQGVTDLGIEAVSKG--CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQ 1078
            +L+ L + +C  + D  + A   G  C N++ L L +C  +++NG+         +E L 
Sbjct: 452  ELQHLSLGSCVMIEDYDVIASMIGAKCKNLRTLDLWRCKNITENGIAELASGCVLLEELD 511

Query: 1077 LEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTG 898
            L  C  +  +                    CF    LA  +P L       + S+C    
Sbjct: 512  LGWCPTLQSS------------------TGCF--VRLARQLPNLQKLFLTANRSVC---- 547

Query: 897  FGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTI 721
              D  +  L+  C  L  L++ G   V+   L   ++SC   L  +++S C  + +K +
Sbjct: 548  --DTDIEELASNCTRLQQLDILGTRMVSPASLRKLLESC-KDLSLLDVSFCSQIDNKAV 603



>gb:BX908798_830310 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 501

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 41/175 (23%), Positives = 70/175 (40%)
 Frame = -3

Query: 1353 IGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCP 1174
            IGH  + L  L L    ++N + +   G    L  L SL    C  +T+  ++++ + C 
Sbjct: 336  IGHQFLNLKKLILDGNVHLNYQSW---GELHRLQTLISLSTRQCHQLTNDDLKSICRNCS 392

Query: 1173 NVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAF 994
             +++  + +C LL+D G++    +   +       C  I+  G+                
Sbjct: 393  RLEEFDVEECRLLTDQGILEIFSSCSHLSKFNCNRCDLITDKGL---------------- 436

Query: 993  ENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSG 829
                    L  GV A    + L  LSI  C+   D  L+   RL PNL  L++ G
Sbjct: 437  --------LEIGVRA----HLLSQLSIERCSKLTDQGLLYFLRLKPNLKELSIKG 479



 Score = 43.1 bits (100), Expect = 0.014
 Identities = 21/89 (23%), Positives = 42/89 (47%)
 Frame = -3

Query: 1251 KLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLE 1072
            +L    +  C+ +TD GI  +   C ++ +    +C L++D G++     A  +  L +E
Sbjct: 393  RLEEFDVEECRLLTDQGILEIFSSCSHLSKFNCNRCDLITDKGLLEIGVRAHLLSQLSIE 452

Query: 1071 ECHRISQAGVFGILVHSAGKLKALAFENC 985
             C +++  G+   L      LK L+ + C
Sbjct: 453  RCSKLTDQGLLYFL-RLKPNLKELSIKGC 480



 Score = 41.2 bits (95), Expect = 0.054
 Identities = 45/172 (26%), Positives = 68/172 (39%), Gaps = 5/172 (2%)
 Frame = -3

Query: 1095 SIESLQLEEC-----HRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNS 931
            S+  L L  C     H I + G      H    LK L  +    +   ++G   L    +
Sbjct: 316  SLGELNLSVCGWLRPHHIREIG------HQFLNLKKLILDGNVHLNYQSWG--ELHRLQT 367

Query: 930  LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLS 751
            L SLS   C    +  L  + R C  L   ++     +TD G+L    SC + L K N +
Sbjct: 368  LISLSTRQCHQLTNDDLKSICRNCSRLEEFDVEECRLLTDQGILEIFSSC-SHLSKFNCN 426

Query: 750  GCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI 595
             C  +TDK +  I  +    L  L++  C  +TD  L         L++L I
Sbjct: 427  RCDLITDKGLLEIG-VRAHLLSQLSIERCSKLTDQGLLYFLRLKPNLKELSI 477



>gb:FRU90880_2572188 Takifugu rubripes isotocin and vasotocin locus.
          Length = 257

 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 35/154 (22%), Positives = 64/154 (41%)
 Frame = -3

Query: 1167 KQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFEN 988
            KQ+ L     ++D+ +V      ++I  + + +C  +   GV  +  H            
Sbjct: 67   KQIDLSGLQQVNDDLLVKIASRRQNITEINISDCRGVHDHGVSSLASH------------ 114

Query: 987  CFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDY 808
                            C SL+  +   C   GDASL  L   CP LV +++   + +TD 
Sbjct: 115  ----------------CPSLQKYTAYRCKQLGDASLSALGTHCPLLVKVHVGNQDKLTDE 158

Query: 807  GLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAK 706
             L    + C + L  ++L  C ++TD+ + A++K
Sbjct: 159  ALKKLGEHC-SELKDIHLGQCYSITDEGMVALSK 191



 Score = 47.0 bits (110), Expect = 0.001
 Identities = 31/116 (26%), Positives = 59/116 (50%), Gaps = 1/116 (0%)
 Frame = -3

Query: 891 DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI 712
           D  LV ++    N+  +N+S   GV D+G+      C + L K     C  + D ++SA+
Sbjct: 79  DDLLVKIASRRQNITEINISDCRGVHDHGVSSLASHCPS-LQKYTAYRCKQLGDASLSAL 137

Query: 711 AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKS-RVSDFGIAALAGG 547
              H   L  +++     +TD +L  + ++CS L+D+ + +   ++D G+ AL+ G
Sbjct: 138 GT-HCPLLVKVHVGNQDKLTDEALKKLGEHCSELKDIHLGQCYSITDEGMVALSKG 192



 Score = 38.5 bits (88), Expect = 0.35
 Identities = 21/85 (24%), Positives = 45/85 (52%)
 Frame = -3

Query: 1377 ISDISLAVIGHYGVALTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGI 1198
            + D SL+ +G +   L  + + N   + +     +G  +   +L+ + +  C  +TD G+
Sbjct: 129  LGDASLSALGTHCPLLVKVHVGNQDKLTDEALKKLG--EHCSELKDIHLGQCYSITDEGM 186

Query: 1197 EAVSKGCPNVKQLCLRKCTLLSDNG 1123
             A+SKGC  +++L L++  L++  G
Sbjct: 187  VALSKGCRKLQRLYLQENKLITKGG 211



 Score = 35.0 bits (79), Expect = 3.9
 Identities = 15/57 (26%), Positives = 32/57 (56%)
 Frame = -3

Query: 1215 VTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAG 1045
            +TD  ++ + + C  +K + L +C  ++D G+V+  K    ++ L L+E   I++ G
Sbjct: 155  LTDEALKKLGEHCSELKDIHLGQCYSITDEGMVALSKGCRKLQRLYLQENKLITKGG 211



 Score = 34.7 bits (78), Expect = 5.1
 Identities = 45/221 (20%), Positives = 84/221 (38%)
 Frame = -3

Query: 1317 LINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTL 1138
            L  LQ +N+     + S +    +  + I+ C+GV D G+ +++  CP++++    +C  
Sbjct: 71   LSGLQQVNDDLLVKIASRR--QNITEINISDCRGVHDHGVSSLASHCPSLQKYTAYRCKQ 128

Query: 1137 LSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFG 958
            L D  + +       +  + +    +++              LK L  E+C  +KD+  G
Sbjct: 129  LGDASLSALGTHCPLLVKVHVGNQDKLTDEA-----------LKKLG-EHCSELKDIHLG 176

Query: 957  VPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCD 778
                             C    D  +V LS+ C  L  L L     +T  G +       
Sbjct: 177  ----------------QCYSITDEGMVALSKGCRKLQRLYLQENKLITKGGKMRICMKFW 220

Query: 777  AGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV 655
              L  V L   ++      SA++ +  + L   N+ G  CV
Sbjct: 221  VQLFGVIL---LHPPPPNTSAVSIIQPQ-LHKFNIGGNECV 257



>gb:ATT6G21_1556302 Arabidopsis thaliana DNA chromosome 5, BAC clone
            T6G21 (ESSA project).>gb:BT015833_1642451 Arabidopsis
            thaliana At5g21900 gene, complete
            cds.>gb:BT020184_1642579 Arabidopsis thaliana At5g21900
            mRNA, complete cds.>gb:AC140977_1744067 Arabidopsis
            thaliana chromosome 5 BAC F13M11 genomic sequence,
            complete sequence.
          Length = 544

 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 48/170 (28%), Positives = 77/170 (45%), Gaps = 1/170 (0%)
 Frame = -3

Query: 1332 LTDLALINLQNINERGFWVMGSGQGLHKLRSLVITACQGVTDLGIEAVSKGCPNVKQLCL 1153
            LTDL+L N   + +   W +G  +   KL +L IT    +TD  +E +++GC  +K L L
Sbjct: 364  LTDLSLANCNEVTDECMWHIG--RYCKKLEALDITDLDKLTDKSLEFITEGCRYLKSLKL 421

Query: 1152 RKCTLLSDNGVVSFVKAAE-SIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGM 976
                  SD  + +F++ +  S+  L L +   +     F  L      L+ L    C  +
Sbjct: 422  TS-NRFSDECIAAFLEVSGGSLRELCLNKVRDVGPETAFS-LAKVCKMLQFLDLSWCRRL 479

Query: 975  KDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGL 826
            K+       L  C+SL+SL +   T   D  L  LSR   ++  L L+ L
Sbjct: 480  KEDDLR-RILRCCSSLQSLKLFGWTQVEDTYLEELSRSDVHITGLKLTSL 528



 Score = 42.4 bits (98), Expect = 0.024
 Identities = 64/277 (23%), Positives = 108/277 (38%), Gaps = 7/277 (2%)
 Frame = -3

Query: 1248 LRSLVITAC-QGVTDLGIEAVSK----GCPNVKQLCLRKCTLLSDNGVVSFVKAAESIES 1084
            L+ L++  C + +TD  I    K    G P++  L L+    L+DN ++   K++  ++ 
Sbjct: 226  LKVLILDLCGRSMTDYTINQFFKRAPNGFPSLTTLSLQGAFCLTDNALLLISKSSPLLQY 285

Query: 1083 LQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNC 904
            + L EC          +L + A ++ A  F +                  +LR LSI  C
Sbjct: 286  INLTEC---------SLLTYRALRILADKFGS------------------TLRGLSIGGC 318

Query: 903  TGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKT 724
             G                 H   S         L  F +     L  ++++G ++V D  
Sbjct: 319  QGIKK--------------HKGFSS-------SLYKFEK-----LNYLSVAGLVSVNDGV 352

Query: 723  ISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAALAGG 547
            + +        L  L+L  C  VTD  +  I  YC  L  LDI+   +++D  +  +  G
Sbjct: 353  VRSFFMFRSSILTDLSLANCNEVTDECMWHIGRYCKKLEALDITDLDKLTDKSLEFITEG 412

Query: 546  SAIQFSLQILSLSGCVLASDKCL-PYLHKLGNSLAGL 439
                 SL++ S       SD+C+  +L   G SL  L
Sbjct: 413  CRYLKSLKLTSNR----FSDECIAAFLEVSGGSLREL 445



 Score = 40.8 bits (94), Expect = 0.071
 Identities = 42/165 (25%), Positives = 77/165 (46%), Gaps = 7/165 (4%)
 Frame = -3

Query: 858 PNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELL 679
           P+L  L+L G   +TD  LL   +S    L  +NL+ C  +T + +  +A   G TL  L
Sbjct: 255 PSLTTLSLQGAFCLTDNALLLISKSSPL-LQYINLTECSLLTYRALRILADKFGSTLRGL 313

Query: 678 NLNGCGCVT-----DASLAAIA--DYCSVLRDLDISKSRVSDFGIAALAGGSAIQFSLQI 520
           ++ GC  +       +SL      +Y SV   + ++   V  F +      S+I   L  
Sbjct: 314 SIGGCQGIKKHKGFSSSLYKFEKLNYLSVAGLVSVNDGVVRSFFMFR----SSI---LTD 366

Query: 519 LSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVE 385
           LSL+ C   +D+C+ ++ +    L  L+I +   ++ + ++ + E
Sbjct: 367 LSLANCNEVTDECMWHIGRYCKKLEALDITDLDKLTDKSLEFITE 411



>pir|E85040|E85040 hypothetical protein AT4g03190 [imported] -
            Arabidopsis thaliana>gb:AC005275_1532350 Arabidopsis
            thaliana BAC F4C21 from chromosome IV, top arm, near 17
            cM, complete sequence.>gb:ATCHRIV8_1547300 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            8.>gb:AY150427_1584992 Arabidopsis thaliana putative
            F-box protein AtFBL18 (At4g03190) mRNA, complete cds.
          Length = 585

 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 59/222 (26%), Positives = 94/222 (42%), Gaps = 4/222 (1%)
 Frame = -3

Query: 1239 LVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTL--LSDNGVVSFVKAAESIESLQLEEC 1066
            LV+T+C+G +  GI A++  C N++ L LR+C +  L  + +  F +++ S+ SL     
Sbjct: 131  LVLTSCEGFSTDGIAAIAATCRNLRVLELRECIVEDLGGDWLSYFPESSTSLVSLDFSCL 190

Query: 1065 HRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDA 886
                +      LV  +  LK+L       +  L   +   P    L + S          
Sbjct: 191  DSEVKISDLERLVSRSPNLKSLKLNPAVTLDGLVSLLRCAPQLTELGTGSF--AAQLKPE 248

Query: 885  SLVVLSRLCPNLVHL-NLSGLNGVTDYGLLPFVQSCDAGLVKVNLS-GCINVTDKTISAI 712
            +   LS    N   L +LSGL  V     LP + S   GL  +NLS   + + D     +
Sbjct: 249  AFSKLSEAFSNCKQLQSLSGLWDVLP-EYLPALYSVCPGLTSLNLSYATVRMPD-----L 302

Query: 711  AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKS 586
             +L     +L  L     + D  L A+A YC  LR+L +  S
Sbjct: 303  VELLRRCSKLQKLWVMDLIEDKGLEAVASYCKELRELRVFPS 344



>pir|S13724|S13724 ESAG 8 protein - Trypanosoma
            brucei>gb:TBESAG8_1399003 T. brucei ESAG 8 gene for a
            leucine-rich repeat family protein.
          Length = 630

 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 60/213 (28%), Positives = 94/213 (44%), Gaps = 16/213 (7%)
 Frame = -3

Query: 1251 KLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLE 1072
            KL+ L I++C  +TDL       G  ++++L L  C  ++  G+    K + ++  L + 
Sbjct: 255  KLKVLDISSCHEITDL---TAIGGVRSLEKLSLSGCWNVT-KGLEELCKFS-NLRELDIS 309

Query: 1071 ECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG 892
             C  +  A V   L++    LK L+  NC   KDL      L    +L  L++  C G  
Sbjct: 310  GCPVLGSAVVLRNLIN----LKVLSVSNCKNFKDL----NGLERLVNLEKLNLSGCHGVS 361

Query: 891  DASLVV-LSRL-------CPNLVHLN-LSGLNGVTDYGLLPFVQSCDAGLVK-------V 760
                V  LS L       C +LV  + L  LN +    L       + G +K       +
Sbjct: 362  SLGFVANLSNLKELDISGCESLVCFDGLQDLNNLEVLYLRDVKSFTNVGAIKNLSKMREL 421

Query: 759  NLSGCINVTDKTISAIAKLHGETLELLNLNGCG 661
            +LSGC  +T  ++S +  L G  LE L+L GCG
Sbjct: 422  DLSGCERIT--SLSGLESLKG--LEELSLEGCG 450



 Score = 40.4 bits (93), Expect = 0.092
 Identities = 62/207 (29%), Positives = 87/207 (42%), Gaps = 44/207 (21%)
 Frame = -3

Query: 852 LVHLNLSGLNGVTDYGLLPFVQSCDA-----------GLVKV-------NLSGC-INVTD 730
           LVHL + G  GVTD   L  +++ +A           G  K+       +LS C  NVTD
Sbjct: 185 LVHLEVDGSRGVTDITGLCRLKTLEALSLDSCINITKGFDKICALPQLTSLSLCQTNVTD 244

Query: 729 KTISA-----------IAKLHGET----------LELLNLNGCGCVTDASLAAIADYC-- 619
           K +             I+  H  T          LE L+L+GC  VT      + + C  
Sbjct: 245 KDLRCIHPDGKLKVLDISSCHEITDLTAIGGVRSLEKLSLSGCWNVT----KGLEELCKF 300

Query: 618 SVLRDLDISKSRVSDFGIAALAGGSAIQ--FSLQILSLSGCVLASDKCLPYLHKLGNSLA 445
           S LR+LDIS       G   L     ++   +L++LS+S C   + K L  L +L N L 
Sbjct: 301 SNLRELDIS-------GCPVLGSAVVLRNLINLKVLSVSNC--KNFKDLNGLERLVN-LE 350

Query: 444 GLNIQNCVGISHRGVDLLVERLWRCDI 364
            LN+  C G+S  G    +  L   DI
Sbjct: 351 KLNLSGCHGVSSLGFVANLSNLKELDI 377



>gb:AF291816_1783718 Arabidopsis thaliana GRR1-like protein 1 (GRH1)
            mRNA, complete cds.
          Length = 585

 Score = 48.1 bits (113), Expect = 4e-04
 Identities = 58/222 (26%), Positives = 94/222 (42%), Gaps = 4/222 (1%)
 Frame = -3

Query: 1239 LVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTL--LSDNGVVSFVKAAESIESLQLEEC 1066
            LV+T+C+G +  GI A++  C N++ L LR+C +  L  + +  F +++ S+ SL     
Sbjct: 131  LVLTSCEGFSTDGIAAIASTCRNLRVLELRECIVEDLGGDWLSYFPESSTSLVSLDFSCL 190

Query: 1065 HRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDA 886
                +      LV  +  LK+L       +  L   +   P    L + S          
Sbjct: 191  DSEVKISDLERLVSRSPNLKSLKLNPAVTLDGLVSLLRCAPQLTELGTGSF--AAQLKPE 248

Query: 885  SLVVLSRLCPNLVHL-NLSGLNGVTDYGLLPFVQSCDAGLVKVNLS-GCINVTDKTISAI 712
            +   LS    N   L +LSGL  V     LP + S   GL  +NL+   + + D     +
Sbjct: 249  AFSKLSEAFSNCKQLQSLSGLWDVLP-EYLPALYSVCPGLTSLNLTYATVRMPD-----L 302

Query: 711  AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKS 586
             +L     +L  L     + D  L A+A YC  LR+L +  S
Sbjct: 303  VELLRRCSKLQKLWVMDLIEDKGLEAVASYCKELRELRVFPS 344



>gb:BX908798_831011 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 1866

 Score = 48.1 bits (113), Expect = 4e-04
 Identities = 73/263 (27%), Positives = 124/263 (47%), Gaps = 17/263 (6%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPN---VKQLCLRKCTLLSDNGVVSFVKAAES---IE 1087
            L+SL     Q ++D G+EA ++   +    K L L     +SD G+ +F +A  S   ++
Sbjct: 1512 LKSLSFNENQ-ISDKGMEAFAQALASNTTFKSLYLGG-NQISDKGMEAFAQALASNTTLK 1569

Query: 1086 SLQLEECHRISQAGVFGILVHSAGK--LKALAF-ENCFGMKDLAFGVPALPPCNSLRSLS 916
            SL L++ ++IS  G   +    A    LK+L+F EN    K       AL    +L+SL 
Sbjct: 1570 SLYLDD-NQISNKGAQALAQALASNTILKSLSFNENQISDKGAQALAQALASNTTLKSLY 1628

Query: 915  ICNCTGFGDASLVVLSRLCPNLVHLNLS-GLNGVTDYGLLPFVQSCDAG--LVKVNLSGC 745
            + +       +  +   L  N    +L  G N ++D G     Q+  +   L  ++L+G 
Sbjct: 1629 LDDSQISDKGAQALAQALASNKALKSLCLGSNQISDKGAQALAQALASNTTLKSLSLNGK 1688

Query: 744  INVTDKTISAIAKL--HGETLELLNLNGCGCVTDASLAAIADYCS---VLRDLDISKSRV 580
              ++DK + AIA+      TL+ L+LNG   ++D  + A A   +    L  LD+  +++
Sbjct: 1689 -QISDKGMEAIAQALASNTTLKSLSLNGKQ-ISDKGMEAFAQTLASNTTLESLDLRNNQI 1746

Query: 579  SDFGIAALAGGSAIQFSLQILSL 511
            SD G+ A A   A   +L+ L L
Sbjct: 1747 SDKGMQAFAQTLASNTTLESLDL 1769



 Score = 41.6 bits (96), Expect = 0.042
 Identities = 74/307 (24%), Positives = 137/307 (44%), Gaps = 17/307 (5%)
 Frame = -3

Query: 1248 LRSLVITACQGVTDLGIEAVSKGCPN---VKQLCLRKCTLLSDNGVVSFVKAAES---IE 1087
            L SL +   Q ++D G+EA ++   +   +K L L     +SD G+ +F +A  S   ++
Sbjct: 1456 LESLYLGGNQ-ISDKGMEAFAQALASNTTLKSLYLDD-NQISDKGMEAFAQALASNTTLK 1513

Query: 1086 SLQLEECHRISQAGV--FGILVHSAGKLKALAFE-NCFGMKDLAFGVPALPPCNSLRSLS 916
            SL   E ++IS  G+  F   + S    K+L    N    K +     AL    +L+SL 
Sbjct: 1514 SLSFNE-NQISDKGMEAFAQALASNTTFKSLYLGGNQISDKGMEAFAQALASNTTLKSLY 1572

Query: 915  ICNCTGFGDASLVVLSRLCPNLVHLNLS-GLNGVTDYGLLPFVQSCDAGLVKVNLS-GCI 742
            + +       +  +   L  N +  +LS   N ++D G     Q+  +     +L     
Sbjct: 1573 LDDNQISNKGAQALAQALASNTILKSLSFNENQISDKGAQALAQALASNTTLKSLYLDDS 1632

Query: 741  NVTDKTISAIAKLHGETLELLNLN-GCGCVTDASLAAIADYCS---VLRDLDISKSRVSD 574
             ++DK   A+A+       L +L  G   ++D    A+A   +    L+ L ++  ++SD
Sbjct: 1633 QISDKGAQALAQALASNKALKSLCLGSNQISDKGAQALAQALASNTTLKSLSLNGKQISD 1692

Query: 573  FGIAALAGGSAIQFSLQILSLSGCVLASDKCLPYLHKLGN--SLAGLNIQNCVGISHRGV 400
             G+ A+A   A   +L+ LSL+G  ++      +   L +  +L  L+++N   IS +G+
Sbjct: 1693 KGMEAIAQALASNTTLKSLSLNGKQISDKGMEAFAQTLASNTTLESLDLRN-NQISDKGM 1751

Query: 399  DLLVERL 379
                + L
Sbjct: 1752 QAFAQTL 1758



 Score = 38.1 bits (87), Expect = 0.46
 Identities = 69/273 (25%), Positives = 112/273 (41%), Gaps = 24/273 (8%)
 Frame = -3

Query: 1251 KLRSLVITACQGVTDLGIEAVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAA-----ESIE 1087
            +L  L ++ C  +    ++ + K  PN+K L L +C+ L      +F  A+       +E
Sbjct: 1193 ELDYLNVSGCPLIKVETLQEIEKSSPNLKALYLNRCSQLHALEKPNFPFASTYLQFARLE 1252

Query: 1086 SLQLEECHRISQAGVFGILVHS--AGK---LKALAFENCFG-MKDLAFGVPA--LPPCNS 931
             LQL  C  +    +   L+H+  A K   LK L F+     +K      PA  L     
Sbjct: 1253 ELQLRRCKALVSIQLDAPLLHTLKADKNPHLKMLFFKTTAPYIKGSFTRCPALDLETAKK 1312

Query: 930  LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLN--GVTDYGLLPFV----QSCDAGL 769
             R   I       +     L +L  N   L   GLN  G++D  +   V     +C+  L
Sbjct: 1313 ERVQKILKEIKTSEIDHTQLFQLYMNDSELTSFGLNRKGISDKEMEVEVIANGLACNTAL 1372

Query: 768  VKVNLSGCINVTDKTISAIAK--LHGETLELLNLNGCGCVTDASLAAIADYC---SVLRD 604
                L G   ++D+   A A+      TL+ L L G   ++D  + A A      + L  
Sbjct: 1373 KSFWLKG-NQISDRGAEAFAQALASNTTLKSLYLGG-NQISDKGMEAFAQALASNTTLES 1430

Query: 603  LDISKSRVSDFGIAALAGGSAIQFSLQILSLSG 505
            L  +++++SD G+ A A   A   +L+ L L G
Sbjct: 1431 LSFNENQISDKGMEAFAQALASNTTLESLYLGG 1463



>gb:AP005286_1849872 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1004_A05.
          Length = 582

 Score = 47.8 bits (112), Expect = 6e-04
 Identities = 76/291 (26%), Positives = 126/291 (43%), Gaps = 62/291 (21%)
 Frame = -3

Query: 1263 QGLHKLRSLVITACQGVTDLGIEAVS-----------------KGCPNVKQLCLRKCTLL 1135
            +GL KL  L +  C  VT   +EA+S                 +GC N + L   K   L
Sbjct: 280  RGLSKLTQLNLEGCP-VTAACLEAISGLASLVVLNLSRCGIYGEGCENFQGLKKLKVLNL 338

Query: 1134 SDNGV----VSFVKAAESIESLQLEECHRISQAGVFGI--------LVHSAGKLKALAFE 991
              N +    ++ +K   ++ESL L+ C ++   G+  +        L  S  ++ +   +
Sbjct: 339  GFNNITDDCLAHLKELINLESLNLDSC-KVGDEGLLHLRGLMLLKSLELSDTEVGSSGLQ 397

Query: 990  NCFGMKDLAF-----------GVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVH 844
            +  G+++L             G+  +   NSL+S+++ N     D  L  L+ L   L H
Sbjct: 398  HLSGLRNLESINLSFTLVTDTGMKKISALNSLKSVNLDN-RQITDVGLAALTSLT-GLTH 455

Query: 843  LNLSGLNGVTDYGLLPF--------VQSC-----DAG---------LVKVNLSGCINVTD 730
            L+L G   +TDYG   F        ++ C     DAG         L ++NLS  +N+TD
Sbjct: 456  LDLFGAR-ITDYGTSCFRFFKNLESLEVCGGLITDAGVKNIKDLKALKQLNLSQNVNLTD 514

Query: 729  KTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVS 577
            KT+  I+ L    L  LN++    V++A L  + D  + LR L +   RV+
Sbjct: 515  KTLELISGL--TALVSLNVSNTR-VSNAGLRHLKDLQN-LRSLSLDSCRVT 561



>gb:AB178014_16275 Ralstonia solanacearum lrpF gene for leucine-rich
            repeat protein, complete cds.
          Length = 1035

 Score = 47.8 bits (112), Expect = 6e-04
 Identities = 62/198 (31%), Positives = 88/198 (44%), Gaps = 23/198 (11%)
 Frame = -3

Query: 1011 LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTG--FGDASLVVLSRLCPNLVHLN 838
            L++L+F     + DL     ALPP  S+R L +  CTG    +A L  L+RL   L  L+
Sbjct: 612  LESLSFHGPLSLADLR----ALPP--SVRHLDLSGCTGSAVSEAGLAYLARL--PLASLD 663

Query: 837  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSG------------------CINVTDKTI--- 721
            LS   G+ + G      S  A L  +NLSG                   ++++   I   
Sbjct: 664  LSD-TGIGNRGAQALAAS--ASLTSLNLSGNGIGTAGAEALGRNTVLTALDISANPIRNA 720

Query: 720  SAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISKSRVSDFGIAALAGGSA 541
             A A     +L  L L   G + D  + A+A   +VLR LDIS + +SD   AALA    
Sbjct: 721  GAQALASSRSLTSLELRDTG-IEDGGIEALAAN-TVLRSLDISGNDLSDQSAAALAANR- 777

Query: 540  IQFSLQILSLSGCVLASD 487
               +L  L  +GC L +D
Sbjct: 778  ---TLTSLKANGCGLTND 792



>gb:BC088595_2565725 Xenopus tropicalis cDNA clone IMAGE:6992156,
            partial cds.
          Length = 383

 Score = 47.4 bits (111), Expect = 8e-04
 Identities = 59/238 (24%), Positives = 108/238 (45%), Gaps = 3/238 (1%)
 Frame = -3

Query: 1083 LQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNC 904
            + L  C  I+   + GI+      L  L++ N    K L++ +  LP   +LR L++  C
Sbjct: 152  IDLNRCKSITPLMLSGIIRRQPASLD-LSWTN-ISKKQLSWLINRLP---ALRDLNLSGC 206

Query: 903  TGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKT 724
            +    ++L   S  CP L  LN+  + G+ D  +               LS   +     
Sbjct: 207  SWIAVSALC--SSSCPLLRTLNVQWVEGLKDAQMRDL------------LSPPTDNRPGQ 252

Query: 723  ISAIAKLHGET-LELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAAL-A 553
            I   +KL   T L L  L+    +TDASL  +  +  +L  LD+S  + V+D  I  L A
Sbjct: 253  IDNRSKLRNITELRLAGLD----ITDASLRLMIRHMPLLAKLDLSYCNHVTDQSINLLTA 308

Query: 552  GGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVERL 379
             G++ + +L  ++LS C   +D+CL +  + GN +  ++++ C  ++    +  +  +
Sbjct: 309  VGTSTRDTLLEMNLSDCNNVTDQCLTFFKRCGN-ICSIDLRFCKQVTKESCEQFIAEM 365



>gb:BC082636_2562784 Xenopus laevis MGC80880 protein, mRNA (cDNA clone
            MGC:81537 IMAGE:6862732), complete cds.
          Length = 1259

 Score = 47.4 bits (111), Expect = 8e-04
 Identities = 60/238 (25%), Positives = 108/238 (45%), Gaps = 3/238 (1%)
 Frame = -3

Query: 1083 LQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNC 904
            + L  C  I+   + GI+      L  L++ N    K L++ +  LP   +LR L++  C
Sbjct: 1028 IDLNRCKSITPLMLSGIIRRQPASLD-LSWTN-ISKKQLSWLINRLP---ALRDLNLSGC 1082

Query: 903  TGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKT 724
            +    ++L   S  CP L  LN+  + G+ D  +               LS   +     
Sbjct: 1083 SWIAVSALC--SSCCPLLRTLNVQWVEGLKDAQMRDL------------LSPPTDNRPGQ 1128

Query: 723  ISAIAKLHGET-LELLNLNGCGCVTDASLAAIADYCSVLRDLDISK-SRVSDFGIAAL-A 553
            I   +KL   T L L  L+    +TDASL  +  +  +L  LD+S  + V+D  I  L A
Sbjct: 1129 IDNRSKLRNITELRLAGLD----ITDASLRLMIRHMPLLAKLDLSYCNHVTDQSINLLTA 1184

Query: 552  GGSAIQFSLQILSLSGCVLASDKCLPYLHKLGNSLAGLNIQNCVGISHRGVDLLVERL 379
             G++ + +L  ++LS C   +D+CL +  + GN +  ++++ C  +S    +  +  +
Sbjct: 1185 VGTSTRDTLLEMNLSDCNNVTDQCLTFFKRCGN-ICLIDLRFCKQVSKESCEQFIAEM 1241


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,515,392,177
Number of Sequences: 1806583
Number of extensions: 33728218
Number of successful extensions: 89820
Number of sequences better than 10.0: 496
Number of HSP's better than 10.0 without gapping: 80987
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 87301
length of database: 581,917,975
effective HSP length: 128
effective length of database: 350,675,351
effective search space used: 123437723552
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)