BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10414
         (591 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AF079782_1766406 Zea mays translation initiation factor 4A2 (...   177   1e-43   
pir|S52023|S52023 translation initiation factor eIF-4A.14 - comm...   177   1e-43   Nicotiana tabacum [American tobacco]
sp|Q40467|IF4Y_TOBAC|IF4Y_TOBAC Eukaryotic initiation factor 4A-14 (eIF4A-1...   177   1e-43   Nicotiana tabacum [American tobacco]
pir|S52021|S52021 translation initiation factor eIF-4A.6 - commo...   176   3e-43   Nicotiana tabacum [American tobacco]
gb:ZMU73459_1732221 Zea mays translational initiation factor eIF...   175   4e-43   
gb:AY158704_1585544 Apium graveolens var. dulce translation init...   175   4e-43   
gb:AP003726_1832494 Oryza sativa (japonica cultivar-group) genom...   175   6e-43   
sp|P35683|IF4A_ORYSA|IF4A_ORYSA Eukaryotic initiation factor 4A (eIF4A) (eI...   175   6e-43   Oryza sativa [red rice]
gb:AF007580_1760920 Zea mays translation initiation factor (eIF-...   174   7e-43   
sp|Q40469|IF46_TOBAC|IF46_TOBAC Eukaryotic initiation factor 4A-6 (eIF4A-6)...   174   7e-43   Nicotiana tabacum [American tobacco]
gb:AP005288_1849910 Oryza sativa (japonica cultivar-group) genom...   174   1e-42   
pir|S52018|S52018 translation initiation factor eIF-4A.11 - comm...   174   1e-42   Nicotiana tabacum [American tobacco]
sp|Q40465|IF4V_TOBAC|IF4V_TOBAC Eukaryotic initiation factor 4A-11 (eIF4A-1...   174   1e-42   Nicotiana tabacum [American tobacco]
sp|P41382|IF4U_TOBAC|IF4U_TOBAC Eukaryotic initiation factor 4A-10 (eIF4A-1...   174   1e-42   Nicotiana tabacum [American tobacco]
sp|P41381|IF48_TOBAC|IF48_TOBAC Eukaryotic initiation factor 4A-8 (eIF4A-8)...   174   1e-42   Nicotiana tabacum [American tobacco]
sp|P41379|IF42_NICPL|IF42_NICPL Eukaryotic initiation factor 4A-2 (eIF4A-2)...   174   1e-42   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb:AY086907_1571946 Arabidopsis thaliana clone 29310 mRNA, compl...   174   1e-42   
gb:AY081287_1568633 Arabidopsis thaliana eukaryotic translation ...   174   1e-42   
gb:ATH298137_1552408 Arabidopsis thaliana eIF-4A1 gene for trans...   174   1e-42   
sp|P41376|IF41_ARATH|IF41_ARATH Eukaryotic initiation factor 4A-1 (eIF4A-1)...   174   1e-42   Arabidopsis thaliana [mouse-ear cress]
pir|S52020|S52020 translation initiation factor eIF-4A.15 - comm...   173   2e-42   Nicotiana tabacum [American tobacco]
gb:AY167670_1586294 Pisum sativum DEAD box RNA helicase mRNA, co...   172   4e-42   
sp|P41378|IF4A_WHEAT|IF4A_WHEAT Eukaryotic initiation factor 4A (eIF4A) (eI...   172   4e-42   Triticum aestivum [Canadian hard winter wheat]
sp|Q40468|IF4Z_TOBAC|IF4Z_TOBAC Eukaryotic initiation factor 4A-15 (eIF4A-1...   171   6e-42   Nicotiana tabacum [American tobacco]
sp|Q41741|IF4A_MAIZE|IF4A_MAIZE Eukaryotic initiation factor 4A (eIF4A) (eI...   171   6e-42   Zea mays [maize]
sp|P41377|IF42_ARATH|IF42_ARATH Eukaryotic initiation factor 4A-2 (eIF4A-2)...   171   6e-42   Arabidopsis thaliana [mouse-ear cress]
pir|S52019|S52019 translation initiation factor eIF-4A.7 - commo...   171   1e-41   Nicotiana tabacum [American tobacco]
sp|Q40470|IF47_TOBAC|IF47_TOBAC Eukaryotic initiation factor 4A-7 (eIF4A-7)...   171   1e-41   Nicotiana tabacum [American tobacco]
gb:AY040227_1560581 Elaeis oleifera eukaryotic translation initi...   170   2e-41   
pir|S52017|S52017 translation initiation factor eIF-4A.9 - commo...   170   2e-41   Nicotiana tabacum [American tobacco]
sp|Q40471|IF49_TOBAC|IF49_TOBAC Eukaryotic initiation factor 4A-9 (eIF4A-9)...   170   2e-41   Nicotiana tabacum [American tobacco]
gb:AF180356_1774812 Brassica oleracea isolate B265 EIF4A protein...   168   5e-41   
gb:AY428601_1605820 Helianthus annuus clone HA24-15A initiation ...   168   5e-41   
gb:AY167671_1586295 Pisum sativum DEAD box RNA helicase mRNA, co...   165   4e-40   
gb:ATH010472_1551905 Arabidopsis thaliana mRNA for DEAD box RNA ...   165   4e-40   
pir|T51347|T51347 RNA helicase RH23 [imported] - Arabidopsis tha...   165   4e-40   Arabidopsis thaliana [mouse-ear cress]
pir|B96752|B96752 hypothetical protein F28P22.8 [imported] - Ara...   165   4e-40   Arabidopsis thaliana [mouse-ear cress]
gb:AB046414_1520492 Oryza sativa eIF4A-2 mRNA for eukaryotic ini...   159   2e-38   
gb:BC055242_2551321 Danio rerio zgc:63783, mRNA (cDNA clone MGC:...   151   7e-36   
gb:AF515726_2498839 Gallus gallus translational eukaryotic initi...   151   9e-36   
gb:HUMELF4AII_2030861 Homo sapiens mRNA for eukaryotic initiatio...   151   9e-36   
gb:BC016295_1975524 Homo sapiens eukaryotic translation initiati...   151   9e-36   
gb:BC015842_1975341 Homo sapiens eukaryotic translation initiati...   151   9e-36   
gb:BC012547_1973667 Homo sapiens eukaryotic translation initiati...   151   9e-36   
gb:AB060830_1868712 Macaca fascicularis brain cDNA clone:QtrA-10...   151   9e-36   
gb:AF208852_1150557 Homo sapiens BM-010 mRNA, complete cds.           151   9e-36   
sp|Q14240|IF42_HUMAN|IF42_HUMAN Eukaryotic initiation factor 4A-II (eIF4A-I...   151   9e-36   Homo sapiens [man]
gb:XLEIF4AI_2582767 X.laevis mRNA for translation initiation fac...   149   3e-35   
gb:BC084468_2563842 Xenopus tropicalis hypothetical LOC496556, m...   149   3e-35   
gb:BC077641_2560340 Xenopus laevis translation initiation factor...   149   3e-35   
gb:BC068800_2555300 Xenopus laevis translation initiation factor...   149   3e-35   
gb:BC045237_2549092 Xenopus laevis translation initiation factor...   149   3e-35   
gb:BC049427_2550236 Danio rerio eukaryotic translation initiatio...   149   3e-35   
gb:BC048899_2550074 Danio rerio eukaryotic translation initiatio...   148   7e-35   
gb:BC084034_2563442 Xenopus laevis hypothetical LOC494976, mRNA ...   147   1e-34   
gb:BT019879_2151582 Synthetic construct Homo sapiens eukaryotic ...   147   1e-34   
gb:MUSELF4A5_2125725 Mus musculus protein synthesis initiation f...   147   1e-34   
gb:MMEIF4AI_2114797 Mouse mRNA for initiation factor eIF-4AI.>gb...   147   1e-34   
gb:MMEIF4AI_2114796 Mouse mRNA for initiation factor eIF-4AI.>gb...   147   1e-34   
gb:BC006380_1970242 Homo sapiens cDNA clone IMAGE:4099962, parti...   147   1e-34   
gb:CR860906_1184950 Pongo pygmaeus mRNA; cDNA DKFZp470B2433 (fro...   147   1e-34   
pir|S13269|S13269 translation initiation factor eIF-4A.I - rabbi...   147   1e-34   Oryctolagus cuniculus [domestic rabbit]
sp|P29562|IF41_RABIT|IF41_RABIT Eukaryotic initiation factor 4A-I (eIF4A-I)...   147   1e-34   Oryctolagus cuniculus [domestic rabbit]
sp|P60842|IF41_HUMAN|IF41_HUMAN Eukaryotic initiation factor 4A-I (eIF4A-I)...   147   1e-34   Homo sapiens [man]
gb:XLEIF4AII_2582768 X.laevis mRNA for translation initiation fa...   146   2e-34   
gb:MMEIF4AR_2114804 Mouse eIF-4AII mRNA for protein synthesis in...   145   4e-34   
pir|S30278|S30278 translation initiation factor eIF-4A - fruit f...   145   4e-34   Drosophila melanogaster
sp|Q02748|IF4A_DROME|IF4A_DROME Eukaryotic initiation factor 4A (eIF4A) (eI...   145   4e-34   Drosophila melanogaster
gb:CR857735_1181950 Pongo pygmaeus mRNA; cDNA DKFZp469I1935 (fro...   145   5e-34   
sp|P47943|IF4A_SCHPO|IF4A_SCHPO Eukaryotic initiation factor 4A (eIF4A) (eI...   142   4e-33   Schizosaccharomyces pombe
gb:AE017341_1754588 Cryptococcus neoformans var. neoformans JEC2...   142   5e-33   
sp|P27639|IF4A_CAEEL|IF4A_CAEEL Eukaryotic initiation factor 4A (eIF4A) (eI...   140   1e-32   Caenorhabditis elegans [roundworm]
gb:AE017343_1755881 Cryptococcus neoformans var. neoformans JEC2...   139   3e-32   
gb:TGO320155_1400167 Toxoplasma gondii mRNA for eukaryotic trans...   138   8e-32   
sp|O02494|IF4A_CRYPV|IF4A_CRYPV Eukaryotic initiation factor 4A (eIF4A) (eI...   137   1e-31   Cryptosporidium parvum
gb:CR382128_1661208 Yarrowia lipolytica chromosome B of strain C...   135   4e-31   
gb:AE014187_939121 Plasmodium falciparum 3D7 chromosome 14 compl...   135   4e-31   
gb:PCY245475_1391862 Plasmodium cynomolgi gene for RNA helicase-1.    135   5e-31   
gb:NC8D4_1688770 Neurospora crassa DNA linkage group V Cosmid co...   135   6e-31   
gb:AY089635_1297291 Drosophila melanogaster RE50350 full insert ...   135   6e-31   
gb:AE014297_1138455 Drosophila melanogaster chromosome 3R, compl...   134   8e-31   
sp|Q10055|IF4N_SCHPO|IF4N_SCHPO Eukaryotic initiation factor 4A-like protei...   134   8e-31   Schizosaccharomyces pombe
pir|S05835|FIBY1 translation initiation factor eIF-4A - yeast (S...   134   1e-30   
sp|P10081|IF4A_YEAST|IF4A_YEAST Eukaryotic initiation factor 4A (eIF4A) (eI...   134   1e-30   Saccharomyces cerevisiae [brewer's yeast]
gb:CR382136_1668772 Debaryomyces hansenii chromosome D of strain...   133   2e-30   
gb:AY050367_1562146 Arabidopsis thaliana AT3g19760/MMB12_21 mRNA...   133   2e-30   
pir|T51737|T51737 RNA helicase RH2 [imported] - Arabidopsis thal...   133   2e-30   Arabidopsis thaliana [mouse-ear cress]
gb:CR382136_1669297 Debaryomyces hansenii chromosome D of strain...   133   2e-30   
sp|P87206|IF4A_CANAL|IF4A_CANAL Eukaryotic initiation factor 4A (eIF4A) (eI...   133   2e-30   Candida albicans
gb:AP003607_1831254 Oryza sativa (japonica cultivar-group) genom...   132   3e-30   
gb:AC084404_1733571 Oryza sativa chromosome 3 BAC OSJNBa0026A15 ...   132   3e-30   
gb:AE016816_1746943 Ashbya gossypii (= Eremothecium gossypii) AT...   132   4e-30   
gb:CR382132_1665044 Yarrowia lipolytica chromosome F of strain C...   132   4e-30   
gb:CR380955_1651701 Candida glabrata strain CBS138 chromosome I ...   131   7e-30   
sp|P41380|IF43_NICPL|IF43_NICPL Eukaryotic initiation factor 4A-3 (eIF4A-3)...   131   9e-30   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb:CR382121_1654516 Kluyveromyces lactis strain NRRL Y-1140 chro...   130   2e-29   
gb:AY598438_2365404 Diachasmimorpha longicaudata entomopoxvirus ...   129   3e-29   
gb:CAL250879_1644946 Candida albicans fal1 gene for ATP-dependen...   129   4e-29   
pir|T06824|T06824 translation initiation factor - garden pea>gb:...   129   4e-29   Pisum sativum [garden pea]
gb:AC024844_1204946 Caenorhabditis elegans cosmid Y65B4A, comple...   129   5e-29   
pir|T32773|T32773 hypothetical protein F33D11.10 - Caenorhabditi...   129   5e-29   Caenorhabditis elegans [roundworm]
gb:BC045939_2549453 Danio rerio zgc:56139, mRNA (cDNA clone MGC:...   128   8e-29   
gb:AJ719548_2501735 Gallus gallus mRNA for hypothetical protein,...   127   1e-28   
gb:AF020432_2469032 Xenopus laevis eukaryotic translation initia...   127   1e-28   
gb:HUMORFJA_2035323 Homo sapiens KIAA0111 mRNA, partial cds.          127   1e-28   
gb:AK075920_1171103 Mus musculus ES cells cDNA, RIKEN full-lengt...   127   1e-28   
sp|Q91VC3|DD48_MOUSE|DD48_MOUSE Probable ATP-dependent helicase DDX48 (DEAD...   127   1e-28   Mus musculus [mouse]
sp|P38919|DD48_HUMAN|DD48_HUMAN Probable ATP-dependent helicase DDX48 (DEAD...   127   1e-28   Homo sapiens [man]
sp|Q12099|FAL1_YEAST|FAL1_YEAST Probable ATP-dependent RNA helicase FAL1.>p...   127   1e-28   Saccharomyces cerevisiae [brewer's yeast]
gb:EMU292369_1384653 Echinococcus multilocularis mRNA for transl...   126   3e-28   
pir|S45142|S45142 translation initiation factor eIF-4A2 homolog ...   126   3e-28   Homo sapiens [man]
gb:BC084859_2564103 Xenopus laevis cDNA clone MGC:85498 IMAGE:69...   125   7e-28   
gb:CR380959_1653935 Candida glabrata strain CBS138 chromosome M ...   124   1e-27   
gb:DDU78759_1377426 Dictyostelium discoideum IfdA (ifdA) mRNA, p...   123   3e-27   
gb:SCYURI_1714843 S.cerevisiae YURI gene (3' end), TIF2 gene for...   122   6e-27   
gb:AE016818_1748551 Ashbya gossypii (= Eremothecium gossypii) AT...   120   2e-26   
pir|A81464|A81464 translation initiation factor eIF-4A [similari...   119   4e-26   Leishmania major
gb:CR382121_1654727 Kluyveromyces lactis strain NRRL Y-1140 chro...   119   5e-26   
gb:PFMAL4P4_1394862 Plasmodium falciparum MAL4P4.                     118   8e-26   
pir|C90137|C90137 eukaryotic initiation factor 4a [imported] - G...   118   8e-26   Guillardia theta
pir|T48731|T48731 probable translation initiation factor eIF-4A ...   117   1e-25   Neurospora crassa
gb:AF179303_1247974 Plasmodium falciparum eukaryotic initiation ...   116   2e-25   
sp|Q25225|IF4A_LEIBR|IF4A_LEIBR Probable eukaryotic initiation factor 4A (e...   115   4e-25   Leishmania braziliensis
gb:AC024261_1539332 Arabidopsis thaliana chromosome 1 BAC F5D21 ...   109   4e-23   
pir|H96551|H96551 hypothetical protein F11M15.24 [imported] - Ar...   109   4e-23   Arabidopsis thaliana [mouse-ear cress]
gb:BC002266_2089013 Mus musculus eukaryotic translation initiati...   105   7e-22   
gb:AY347787_1177948 Malus x domestica clone 31-4 translation ini...    99   5e-20   
gb:CR382131_1664757 Yarrowia lipolytica chromosome E of strain C...    93   4e-18   
pir|AE1584|AE1584 ATP-dependent RNA helicase (DEAD motif) homolo...    92   5e-18   Listeria innocua
sp|P20449|DBP5_YEAST|DBP5_YEAST ATP-dependent RNA helicase DBP5 (Helicase C...    92   8e-18   Saccharomyces cerevisiae [brewer's yeast]
gb:AE017326_443686 Listeria monocytogenes str. 4b F2365, section...    91   1e-17   
pir|AF1230|AF1230 ATP-dependent RNA helicase (DEAD motif) homolo...    91   1e-17   Listeria monocytogenes
sp|Q09747|YB66_SCHPO|YB66_SCHPO Putative ATP-dependent RNA helicase C12C2.0...    91   2e-17   Schizosaccharomyces pombe
gb:NC123A4_1688268 Neurospora crassa DNA linkage group V cosmid ...    90   2e-17   
gb:AP004225_1838948 Oryza sativa (japonica cultivar-group) genom...    90   3e-17   
gb:AP004225_1838946 Oryza sativa (japonica cultivar-group) genom...    90   3e-17   
gb:CR382126_1659062 Kluyveromyces lactis strain NRRL Y-1140 chro...    90   3e-17   
gb:AY052303_1562676 Arabidopsis thaliana AT5g11170/F2I11_60 mRNA...    90   3e-17   
gb:ATH010466_1551899 Arabidopsis thaliana mRNA for DEAD box RNA ...    90   3e-17   
gb:ATF2I11_1550468 Arabidopsis thaliana DNA chromosome 5, BAC cl...    90   3e-17   
gb:ATF2I11_1550465 Arabidopsis thaliana DNA chromosome 5, BAC cl...    90   3e-17   
pir|T51343|T51343 RNA helicase RH15 [imported] - Arabidopsis tha...    90   3e-17   Arabidopsis thaliana [mouse-ear cress]
sp|P42305|DBPA_BACSU|DBPA_BACSU ATP-dependent RNA helicase dbpA.>pir|E69613...    90   3e-17   Bacillus subtilis
gb:CR382138_1671911 Debaryomyces hansenii chromosome F of strain...    89   4e-17   
gb:AC006605_1203307 Caenorhabditis elegans cosmid C07H6, complet...    89   4e-17   
gb:CP000027_79192 Dehalococcoides ethenogenes 195, complete genome.    89   4e-17   
pir|H90136|H90136 RNA helicase [imported] - Guillardia theta nuc...    89   4e-17   Guillardia theta
sp|P46942|DB10_NICSY|DB10_NICSY RNA helicase-like protein DB10.>pir|S42639|...    89   4e-17   Nicotiana sylvestris
gb:YLAJ11564_1727886 Yarrowia lipolytica DHH1 gene.                    89   5e-17   
gb:CR382132_1665823 Yarrowia lipolytica chromosome F of strain C...    89   5e-17   
pir|T51743|T51743 RNA helicase RH12 [imported] - Arabidopsis tha...    89   5e-17   Arabidopsis thaliana [mouse-ear cress]
pir|T47916|T47916 DEAD box RNA helicase RH12 - Arabidopsis thali...    89   5e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AJ720165_2502352 Gallus gallus mRNA for hypothetical protein,...    89   7e-17   
gb:AB013609_2043770 Cavia porcellus mRNA for DEAD box protein, c...    89   7e-17   
gb:HUMRCK_2036239 Homo sapiens mRNA for RCK, complete cds.             89   7e-17   
gb:AF399934_1268224 Spisula solidissima RNA helicase p47 mRNA, c...    89   7e-17   
pir|S22651|S22651 probable RNA helicase (EC 3.6.1.-) RCK - human...    89   7e-17   Homo sapiens [man]
sp|P54823|DDX6_MOUSE|DDX6_MOUSE Probable ATP-dependent RNA helicase p54 (On...    89   7e-17   Mus musculus [mouse]
sp|P26196|DDX6_HUMAN|DDX6_HUMAN Probable ATP-dependent RNA helicase p54 (On...    89   7e-17   Homo sapiens [man]
gb:AP004225_1838944 Oryza sativa (japonica cultivar-group) genom...    88   9e-17   
gb:AP004225_1838943 Oryza sativa (japonica cultivar-group) genom...    88   9e-17   
gb:CR382123_1656205 Kluyveromyces lactis strain NRRL Y-1140 chro...    88   9e-17   
gb:AY223366_1176826 Schistosoma japonicum clone ZZZ211 mRNA sequ...    88   9e-17   
gb:AE014187_939029 Plasmodium falciparum 3D7 chromosome 14 compl...    88   1e-16   
gb:BC035388_1981561 Homo sapiens, DEAD/H (Asp-Glu-Ala-Asp/His) b...    87   2e-16   
gb:AY080837_1568530 Arabidopsis thaliana putative RNA helicase (...    87   2e-16   
gb:AK054144_1170718 Mus musculus 2 days pregnant adult female ov...    87   2e-16   
pir|T01230|T01230 probable RNA helicase (EC 3.6.1.-) F6N23.6 - A...    87   2e-16   Arabidopsis thaliana [mouse-ear cress]
pir|T51741|T51741 RNA helicase RH8 [imported] - Arabidopsis thal...    87   2e-16   Arabidopsis thaliana [mouse-ear cress]
sp|Q9UHL0|DD25_HUMAN|DD25_HUMAN ATP-dependent RNA helicase DDX25 (DEAD-box ...    87   2e-16   Homo sapiens [man]
gb:AE017341_1754546 Cryptococcus neoformans var. neoformans JEC2...    87   2e-16   
gb:AE017341_1754545 Cryptococcus neoformans var. neoformans JEC2...    87   2e-16   
gb:AE016816_1746887 Ashbya gossypii (= Eremothecium gossypii) AT...    87   2e-16   
gb:D89270_1675387 Schizosaccharomyces pombe mRNA, partial cds, c...    87   2e-16   
gb:CR382138_1670944 Debaryomyces hansenii chromosome F of strain...    87   2e-16   
gb:CNS07EGI_1374506 chromosome IX of strain GB-M1 of Encephalito...    87   2e-16   
pir|T37846|T37846 probable ATP-dependent RNA helicase - fission ...    87   2e-16   Schizosaccharomyces pombe
pir|T43199|T43199 probable nuclear RNA helicase (DEAD family) - ...    87   2e-16   Schizosaccharomyces pombe
sp|P39517|DHH1_YEAST|DHH1_YEAST Putative ATP-dependent RNA helicase DHH1.>p...    87   2e-16   Saccharomyces cerevisiae [brewer's yeast]
sp|O61305|DB80_DROME|DB80_DROME DEAD-box helicase Dbp80.>gb:AF005239_123120...    87   2e-16   Drosophila melanogaster
gb:AF155140_1886636 Homo sapiens gonadotropin-regulated testicul...    87   3e-16   
gb:AE017343_1755891 Cryptococcus neoformans var. neoformans JEC2...    87   3e-16   
gb:CR380958_1653504 Candida glabrata strain CBS138 chromosome L ...    87   3e-16   
gb:BX842646_823349 Bdellovibrio bacteriovorus complete genome, s...    87   3e-16   
pir|C97238|C97238 ATP dependent RNA helicase DeaD, superfamily I...    87   3e-16   Clostridium acetobutylicum
sp|P54824|DDX6_XENLA|DDX6_XENLA ATP-dependent RNA helicase p54 (Xp54).>gb:X...    87   3e-16   Xenopus laevis [clawed frog]
gb:AF038995_2051892 Mus musculus putative RNA helicase RCK mRNA,...    86   3e-16   
gb:DROHELI_1382110 D.melanogaster RNA helicase mRNA, complete cds.     86   3e-16   
gb:AE014134_1128513 Drosophila melanogaster chromosome 2L, compl...    86   3e-16   
pir|G71614|G71614 eIF-4A-like DEAD family RNA helicase PFB0445c ...    86   3e-16   Plasmodium falciparum 3D7
pir|A39157|A39157 probable RNA helicase (EC 3.6.1.-) - fruit fly...    86   3e-16   Drosophila melanogaster
sp|P23128|ME31_DROME|ME31_DROME Putative ATP-dependent RNA helicase me31b (...    86   3e-16   Drosophila melanogaster
gb:AE016817_1747644 Ashbya gossypii (= Eremothecium gossypii) AT...    86   4e-16   
gb:CR382127_1659975 Yarrowia lipolytica chromosome A of strain C...    86   4e-16   
gb:CR380955_1651662 Candida glabrata strain CBS138 chromosome I ...    86   4e-16   
gb:AX716945_1473722 Sequence 56 from Patent WO03020757.                86   4e-16   
gb:CR857097_1181350 Pongo pygmaeus mRNA; cDNA DKFZp469I1738 (fro...    86   4e-16   
gb:BC078791_2106950 Rattus norvegicus DEAD (Asp-Glu-Ala-Asp) box...    86   6e-16   
gb:AP004133_1838092 Oryza sativa (japonica cultivar-group) genom...    86   6e-16   
gb:AP004133_1838091 Oryza sativa (japonica cultivar-group) genom...    86   6e-16   
sp|Q09181|ST13_SCHPO|ST13_SCHPO Putative ATP-dependent RNA helicase ste13.>...    86   6e-16   Schizosaccharomyces pombe
sp|Q9QY16|DD25_RAT|DD25_RAT ATP-dependent RNA helicase DDX25 (DEAD-box pr...    86   6e-16   Rattus norvegicus [brown rat]
gb:OSJN00204_1696668 Oryza sativa genomic DNA, chromosome 4, BAC...    85   8e-16   
gb:PFMAL3P7_1394581 Plasmodium falciparum MAL3P7, complete seque...    85   8e-16   
gb:AK050693_1169432 Mus musculus 9 days embryo whole body cDNA, ...    85   8e-16   
sp|Q89AF9|DEAD_BUCBP|DEAD_BUCBP Cold-shock DEAD-box protein A homolog (ATP-...    85   8e-16   
sp|Q9QY15|DD25_MOUSE|DD25_MOUSE ATP-dependent RNA helicase DDX25 (DEAD-box ...    85   8e-16   Mus musculus [mouse]
gb:BC079094_2107227 Rattus norvegicus cDNA clone MGC:94068 IMAGE...    85   1e-15   
gb:BC025594_2095092 Mus musculus DEAD (Asp-Glu-Ala-Asp) box poly...    85   1e-15   
gb:AY751756_2088403 Rattus norvegicus zinc responsive protein Zd...    85   1e-15   
gb:AY303540_2081902 Rattus norvegicus zinc responsive protein ZD...    85   1e-15   
gb:CR533509_1993714 Homo sapiens full open reading frame cDNA cl...    85   1e-15   
gb:CR457215_1993422 Homo sapiens full open reading frame cDNA cl...    85   1e-15   
gb:AF353720_1898762 Homo sapiens testicular DEAD-box helicase pr...    85   1e-15   
gb:AF183422_1888524 Homo sapiens RNA helicase mRNA, complete cds.      85   1e-15   
gb:AF136175_1885745 Homo sapiens RNA helicase mRNA, complete cds.      85   1e-15   
gb:AE016816_1746768 Ashbya gossypii (= Eremothecium gossypii) AT...    85   1e-15   
gb:ATAC011623_1543314 Arabidopsis thaliana chromosome III BAC F2...    85   1e-15   
gb:HSM804281_1187156 Homo sapiens mRNA; cDNA DKFZp666D212 (from ...    85   1e-15   
gb:HSM804212_1187110 Homo sapiens mRNA; cDNA DKFZp762C1313 (from...    85   1e-15   
gb:HSM801612_1186301 Homo sapiens mRNA; cDNA DKFZp564C183 (from ...    85   1e-15   
gb:CR749227_1180858 Homo sapiens mRNA; cDNA DKFZp686C21137 (from...    85   1e-15   
gb:AK049467_1168810 Mus musculus 7 days embryo whole body cDNA, ...    85   1e-15   
gb:AK033235_1163249 Mus musculus 15 days embryo male testis cDNA...    85   1e-15   
sp|Q61655|DD19_MOUSE|DD19_MOUSE ATP-dependent RNA helicase DDX19 (DEAD-box ...    85   1e-15   Mus musculus [mouse]
sp|Q9UMR2|DD19_HUMAN|DD19_HUMAN ATP-dependent RNA helicase DDX19 (DEAD-box ...    85   1e-15   Homo sapiens [man]
gb:BC046696_2549686 Xenopus laevis DEAD/H (Asp-Glu-Ala-Asp/His) ...    84   1e-15   
gb:CR861435_1185430 Pongo pygmaeus mRNA; cDNA DKFZp459H062 (from...    84   1e-15   
gb:AE016959_1023315 Oryza sativa (japonica cultivar-group) chrom...    84   1e-15   
gb:AP006627_564519 Bacillus clausii KSM-K16 DNA, complete genome.      84   1e-15   
gb:BC044541_2548843 Danio rerio DEAD/H (Asp-Glu-Ala-Asp/His) box...    84   2e-15   
gb:BC024852_2094757 Mus musculus DEAD (Asp-Glu-Ala-Asp) box poly...    84   2e-15   
gb:CR382125_1658207 Kluyveromyces lactis strain NRRL Y-1140 chro...    84   2e-15   
gb:AY039862_1560376 Arabidopsis thaliana At2g45810/F4I18.21 mRNA...    84   2e-15   
gb:ATH010459_1551892 Arabidopsis thaliana mRNA for DEAD box RNA ...    84   2e-15   
gb:AK088669_1175543 Mus musculus 2 days neonate thymus thymic ce...    84   2e-15   
gb:BX321863_774368 Nitrosomonas europaea ATCC 19718, complete ge...    84   2e-15   
pir|H83947|H83947 ATP-dependent RNA helicase BH2384 [imported] -...    84   2e-15   Bacillus halodurans
pir|T51740|T51740 RNA helicase RH6 [imported] - Arabidopsis thal...    84   2e-15   Arabidopsis thaliana [mouse-ear cress]
pir|T02466|T02466 probable ATP-dependent RNA helicase [imported]...    84   2e-15   Arabidopsis thaliana [mouse-ear cress]
gb:PFA17288_1392028 Plasmodium falciparum gene encoding RNA heli...    84   2e-15   
sp|Q07478|SUB2_YEAST|SUB2_YEAST Probable ATP-dependent RNA helicase SUB2.>p...    84   2e-15   Saccharomyces cerevisiae [brewer's yeast]
gb:CR382136_1669388 Debaryomyces hansenii chromosome D of strain...    83   3e-15   
pir|T46157|T46157 RNA helicase-like protein - Arabidopsis thalia...    83   3e-15   Arabidopsis thaliana [mouse-ear cress]
gb:CR380958_1653373 Candida glabrata strain CBS138 chromosome L ...    83   4e-15   
gb:AE015582_315787 Shewanella oneidensis MR-1 section 131 of 457...    83   4e-15   
gb:AP003282_1827231 Oryza sativa (japonica cultivar-group) genom...    82   5e-15   
gb:AP003282_1827230 Oryza sativa (japonica cultivar-group) genom...    82   5e-15   
gb:CNS07EGI_1374552 chromosome IX of strain GB-M1 of Encephalito...    82   5e-15   
gb:AL646059_545467 Ralstonia solanacearum GMI1000 chromosome, co...    82   5e-15   
gb:AE016933_361253 Bacteroides thetaiotaomicron VPI-5482, sectio...    82   5e-15   
gb:BC041252_2547887 Xenopus laevis eukaryotic translation initia...    82   6e-15   
gb:AY372452_613927 Uncultured marine proteobacterium ANT8C10 fos...    82   6e-15   
gb:AE017354_458643 Legionella pneumophila subsp. pneumophila str...    82   6e-15   
gb:AE011501_273670 Leptospira interrogans serovar lai str. 56601...    82   6e-15   
gb:CR628337_113499 Legionella pneumophila str. Lens complete gen...    82   6e-15   
gb:CR628336_110432 Legionella pneumophila str. Paris complete ge...    82   6e-15   
pir|F95988|F95988 probable ATP-dependent RNA helicase protein [i...    82   6e-15   Sinorhizobium meliloti
gb:BC045125_2549057 Xenopus laevis nuclear RNA helicase, mRNA (c...    82   8e-15   
gb:AY099536_2512372 Danio rerio DEAD box RNA helicase (ddx19) mR...    82   8e-15   
gb:AJ719463_2501650 Gallus gallus mRNA for hypothetical protein,...    82   8e-15   
gb:AF190623_2479224 Xenopus laevis DEADSouth RNA helicase (DEADS...    82   8e-15   
gb:BC001009_1967207 Homo sapiens DEAD (Asp-Glu-Ala-Asp) box poly...    82   8e-15   
gb:AK026614_1910664 Homo sapiens cDNA: FLJ22961 fis, clone KAT10...    82   8e-15   
gb:AC084023_1733314 Oryza sativa chromosome 10 BAC OSJNBa0062C05...    82   8e-15   
gb:HSM802891_1186825 Homo sapiens mRNA; cDNA DKFZp547B159 (from ...    82   8e-15   
pir|H87352|H87352 hypothetical protein CC0835 [imported] - Caulo...    82   8e-15   Caulobacter vibrioides
pir|C97640|C97640 probable ATP-dependent RNA helicase (AE005260)...    82   8e-15   Agrobacterium fabrum str. C58
pir|F69531|F69531 ATP-dependent RNA helicase, DEAD-family (deaD)...    82   8e-15   Archaeoglobus fulgidus
gb:BC061342_2553118 Xenopus tropicalis DEAD (Asp-Glu-Ala-As) box...    81   1e-14   
gb:AY298950_2525768 Xenopus laevis DECD-box RNA helicase (DDX39)...    81   1e-14   
gb:BC086328_2109523 Rattus norvegicus nuclear RNA helicase, DECD...    81   1e-14   
gb:BC020134_2093288 Mus musculus DEAD (Asp-Glu-Ala-Asp) box poly...    81   1e-14   
gb:AF063447_2052988 Rattus norvegicus nuclear RNA helicase mRNA,...    81   1e-14   
gb:CR382137_1670271 Debaryomyces hansenii chromosome E of strain...    81   1e-14   
gb:BT021050_1436408 Bos taurus DEAD (Asp-Glu-Ala-Asp) box polype...    81   1e-14   
gb:AK088894_1175688 Mus musculus 2 days neonate thymus thymic ce...    81   1e-14   
gb:BX842646_823341 Bdellovibrio bacteriovorus complete genome, s...    81   1e-14   
gb:AE017355_466420 Bacillus thuringiensis serovar konkukian str....    81   1e-14   
gb:AE015812_318103 Shewanella oneidensis MR-1 section 361 of 457...    81   1e-14   
gb:BC044169_2548558 Danio rerio DEAD (Asp-Glu-Ala-Asp) box polyp...    81   1e-14   
gb:AF002677_1230709 Dictyostelium discoideum DEAD-box RNA helica...    81   1e-14   
gb:CP000021_872902 Vibrio fischeri ES114 chromosome II, complete...    81   1e-14   
gb:AE017354_460693 Legionella pneumophila subsp. pneumophila str...    81   1e-14   
gb:AE017179_398198 Porphyromonas gingivalis W83 section 8 of 8 o...    81   1e-14   
gb:AE015596_315901 Shewanella oneidensis MR-1 section 145 of 457...    81   1e-14   
gb:CR628337_115471 Legionella pneumophila str. Lens complete gen...    81   1e-14   
gb:CR628336_112411 Legionella pneumophila str. Paris complete ge...    81   1e-14   
sp|Q27268|HE47_DROME|HE47_DROME Probable ATP-dependent RNA helicase WM6.>pi...    81   1e-14   
gb:BC060524_2552966 Danio rerio zgc:63742, mRNA (cDNA clone MGC:...    80   2e-14   
gb:BC055240_2551319 Danio rerio zgc:63773, mRNA (cDNA clone MGC:...    80   2e-14   
gb:BC042330_2548141 Danio rerio zgc:55881, mRNA (cDNA clone MGC:...    80   2e-14   
gb:BC002366_1968052 Homo sapiens DEAD (Asp-Glu-Ala-Asp) box poly...    80   2e-14   
gb:AF026402_1877308 Homo sapiens U5 snRNP 100 kD protein mRNA, c...    80   2e-14   
gb:AF140505_1771551 Candida albicans DEAD box RNA helicase (CHR1...    80   2e-14   
gb:CTE318937_1375856 Chironomus tentans mRNA for Dbp5 protein.         80   2e-14   
gb:CEU08102_1368390 Caenorhabditis elegans putative RNA helicase...    80   2e-14   
gb:AY060822_1292627 Drosophila melanogaster GM01081 full length ...    80   2e-14   
gb:CR858413_1182588 Pongo pygmaeus mRNA; cDNA DKFZp459D1332 (fro...    80   2e-14   
gb:AE014134_1129612 Drosophila melanogaster chromosome 2L, compl...    80   2e-14   
sp|Q18212|HE47_CAEEL|HE47_CAEEL Probable ATP-dependent RNA helicase p47 hom...    80   2e-14   
gb:AY057548_1563965 Arabidopsis thaliana AT3g53110/T4D2_40 mRNA,...    80   2e-14   
gb:CP000001_855737 Bacillus cereus ZK, complete genome.                80   2e-14   
gb:AE017041_385577 Bacillus anthracis str. Ames section 18 of 18...    80   2e-14   
gb:AE016827_342124 Mannheimia succiniciproducens MBEL55E, comple...    80   2e-14   
gb:AJ720994_2503181 Gallus gallus mRNA for hypothetical protein,...    80   3e-14   
gb:BT008096_2151028 Synthetic construct Homo sapiens HLA-B assoc...    80   3e-14   
gb:AF387339_2064639 Rattus norvegicus IkBL, vacuolar ATPase NG38...    80   3e-14   
gb:AL662801_1931483 Human DNA sequence from clone XXbac-296P20 o...    80   3e-14   
gb:AF029062_1877518 Homo sapiens DEAD-box protein (BAT1) gene, p...    80   3e-14   
gb:AF029061_1877516 Homo sapiens BAT1 (BAT1) gene, partial cds; ...    80   3e-14   
gb:AY423389_1430089 Canis familiaris BAC 231G24 MHC class I locu...    80   3e-14   
gb:AF391287_1267424 Branchiostoma floridae cosmid MPMGc117C0356,...    80   3e-14   
gb:AK051034_1169553 Mus musculus 9 days embryo whole body cDNA, ...    80   3e-14   
gb:BA000021_686967 Wigglesworthia glossinidia endosymbiont of Gl...    80   3e-14   
gb:AE015941_320617 Clostridium tetani E88, section 6 of 10 of th...    80   3e-14   
gb:AE013672_299026 Yersinia pestis KIM section 72 of 415 of the ...    80   3e-14   
gb:AE012833_286081 Chlorobium tepidum TLS section 54 of 194 of t...    80   3e-14   
pir|AI0423|AI0423 cold-shock dead-box protein A [imported] - Yer...    80   3e-14   
sp|Q13838|HE47_HUMAN|HE47_HUMAN Probable ATP-dependent RNA helicase p47 (HL...    80   3e-14   
gb:U72484_2581137 Fugu rubripes RNA helicase (RNA-H) gene, parti...    79   4e-14   
gb:BC071505_2556241 Danio rerio zgc:55881, mRNA (cDNA clone MGC:...    79   4e-14   
gb:BC067608_2554781 Danio rerio hypothetical protein LOC407696, ...    79   4e-14   
gb:CR382133_1666859 Debaryomyces hansenii chromosome A of strain...    79   4e-14   
gb:CR382131_1664599 Yarrowia lipolytica chromosome E of strain C...    79   4e-14   
gb:CR380958_1653237 Candida glabrata strain CBS138 chromosome L ...    79   4e-14   
gb:AF158723_1415314 Bos taurus HLA-B-associated transcript 1 (BA...    79   4e-14   
gb:U13070_1401791 Caenorhabditis elegans cosmid F01F1, complete ...    79   4e-14   
gb:CTE428513_1375860 Chironomus tentans mRNA for HEL protein.          79   4e-14   
gb:BX538352_1358967 Cryptosporidium parvum chromosome 6, complet...    79   4e-14   
gb:AL935253_550486 Lactobacillus plantarum strain WCFS1 complete...    79   4e-14   
gb:AE017320_441550 Desulfovibrio vulgaris subsp. vulgaris str. H...    79   4e-14   
sp|Q9P7C7|PR11_SCHPO|PR11_SCHPO Probable ATP-dependent RNA helicase prp11.>...    79   4e-14   
gb:BC088581_2565711 Xenopus tropicalis hypothetical LOC496953, m...    79   5e-14   
gb:BC044017_2548424 Xenopus laevis similar to ATP-dependent, RNA...    79   5e-14   
gb:AE017341_1754488 Cryptococcus neoformans var. neoformans JEC2...    79   5e-14   
gb:AC099401_1737147 Oryza sativa (japonica cultivar-group) chrom...    79   5e-14   
gb:PFA929353_1393087 Plasmodium falciparum strain 3D7, chromosom...    79   5e-14   
gb:BX936398_835859 Yersinia pseudotuberculosis IP32953 genome, c...    79   5e-14   
gb:AF426171_509837 Yersinia pestis transposase (tnp), xanthosine...    79   5e-14   
gb:AE017130_386802 Yersinia pestis biovar Medievalis str. 91001 ...    79   5e-14   
gb:AE004969_60406 Neisseria gonorrhoeae FA 1090, complete genome.      79   5e-14   
pir|E81090|E81090 ATP-dependent RNA helicase, probable NMB1368 [...    79   5e-14   
pir|G81850|G81850 probable ATP-dependent RNA helicase NMA1580 [i...    79   5e-14   
pir|T48634|T48634 DRH1 DEAD box protein-like - Arabidopsis thali...    79   5e-14   
gb:AP004635_1842359 Oryza sativa (japonica cultivar-group) genom...    79   7e-14   
gb:CR548612_1375324 Paramecium tetraurelia macronuclear largest ...    79   7e-14   
gb:BX640449_816631 Bordetella bronchiseptica strain RB50, comple...    79   7e-14   
gb:BX640434_811784 Bordetella parapertussis strain 12822, comple...    79   7e-14   
gb:BX640421_807786 Bordetella pertussis strain Tohama I, complet...    79   7e-14   
gb:AP006878_575458 Thermococcus kodakaraensis strain KOD1 DNA, c...    79   7e-14   
gb:AP006841_572185 Bacteroides fragilis YCH46 DNA, complete genome.    79   7e-14   
gb:AJ749949_531928 Francisella tularensis subsp. tularensis comp...    79   7e-14   
gb:AE017281_426791 Bacillus cereus ATCC 10987, section 18 of 18 ...    79   7e-14   
gb:AE017015_380268 Bacillus cereus ATCC 14579 section 18 of 18 o...    79   7e-14   
gb:AE016929_360199 Bacteroides thetaiotaomicron VPI-5482, sectio...    79   7e-14   
gb:AE011107_269243 Methanosarcina acetivorans str. C2A, section ...    79   7e-14   
pir|E88493|E88493 protein F57B9.3 [imported] - Caenorhabditis el...    79   7e-14   
pir|T22917|T22917 probable ATP-dependent RNA helicase F58E10.3 [...    79   7e-14   
gb:HSA010840_2000007 Homo sapiens mRNA for ATP-dependent RNA hel...    78   9e-14   
gb:AX877206_1476887 Sequence 12111 from Patent EP1074617.>gb:AK0...    78   9e-14   
gb:AX876326_1476477 Sequence 11231 from Patent EP1074617.>gb:AX8...    78   9e-14   
gb:AF077033_1149717 Homo sapiens putative ATP-dependent RNA heli...    78   9e-14   
gb:CP000001_850856 Bacillus cereus ZK, complete genome.                78   9e-14   
gb:BX571965_790476 Burkholderia pseudomallei strain K96243, chro...    78   9e-14   
gb:BA000035_716042 Corynebacterium efficiens YS-314 DNA, complet...    78   9e-14   
gb:AE017282_428321 Methylococcus capsulatus str. Bath, complete ...    78   9e-14   
gb:AE017264_421502 Bacillus cereus ATCC 10987, section 1 of 18 o...    78   9e-14   
gb:AE017180_399214 Geobacter sulfurreducens PCA, complete genome.      78   9e-14   
gb:AE017024_380528 Bacillus anthracis str. Ames section 1 of 18 ...    78   9e-14   
gb:AE016998_375284 Bacillus cereus ATCC 14579 section 1 of 18 of...    78   9e-14   
gb:AE016767_327895 Escherichia coli CFT073 section 13 of 18 of t...    78   9e-14   
gb:AE010500_263766 Fusobacterium nucleatum subsp. nucleatum ATCC...    78   9e-14   
gb:AE008851_244924 Salmonella typhimurium LT2, section 155 of 22...    78   9e-14   
gb:ECODEAD_128427 E.coli deaD gene, complete cds.                      78   9e-14   
gb:CP000026_77859 Salmonella enterica subsp. enterica serovar Pa...    78   9e-14   
pir|F65106|F65106 probable ATP-dependent RNA helicase deaD - Esc...    78   9e-14   
pir|JX0314|JX0314 DEAD box protein - Klebsiella pneumoniae>gb:KP...    78   9e-14   
pir|C91134|C91134 inducible ATP-independent RNA helicase [import...    78   9e-14   
pir|AB0901|AB0901 ATP-dependent RNA helicase (dead-box protein) ...    78   9e-14   
pir|T15942|T15942 hypothetical protein F01F1.7 - Caenorhabditis ...    78   9e-14   
sp|Q63413|HE47_RAT|HE47_RAT Probable ATP-dependent RNA helicase p47.            78   9e-14   
sp|Q9Y2R4|DX52_HUMAN|DX52_HUMAN DEAD-box protein 52 (EC 3.6.1.-) (Putative ...    78   9e-14   
sp|P33906|DEAD_KLEPN|DEAD_KLEPN Cold-shock DEAD-box protein A (ATP-dependen...    78   9e-14   
sp|P23304|DEAD_ECOLI|DEAD_ECOLI Cold-shock DEAD-box protein A (ATP-dependen...    78   9e-14   
sp|Q8XA87|DEAD_ECO57|DEAD_ECO57 Cold-shock DEAD-box protein A (ATP-dependen...    78   9e-14   
gb:BT000795_1635066 Arabidopsis thaliana putative RNA helicase, ...    78   1e-13   
gb:AY062591_1565247 Arabidopsis thaliana RNA helicase, DRH1 (At3...    78   1e-13   
gb:AY050375_1562154 Arabidopsis thaliana AT3g01540/F4P13_9 mRNA,...    78   1e-13   
gb:AE014297_1138115 Drosophila melanogaster chromosome 3R, compl...    78   1e-13   
gb:AE014297_1138114 Drosophila melanogaster chromosome 3R, compl...    78   1e-13   
gb:AE014297_1138113 Drosophila melanogaster chromosome 3R, compl...    78   1e-13   
gb:BX950851_839470 Erwinia carotovora subsp. atroseptica SCRI104...    78   1e-13   
gb:BX571874_789378 Photorhabdus luminescens subsp. laumondii TTO...    78   1e-13   
gb:AE016757_324922 Escherichia coli CFT073 section 3 of 18 of th...    78   1e-13   
gb:AE008734_242529 Salmonella typhimurium LT2, section 42 of 220...    78   1e-13   
gb:CP000026_76727 Salmonella enterica subsp. enterica serovar Pa...    78   1e-13   
gb:AE005674_70329 Shigella flexneri 2a str. 301, complete genome...    78   1e-13   
pir|D85588|D85588 probable ATP-dependent RNA helicase rhlE [impo...    78   1e-13   
pir|AI0599|AI0599 probable ATP-dependent RNA helicase rhlE STY08...    78   1e-13   
pir|T52137|T52137 ATP-dependent DEAD box RNA helicase DRH1 [vali...    78   1e-13   
pir|S11485|S11485 RNA helicase - fruit fly (Drosophila melanogas...    78   1e-13   
sp|P19109|RM62_DROME|RM62_DROME Putative ATP-dependent RNA helicase P62.>gb...    78   1e-13   
sp|P25888|RHLE_ECOLI|RHLE_ECOLI Putative ATP-dependent RNA helicase rhlE.>p...    78   1e-13   
gb:BC082368_2562605 Xenopus laevis MGC81606 protein, mRNA (cDNA ...    77   2e-13   
gb:BC079986_2561424 Xenopus laevis hypothetical protein LOC44627...    77   2e-13   
gb:BC061280_2553057 Xenopus tropicalis hypothetical protein MGC7...    77   2e-13   
gb:CR382138_1671155 Debaryomyces hansenii chromosome F of strain...    77   2e-13   
gb:CR382126_1659401 Kluyveromyces lactis strain NRRL Y-1140 chro...    77   2e-13   
gb:CR380955_1651617 Candida glabrata strain CBS138 chromosome I ...    77   2e-13   
gb:AB008265_1510395 Arabidopsis thaliana genomic DNA, chromosome...    77   2e-13   
gb:AX404864_1467461 Sequence 1 from Patent WO0226787.                  77   2e-13   
gb:BX927151_832739 Corynebacterium glutamicum ATCC 13032, IS fin...    77   2e-13   
gb:BA000036_718883 Corynebacterium glutamicum ATCC 13032 DNA, co...    77   2e-13   
gb:AP006627_566258 Bacillus clausii KSM-K16 DNA, complete genome.      77   2e-13   
gb:AE008692_240952 Zymomonas mobilis subsp. mobilis ZM4, complet...    77   2e-13   
gb:CR378680_98596 Photobacterium profundum SS9 chromosome 2; seg...    77   2e-13   
pir|I47126|I47126 nuclear RNA helicase (DEAD family) BAT1 - pig>...    77   2e-13   
gb:AE017346_1757272 Cryptococcus neoformans var. neoformans JEC2...    77   2e-13   
gb:AE017346_1757271 Cryptococcus neoformans var. neoformans JEC2...    77   2e-13   
gb:AF110008_1241945 Molgula occulta p68 RNA helicase (bobcat) ge...    77   2e-13   
gb:AF110007_1241943 Molgula oculata p68 RNA helicase (bobcat) an...    77   2e-13   
gb:CP000009_862233 Gluconobacter oxydans 621H, complete genome.        77   2e-13   
gb:AP006841_572823 Bacteroides fragilis YCH46 DNA, complete genome.    77   2e-13   
gb:AE016913_355964 Chromobacterium violaceum ATCC 12472 section ...    77   2e-13   
gb:AE011560_274285 Leptospira interrogans serovar lai str. 56601...    77   2e-13   
gb:AE008692_241155 Zymomonas mobilis subsp. mobilis ZM4, complet...    77   2e-13   
pir|F82295|F82295 ATP-dependent RNA helicase SrmB VC0660 [import...    77   2e-13   
sp|P24783|DBP2_YEAST|DBP2_YEAST P68-like protein.>pir|S13757|S13757 RNA hel...    77   2e-13   
gb:BC089107_2110714 Rattus norvegicus ATP-dependent, RNA helicas...    77   3e-13   
gb:AL645615_2071761 Mouse DNA sequence from clone RP23-395B22 on...    77   3e-13   
gb:HSU90426_2027133 Human nuclear RNA helicase, complete cds.          77   3e-13   
gb:AE017349_1758681 Cryptococcus neoformans var. neoformans JEC2...    77   3e-13   
gb:AE017349_1758680 Cryptococcus neoformans var. neoformans JEC2...    77   3e-13   
gb:AY887136_1354966 Tribolium castaneum vasa RNA helicase mRNA, ...    77   3e-13   
gb:AK080767_1173065 Mus musculus adult retina cDNA, RIKEN full-l...    77   3e-13   
gb:BX842649_824315 Bdellovibrio bacteriovorus complete genome, s...    77   3e-13   
gb:BX248356_762301 Corynebacterium diphtheriae gravis NCTC13129,...    77   3e-13   
gb:BA000016_674436 Clostridium perfringens str. 13 DNA, complete...    77   3e-13   
gb:AY458648_620090 Uncultured bacterium 581 clone EBAC000-69B03 ...    77   3e-13   
gb:AP006840_568836 Symbiobacterium thermophilum DNA, complete ge...    77   3e-13   
gb:AF542976_520681 Yersinia enterocolitica PNPase (pnp), lipopro...    77   3e-13   
gb:AF186181_486491 Synechococcus PCC7002 slr0082 (slr0082) gene,...    77   3e-13   
gb:AE017333_449996 Bacillus licheniformis DSM 13, complete genom...    77   3e-13   
gb:AE016808_337986 Vibrio vulnificus CMCP6 chromosome II section...    77   3e-13   
gb:AE015698_316940 Shewanella oneidensis MR-1 section 247 of 457...    77   3e-13   
gb:AE008919_246252 Uncultured proteobacterium BAC EBAC000-65D09 ...    77   3e-13   
pir|T24662|T24662 hypothetical protein T07D4.4c - Caenorhabditis...    77   3e-13   
pir|T24661|T24661 hypothetical protein T07D4.4b - Caenorhabditis...    77   3e-13   
pir|T24663|T24663 hypothetical protein T07D4.4a - Caenorhabditis...    77   3e-13   
pir|AF2395|AF2395 ATP-dependent RNA helicase [imported] - Nostoc...    77   3e-13   
pir|T46969|T46969 DEAD box RNA helicase homolog [imported] - Ana...    77   3e-13   
sp|Q58083|H669_METJA|H669_METJA Probable ATP-dependent RNA helicase MJ0669....    77   3e-13   
sp|Q99PT0|DX52_RAT|DX52_RAT DEAD-box protein 52 (EC 3.6.1.-) (Putative AT...    77   3e-13   
sp|Q8K301|DX52_MOUSE|DX52_MOUSE DEAD-box protein 52 (EC 3.6.1.-) (Putative ...    77   3e-13   
sp|Q8K9H6|DEAD_BUCAP|DEAD_BUCAP Cold-shock DEAD-box protein A homolog (ATP-...    77   3e-13   
gb:AF188678_1775239 Pisum sativum P72 DEAD box protein mRNA, com...    76   4e-13   
gb:AE016817_1747361 Ashbya gossypii (= Eremothecium gossypii) AT...    76   4e-13   
gb:AX716935_1473720 Sequence 46 from Patent WO03020757.                76   4e-13   
gb:CP000009_864291 Gluconobacter oxydans 621H, complete genome.        76   4e-13   
gb:CP000001_852834 Bacillus cereus ZK, complete genome.                76   4e-13   
gb:BA000016_673902 Clostridium perfringens str. 13 DNA, complete...    76   4e-13   
gb:AL646061_545880 Ralstonia solanacearum GMI1000 chromosome, co...    76   4e-13   
gb:AE017355_463571 Bacillus thuringiensis serovar konkukian str....    76   4e-13   
gb:AE017272_423725 Bacillus cereus ATCC 10987, section 9 of 18 o...    76   4e-13   
gb:AE017031_382579 Bacillus anthracis str. Ames section 8 of 18 ...    76   4e-13   
gb:AE017005_377327 Bacillus cereus ATCC 14579 section 8 of 18 of...    76   4e-13   
gb:AE016822_340402 Leifsonia xyli subsp. xyli str. CTCB07, compl...    76   4e-13   
gb:AE004969_59936 Neisseria gonorrhoeae FA 1090, complete genome.      76   4e-13   
pir|H81085|H81085 ATP-dependent RNA helicase, probable NMB1422 [...    76   4e-13   
pir|F81857|F81857 probable ATP-dependent RNA helicase NMA1634 [i...    76   4e-13   
gb:BX569691_775822 Synechococcus sp. WH8102 complete genome; seg...    76   5e-13   
gb:AE017333_446464 Bacillus licheniformis DSM 13, complete genom...    76   5e-13   
gb:AE013300_291077 Methanosarcina mazei strain Goe1, section 82 ...    76   5e-13   
pir|A97581|A97581 ATP-dependent RNA helicase rhle VCA0204 [impor...    76   5e-13   
gb:CR382128_1661236 Yarrowia lipolytica chromosome B of strain C...    75   6e-13   
gb:CR382123_1656241 Kluyveromyces lactis strain NRRL Y-1140 chro...    75   6e-13   
gb:ATH010476_1551909 Arabidopsis thaliana mRNA for DEAD box RNA ...    75   6e-13   
gb:AC016661_1538194 Arabidopsis thaliana chromosome 3 BAC F11F8 ...    75   6e-13   
gb:AB047382_1195883 Hydra magnipapillata mRNA for vasa-related p...    75   6e-13   
gb:AE014298_1124710 Drosophila melanogaster chromosome X, comple...    75   6e-13   
gb:AE014187_938903 Plasmodium falciparum 3D7 chromosome 14 compl...    75   6e-13   
gb:BX950851_842022 Erwinia carotovora subsp. atroseptica SCRI104...    75   6e-13   
gb:BA000032_709385 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    75   6e-13   
gb:AE016911_355344 Chromobacterium violaceum ATCC 12472 section ...    75   6e-13   
gb:AE016791_333920 Pseudomonas putida KT2440 section 18 of 21 of...    75   6e-13   
gb:AE015835_318347 Shewanella oneidensis MR-1 section 384 of 457...    75   6e-13   
gb:CR522870_100535 Desulfotalea psychrophila LSv54 chromosome.         75   6e-13   
pir|H86341|H86341 hypothetical protein F9H16.10 - Arabidopsis th...    75   6e-13   
pir|T51349|T51349 RNA helicase RH30 [imported] - Arabidopsis tha...    75   6e-13   
pir|D83591|D83591 probable ATP-dependent RNA helicase PA0428 [im...    75   6e-13   
pir|D69772|D69772 ATP-dependent RNA helicase homolog ydbR - Baci...    75   6e-13   
sp|P45818|ROK1_YEAST|ROK1_YEAST ATP-dependent RNA helicase ROK1 (EC 3.6.1.-...    75   6e-13   
gb:SPP68_1721974 Schizosaccharomyces pombe p68 gene for p68 prot...    75   8e-13   
gb:CR382129_1661527 Yarrowia lipolytica chromosome C of strain C...    75   8e-13   
gb:BT002030_1635633 Arabidopsis thaliana putative RNA helicase (...    75   8e-13   
gb:CNS07EG9_1372906 chromosome II of strain GB-M1 of Encephalito...    75   8e-13   
gb:AY058515_1291669 Drosophila melanogaster LD21880 full length ...    75   8e-13   
gb:AE014298_1125730 Drosophila melanogaster chromosome X, comple...    75   8e-13   
gb:CP000020_871320 Vibrio fischeri ES114 chromosome I, complete ...    75   8e-13   


>gb:AF079782_1766406 Zea mays translation initiation factor 4A2
           (tif4A2) mRNA, partial cds.
          Length = 215

 Score =  177 bits (449), Expect = 1e-43
 Identities = 88/96 (91%), Positives = 91/96 (94%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG
Sbjct: 120 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 179

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT+DD+RMLFDIQKFYNVL+EELPANVAD L
Sbjct: 180 VAINFVTRDDERMLFDIQKFYNVLIEELPANVADLL 215



>pir|S52023|S52023 translation initiation factor eIF-4A.14 - common
           tobacco
          Length = 413

 Score =  177 bits (449), Expect = 1e-43
 Identities = 88/96 (91%), Positives = 91/96 (94%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG
Sbjct: 318 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 377

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVTKDD+RMLFDIQKFYNV++EELPANVAD L
Sbjct: 378 VAINFVTKDDERMLFDIQKFYNVVIEELPANVADLL 413



>sp|Q40467|IF4Y_TOBAC Eukaryotic initiation factor 4A-14 (eIF4A-14)
           (eIF-4A-14).>gb:NT4A14_1691240 N.tabacum NeIF-4A14 mRNA.
          Length = 413

 Score =  177 bits (449), Expect = 1e-43
 Identities = 88/96 (91%), Positives = 91/96 (94%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG
Sbjct: 318 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 377

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVTKDD+RMLFDIQKFYNV++EELPANVAD L
Sbjct: 378 VAINFVTKDDERMLFDIQKFYNVVIEELPANVADLL 413



>pir|S52021|S52021 translation initiation factor eIF-4A.6 - common
           tobacco  (fragment)
          Length = 254

 Score =  176 bits (446), Expect = 3e-43
 Identities = 87/96 (90%), Positives = 91/96 (94%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG
Sbjct: 159 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 218

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           V+INFVTKDD+RMLFDIQKFYNV++EELPANVAD L
Sbjct: 219 VSINFVTKDDERMLFDIQKFYNVVIEELPANVADLL 254



>gb:ZMU73459_1732221 Zea mays translational initiation factor eIF-4A
           (tif-4A3) mRNA, complete cds.
          Length = 414

 Score =  175 bits (444), Expect = 4e-43
 Identities = 87/96 (90%), Positives = 91/96 (94%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG
Sbjct: 319 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 378

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT+D++RMLFDIQKFYNVL+EELPANVAD L
Sbjct: 379 VAINFVTRDNERMLFDIQKFYNVLIEELPANVADLL 414



>gb:AY158704_1585544 Apium graveolens var. dulce translation
           initition factor eIF4A mRNA, partial cds.
          Length = 180

 Score =  175 bits (444), Expect = 4e-43
 Identities = 88/93 (94%), Positives = 89/93 (95%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG
Sbjct: 88  RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 147

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVA 313
           VAINFVTKDDDRMLFDIQKFYNV+VEELPANVA
Sbjct: 148 VAINFVTKDDDRMLFDIQKFYNVVVEELPANVA 180



>gb:AP003726_1832494 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0596H10.>gb:AP004278_1839688 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0468G03.
          Length = 414

 Score =  175 bits (443), Expect = 6e-43
 Identities = 86/96 (89%), Positives = 91/96 (94%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG
Sbjct: 319 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 378

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT+DD+RMLFDIQ+FYNV++EELPANVAD L
Sbjct: 379 VAINFVTRDDERMLFDIQRFYNVVIEELPANVADLL 414



>sp|P35683|IF4A_ORYSA Eukaryotic initiation factor 4A (eIF4A)
           (eIF-4A).>pir|S38358|S38358 translation initiation
           factor eIF-4A - rice>gb:AB046416_1520494 Oryza sativa
           eIF4A-1 gene for eukaryotic initiation factor 4A,
           complete cds.>gb:RICEIF4A_1703606 Oryza sativa (japonica
           cultivar-group) mRNA for eukaryotic initiation factor
           4A, complete cds.
          Length = 413

 Score =  175 bits (443), Expect = 6e-43
 Identities = 86/96 (89%), Positives = 91/96 (94%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG
Sbjct: 318 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 377

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT+DD+RMLFDIQ+FYNV++EELPANVAD L
Sbjct: 378 VAINFVTRDDERMLFDIQRFYNVVIEELPANVADLL 413



>gb:AF007580_1760920 Zea mays translation initiation factor (eIF-4A)
           mRNA, complete cds.
          Length = 414

 Score =  174 bits (442), Expect = 7e-43
 Identities = 86/96 (89%), Positives = 91/96 (94%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG
Sbjct: 319 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 378

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT+DD+R++FDIQKFYNVL+EELPANVAD L
Sbjct: 379 VAINFVTRDDERIVFDIQKFYNVLIEELPANVADLL 414



>sp|Q40469|IF46_TOBAC Eukaryotic initiation factor 4A-6 (eIF4A-6)
           (eIF-4A-6) (Fragment).>gb:NT4A6_1691242 N.tabacum
           NeIF-4A6 mRNA.
          Length = 253

 Score =  174 bits (442), Expect = 7e-43
 Identities = 86/94 (91%), Positives = 90/94 (95%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG
Sbjct: 159 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 218

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVAD 310
           V+INFVTKDD+RMLFDIQKFYNV++EELPANVAD
Sbjct: 219 VSINFVTKDDERMLFDIQKFYNVVIEELPANVAD 252



>gb:AP005288_1849910 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1008_C03.
          Length = 414

 Score =  174 bits (441), Expect = 1e-42
 Identities = 86/96 (89%), Positives = 90/96 (93%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG
Sbjct: 319 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 378

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT+DD+RMLFDIQ+FYNV +EELPANVAD L
Sbjct: 379 VAINFVTRDDERMLFDIQRFYNVTIEELPANVADLL 414



>pir|S52018|S52018 translation initiation factor eIF-4A.11 - common
           tobacco
          Length = 413

 Score =  174 bits (441), Expect = 1e-42
 Identities = 86/96 (89%), Positives = 90/96 (93%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVINYDLPTQPENYLHRIG SGRFGRKG
Sbjct: 318 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGHSGRFGRKG 377

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           V+INFVTKDD+RMLFDIQKFYNV++EELPANVAD L
Sbjct: 378 VSINFVTKDDERMLFDIQKFYNVVIEELPANVADLL 413



>sp|Q40465|IF4V_TOBAC Eukaryotic initiation factor 4A-11 (eIF4A-11)
           (eIF-4A-11).>gb:NT4A11_1691238 N.tabacum NeIF-4A11 mRNA.
          Length = 413

 Score =  174 bits (441), Expect = 1e-42
 Identities = 86/96 (89%), Positives = 90/96 (93%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVINYDLPTQPENYLHRIG SGRFGRKG
Sbjct: 318 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGHSGRFGRKG 377

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           V+INFVTKDD+RMLFDIQKFYNV++EELPANVAD L
Sbjct: 378 VSINFVTKDDERMLFDIQKFYNVVIEELPANVADLL 413



>sp|P41382|IF4U_TOBAC Eukaryotic initiation factor 4A-10 (eIF4A-10)
           (eIF-4A-10).>pir|S55898|S55898 translation initiation
           factor eIF-4A.10 - common tobacco>gb:NTEIF4A1_1691554
           N.tabacum eIF-4A10 mRNA.>gb:NTEIF4A1D_1691555 N.tabacum
           eIF-4A10 gene.
          Length = 413

 Score =  174 bits (441), Expect = 1e-42
 Identities = 87/96 (90%), Positives = 90/96 (93%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG
Sbjct: 318 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 377

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVTKDD+RML DIQKFYNV++EELPANVAD L
Sbjct: 378 VAINFVTKDDERMLSDIQKFYNVVIEELPANVADLL 413



>sp|P41381|IF48_TOBAC Eukaryotic initiation factor 4A-8 (eIF4A-8)
           (eIF-4A-8).>pir|S60244|S60244 translation initiation
           factor eIF-4A.8, anther-specific - common
           tobacco>gb:NTEIF4A8_1691556 N.tabacum eIF-4A8
           mRNA.>gb:NTEIF4A8D_1691557 N.tabacum eIF-4A8 gene.
          Length = 413

 Score =  174 bits (441), Expect = 1e-42
 Identities = 86/96 (89%), Positives = 90/96 (93%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG
Sbjct: 318 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 377

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT DD+RMLFDIQKFYNV++EELP+NVAD L
Sbjct: 378 VAINFVTTDDERMLFDIQKFYNVIIEELPSNVADLL 413



>sp|P41379|IF42_NICPL Eukaryotic initiation factor 4A-2 (eIF4A-2)
           (eIF-4A-2).>pir|S22578|S22578 translation initiation
           factor eIF-4A - curled-leaved
           tobacco>gb:NPNEIF4A2_1691095 N. plumbaginifolia NeIF-4A2
           mRNA for nicotiana eukaryotic translation initiation
           factor 4A.
          Length = 413

 Score =  174 bits (441), Expect = 1e-42
 Identities = 87/96 (90%), Positives = 90/96 (93%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG
Sbjct: 318 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 377

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAIN VTKDD+RMLFDIQKFYNV++EELPANVAD L
Sbjct: 378 VAINSVTKDDERMLFDIQKFYNVVIEELPANVADLL 413



>gb:AY086907_1571946 Arabidopsis thaliana clone 29310 mRNA, complete
           sequence.
          Length = 412

 Score =  174 bits (440), Expect = 1e-42
 Identities = 86/96 (89%), Positives = 91/96 (94%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKG
Sbjct: 317 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKG 376

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT+DD+RMLFDIQKFYNV+VEELP+NVAD L
Sbjct: 377 VAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLL 412



>gb:AY081287_1568633 Arabidopsis thaliana eukaryotic translation
           initiation factor (At3g13920) mRNA, complete cds.
          Length = 412

 Score =  174 bits (440), Expect = 1e-42
 Identities = 86/96 (89%), Positives = 91/96 (94%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKG
Sbjct: 317 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKG 376

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT+DD+RMLFDIQKFYNV+VEELP+NVAD L
Sbjct: 377 VAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLL 412



>gb:ATH298137_1552408 Arabidopsis thaliana eIF-4A1 gene for
           translation initiation factor eIF-4A1, exons 1-5 and gus
           gene for beta-glucuronidase.
          Length = 369

 Score =  174 bits (440), Expect = 1e-42
 Identities = 86/96 (89%), Positives = 91/96 (94%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKG
Sbjct: 274 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKG 333

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT+DD+RMLFDIQKFYNV+VEELP+NVAD L
Sbjct: 334 VAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLL 369



>sp|P41376|IF41_ARATH Eukaryotic initiation factor 4A-1 (eIF4A-1)
           (eIF-4A-1).>pir|JC1452|JC1452 translation initiation
           factor eIF-4A1 - Arabidopsis
           thaliana>gb:AB019229_1514118 Arabidopsis thaliana
           genomic DNA, chromosome 3, P1 clone:
           MDC16.>gb:ATH298138_1552410 Arabidopsis thaliana mRNA
           for translation initiation factor eIF-4A1 (eIF-4A1
           gene).>gb:ATTIF4A1_1556674 A.thaliana mRNA for
           eukaryotic translation initiation factor
           4A-1.>gb:AY050957_1562440 Arabidopsis thaliana putative
           Eukaryotic initiation factor 4A (At3g13920) mRNA,
           complete cds.>gb:AY052344_1562716 Arabidopsis thaliana
           AT3g13920/MDC16_4 mRNA, complete
           cds.>gb:AY091304_1574508 Arabidopsis thaliana putative
           eukaryotic initiation factor 4A (At3g13920) mRNA,
           complete cds.>gb:AY098962_1576522 Arabidopsis thaliana
           AT3g13920/MDC16_4 mRNA, complete
           cds.>gb:AY139981_1582423 Arabidopsis thaliana unknown
           protein mRNA, complete cds.>gb:BT000655_1634933
           Arabidopsis thaliana clone RAFL07-07-D14 (R10830)
           putative eukaryotic initiation factor 4A (At3g13920)
           mRNA, complete cds.
          Length = 412

 Score =  174 bits (440), Expect = 1e-42
 Identities = 86/96 (89%), Positives = 91/96 (94%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKG
Sbjct: 317 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKG 376

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT+DD+RMLFDIQKFYNV+VEELP+NVAD L
Sbjct: 377 VAINFVTRDDERMLFDIQKFYNVVVEELPSNVADLL 412



>pir|S52020|S52020 translation initiation factor eIF-4A.15 - common
           tobacco
          Length = 413

 Score =  173 bits (438), Expect = 2e-42
 Identities = 86/96 (89%), Positives = 90/96 (93%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG
Sbjct: 318 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 377

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVTKDD+RML DIQ+FYNV++EELPANVAD L
Sbjct: 378 VAINFVTKDDERMLSDIQRFYNVVIEELPANVADLL 413



>gb:AY167670_1586294 Pisum sativum DEAD box RNA helicase mRNA,
           complete cds.>gb:AY513583_1610485 Pisum sativum DEAD box
           RNA helicase gene, complete cds.
          Length = 413

 Score =  172 bits (436), Expect = 4e-42
 Identities = 86/96 (89%), Positives = 90/96 (93%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG
Sbjct: 318 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 377

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVTKDD+RML DIQKFYNVL+EELP+NVA+ L
Sbjct: 378 VAINFVTKDDERMLGDIQKFYNVLIEELPSNVAELL 413



>sp|P41378|IF4A_WHEAT Eukaryotic initiation factor 4A (eIF4A)
           (eIF-4A).>pir|JN0839|JN0839 translation initiation
           factor eIF-4A - wheat
          Length = 414

 Score =  172 bits (436), Expect = 4e-42
 Identities = 85/96 (88%), Positives = 90/96 (93%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVINYDLPTQPENY HRIGRSGRFGRKG
Sbjct: 319 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYQHRIGRSGRFGRKG 378

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT++D+RMLFDIQKFYNV++EELPANVAD L
Sbjct: 379 VAINFVTREDERMLFDIQKFYNVVIEELPANVADLL 414



>sp|Q40468|IF4Z_TOBAC Eukaryotic initiation factor 4A-15 (eIF4A-15)
           (eIF-4A-15).>gb:NT4A15_1691241 N.tabacum NeIF-4A15 mRNA.
          Length = 413

 Score =  171 bits (434), Expect = 6e-42
 Identities = 85/96 (88%), Positives = 90/96 (93%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKG
Sbjct: 318 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKG 377

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVTKDD+RML DIQ+FYNV++EELPANVAD L
Sbjct: 378 VAINFVTKDDERMLSDIQRFYNVVIEELPANVADLL 413



>sp|Q41741|IF4A_MAIZE Eukaryotic initiation factor 4A (eIF4A)
           (eIF-4A).>gb:ZMU17979_1732098 Zea mays translation
           initiation factor eIF-4A mRNA, complete cds.
          Length = 410

 Score =  171 bits (434), Expect = 6e-42
 Identities = 84/96 (87%), Positives = 90/96 (93%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG
Sbjct: 315 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 374

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT+DD+R++FD+Q+FYNV VEELPANVAD L
Sbjct: 375 VAINFVTRDDERIVFDVQRFYNVTVEELPANVADLL 410



>sp|P41377|IF42_ARATH Eukaryotic initiation factor 4A-2 (eIF4A-2)
           (eIF-4A-2).>pir|JC1453|JC1453 translation initiation
           factor eIF-4A2 - Arabidopsis thaliana>gb:AE005173_893325
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC005287_1532381 Arabidopsis thaliana
           chromosome I BAC F20D21 genomic sequence, complete
           sequence.>gb:ATTIF4A2_1556675 A.thaliana mRNA for
           eukaryotic translation initiation factor
           4A-2.>gb:AY087965_1572989 Arabidopsis thaliana clone
           3997 mRNA, complete sequence.>gb:BT008504_1639721
           Arabidopsis thaliana At1g54270 gene, complete
           cds.>gb:AF386923_1794728 Arabidopsis thaliana Eukaryotic
           Initiation Factor 4A-2 (F20D21.9) mRNA, complete
           cds.>gb:AF428462_1799392 Arabidopsis thaliana
           At1g54270/F20D21_52 mRNA, complete cds.
          Length = 412

 Score =  171 bits (434), Expect = 6e-42
 Identities = 86/96 (89%), Positives = 89/96 (92%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKG
Sbjct: 317 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKG 376

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT DD RMLFDIQKFYNV+VEELP+NVAD L
Sbjct: 377 VAINFVTLDDQRMLFDIQKFYNVVVEELPSNVADLL 412



>pir|S52019|S52019 translation initiation factor eIF-4A.7 - common
           tobacco
          Length = 413

 Score =  171 bits (432), Expect = 1e-41
 Identities = 85/96 (88%), Positives = 89/96 (92%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG
Sbjct: 318 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 377

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFV KDD+RML DIQ+FYNV++EELPANVAD L
Sbjct: 378 VAINFVIKDDERMLSDIQRFYNVVIEELPANVADLL 413



>sp|Q40470|IF47_TOBAC Eukaryotic initiation factor 4A-7 (eIF4A-7)
           (eIF-4A-7).>gb:NT4A7_1691243 N.tabacum NeIF-4A7 mRNA.
          Length = 413

 Score =  171 bits (432), Expect = 1e-41
 Identities = 85/96 (88%), Positives = 89/96 (92%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG
Sbjct: 318 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 377

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFV KDD+RML DIQ+FYNV++EELPANVAD L
Sbjct: 378 VAINFVIKDDERMLSDIQRFYNVVIEELPANVADLL 413



>gb:AY040227_1560581 Elaeis oleifera eukaryotic translation
           initiation factor 4A-1 mRNA, partial cds.
          Length = 170

 Score =  170 bits (430), Expect = 2e-41
 Identities = 83/93 (89%), Positives = 89/93 (95%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG
Sbjct: 78  RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 137

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVA 313
           VAINFVT+DD+RMLFDIQ+FYNV++EELP+NVA
Sbjct: 138 VAINFVTRDDERMLFDIQRFYNVVIEELPSNVA 170



>pir|S52017|S52017 translation initiation factor eIF-4A.9 - common
           tobacco
          Length = 413

 Score =  170 bits (430), Expect = 2e-41
 Identities = 84/96 (87%), Positives = 89/96 (92%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG
Sbjct: 318 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 377

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           V+INFVT DD+RML DIQ+FYNV++EELPANVAD L
Sbjct: 378 VSINFVTSDDERMLSDIQRFYNVVIEELPANVADLL 413



>sp|Q40471|IF49_TOBAC Eukaryotic initiation factor 4A-9 (eIF4A-9)
           (eIF-4A-9).>gb:NT4A9_1691244 N.tabacum NeIF-4A9 mRNA.
          Length = 413

 Score =  170 bits (430), Expect = 2e-41
 Identities = 84/96 (87%), Positives = 89/96 (92%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG
Sbjct: 318 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 377

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           V+INFVT DD+RML DIQ+FYNV++EELPANVAD L
Sbjct: 378 VSINFVTSDDERMLSDIQRFYNVVIEELPANVADLL 413



>gb:AF180356_1774812 Brassica oleracea isolate B265 EIF4A protein
           (EIF4A) gene, partial cds; putative protein gene,
           complete cds; and casein kinase I-like protein (CK1b)
           gene, partial cds.
          Length = 354

 Score =  168 bits (426), Expect = 5e-41
 Identities = 84/96 (87%), Positives = 89/96 (92%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKG
Sbjct: 259 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKG 318

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINF+T DD+RML DIQKFYNV+VEELP+NVAD L
Sbjct: 319 VAINFMTTDDERMLSDIQKFYNVVVEELPSNVADLL 354



>gb:AY428601_1605820 Helianthus annuus clone HA24-15A initiation
           factor eIF4A-15 mRNA, complete cds.
          Length = 413

 Score =  168 bits (426), Expect = 5e-41
 Identities = 84/96 (87%), Positives = 89/96 (92%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG
Sbjct: 318 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 377

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT DD++ML DIQKFYNV+VEELP+NVAD +
Sbjct: 378 VAINFVTLDDEKMLGDIQKFYNVVVEELPSNVADLI 413



>gb:AY167671_1586295 Pisum sativum DEAD box RNA helicase mRNA,
           complete cds.
          Length = 413

 Score =  165 bits (418), Expect = 4e-40
 Identities = 83/96 (86%), Positives = 88/96 (91%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKG
Sbjct: 318 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKG 377

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFV K+D+ ML DIQKFYNVLVEELP+NVA+ L
Sbjct: 378 VAINFVNKEDEAMLQDIQKFYNVLVEELPSNVAELL 413



>gb:ATH010472_1551905 Arabidopsis thaliana mRNA for DEAD box RNA
           helicase, RH23.
          Length = 441

 Score =  165 bits (418), Expect = 4e-40
 Identities = 81/96 (84%), Positives = 89/96 (92%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKG
Sbjct: 346 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKG 405

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINF+T +D+RM+ DIQ+FYNV+VEELP+NVAD L
Sbjct: 406 VAINFMTSEDERMMADIQRFYNVVVEELPSNVADLL 441



>pir|T51347|T51347 RNA helicase RH23 [imported] - Arabidopsis
           thaliana  (fragment)
          Length = 441

 Score =  165 bits (418), Expect = 4e-40
 Identities = 81/96 (84%), Positives = 89/96 (92%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKG
Sbjct: 346 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKG 405

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINF+T +D+RM+ DIQ+FYNV+VEELP+NVAD L
Sbjct: 406 VAINFMTSEDERMMADIQRFYNVVVEELPSNVADLL 441



>pir|B96752|B96752 hypothetical protein F28P22.8 [imported] -
           Arabidopsis thaliana>gb:AE005173_894820 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010926_1537148 Arabidopsis thaliana
           chromosome 1 BAC F28P22 genomic sequence, complete
           sequence.>gb:AY060592_1564895 Arabidopsis thaliana
           At1g72730/F28P22_8 mRNA, complete
           cds.>gb:AY088176_1573198 Arabidopsis thaliana clone
           42530 mRNA, complete sequence.>gb:AY142066_1582903
           Arabidopsis thaliana At1g72730/F28P22_8 mRNA, complete
           cds.
          Length = 414

 Score =  165 bits (418), Expect = 4e-40
 Identities = 81/96 (84%), Positives = 89/96 (92%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKG
Sbjct: 319 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKG 378

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINF+T +D+RM+ DIQ+FYNV+VEELP+NVAD L
Sbjct: 379 VAINFMTSEDERMMADIQRFYNVVVEELPSNVADLL 414



>gb:AB046414_1520492 Oryza sativa eIF4A-2 mRNA for eukaryotic
           initiation factor 4A, complete cds.>gb:AB046415_1520493
           Oryza sativa eIF4A-2 gene for eukaryotic initiation
           factor 4A, complete cds.
          Length = 414

 Score =  159 bits (403), Expect = 2e-38
 Identities = 81/96 (84%), Positives = 85/96 (88%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D L RGIDVQQVSLVINYDL TQ ENYLHRIGRSGRFGRKG
Sbjct: 319 RDIIMREFRSGSSRVLITTDLLDRGIDVQQVSLVINYDLSTQTENYLHRIGRSGRFGRKG 378

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAI FVT+DD+RMLFDIQ+FYN  +EELPANVAD L
Sbjct: 379 VAIIFVTRDDERMLFDIQRFYNGTIEELPANVADLL 414



>gb:BC055242_2551321 Danio rerio zgc:63783, mRNA (cDNA clone
           MGC:63783 IMAGE:2643605), complete cds.
          Length = 280

 Score =  151 bits (382), Expect = 7e-36
 Identities = 75/96 (78%), Positives = 82/96 (85%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RDIIMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 185 RDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 244

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT++D R+L DI+ FYN  VEE+P NVAD +
Sbjct: 245 VAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 280



>gb:AF515726_2498839 Gallus gallus translational eukaryotic
           inititation factor 4AII (EIF4AII) mRNA, complete
           cds.>gb:AJ720280_2502467 Gallus gallus mRNA for
           hypothetical protein, clone 14a6.
          Length = 407

 Score =  151 bits (381), Expect = 9e-36
 Identities = 74/96 (77%), Positives = 82/96 (85%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 312 RDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 371

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT++D R+L DI+ FYN  VEE+P NVAD +
Sbjct: 372 VAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 407



>gb:HUMELF4AII_2030861 Homo sapiens mRNA for eukaryotic initiation
           factor 4AII, complete cds.
          Length = 407

 Score =  151 bits (381), Expect = 9e-36
 Identities = 74/96 (77%), Positives = 82/96 (85%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 312 RDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 371

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT++D R+L DI+ FYN  VEE+P NVAD +
Sbjct: 372 VAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 407



>gb:BC016295_1975524 Homo sapiens eukaryotic translation initiation
           factor 4A, isoform 2, mRNA (cDNA clone IMAGE:3912165),
           complete cds.
          Length = 179

 Score =  151 bits (381), Expect = 9e-36
 Identities = 74/96 (77%), Positives = 82/96 (85%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 84  RDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 143

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT++D R+L DI+ FYN  VEE+P NVAD +
Sbjct: 144 VAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 179



>gb:BC015842_1975341 Homo sapiens eukaryotic translation initiation
           factor 4A, isoform 2, mRNA (cDNA clone MGC:27241
           IMAGE:4337581), complete cds.
          Length = 407

 Score =  151 bits (381), Expect = 9e-36
 Identities = 74/96 (77%), Positives = 82/96 (85%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 312 RDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 371

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT++D R+L DI+ FYN  VEE+P NVAD +
Sbjct: 372 VAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 407



>gb:BC012547_1973667 Homo sapiens eukaryotic translation initiation
           factor 4A, isoform 2, mRNA (cDNA clone MGC:13368
           IMAGE:4079371), complete cds.>gb:BC048105_1984083 Homo
           sapiens eukaryotic translation initiation factor 4A,
           isoform 2, mRNA (cDNA clone MGC:57298 IMAGE:4820774),
           complete cds.>gb:MMEIF4AII_2114798 M.musculus eIF-4AII
           gene for protein synthesis initiation factor 4A.
          Length = 408

 Score =  151 bits (381), Expect = 9e-36
 Identities = 74/96 (77%), Positives = 82/96 (85%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 313 RDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 372

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT++D R+L DI+ FYN  VEE+P NVAD +
Sbjct: 373 VAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 408



>gb:AB060830_1868712 Macaca fascicularis brain cDNA
           clone:QtrA-10374, full insert sequence.
          Length = 242

 Score =  151 bits (381), Expect = 9e-36
 Identities = 74/96 (77%), Positives = 82/96 (85%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 147 RDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 206

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT++D R+L DI+ FYN  VEE+P NVAD +
Sbjct: 207 VAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 242



>gb:AF208852_1150557 Homo sapiens BM-010 mRNA, complete cds.
          Length = 312

 Score =  151 bits (381), Expect = 9e-36
 Identities = 74/96 (77%), Positives = 82/96 (85%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 217 RDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 276

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT++D R+L DI+ FYN  VEE+P NVAD +
Sbjct: 277 VAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 312



>sp|Q14240|IF42_HUMAN Eukaryotic initiation factor 4A-II (eIF4A-II)
           (eIF-4A-II).>sp|P10630|IF42_MOUSE Eukaryotic initiation
           factor 4A-II (eIF4A-II) (eIF-4A-II).>pir|S00985|S00985
           translation initiation factor eIF-4A II -
           mouse>gb:AK076509_1171421 Mus musculus 0 day neonate
           head cDNA, RIKEN full-length enriched library,
           clone:4833432N07 product:EUKARYOTIC INITIATION FACTOR
           4A-II (EIF-4A-II) (EIF4A-II), full insert
           sequence.>gb:CR861119_1185134 Pongo pygmaeus mRNA; cDNA
           DKFZp459F0214 (from clone
           DKFZp459F0214).>gb:BC013708_1974184 Homo sapiens
           eukaryotic translation initiation factor 4A, isoform 2,
           mRNA (cDNA clone MGC:21863 IMAGE:4341420), complete
           cds.>gb:BT009860_1990997 Homo sapiens eukaryotic
           translation initiation factor 4A, isoform 2 mRNA,
           complete cds.>gb:BC085859_2109418 Rattus norvegicus
           eukaryotic translation initiation factor 4A2
           (predicted), mRNA (cDNA clone MGC:94588 IMAGE:7190333),
           complete cds.>gb:MMEIF4AII_2114799 M.musculus eIF-4AII
           gene for protein synthesis initiation factor 4A.
          Length = 407

 Score =  151 bits (381), Expect = 9e-36
 Identities = 74/96 (77%), Positives = 82/96 (85%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 312 RDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 371

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT++D R+L DI+ FYN  VEE+P NVAD +
Sbjct: 372 VAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI 407



>gb:XLEIF4AI_2582767 X.laevis mRNA for translation initiation factor
           eIF4A I.
          Length = 406

 Score =  149 bits (377), Expect = 3e-35
 Identities = 74/96 (77%), Positives = 80/96 (83%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 311 RDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 370

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAIN VT+DD R L DI+ FYN  VEE+P NVAD +
Sbjct: 371 VAINMVTEDDKRTLKDIETFYNTTVEEMPMNVADLI 406



>gb:BC084468_2563842 Xenopus tropicalis hypothetical LOC496556, mRNA
           (cDNA clone MGC:89309 IMAGE:6986347), complete cds.
          Length = 406

 Score =  149 bits (377), Expect = 3e-35
 Identities = 74/96 (77%), Positives = 80/96 (83%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 311 RDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 370

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAIN VT+DD R L DI+ FYN  VEE+P NVAD +
Sbjct: 371 VAINMVTEDDKRTLKDIETFYNTTVEEMPMNVADLI 406



>gb:BC077641_2560340 Xenopus laevis translation initiation factor
           eIF4A II, mRNA (cDNA clone MGC:86382 IMAGE:7011148),
           complete cds.
          Length = 406

 Score =  149 bits (377), Expect = 3e-35
 Identities = 74/96 (77%), Positives = 80/96 (83%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 311 RDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 370

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAIN VT+DD R L DI+ FYN  VEE+P NVAD +
Sbjct: 371 VAINMVTEDDKRTLKDIETFYNTTVEEMPMNVADLI 406



>gb:BC068800_2555300 Xenopus laevis translation initiation factor
           eIF4A I, mRNA (cDNA clone MGC:81383 IMAGE:6634613),
           complete cds.
          Length = 406

 Score =  149 bits (377), Expect = 3e-35
 Identities = 74/96 (77%), Positives = 80/96 (83%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 311 RDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 370

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAIN VT+DD R L DI+ FYN  VEE+P NVAD +
Sbjct: 371 VAINMVTEDDKRTLKDIETFYNTTVEEMPMNVADLI 406



>gb:BC045237_2549092 Xenopus laevis translation initiation factor
           eIF4A II, mRNA (cDNA clone IMAGE:4887970), partial cds.
          Length = 404

 Score =  149 bits (377), Expect = 3e-35
 Identities = 74/96 (77%), Positives = 80/96 (83%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 309 RDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 368

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAIN VT+DD R L DI+ FYN  VEE+P NVAD +
Sbjct: 369 VAINMVTEDDKRTLKDIETFYNTTVEEMPMNVADLI 404



>gb:BC049427_2550236 Danio rerio eukaryotic translation initiation
           factor 4A, isoform 1B, mRNA (cDNA clone MGC:56410
           IMAGE:5605327), complete cds.
          Length = 406

 Score =  149 bits (376), Expect = 3e-35
 Identities = 74/96 (77%), Positives = 80/96 (83%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 311 RDLIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 370

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAIN VT+DD R L DI+ FYN  VEE+P NVAD +
Sbjct: 371 VAINMVTEDDKRTLRDIETFYNTTVEEMPMNVADLI 406



>gb:BC048899_2550074 Danio rerio eukaryotic translation initiation
           factor 4A, isoform 1A, mRNA (cDNA clone MGC:55961
           IMAGE:3819402), complete cds.
          Length = 406

 Score =  148 bits (373), Expect = 7e-35
 Identities = 72/96 (75%), Positives = 80/96 (83%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IM+EFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 311 RDVIMKEFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 370

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAIN +T+DD R L DI+ FYN  VEE+P NVAD +
Sbjct: 371 VAINMITEDDKRTLRDIETFYNTTVEEMPMNVADLI 406



>gb:BC084034_2563442 Xenopus laevis hypothetical LOC494976, mRNA
           (cDNA clone IMAGE:7197002), partial cds.
          Length = 404

 Score =  147 bits (371), Expect = 1e-34
 Identities = 72/96 (75%), Positives = 80/96 (83%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 309 RDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 368

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAIN VT++D R L DI+ FYN  +EE+P NVAD +
Sbjct: 369 VAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI 404



>gb:BT019879_2151582 Synthetic construct Homo sapiens eukaryotic
           translation initiation factor 4A, isoform 1 mRNA,
           partial cds.
          Length = 407

 Score =  147 bits (371), Expect = 1e-34
 Identities = 72/96 (75%), Positives = 80/96 (83%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 311 RDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 370

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAIN VT++D R L DI+ FYN  +EE+P NVAD +
Sbjct: 371 VAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI 406



>gb:MUSELF4A5_2125725 Mus musculus protein synthesis initiation
           factor 4A (elf-4A) gene, exons 10 and 11, complete cds.
          Length = 406

 Score =  147 bits (371), Expect = 1e-34
 Identities = 72/96 (75%), Positives = 80/96 (83%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 311 RDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 370

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAIN VT++D R L DI+ FYN  +EE+P NVAD +
Sbjct: 371 VAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI 406



>gb:MMEIF4AI_2114797 Mouse mRNA for initiation factor
           eIF-4AI.>gb:MMEIF4AL_2114802 Mouse mRNA for initiation
           factor eIF-4A long form.
          Length = 370

 Score =  147 bits (371), Expect = 1e-34
 Identities = 72/96 (75%), Positives = 80/96 (83%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 275 RDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 334

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAIN VT++D R L DI+ FYN  +EE+P NVAD +
Sbjct: 335 VAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI 370



>gb:MMEIF4AI_2114796 Mouse mRNA for initiation factor
           eIF-4AI.>gb:MMEIF4AL_2114801 Mouse mRNA for initiation
           factor eIF-4A long form.
          Length = 390

 Score =  147 bits (371), Expect = 1e-34
 Identities = 72/96 (75%), Positives = 80/96 (83%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 295 RDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 354

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAIN VT++D R L DI+ FYN  +EE+P NVAD +
Sbjct: 355 VAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI 390



>gb:BC006380_1970242 Homo sapiens cDNA clone IMAGE:4099962, partial
           cds.
          Length = 473

 Score =  147 bits (371), Expect = 1e-34
 Identities = 72/96 (75%), Positives = 80/96 (83%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 378 RDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 437

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAIN VT++D R L DI+ FYN  +EE+P NVAD +
Sbjct: 438 VAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI 473



>gb:CR860906_1184950 Pongo pygmaeus mRNA; cDNA DKFZp470B2433 (from
           clone DKFZp470B2433).
          Length = 406

 Score =  147 bits (371), Expect = 1e-34
 Identities = 72/96 (75%), Positives = 80/96 (83%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 311 RDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 370

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAIN VT++D R L DI+ FYN  +EE+P NVAD +
Sbjct: 371 VAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI 406



>pir|S13269|S13269 translation initiation factor eIF-4A.I - rabbit
           (fragment)
          Length = 398

 Score =  147 bits (371), Expect = 1e-34
 Identities = 72/96 (75%), Positives = 80/96 (83%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 303 RDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 362

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAIN VT++D R L DI+ FYN  +EE+P NVAD +
Sbjct: 363 VAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI 398



>sp|P29562|IF41_RABIT Eukaryotic initiation factor 4A-I (eIF4A-I)
           (eIF-4A-I) (Fragment).
          Length = 398

 Score =  147 bits (371), Expect = 1e-34
 Identities = 72/96 (75%), Positives = 80/96 (83%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 303 RDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 362

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAIN VT++D R L DI+ FYN  +EE+P NVAD +
Sbjct: 363 VAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI 398



>sp|P60842|IF41_HUMAN Eukaryotic initiation factor 4A-I (eIF4A-I)
           (eIF-4A-I).>sp|P60843|IF41_MOUSE Eukaryotic initiation
           factor 4A-I (eIF4A-I) (eIF-4A-I).>pir|JS0039|FIMS4A
           translation initiation factor eIF-4A I -
           mouse>pir|S33681|S33681 translation initiation factor
           eIF-4A.I - human>gb:AK077429_1171847 Mus musculus 8 days
           embryo whole body cDNA, RIKEN full-length enriched
           library, clone:5730408A09 product:EUKARYOTIC INITIATION
           FACTOR 4A-I (EIF-4A-I) (EIF4A-I), full insert
           sequence.>gb:AX306781_1465648 Sequence 14 from Patent
           WO0018961.>gb:BC009585_1972118 Homo sapiens eukaryotic
           translation initiation factor 4A, isoform 1, mRNA (cDNA
           clone MGC:14648 IMAGE:4096621), complete
           cds.>gb:BC073752_1989069 Homo sapiens eukaryotic
           translation initiation factor 4A, isoform 1, mRNA (cDNA
           clone MGC:88756 IMAGE:6371531), complete
           cds.>gb:BT019880_1991281 Homo sapiens eukaryotic
           translation initiation factor 4A, isoform 1 mRNA,
           complete cds.>gb:BT019881_1991282 Homo sapiens
           eukaryotic translation initiation factor 4A, isoform 1
           mRNA, complete cds.>gb:HUM4AI_2028837 Homo sapiens mRNA
           for eukaryotic initiation factor 4AI, complete
           cds.>gb:AB011595_2043669 Mus musculus gene for eIF4A,
           complete cds.>gb:AL603707_2071124 Mouse DNA sequence
           from clone RP23-422L16 on chromosome 11 Contains the 3'
           end of the Sat2 gene for spermidine/spermine N1-acetyl
           transferase 2, a ribosomal potein S15A (Rps15a)
           pseudogene, a ubiquitin-like 5 (Ubl5) pseudogene, the
           Fxr2h gene for autosomal homolog of fragile X mental
           retardation gene 2, the Sox15 gene for SRY-box
           containing gene 15, the Mpdu1 gene for
           mannose-P-dolichol utilization defect 1, the Cd68 gene
           for CD68 antigen, the Eif4a1 gene for eukaryotic
           translation initiation factor 4A1, the gene for
           sentrin/SUMO-specific protease Smt3ip1, the Tnfsf13 and
           Tnfsf12 genes for tumor necrosis factor (ligand)
           superfamily members 13 and 12, three novel genes, a
           ribosomal protein L13 (Rpl13) pseudogene, the Polr2a
           gene for polymerase (RNA) II (DNA directed) polypeptide
           A, the Amac1 gene for acyl-malonyl condensing enzyme,
           the gene for a novel BTB/POZ domain containing C2H2 type
           zinc finger protein, the Chrnb1 gene for nicotinic
           cholinergic receptor beta polypeptide 1 (muscle), the
           Fgf11 gene for fibroblast growth factor 11, a novel
           pseudogene, the gene for the ortholog of human and rat
           neuroligin 2 NLGN2, the gene for a novel protein of
           unknown function (DUF423) family member, the Plscr3 gene
           for phospholipid scramblase 3, the 3' end of the Tnk1
           gene for non-receptor tyrosine kinase 1 and nine CpG
           islands, complete sequence.>gb:BC049915_2100255 Mus
           musculus eukaryotic translation initiation factor 4A1,
           mRNA (cDNA clone MGC:54779 IMAGE:5068709), complete
           cds.>gb:BC063812_2105269 Rattus norvegicus eukaryotic
           translation initiation factor 4A, isoform 1, mRNA (cDNA
           clone MGC:72964 IMAGE:6921521), complete cds.
          Length = 406

 Score =  147 bits (371), Expect = 1e-34
 Identities = 72/96 (75%), Positives = 80/96 (83%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 311 RDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 370

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAIN VT++D R L DI+ FYN  +EE+P NVAD +
Sbjct: 371 VAINMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI 406



>gb:XLEIF4AII_2582768 X.laevis mRNA for translation initiation
           factor eIF4A II, partial.
          Length = 413

 Score =  146 bits (369), Expect = 2e-34
 Identities = 73/96 (76%), Positives = 79/96 (82%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFG KG
Sbjct: 318 RDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGWKG 377

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAIN VT+DD R L DI+ FYN  VEE+P NVAD +
Sbjct: 378 VAINMVTEDDKRTLKDIETFYNTTVEEMPMNVADLI 413



>gb:MMEIF4AR_2114804 Mouse eIF-4AII mRNA for protein synthesis
           initiation factor 4AII.
          Length = 407

 Score =  145 bits (367), Expect = 4e-34
 Identities = 72/96 (75%), Positives = 80/96 (83%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 312 RDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 371

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT++D R+L  I+ FYN  VEE+P N AD +
Sbjct: 372 VAINFVTEEDKRILRHIETFYNTTVEEMPMNGADLI 407



>pir|S30278|S30278 translation initiation factor eIF-4A - fruit fly
           (Drosophila melanogaster)>gb:DMEIF4A_1379496
           D.melanogaster gene for eIF-4A eukaryotic translation
           initiation factor.
          Length = 402

 Score =  145 bits (367), Expect = 4e-34
 Identities = 68/96 (70%), Positives = 83/96 (86%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R++IM++FR G SRVLIT D LARGIDVQQVSLVINYDLP+  ENY+HRIGR GRFGRKG
Sbjct: 307 REVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKG 366

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINF+T DD R+L DI++FY+  +EE+PAN+AD +
Sbjct: 367 VAINFITDDDRRILKDIEQFYHTTIEEMPANIADLI 402



>sp|Q02748|IF4A_DROME Eukaryotic initiation factor 4A (eIF4A)
           (eIF-4A).>gb:AE014134_1127744 Drosophila melanogaster
           chromosome 2L, complete sequence.>gb:AE014134_1127745
           Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE014134_1127746 Drosophila melanogaster
           chromosome 2L, complete sequence.>gb:AE014134_1127747
           Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003612_1217851 Drosophila melanogaster
           chromosome 2L, section 21 of 83 of the complete
           sequence.>gb:AE003612_1217852 Drosophila melanogaster
           chromosome 2L, section 21 of 83 of the complete
           sequence.>gb:AE003612_1217853 Drosophila melanogaster
           chromosome 2L, section 21 of 83 of the complete
           sequence.>gb:AE003612_1217854 Drosophila melanogaster
           chromosome 2L, section 21 of 83 of the complete
           sequence.>gb:AF145621_1244680 Drosophila melanogaster
           clone GH03937 eukaryotic initiation factor-4a (eIF-4a)
           mRNA, complete cds.>gb:AY069283_1294013 Drosophila
           melanogaster GM14109 full length
           cDNA.>gb:AY121623_1301285 Drosophila melanogaster
           GH17619 full insert cDNA.
          Length = 403

 Score =  145 bits (367), Expect = 4e-34
 Identities = 68/96 (70%), Positives = 83/96 (86%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R++IM++FR G SRVLIT D LARGIDVQQVSLVINYDLP+  ENY+HRIGR GRFGRKG
Sbjct: 308 REVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKG 367

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINF+T DD R+L DI++FY+  +EE+PAN+AD +
Sbjct: 368 VAINFITDDDRRILKDIEQFYHTTIEEMPANIADLI 403



>gb:CR857735_1181950 Pongo pygmaeus mRNA; cDNA DKFZp469I1935 (from
           clone DKFZp469I1935).
          Length = 312

 Score =  145 bits (366), Expect = 5e-34
 Identities = 72/96 (75%), Positives = 80/96 (83%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR   SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 217 RDVIMREFRSESSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKG 276

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT++D R+L DI+ FYN  VE +P NVAD +
Sbjct: 277 VAINFVTEEDKRILRDIEAFYNTTVEGMPMNVADLI 312



>sp|P47943|IF4A_SCHPO Eukaryotic initiation factor 4A (eIF4A)
           (eIF-4A).>pir|S71745|S71745 translation initiation
           factor eIF-4A [similarity] - fission yeast
           (Schizosaccharomyces pombe)>gb:SPAC1006_1716263 S.pombe
           chromosome I cosmid c1006.>gb:SPEIF4A_1721793 S.pombe
           eIF-4A mRNA for translation initiation
           factor.>gb:YSPTIF1A_1731237 Schizosaccharomyces pombe
           cell cycle control protein eIF-4A (tif1) mRNA, complete
           cds.
          Length = 392

 Score =  142 bits (358), Expect = 4e-33
 Identities = 67/96 (69%), Positives = 79/96 (82%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD +M EFR G SR+LIT D LARGIDVQQVSLVINYDLP   ENY+HRIGR GRFGRKG
Sbjct: 297 RDTLMHEFRTGSSRILITTDLLARGIDVQQVSLVINYDLPANRENYIHRIGRGGRFGRKG 356

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           V+INFVT DD RM+ +I++FYN  +EE+P N+AD +
Sbjct: 357 VSINFVTNDDVRMMREIEQFYNTHIEEMPMNIADLI 392



>gb:AE017341_1754588 Cryptococcus neoformans var. neoformans JEC21
           chromosome 1, complete sequence.
          Length = 401

 Score =  142 bits (357), Expect = 5e-33
 Identities = 68/96 (70%), Positives = 80/96 (83%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R++IM+EFR G SRVLIT D LARGIDVQQVSLVINYDLP+  ENY+HRIGR GRFGRKG
Sbjct: 306 REVIMKEFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSSKENYIHRIGRGGRFGRKG 365

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFV+ +D  ML +I+ +YN  VEE+P NVAD +
Sbjct: 366 VAINFVSNEDKNMLEEIETYYNTQVEEMPLNVADLI 401



>sp|P27639|IF4A_CAEEL Eukaryotic initiation factor 4A (eIF4A)
           (eIF-4A).>pir|S26281|S26281 translation initiation
           factor eIF-4A homolog - Caenorhabditis
           elegans>gb:CEEIF4AM_1361909 C.elegans mRNA for eIF-4A
           homologue.>gb:U13876_1401881 Caenorhabditis elegans
           cosmid F57B9, complete sequence.
          Length = 402

 Score =  140 bits (354), Expect = 1e-32
 Identities = 68/96 (70%), Positives = 80/96 (83%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IMREFR G SRVLIT D LARGIDVQQVSLVINYDLP+  ENY+HRIGRSGRFGRKG
Sbjct: 307 RDTIMREFRSGSSRVLITTDILARGIDVQQVSLVINYDLPSNRENYIHRIGRSGRFGRKG 366

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT++D R L +I+ +Y   +EE+P ++AD +
Sbjct: 367 VAINFVTENDARQLKEIESYYTTQIEEMPESIADLI 402



>gb:AE017343_1755881 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 396

 Score =  139 bits (350), Expect = 3e-32
 Identities = 70/94 (74%), Positives = 79/94 (84%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IM EFR G SRVLIT D  ARGIDVQQVSLVINYDLPT  ENYLHRIGRSGRFGRKG
Sbjct: 301 RDAIMAEFRGGQSRVLITTDVWARGIDVQQVSLVINYDLPTSRENYLHRIGRSGRFGRKG 360

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVAD 310
           VAINFVT DD R+L DI+++Y+  ++E+P NVA+
Sbjct: 361 VAINFVTVDDVRILRDIEQYYSTQIDEMPMNVAE 394



>gb:TGO320155_1400167 Toxoplasma gondii mRNA for eukaryotic
           translation initiation factor 4A (toif4A gene).
          Length = 412

 Score =  138 bits (347), Expect = 8e-32
 Identities = 68/95 (71%), Positives = 77/95 (81%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R++IMREFR G +RVLIT D LARGIDVQQVSLVINYDLP   ENY+HRIGRSGRFGRKG
Sbjct: 317 REMIMREFRSGSTRVLITTDLLARGIDVQQVSLVINYDLPATKENYIHRIGRSGRFGRKG 376

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADF 307
           VAINFVT  D   L +I+K YN  +EE+P  VA+F
Sbjct: 377 VAINFVTSSDVEQLKEIEKHYNTQIEEMPMEVAEF 411



>sp|O02494|IF4A_CRYPV Eukaryotic initiation factor 4A (eIF4A)
           (eIF-4A).>gb:AF001211_1230635 Cryptosporidium parvum
           translation initiation factor (eIF4-A) mRNA, complete
           cds.>gb:AF001378_1230648 Cryptosporidium parvum
           translation initiation factor (eIF4-A) mRNA, complete
           cds.
          Length = 405

 Score =  137 bits (345), Expect = 1e-31
 Identities = 66/96 (68%), Positives = 77/96 (80%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R++IMR+FR G SRVLIT D LARGIDVQQVSLVINYDLP  PE Y+HRIGRSGRFG+KG
Sbjct: 309 REVIMRQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPVSPETYIHRIGRSGRFGKKG 368

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           V+INFVT DD   L DI++ YN  +EE+P  + D L
Sbjct: 369 VSINFVTDDDIVCLRDIERHYNTQIEEMPMGITDIL 404



>gb:CR382128_1661208 Yarrowia lipolytica chromosome B of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 395

 Score =  135 bits (341), Expect = 4e-31
 Identities = 63/96 (65%), Positives = 79/96 (82%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IM+ FR G SR+LIT D LARGIDVQQVSLVIN+DLP+  ENY+HRIGR GRFGRKG
Sbjct: 300 RDVIMKAFRTGSSRILITTDLLARGIDVQQVSLVINFDLPSNRENYIHRIGRGGRFGRKG 359

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT +D  ML ++++FY+  + E+P N+AD +
Sbjct: 360 VAINFVTSEDHGMLKELERFYSTEIVEMPTNIADLI 395



>gb:AE014187_939121 Plasmodium falciparum 3D7 chromosome 14 complete
           sequence.>gb:AE014827_1228197 Plasmodium falciparum 3D7
           chromosome 14 section 12 of 13 of the complete sequence.
          Length = 398

 Score =  135 bits (341), Expect = 4e-31
 Identities = 67/98 (68%), Positives = 78/98 (79%), Gaps = 2/98 (2%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G +RVL+T D LARGIDVQQVSLVINYDLP  P+ Y+HRIGRSGRFGRKG
Sbjct: 301 RDLIMREFRSGSTRVLVTTDLLARGIDVQQVSLVINYDLPASPDTYIHRIGRSGRFGRKG 360

Query: 411 VAINFVTKDDDR--MLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT DD     L  I+ +Y+  +EE+P  VAD+L
Sbjct: 361 VAINFVTNDDKEKDKLKKIESYYSTQIEEMPLEVADYL 398



>gb:PCY245475_1391862 Plasmodium cynomolgi gene for RNA helicase-1.
          Length = 398

 Score =  135 bits (340), Expect = 5e-31
 Identities = 67/98 (68%), Positives = 78/98 (79%), Gaps = 2/98 (2%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD+IMREFR G +RVL+T D LARGIDVQQVSLVINYDLP  P+ Y+HRIGRSGRFGRKG
Sbjct: 301 RDLIMREFRSGSTRVLVTTDLLARGIDVQQVSLVINYDLPCSPDTYIHRIGRSGRFGRKG 360

Query: 411 VAINFVTKDDDR--MLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT DD     L  I+ +Y+  +EE+P  VAD+L
Sbjct: 361 VAINFVTNDDKEKDKLKKIESYYSTQIEEMPLEVADYL 398



>gb:NC8D4_1688770 Neurospora crassa DNA linkage group V Cosmid
           contig 8D4.
          Length = 400

 Score =  135 bits (339), Expect = 6e-31
 Identities = 66/96 (68%), Positives = 80/96 (83%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IM++FR G SRVLI+ D  ARGIDVQQVSLVINYDLP+  ENY+HRIGRSGRFGRKG
Sbjct: 304 RDSIMQDFRQGNSRVLISTDVWARGIDVQQVSLVINYDLPSNRENYIHRIGRSGRFGRKG 363

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT +D R+L DI+ +Y+  ++E+P NVAD +
Sbjct: 364 VAINFVTSEDVRILRDIELYYSTQIDEMPMNVADLI 399



>gb:AY089635_1297291 Drosophila melanogaster RE50350 full insert
           cDNA.
          Length = 399

 Score =  135 bits (339), Expect = 6e-31
 Identities = 67/96 (69%), Positives = 78/96 (81%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IM+EFR G SRVLIT D  ARGIDVQQVSLVINYDLP   E Y+HRIGRSGRFGRKG
Sbjct: 304 RDEIMKEFRAGQSRVLITTDVWARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKG 363

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFV  DD R+L DI+++Y+  ++E+P NVAD +
Sbjct: 364 VAINFVKSDDIRILRDIEQYYSTQIDEMPVNVADLI 399



>gb:AE014297_1138455 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003678_1220448 Drosophila melanogaster
           chromosome 3R, section 16 of 118 of the complete
           sequence.
          Length = 399

 Score =  134 bits (338), Expect = 8e-31
 Identities = 67/96 (69%), Positives = 78/96 (81%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IM+EFR G SRVLIT D  ARGIDVQQVSLVINYDLP   E Y+HRIGRSGRFGRKG
Sbjct: 304 RDEIMKEFRAGQSRVLITTDVWARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKG 363

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFV  DD R+L DI+++Y+  ++E+P NVAD +
Sbjct: 364 VAINFVKSDDIRILRDIEQYYSTQIDEMPMNVADLI 399



>sp|Q10055|IF4N_SCHPO Eukaryotic initiation factor 4A-like protein
           C1F5.10.>pir|T38085|T38085 translation initiation factor
           eIF-4a - fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC1F5_1717030 S. pombe chromosome I cosmid
           c1F5.
          Length = 394

 Score =  134 bits (338), Expect = 8e-31
 Identities = 64/96 (66%), Positives = 79/96 (82%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IM++FR G SRVLI  D  ARGIDVQQVSLVINYDLP   ENY+HRIGRSGRFGRKG
Sbjct: 299 RDAIMQDFRQGNSRVLICTDIWARGIDVQQVSLVINYDLPANRENYIHRIGRSGRFGRKG 358

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT +D R+L DI+++Y+ +++E+P N+ D +
Sbjct: 359 VAINFVTNEDVRILRDIEQYYSTVIDEMPMNIGDMV 394



>pir|S05835|FIBY1 translation initiation factor eIF-4A - yeast
           (Saccharomyces cerevisiae)>gb:SCTIF1_1709626 Yeast TIF1
           gene.>gb:SCTIF2_1709627 Yeast TIF2
           gene.>gb:SCX731_1710795 S.cerevisiae DNA from chromosome
           X (cosmids 7,31).>gb:SCYJL138C_1712701 S.cerevisiae
           chromosome X reading frame ORF
           YJL138c.>gb:SCYKR059W_1713273 S.cerevisiae chromosome XI
           reading frame ORF YKR059w.
          Length = 395

 Score =  134 bits (337), Expect = 1e-30
 Identities = 64/96 (66%), Positives = 78/96 (81%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IM+EFR G SR+LI+ D LARGIDVQQVSLVINYDLP   ENY+HRIGR GRFGRKG
Sbjct: 299 RDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKG 358

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT +D   + +++KFY+  +EELP+++A  L
Sbjct: 359 VAINFVTNEDVGAMRELEKFYSTQIEELPSDIATLL 394



>sp|P10081|IF4A_YEAST Eukaryotic initiation factor 4A (eIF4A)
           (eIF-4A) (Stimulator factor I 37 kDa component) (p37).
          Length = 394

 Score =  134 bits (337), Expect = 1e-30
 Identities = 64/96 (66%), Positives = 78/96 (81%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IM+EFR G SR+LI+ D LARGIDVQQVSLVINYDLP   ENY+HRIGR GRFGRKG
Sbjct: 298 RDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKG 357

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT +D   + +++KFY+  +EELP+++A  L
Sbjct: 358 VAINFVTNEDVGAMRELEKFYSTQIEELPSDIATLL 393



>gb:CR382136_1668772 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 399

 Score =  133 bits (335), Expect = 2e-30
 Identities = 66/96 (68%), Positives = 77/96 (80%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IM +FR G SRVLI+ D  ARGIDVQQVSLVINYDLPT  ENY+HRIGRSGRFGRKG
Sbjct: 304 RDSIMNDFRTGNSRVLISTDVWARGIDVQQVSLVINYDLPTDKENYVHRIGRSGRFGRKG 363

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAIN VTK+D   L DI++FY + ++E+P NV D +
Sbjct: 364 VAINLVTKEDVDELRDIERFYRIRIKEMPVNVNDIM 399



>gb:AY050367_1562146 Arabidopsis thaliana AT3g19760/MMB12_21 mRNA,
           complete cds.>gb:BT002207_1635810 Arabidopsis thaliana
           At3g19760/MMB12_21 mRNA, complete cds.
          Length = 408

 Score =  133 bits (335), Expect = 2e-30
 Identities = 66/96 (68%), Positives = 77/96 (80%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IM EFR G SRVLIT D  ARGIDVQQVSLVINYDLP   E Y+HRIGRSGRFGRKG
Sbjct: 313 RDAIMNEFRSGDSRVLITTDVWARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKG 372

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFV  DD ++L DI+++Y+  ++E+P NVAD +
Sbjct: 373 VAINFVKSDDIKILRDIEQYYSTQIDEMPMNVADLI 408



>pir|T51737|T51737 RNA helicase RH2 [imported] - Arabidopsis
           thaliana>gb:ATH010456_1551889 Arabidopsis thaliana mRNA
           for DEAD box RNA helicase, RH2.>gb:AP000417_1820127
           Arabidopsis thaliana genomic DNA, chromosome 3, P1
           clone: MMB12.
          Length = 391

 Score =  133 bits (335), Expect = 2e-30
 Identities = 66/96 (68%), Positives = 77/96 (80%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IM EFR G SRVLIT D  ARGIDVQQVSLVINYDLP   E Y+HRIGRSGRFGRKG
Sbjct: 296 RDAIMNEFRSGDSRVLITTDVWARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKG 355

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFV  DD ++L DI+++Y+  ++E+P NVAD +
Sbjct: 356 VAINFVKSDDIKILRDIEQYYSTQIDEMPMNVADLI 391



>gb:CR382136_1669297 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 397

 Score =  133 bits (334), Expect = 2e-30
 Identities = 64/92 (69%), Positives = 75/92 (81%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IM EFR G SR+LI+ D LARGIDVQQVSLVINYDLP   ENY+HRIGR GRFGRKG
Sbjct: 301 RDTIMNEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKG 360

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           VAINFVT  D  M+ +I+KFY+  +EE+PA++
Sbjct: 361 VAINFVTDQDVGMMREIEKFYSTQIEEMPADI 392



>sp|P87206|IF4A_CANAL Eukaryotic initiation factor 4A (eIF4A)
           (eIF-4A).>gb:D84472_1674863 Candida albicans DNA for
           translation initiation factor, complete cds.
          Length = 397

 Score =  133 bits (334), Expect = 2e-30
 Identities = 64/92 (69%), Positives = 76/92 (82%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IM+EFR G SR+LI+ D LARGIDVQQVSLVINYDLP   ENY+HRIGR GRFGRKG
Sbjct: 301 RDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKG 360

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           VAINFVT  D  M+ +I+KFY+  +EE+PA++
Sbjct: 361 VAINFVTDRDVGMMREIEKFYSTQIEEMPADI 392



>gb:AP003607_1831254 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0004A09.>gb:AP004367_1840895 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0696E01.
          Length = 404

 Score =  132 bits (333), Expect = 3e-30
 Identities = 65/96 (67%), Positives = 78/96 (81%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IM EFR G +RVLIT D  ARG+DVQQVSLVINYDLP   E Y+HRIGRSGRFGRKG
Sbjct: 309 RDAIMGEFRSGATRVLITTDVWARGLDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKG 368

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFV K+D R+L DI+++Y+  ++E+P NVAD +
Sbjct: 369 VAINFVKKEDIRILRDIEQYYSTQIDEMPMNVADLI 404



>gb:AC084404_1733571 Oryza sativa chromosome 3 BAC OSJNBa0026A15
           genomic sequence, complete sequence.
          Length = 404

 Score =  132 bits (333), Expect = 3e-30
 Identities = 65/96 (67%), Positives = 78/96 (81%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IM EFR G +RVLIT D  ARG+DVQQVSLVINYDLP   E Y+HRIGRSGRFGRKG
Sbjct: 309 RDAIMGEFRSGATRVLITTDVWARGLDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKG 368

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFV K+D R+L DI+++Y+  ++E+P NVAD +
Sbjct: 369 VAINFVKKEDIRILRDIEQYYSTQIDEMPMNVADLI 404



>gb:AE016816_1746943 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome III, complete sequence.
          Length = 396

 Score =  132 bits (332), Expect = 4e-30
 Identities = 64/94 (68%), Positives = 76/94 (80%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IM+EFR G SR+LI+ D LARGIDVQQVSLVINYDLP   ENY+HRIGR GRFGRKG
Sbjct: 300 RDTIMKEFRTGSSRILISTDLLARGIDVQQVSLVINYDLPNNKENYIHRIGRGGRFGRKG 359

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVAD 310
           VAIN VT  D   + ++++FY+  +EELPAN+AD
Sbjct: 360 VAINLVTDRDVGDMRELERFYSTQIEELPANIAD 393



>gb:CR382132_1665044 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 397

 Score =  132 bits (332), Expect = 4e-30
 Identities = 65/96 (67%), Positives = 75/96 (78%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IM EFR G SRVLI+ D  ARGIDVQQVSLVINYDLP   ENY+HRIGRSGRFGRKG
Sbjct: 302 RDSIMNEFRSGRSRVLISTDVWARGIDVQQVSLVINYDLPPNRENYIHRIGRSGRFGRKG 361

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINF T DD   L DI+++Y+  ++E+P NV D +
Sbjct: 362 VAINFATNDDITTLRDIEQYYSTQIDEMPVNVTDMM 397



>gb:CR380955_1651701 Candida glabrata strain CBS138 chromosome I
           complete sequence.
          Length = 396

 Score =  131 bits (330), Expect = 7e-30
 Identities = 61/92 (66%), Positives = 77/92 (83%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IM+EFR G SR+LI+ D LARGIDVQQVSLVINYDLPT  ENY+HRIGR GRFGRKG
Sbjct: 300 RDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPTNKENYIHRIGRGGRFGRKG 359

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           VAINF+  +D + L ++++FY+  +EELP+++
Sbjct: 360 VAINFIVNEDVQALRELEQFYSTQIEELPSDI 391



>sp|P41380|IF43_NICPL Eukaryotic initiation factor 4A-3 (eIF4A-3)
           (eIF-4A-3).>pir|S22579|S22579 translation initiation
           factor eIF-4A - curled-leaved
           tobacco>gb:NPNEIF4A3_1691096 N. plumbaginifolia NeIF-4A3
           mRNA for nicotiana eukaryotic translation initiation
           factor 4A.
          Length = 391

 Score =  131 bits (329), Expect = 9e-30
 Identities = 64/96 (66%), Positives = 77/96 (80%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IM EFR G +RVLIT D  ARG+DVQQVSLVINYDLP   E Y+HRIGRSGRFGRKG
Sbjct: 296 RDAIMAEFRGGTTRVLITTDVWARGLDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKG 355

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFV  DD ++L DI+++Y+  ++E+P NVAD +
Sbjct: 356 VAINFVKSDDIKILRDIEQYYSTQIDEMPMNVADLI 391



>gb:CR382121_1654516 Kluyveromyces lactis strain NRRL Y-1140
           chromosome A of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 396

 Score =  130 bits (327), Expect = 2e-29
 Identities = 60/94 (63%), Positives = 78/94 (82%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IM+EFR G SR+LI+ D LARGIDVQQVSLVINYDLP+  ENY+HRIGR GRFGRKG
Sbjct: 300 RDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPSNKENYIHRIGRGGRFGRKG 359

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVAD 310
           +AINFVT  D   + ++++FY+  +EELP+++++
Sbjct: 360 IAINFVTNKDIGAMRELERFYSTQIEELPSSISE 393



>gb:AY598438_2365404 Diachasmimorpha longicaudata entomopoxvirus
           unknown gene.
          Length = 379

 Score =  129 bits (325), Expect = 3e-29
 Identities = 58/96 (60%), Positives = 78/96 (81%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IM+EFR G +R+L++ + LARGIDVQQ+SLVINYDLP   ENY+HRIGRSGRFGRKG
Sbjct: 284 RDFIMKEFRDGKTRILLSTNLLARGIDVQQISLVINYDLPHNRENYIHRIGRSGRFGRKG 343

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           +AINF+T+D+   L +++ FYN  ++E+P N+ D +
Sbjct: 344 IAINFITEDELPKLAELETFYNTKIDEMPENIVDLI 379



>gb:CAL250879_1644946 Candida albicans fal1 gene for ATP-dependent
           RNA helicase.
          Length = 399

 Score =  129 bits (324), Expect = 4e-29
 Identities = 62/96 (64%), Positives = 76/96 (79%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IM +FR G SRVLI+ D  ARGIDVQQVSLVINYDLPT  ENY+HRIGRSGRFGRKG
Sbjct: 304 RDSIMNDFRRGNSRVLISTDVWARGIDVQQVSLVINYDLPTDKENYIHRIGRSGRFGRKG 363

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
            AIN +TKDD   L +++K+Y+  ++E+P N+ D +
Sbjct: 364 TAINLITKDDVVTLKELEKYYSTKIKEMPMNINDIM 399



>pir|T06824|T06824 translation initiation factor - garden
           pea>gb:PSY17186_1702598 Pisum sativum mRNA for
           translation initiation factor.
          Length = 407

 Score =  129 bits (324), Expect = 4e-29
 Identities = 62/96 (64%), Positives = 76/96 (79%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IM EFR G +RVLIT D  ARG+DVQQVSLVINYDLP   E Y+HRIGRSGRFGRKG
Sbjct: 312 RDAIMGEFRAGTTRVLITTDVWARGLDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKG 371

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFV  DD ++L DI+++Y+  ++E+P N+ D +
Sbjct: 372 VAINFVKSDDIKILRDIEQYYSTQIDEMPMNIGDLI 407



>gb:AC024844_1204946 Caenorhabditis elegans cosmid Y65B4A, complete
           sequence.
          Length = 399

 Score =  129 bits (323), Expect = 5e-29
 Identities = 61/96 (63%), Positives = 78/96 (81%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD +M+EFR G +RVLI+ D  ARG+DV QVSLVINYDLP   E Y+HRIGRSGRFGRKG
Sbjct: 304 RDEVMKEFRAGTTRVLISTDVWARGLDVPQVSLVINYDLPNNRELYIHRIGRSGRFGRKG 363

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFV +DD R+L DI+++Y+  ++E+P N+AD +
Sbjct: 364 VAINFVKQDDVRILRDIEQYYSTQIDEMPMNIADII 399



>pir|T32773|T32773 hypothetical protein F33D11.10 - Caenorhabditis
           elegans>gb:AF039720_1235579 Caenorhabditis elegans
           cosmid F33D11, complete sequence.
          Length = 399

 Score =  129 bits (323), Expect = 5e-29
 Identities = 61/96 (63%), Positives = 78/96 (81%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD +M+EFR G +RVLI+ D  ARG+DV QVSLVINYDLP   E Y+HRIGRSGRFGRKG
Sbjct: 304 RDEVMKEFRAGTTRVLISTDVWARGLDVPQVSLVINYDLPNNRELYIHRIGRSGRFGRKG 363

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFV +DD R+L DI+++Y+  ++E+P N+AD +
Sbjct: 364 VAINFVKQDDVRILRDIEQYYSTQIDEMPMNIADII 399



>gb:BC045939_2549453 Danio rerio zgc:56139, mRNA (cDNA clone
           MGC:56139 IMAGE:5411951), complete cds.
          Length = 406

 Score =  128 bits (321), Expect = 8e-29
 Identities = 61/96 (63%), Positives = 77/96 (80%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ IM+EFR G SRVLI+ D  ARG+DV QVSL+INYDLP   E Y+HRIGRSGR+GRKG
Sbjct: 311 RESIMKEFRSGASRVLISTDVWARGLDVSQVSLIINYDLPNNRELYIHRIGRSGRYGRKG 370

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFV  DD R+L DI+++Y+  ++E+P NVAD +
Sbjct: 371 VAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI 406



>gb:AJ719548_2501735 Gallus gallus mRNA for hypothetical protein,
           clone 3e17.
          Length = 412

 Score =  127 bits (320), Expect = 1e-28
 Identities = 61/96 (63%), Positives = 77/96 (80%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ IM+EFR G SRVLI+ D  ARG+DV QVSL+INYDLP   E Y+HRIGRSGR+GRKG
Sbjct: 317 RESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKG 376

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFV  DD R+L DI+++Y+  ++E+P NVAD +
Sbjct: 377 VAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI 412



>gb:AF020432_2469032 Xenopus laevis eukaryotic translation
           initiation factor XeIF-4AIII mRNA, complete cds.
          Length = 414

 Score =  127 bits (320), Expect = 1e-28
 Identities = 61/96 (63%), Positives = 77/96 (80%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ IM+EFR G SRVLI+ D  ARG+DV QVSL+INYDLP   E Y+HRIGRSGR+GRKG
Sbjct: 319 RESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKG 378

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFV  DD R+L DI+++Y+  ++E+P NVAD +
Sbjct: 379 VAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI 414



>gb:HUMORFJA_2035323 Homo sapiens KIAA0111 mRNA, partial cds.
          Length = 412

 Score =  127 bits (320), Expect = 1e-28
 Identities = 61/96 (63%), Positives = 77/96 (80%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ IM+EFR G SRVLI+ D  ARG+DV QVSL+INYDLP   E Y+HRIGRSGR+GRKG
Sbjct: 317 RESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKG 376

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFV  DD R+L DI+++Y+  ++E+P NVAD +
Sbjct: 377 VAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI 412



>gb:AK075920_1171103 Mus musculus ES cells cDNA, RIKEN full-length
           enriched library, clone:2400003O03 product:EUKARYOTIC
           INITIATION FACTOR 4A-LIKE NUK-34 homolog [Homo sapiens],
           full insert sequence.
          Length = 411

 Score =  127 bits (320), Expect = 1e-28
 Identities = 61/96 (63%), Positives = 77/96 (80%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ IM+EFR G SRVLI+ D  ARG+DV QVSL+INYDLP   E Y+HRIGRSGR+GRKG
Sbjct: 316 RESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKG 375

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFV  DD R+L DI+++Y+  ++E+P NVAD +
Sbjct: 376 VAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI 411



>sp|Q91VC3|DD48_MOUSE Probable ATP-dependent helicase DDX48
           (DEAD-box protein 48).>gb:BC008132_2090632 Mus musculus
           DEAD (Asp-Glu-Ala-Asp) box polypeptide 48, mRNA (cDNA
           clone MGC:6664 IMAGE:3498954), complete
           cds.>gb:BC012862_2091653 Mus musculus DEAD
           (Asp-Glu-Ala-Asp) box polypeptide 48, mRNA (cDNA clone
           MGC:6715 IMAGE:3585696), complete cds.
          Length = 411

 Score =  127 bits (320), Expect = 1e-28
 Identities = 61/96 (63%), Positives = 77/96 (80%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ IM+EFR G SRVLI+ D  ARG+DV QVSL+INYDLP   E Y+HRIGRSGR+GRKG
Sbjct: 316 RESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKG 375

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFV  DD R+L DI+++Y+  ++E+P NVAD +
Sbjct: 376 VAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI 411



>sp|P38919|DD48_HUMAN Probable ATP-dependent helicase DDX48
           (DEAD-box protein 48) (Eukaryotic initiation factor
           4A-like NUK-34) (Nuclear matrix protein 265) (hNMP 265)
           (Eukaryotic translation initiation factor 4A isoform
           3).>gb:BC003662_1968967 Homo sapiens DEAD
           (Asp-Glu-Ala-Asp) box polypeptide 48, mRNA (cDNA clone
           MGC:764 IMAGE:2988931), complete
           cds.>gb:BC004386_1969229 Homo sapiens DEAD
           (Asp-Glu-Ala-Asp) box polypeptide 48, mRNA (cDNA clone
           MGC:10862 IMAGE:3619386), complete
           cds.>gb:BC011151_1972922 Homo sapiens DEAD
           (Asp-Glu-Ala-Asp) box polypeptide 48, mRNA (cDNA clone
           MGC:17481 IMAGE:3452439), complete
           cds.>gb:CR456750_1992957 Homo sapiens full open reading
           frame cDNA clone RZPDo834C0811D for gene DDX48, DEAD
           (Asp-Glu-Ala-Asp) box polypeptide 48; complete cds,
           incl. stopcodon.
          Length = 411

 Score =  127 bits (320), Expect = 1e-28
 Identities = 61/96 (63%), Positives = 77/96 (80%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ IM+EFR G SRVLI+ D  ARG+DV QVSL+INYDLP   E Y+HRIGRSGR+GRKG
Sbjct: 316 RESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKG 375

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFV  DD R+L DI+++Y+  ++E+P NVAD +
Sbjct: 376 VAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI 411



>sp|Q12099|FAL1_YEAST Probable ATP-dependent RNA helicase
           FAL1.>pir|S54644|S54644 translation initiation factor
           eIF-4A homolog FAL1 - yeast  (Saccharomyces
           cerevisiae)>gb:AY723767_1624173 Saccharomyces cerevisiae
           clone FLH001364.01X YDR021W gene, complete
           cds.>gb:SC354CHIV_1705176 S.cerevisiae 35.4kb DNA region
           on left arm of chromosome IV.>gb:SC9335_1705839
           S.cerevisiae chromosome IV cosmid
           9335.>gb:SCYDR021W_1711842 S.cerevisiae chromosome IV
           reading frame ORF YDR021w.
          Length = 399

 Score =  127 bits (319), Expect = 1e-28
 Identities = 63/94 (67%), Positives = 75/94 (79%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD +M +FR G SRVLI+ D  ARGIDVQQVSLVINYDLP   ENY+HRIGRSGRFGRKG
Sbjct: 304 RDKVMNDFRTGHSRVLISTDVWARGIDVQQVSLVINYDLPEIIENYIHRIGRSGRFGRKG 363

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVAD 310
           VAINF+TK D   L +I+KFY++ +  +PAN A+
Sbjct: 364 VAINFITKADLAKLREIEKFYSIKINPMPANFAE 397



>gb:EMU292369_1384653 Echinococcus multilocularis mRNA for
           translation initiation factor 4A-like protein (eif4A
           gene).
          Length = 403

 Score =  126 bits (316), Expect = 3e-28
 Identities = 62/96 (64%), Positives = 76/96 (79%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ IMR FR   SRVLIT D LARGIDVQQVS+VINY LP   E Y+HRIGRSGRFGRKG
Sbjct: 308 REEIMRNFRSSESRVLITTDLLARGIDVQQVSMVINYGLPNNRELYIHRIGRSGRFGRKG 367

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFV  +D R+L DI+++Y+  ++E+P NV+D +
Sbjct: 368 VAINFVKNEDIRILRDIEQYYSTQIDEMPMNVSDLV 403



>pir|S45142|S45142 translation initiation factor eIF-4A2 homolog -
           human>gb:HSTIF_2021081 H.sapiens nuk_34 mRNA for
           translation initiation factor.
          Length = 411

 Score =  126 bits (316), Expect = 3e-28
 Identities = 60/96 (62%), Positives = 77/96 (80%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ IM+EFR G SRVLI+ D  ARG+DV QVSL+INYDLP   E Y+HRIGRSG++GRKG
Sbjct: 316 RESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGQYGRKG 375

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFV  DD R+L DI+++Y+  ++E+P NVAD +
Sbjct: 376 VAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI 411



>gb:BC084859_2564103 Xenopus laevis cDNA clone MGC:85498
           IMAGE:6940048, complete cds.
          Length = 415

 Score =  125 bits (313), Expect = 7e-28
 Identities = 60/96 (62%), Positives = 76/96 (79%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ IM+EFR G SRVLI+ D  ARG+DV QVSL+INYDLP   E Y+HRIGRSGR+G KG
Sbjct: 320 RESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGGKG 379

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFV  DD R+L DI+++Y+  ++E+P NVAD +
Sbjct: 380 VAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI 415



>gb:CR380959_1653935 Candida glabrata strain CBS138 chromosome M
           complete sequence.
          Length = 399

 Score =  124 bits (310), Expect = 1e-27
 Identities = 61/94 (64%), Positives = 76/94 (80%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD +M EFR G SRVLI+ D  ARGIDVQQVSLVINYDLP   ENY+HRIGRSGRFGRKG
Sbjct: 304 RDRVMNEFRTGQSRVLISTDVWARGIDVQQVSLVINYDLPEITENYVHRIGRSGRFGRKG 363

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVAD 310
           VAINF+TK D   + +I+K+Y + V+ +PA++++
Sbjct: 364 VAINFLTKIDASRMKEIEKYYKIKVKPMPADLSE 397



>gb:DDU78759_1377426 Dictyostelium discoideum IfdA (ifdA) mRNA,
           partial cds.
          Length = 395

 Score =  123 bits (308), Expect = 3e-27
 Identities = 59/96 (61%), Positives = 74/96 (77%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD I++ FR G +RVLIT D LARGIDVQQVSLVIN+DLPT  ENY+HRIGRSGRFGRKG
Sbjct: 300 RDGILQAFRSGATRVLITTDLLARGIDVQQVSLVINFDLPTNIENYIHRIGRSGRFGRKG 359

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINF+T  +   + ++ + YN  + E+P ++  FL
Sbjct: 360 VAINFITDAERGQIDELSRHYNTYIAEMPQDIGSFL 395



>gb:SCYURI_1714843 S.cerevisiae YURI gene (3' end), TIF2 gene for
           eIF-4a, and RPB4 gene for RNA polymerase II subunit 4.
          Length = 89

 Score =  122 bits (305), Expect = 6e-27
 Identities = 58/88 (65%), Positives = 71/88 (80%)
 Frame = -1

Query: 567 RFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTK 388
           R G SR+LI+ D LARGIDVQQVSLVINYDLP   ENY+HRIGR GRFGRKGVAINFVT 
Sbjct: 1   RSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKGVAINFVTN 60

Query: 387 DDDRMLFDIQKFYNVLVEELPANVADFL 304
           +D   + +++KFY+  +EELP+++A  L
Sbjct: 61  EDVGAMRELEKFYSTQIEELPSDIATLL 88



>gb:AE016818_1748551 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 398

 Score =  120 bits (301), Expect = 2e-26
 Identities = 58/92 (63%), Positives = 74/92 (80%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD +M +FR G SRVLI+ D  ARGIDVQQVSLVINYDLP   ENY+HRIGRSGRFGRKG
Sbjct: 303 RDKVMSDFRSGSSRVLISTDVWARGIDVQQVSLVINYDLPELLENYIHRIGRSGRFGRKG 362

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           VAINF+T+++   L  I+K Y++ ++ +PA++
Sbjct: 363 VAINFITREEVTKLKSIEKHYSIKIKPMPADI 394



>pir|A81464|A81464 translation initiation factor eIF-4A [similarity]
           - Leishmania major (strain Friedlin)>gb:AE001274_1208542
           Leishmania major chromosome 1, complete
           sequence.>gb:AE001274_1208543 Leishmania major
           chromosome 1, complete sequence.
          Length = 403

 Score =  119 bits (298), Expect = 4e-26
 Identities = 56/96 (58%), Positives = 73/96 (76%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +M  FR G SRVL+T D +ARGIDV  V++VIN+DLPT  ENYLHRIGR GR+GRKG
Sbjct: 306 RERVMNTFRSGSSRVLVTTDLVARGIDVHHVNIVINFDLPTNKENYLHRIGRGGRYGRKG 365

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT+ D  +L +I+  Y+  ++ELP + A +L
Sbjct: 366 VAINFVTEKDVELLHEIEAHYHTQIDELPVDFAAYL 401



>gb:CR382121_1654727 Kluyveromyces lactis strain NRRL Y-1140
           chromosome A of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 398

 Score =  119 bits (297), Expect = 5e-26
 Identities = 56/94 (59%), Positives = 73/94 (77%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD +M +FR G +RVLI+ D  ARGIDVQQ+SLVINYD+P   ENY+HRIGRSGRFGRKG
Sbjct: 303 RDQVMNDFRSGKARVLISTDVWARGIDVQQISLVINYDIPDNLENYIHRIGRSGRFGRKG 362

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVAD 310
           VAINF+TK++   L +I+  Y + ++  PAN+ +
Sbjct: 363 VAINFITKEERPKLKEIESHYRIKIKPTPANLEE 396



>gb:PFMAL4P4_1394862 Plasmodium falciparum MAL4P4.
          Length = 390

 Score =  118 bits (295), Expect = 8e-26
 Identities = 56/96 (58%), Positives = 74/96 (77%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IM +FR    RVLI+ D   RG+DVQ+VSLV+NYDLP   E+Y+HRIGRSGRFGRKG
Sbjct: 295 RDDIMLKFRQCKFRVLISTDIWGRGLDVQEVSLVVNYDLPNSRESYIHRIGRSGRFGRKG 354

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFV  DD ++L DI+++Y+  ++E+P N+ + L
Sbjct: 355 VAINFVKNDDIKILRDIEQYYSTQIDEMPMNITELL 390



>pir|C90137|C90137 eukaryotic initiation factor 4a [imported] -
           Guillardia theta nucleomorph>gb:AF083031_1766860
           Guillardia theta nucleomorph chromosome 3, complete
           sequence.
          Length = 385

 Score =  118 bits (295), Expect = 8e-26
 Identities = 54/96 (56%), Positives = 75/96 (78%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R  +M++FR G  R+LI+ D ++RGID+QQV LVINYDLP   E Y+HRIGRSGRFGRKG
Sbjct: 290 RSSVMKDFRSGLFRILISTDLVSRGIDIQQVCLVINYDLPKLKEVYIHRIGRSGRFGRKG 349

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINF+++ D  +L  I+ +YN  +EE+P ++++FL
Sbjct: 350 VAINFLSRSDVSILRSIEGYYNTNIEEMPNDISEFL 385



>pir|T48731|T48731 probable translation initiation factor eIF-4A
           [imported] - Neurospora crassa
          Length = 387

 Score =  117 bits (294), Expect = 1e-25
 Identities = 61/84 (72%), Positives = 71/84 (84%), Gaps = 1/84 (1%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IM++FR G SRVLI+ D  ARGIDVQQVSLVINYDLP+  ENY+HRIGRSGRFGRKG
Sbjct: 304 RDSIMQDFRQGNSRVLISTDVWARGIDVQQVSLVINYDLPSNRENYIHRIGRSGRFGRKG 363

Query: 411 VAINFVTKDDDRMLFDIQ-KFYNV 343
           VAINFVT +D R+L DI+ KF+ +
Sbjct: 364 VAINFVTSEDVRILRDIECKFWAI 387



>gb:AF179303_1247974 Plasmodium falciparum eukaryotic initiation
           factor 4A (eIF4A) mRNA, partial cds.
          Length = 100

 Score =  116 bits (291), Expect = 2e-25
 Identities = 55/96 (57%), Positives = 73/96 (76%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IM +FR    RVLI+ D   RG+DVQ+VSLV+NYDLP   E+Y+HRIGRSGRFGRKG
Sbjct: 5   RDDIMLKFRQCKFRVLISTDIWGRGLDVQEVSLVVNYDLPNSRESYIHRIGRSGRFGRKG 64

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFV  DD ++  DI+++Y+  ++E+P N+ + L
Sbjct: 65  VAINFVKNDDIKIFRDIEQYYSTQIDEMPMNITELL 100



>sp|Q25225|IF4A_LEIBR Probable eukaryotic initiation factor 4A
           (eIF4A) (eIF-4A).>gb:LBU19888_1387122 Leishmania
           braziliensis ribosomal DEAD box protein, complete
           cds.>gb:CQ815198_1453520 Sequence 9 from Patent
           EP1422238.>gb:AX134010_1461807 Sequence 9 from Patent
           EP1113073.
          Length = 403

 Score =  115 bits (289), Expect = 4e-25
 Identities = 55/96 (57%), Positives = 72/96 (75%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +M  FR G SRVL+T D +ARGIDV  V++VIN+DLPT  ENYLHRIGR GR+G KG
Sbjct: 306 RERVMNTFRSGSSRVLVTTDLVARGIDVHHVNIVINFDLPTNKENYLHRIGRGGRYGVKG 365

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
           VAINFVT+ D  +L +I+  Y+  ++ELP + A +L
Sbjct: 366 VAINFVTEKDVELLHEIEGHYHTQIDELPVDFAAYL 401



>gb:AC024261_1539332 Arabidopsis thaliana chromosome 1 BAC F5D21
           genomic sequence, complete sequence.
          Length = 347

 Score =  109 bits (272), Expect = 4e-23
 Identities = 55/92 (59%), Positives = 67/92 (72%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IM +FR   SRVLI  D  ARGIDVQ VS VINYD+P  PE Y+HRIGR+GRFGR+G
Sbjct: 255 RDDIMNQFRSFKSRVLIASDVWARGIDVQTVSHVINYDIPNNPELYIHRIGRAGRFGREG 314

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           VAINFV   D + L DI++ Y   + E+PA++
Sbjct: 315 VAINFVKSSDMKDLKDIERHYGTKIREMPADL 346



>pir|H96551|H96551 hypothetical protein F11M15.24 [imported] -
           Arabidopsis thaliana>gb:AE005173_893052 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC006085_1533469 Arabidopsis thaliana
           chromosome I BAC F11M15 genomic sequence, complete
           sequence.>gb:AY058890_1564425 Arabidopsis thaliana
           At1g51380/F11M15_24 mRNA, complete
           cds.>gb:AY079046_1568159 Arabidopsis thaliana
           At1g51380/F11M15_24 mRNA, complete cds.
          Length = 392

 Score =  109 bits (272), Expect = 4e-23
 Identities = 55/92 (59%), Positives = 67/92 (72%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD IM +FR   SRVLI  D  ARGIDVQ VS VINYD+P  PE Y+HRIGR+GRFGR+G
Sbjct: 300 RDDIMNQFRSFKSRVLIASDVWARGIDVQTVSHVINYDIPNNPELYIHRIGRAGRFGREG 359

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           VAINFV   D + L DI++ Y   + E+PA++
Sbjct: 360 VAINFVKSSDMKDLKDIERHYGTKIREMPADL 391



>gb:BC002266_2089013 Mus musculus eukaryotic translation initiation
           factor 4A1, mRNA (cDNA clone IMAGE:3495402), partial
           cds.
          Length = 68

 Score =  105 bits (261), Expect = 7e-22
 Identities = 49/68 (72%), Positives = 56/68 (82%)
 Frame = -1

Query: 507 QQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDDRMLFDIQKFYNVLVEEL 328
           QQVSLVINYDLPT  ENY+HRIGR GRFGRKGVAIN VT++D R L DI+ FYN  +EE+
Sbjct: 1   QQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEM 60

Query: 327 PANVADFL 304
           P NVAD +
Sbjct: 61  PLNVADLI 68



>gb:AY347787_1177948 Malus x domestica clone 31-4 translation
           initiation factor eIF-4A mRNA, partial cds.
          Length = 54

 Score = 99.0 bits (245), Expect = 5e-20
 Identities = 49/54 (90%), Positives = 49/54 (90%)
 Frame = -1

Query: 567 RFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVA 406
           R G SRVLIT D LARGIDVQQVSLVINYDLPTQPENY HRIGRSGRFGRKGVA
Sbjct: 1   RSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYFHRIGRSGRFGRKGVA 54



>gb:CR382131_1664757 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 488

 Score = 92.8 bits (229), Expect = 4e-18
 Identities = 49/101 (48%), Positives = 69/101 (68%), Gaps = 7/101 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPT------QPENYLHRIGRSG 430
           RD +M +FRFG S+VLI+ + +ARGID+  VS+V+NYDLPT       PE YLHRIGR+G
Sbjct: 375 RDRLMDDFRFGRSKVLISTNVIARGIDIATVSMVVNYDLPTDKNGKPDPETYLHRIGRTG 434

Query: 429 RFGRKGVAINFVTKDDD-RMLFDIQKFYNVLVEELPANVAD 310
           RFGR GV+I+FV  +    +L  IQ+   + + ++P +  D
Sbjct: 435 RFGRSGVSISFVHDEASFEVLDSIQQSLGMTLTQVPTDDID 475



>pir|AE1584|AE1584 ATP-dependent RNA helicase (DEAD motif) homolog
           lin1214 [imported] - Listeria innocua (strain
           Clip11262)>gb:AL596168_538559 Listeria innocua Clip11262
           complete genome, segment 6/12.
          Length = 470

 Score = 92.4 bits (228), Expect = 5e-18
 Identities = 44/83 (53%), Positives = 60/83 (72%)
 Frame = -1

Query: 579 MREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAIN 400
           M +F+ G SR LI  D   RGIDV  VSLVINYDLP + ENY+HRIGR+GR G+ G AI+
Sbjct: 273 MDDFKSGKSRFLIATDVAGRGIDVDNVSLVINYDLPIEKENYVHRIGRTGRAGKSGKAIS 332

Query: 399 FVTKDDDRMLFDIQKFYNVLVEE 331
           FV  +++ +L DI++  N+ +E+
Sbjct: 333 FVKTNENPLLRDIEEMLNITIEK 355



>sp|P20449|DBP5_YEAST ATP-dependent RNA helicase DBP5 (Helicase
           CA5/6).>pir|S66920|S66920 probable RNA helicase CA5/6 -
           yeast (Saccharomyces cerevisiae)>gb:SCU28135_1710092
           Saccharomyces cerevisiae DEAD-Box Protein 5 (DBP5) gene,
           complete cds.>gb:SCYOR046C_1714270 S.cerevisiae
           chromosome XV reading frame ORF YOR046c.
          Length = 482

 Score = 91.7 bits (226), Expect = 8e-18
 Identities = 49/88 (55%), Positives = 64/88 (72%), Gaps = 7/88 (7%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPT------QPENYLHRIGRSG 430
           RD ++ +FR G S+VLIT + LARGID+  VS+V+NYDLPT       P  Y+HRIGR+G
Sbjct: 369 RDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPTLANGQADPATYIHRIGRTG 428

Query: 429 RFGRKGVAINFV-TKDDDRMLFDIQKFY 349
           RFGRKGVAI+FV  K+   +L  IQK++
Sbjct: 429 RFGRKGVAISFVHDKNSFNILSAIQKYF 456



>gb:AE017326_443686 Listeria monocytogenes str. 4b F2365, section 5
           of 10 of the complete genome.>gb:AE017262_1076042
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 470

 Score = 90.9 bits (224), Expect = 1e-17
 Identities = 44/83 (53%), Positives = 60/83 (72%)
 Frame = -1

Query: 579 MREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAIN 400
           M +F+ G SR LI  D   RGIDV  VSLVINYDLP + ENY+HRIGR+GR G+ G AI+
Sbjct: 273 MDDFKSGKSRFLIATDVAGRGIDVDNVSLVINYDLPIEKENYVHRIGRTGRAGKSGKAIS 332

Query: 399 FVTKDDDRMLFDIQKFYNVLVEE 331
           FV  +++ +L DI++  +V +E+
Sbjct: 333 FVKTNENPLLRDIEEMLDVTIEK 355



>pir|AF1230|AF1230 ATP-dependent RNA helicase (DEAD motif) homolog
           lmo1246 [imported] - Listeria monocytogenes (strain
           EGD-e)>gb:AL591978_535737 Listeria monocytogenes strain
           EGD, complete genome, segment 6/12.
          Length = 470

 Score = 90.9 bits (224), Expect = 1e-17
 Identities = 44/83 (53%), Positives = 60/83 (72%)
 Frame = -1

Query: 579 MREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAIN 400
           M +F+ G SR LI  D   RGIDV  VSLVINYDLP + ENY+HRIGR+GR G+ G AI+
Sbjct: 273 MDDFKSGKSRFLIATDVAGRGIDVDNVSLVINYDLPIEKENYVHRIGRTGRAGKSGKAIS 332

Query: 399 FVTKDDDRMLFDIQKFYNVLVEE 331
           FV  +++ +L DI++  +V +E+
Sbjct: 333 FVKTNENPLLRDIEEMLDVTIEK 355



>sp|Q09747|YB66_SCHPO Putative ATP-dependent RNA helicase C12C2.06
           (EC 3.6.1.-).>pir|T39375|T39375 probable ATP-dependent
           RNA helicase - fission yeast  (Schizosaccharomyces
           pombe)>gb:SPBC12C2_1718889 S.pombe chromosome II cosmid
           c12C2.
          Length = 503

 Score = 90.5 bits (223), Expect = 2e-17
 Identities = 48/98 (48%), Positives = 65/98 (66%), Gaps = 7/98 (7%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLP------TQPENYLHRIGRSG 430
           RD IM  FR G S+VL+T + +ARGIDV QV+LV+NYD+P        P+ YLHRIGR+G
Sbjct: 391 RDAIMDSFRVGTSKVLVTTNVIARGIDVSQVNLVVNYDMPLDQAGRPDPQTYLHRIGRTG 450

Query: 429 RFGRKGVAINFV-TKDDDRMLFDIQKFYNVLVEELPAN 319
           RFGR GV+INFV  K     +  IQ+++   +  +P +
Sbjct: 451 RFGRVGVSINFVHDKKSWEEMNAIQEYFQRPITRVPTD 488



>gb:NC123A4_1688268 Neurospora crassa DNA linkage group V cosmid
           contig 123A4.
          Length = 483

 Score = 90.1 bits (222), Expect = 2e-17
 Identities = 53/106 (50%), Positives = 69/106 (65%), Gaps = 12/106 (11%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQ--------PENYLHRIGR 436
           RD+++ EFR G S+VLIT + LARGIDV  VS+VINYD+P +         E YLHRIGR
Sbjct: 353 RDVLLDEFRSGRSKVLITTNVLARGIDVSSVSMVINYDIPMKGPGEREPDAETYLHRIGR 412

Query: 435 SGRFGRKGVAINFVTKDDDRMLFD----IQKFYNVLVEELPANVAD 310
           +GRFGR GV+I+FV    DR  F+    I +FY + + +L  N  D
Sbjct: 413 TGRFGRVGVSISFV---HDRRSFEALSQIAQFYGIDLIQLNPNDLD 455



>gb:AP004225_1838948 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:B1156H12.>gb:AP004258_1839241 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OSJNBa0024F24.
          Length = 432

 Score = 89.7 bits (221), Expect = 3e-17
 Identities = 39/88 (44%), Positives = 63/88 (71%), Gaps = 1/88 (1%)
 Frame = -1

Query: 576 REFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINF 397
           + F+ G  R+L+  D + RGID+++V++VINYD+P   ++YLHR+GR+GRFG KG+AI F
Sbjct: 337 KNFKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLAITF 396

Query: 396 VTK-DDDRMLFDIQKFYNVLVEELPANV 316
           V+   D  +L  +Q+ + V ++ELP  +
Sbjct: 397 VSSASDSDVLNQVQERFEVDIKELPEQI 424



>gb:AP004225_1838946 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1156H12.
          Length = 432

 Score = 89.7 bits (221), Expect = 3e-17
 Identities = 39/88 (44%), Positives = 63/88 (71%), Gaps = 1/88 (1%)
 Frame = -1

Query: 576 REFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINF 397
           + F+ G  R+L+  D + RGID+++V++VINYD+P   ++YLHR+GR+GRFG KG+AI F
Sbjct: 337 KNFKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLAITF 396

Query: 396 VTK-DDDRMLFDIQKFYNVLVEELPANV 316
           V+   D  +L  +Q+ + V ++ELP  +
Sbjct: 397 VSSASDSDVLNQVQERFEVDIKELPEQI 424



>gb:CR382126_1659062 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 469

 Score = 89.7 bits (221), Expect = 3e-17
 Identities = 49/102 (48%), Positives = 70/102 (68%), Gaps = 8/102 (7%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPT------QPENYLHRIGRSG 430
           RD ++ +FR G S+VLIT + LARGID+  VS+V+NYDLPT       P  Y+HRIGR+G
Sbjct: 356 RDRLIDDFREGRSKVLITTNVLARGIDIPSVSMVVNYDLPTLPNGQADPSTYVHRIGRTG 415

Query: 429 RFGRKGVAINFV-TKDDDRMLFDIQKFY-NVLVEELPANVAD 310
           RFGR GVAI+F+  K    +L  IQK++ ++ + ++P +  D
Sbjct: 416 RFGRTGVAISFIHDKKSFEVLSAIQKYFGDIEITKVPTDDLD 457



>gb:AY052303_1562676 Arabidopsis thaliana AT5g11170/F2I11_60 mRNA,
           complete cds.>gb:AY059168_1564531 Arabidopsis thaliana
           AT5g11200/F2I11_90 mRNA, complete
           cds.>gb:BT001052_1635307 Arabidopsis thaliana
           At5g11170/F2I11_60 mRNA, complete
           cds.>gb:AF378868_1793453 Arabidopsis thaliana
           AT5g11200/F2I11_90 mRNA, complete cds.
          Length = 427

 Score = 89.7 bits (221), Expect = 3e-17
 Identities = 39/88 (44%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = -1

Query: 576 REFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINF 397
           + F+ G  R+L+  D + RGID+++V++VINYD+P   + YLHR+GR+GRFG KG+AI F
Sbjct: 332 KSFKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITF 391

Query: 396 V-TKDDDRMLFDIQKFYNVLVEELPANV 316
           V +  D  +L  +Q+ + V ++ELP  +
Sbjct: 392 VASASDSEVLNQVQERFEVDIKELPEQI 419



>gb:ATH010466_1551899 Arabidopsis thaliana mRNA for DEAD box RNA
           helicase, RH15.
          Length = 451

 Score = 89.7 bits (221), Expect = 3e-17
 Identities = 39/88 (44%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = -1

Query: 576 REFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINF 397
           + F+ G  R+L+  D + RGID+++V++VINYD+P   + YLHR+GR+GRFG KG+AI F
Sbjct: 356 KSFKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITF 415

Query: 396 V-TKDDDRMLFDIQKFYNVLVEELPANV 316
           V +  D  +L  +Q+ + V ++ELP  +
Sbjct: 416 VASASDSEVLNQVQERFEVDIKELPEQI 443



>gb:ATF2I11_1550468 Arabidopsis thaliana DNA chromosome 5, BAC clone
           F2I11 (ESSA project).
          Length = 427

 Score = 89.7 bits (221), Expect = 3e-17
 Identities = 39/88 (44%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = -1

Query: 576 REFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINF 397
           + F+ G  R+L+  D + RGID+++V++VINYD+P   + YLHR+GR+GRFG KG+AI F
Sbjct: 332 KSFKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITF 391

Query: 396 V-TKDDDRMLFDIQKFYNVLVEELPANV 316
           V +  D  +L  +Q+ + V ++ELP  +
Sbjct: 392 VASASDSEVLNQVQERFEVDIKELPEQI 419



>gb:ATF2I11_1550465 Arabidopsis thaliana DNA chromosome 5, BAC clone
           F2I11 (ESSA project).
          Length = 435

 Score = 89.7 bits (221), Expect = 3e-17
 Identities = 39/88 (44%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = -1

Query: 576 REFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINF 397
           + F+ G  R+L+  D + RGID+++V++VINYD+P   + YLHR+GR+GRFG KG+AI F
Sbjct: 332 KSFKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITF 391

Query: 396 V-TKDDDRMLFDIQKFYNVLVEELPANV 316
           V +  D  +L  +Q+ + V ++ELP  +
Sbjct: 392 VASASDSEVLNQVQERFEVDIKELPEQI 419



>pir|T51343|T51343 RNA helicase RH15 [imported] - Arabidopsis
           thaliana  (fragment)
          Length = 451

 Score = 89.7 bits (221), Expect = 3e-17
 Identities = 39/88 (44%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = -1

Query: 576 REFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINF 397
           + F+ G  R+L+  D + RGID+++V++VINYD+P   + YLHR+GR+GRFG KG+AI F
Sbjct: 356 KSFKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITF 415

Query: 396 V-TKDDDRMLFDIQKFYNVLVEELPANV 316
           V +  D  +L  +Q+ + V ++ELP  +
Sbjct: 416 VASASDSEVLNQVQERFEVDIKELPEQI 443



>sp|P42305|DBPA_BACSU ATP-dependent RNA helicase
           dbpA.>pir|E69613|E69613 ATP-dependent RNA helicase deaD
           - Bacillus subtilis>gb:D83026_120418 Bacillus subtilis
           genome sequence covering lic-cel
           region.>gb:BSUB0021_755876 Bacillus subtilis complete
           genome (section 21 of 21): from 4010730 to 4214630.
          Length = 479

 Score = 89.7 bits (221), Expect = 3e-17
 Identities = 42/87 (48%), Positives = 60/87 (68%)
 Frame = -1

Query: 582 IMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAI 403
           +M EF+ G  R L+  D  ARGID++ +SLVINYDLP + E+Y+HR GR+GR G KG AI
Sbjct: 282 VMNEFKRGEYRYLVATDVAARGIDIENISLVINYDLPLEKESYVHRTGRTGRAGNKGKAI 341

Query: 402 NFVTKDDDRMLFDIQKFYNVLVEELPA 322
           +FVT  + R L DI+++    + ++ A
Sbjct: 342 SFVTAFEKRFLADIEEYIGFEIPKIEA 368



>gb:CR382138_1671911 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 474

 Score = 89.4 bits (220), Expect = 4e-17
 Identities = 43/92 (46%), Positives = 61/92 (66%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  EFR G  RVL+  D L RGID+Q V++VIN+D P   E YLHRIGRSGRFG  G
Sbjct: 264 RNKVFHEFRQGKVRVLVCSDLLTRGIDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLG 323

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           +AIN ++ +D   L+ I++     ++ +PA +
Sbjct: 324 LAINLMSWNDRYNLYKIEQELGTEIKPIPATI 355



>gb:AC006605_1203307 Caenorhabditis elegans cosmid C07H6, complete
           sequence.
          Length = 430

 Score = 89.4 bits (220), Expect = 4e-17
 Identities = 44/92 (47%), Positives = 58/92 (63%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L+  D L RGID+Q V++VIN+D P   E YLHRIGRSGRFG  G
Sbjct: 319 RNRVFHDFRQGNCRNLVCSDLLTRGIDIQAVNVVINFDFPRNAETYLHRIGRSGRFGHLG 378

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           VAIN +T +D   L  I++     +E +P  V
Sbjct: 379 VAINLITYEDRHTLRRIEQELRTRIEPIPKTV 410



>gb:CP000027_79192 Dehalococcoides ethenogenes 195, complete genome.
          Length = 560

 Score = 89.4 bits (220), Expect = 4e-17
 Identities = 43/95 (45%), Positives = 60/95 (63%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R  +M  FR G  ++L+  D  ARG+D+  +S VINYD+P  PE+Y HRIGR+GRF R G
Sbjct: 278 RHAVMEGFRRGNFKILVATDIAARGLDIDHISHVINYDMPDTPEDYTHRIGRTGRFDRTG 337

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADF 307
            A++ VT  D  M+ DIQK  N  ++ L  +  D+
Sbjct: 338 QALSLVTGRDGDMVRDIQKLINSPIQRLRVDGFDY 372



>pir|H90136|H90136 RNA helicase [imported] - Guillardia theta
           nucleomorph>gb:AF083031_1766857 Guillardia theta
           nucleomorph chromosome 3, complete sequence.
          Length = 381

 Score = 89.4 bits (220), Expect = 4e-17
 Identities = 38/91 (41%), Positives = 62/91 (68%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ I  +FR G S++L++ D + RGID+  ++LV+N+DLP   E+YLHRIGR+GRFG+ G
Sbjct: 288 RNKIFHDFRIGKSKLLVSSDLITRGIDIPNINLVVNFDLPLSSESYLHRIGRTGRFGKHG 347

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPAN 319
           +AI+ +T+D+    F I+    + +  +  N
Sbjct: 348 IAISLITEDELETFFRIENELGIEIHPITNN 378



>sp|P46942|DB10_NICSY RNA helicase-like protein
           DB10.>pir|S42639|S42639 ATP-dependent RNA helicase DB10
           - wood tobacco>gb:TOBRDB10_1725530 Tobacco mRNA for RNA
           helicase like protein DB10.
          Length = 607

 Score = 89.4 bits (220), Expect = 4e-17
 Identities = 43/111 (38%), Positives = 64/111 (57%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD ++ +FR G S VL+  D  ARG+D++ + +VINYD PT  E+Y+HRIGR+GR G  G
Sbjct: 428 RDYVLSQFRAGRSPVLVATDVAARGLDIKDIRVVINYDFPTGIEDYVHRIGRTGRAGASG 487

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL*CGFCSGKKKGEWGS 259
           +A  F +  D +   D+ K      + +P  + D    G   G+ +  WGS
Sbjct: 488 LAYTFFSDQDSKHALDLVKVLEGANQCVPTELRDMASRGGGMGRARNHWGS 538



>gb:YLAJ11564_1727886 Yarrowia lipolytica DHH1 gene.
          Length = 523

 Score = 89.0 bits (219), Expect = 5e-17
 Identities = 42/92 (45%), Positives = 59/92 (64%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  EFR G  R L+  D L RGID+Q V++VIN+D P   E YLHRIGRSGRFG  G
Sbjct: 305 RNRVFHEFRNGTCRNLVCSDLLTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGRFGHLG 364

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           +AIN +  +D   L+ I++     ++ +PA +
Sbjct: 365 IAINLINWNDRYNLYKIEQELGTEIKPIPAQI 396



>gb:CR382132_1665823 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 522

 Score = 89.0 bits (219), Expect = 5e-17
 Identities = 42/92 (45%), Positives = 59/92 (64%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  EFR G  R L+  D L RGID+Q V++VIN+D P   E YLHRIGRSGRFG  G
Sbjct: 304 RNRVFHEFRNGTCRNLVCSDLLTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGRFGHLG 363

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           +AIN +  +D   L+ I++     ++ +PA +
Sbjct: 364 IAINLINWNDRYNLYKIEQELGTEIKPIPAQI 395



>pir|T51743|T51743 RNA helicase RH12 [imported] - Arabidopsis
           thaliana>gb:ATH010464_1551897 Arabidopsis thaliana mRNA
           for DEAD box RNA helicase, RH12.
          Length = 498

 Score = 89.0 bits (219), Expect = 5e-17
 Identities = 40/98 (40%), Positives = 62/98 (63%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  EFR G  R L+  D   RGID+Q V++VIN+D P   E+YLHR+GRSGRFG  G
Sbjct: 400 RNRVFHEFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPRTSESYLHRVGRSGRFGHLG 459

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL*C 298
           +A+N VT +D   ++  ++     ++ +P+N+   + C
Sbjct: 460 LAVNLVTYEDRFKMYQTEQELGTEIKPIPSNIDQAIYC 497



>pir|T47916|T47916 DEAD box RNA helicase RH12 - Arabidopsis
           thaliana>gb:ATT20K12_1554963 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T20K12.>gb:AY120712_1579594
           Arabidopsis thaliana DEAD box RNA helicase RH12
           (At3g61240) mRNA, complete cds.>gb:BT000038_1634316
           Arabidopsis thaliana DEAD box RNA helicase RH12
           (At3g61240) mRNA, complete cds.
          Length = 498

 Score = 89.0 bits (219), Expect = 5e-17
 Identities = 40/98 (40%), Positives = 62/98 (63%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  EFR G  R L+  D   RGID+Q V++VIN+D P   E+YLHR+GRSGRFG  G
Sbjct: 400 RNRVFHEFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPRTSESYLHRVGRSGRFGHLG 459

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL*C 298
           +A+N VT +D   ++  ++     ++ +P+N+   + C
Sbjct: 460 LAVNLVTYEDRFKMYQTEQELGTEIKPIPSNIDQAIYC 497



>gb:AJ720165_2502352 Gallus gallus mRNA for hypothetical protein,
           clone 11n24.
          Length = 483

 Score = 88.6 bits (218), Expect = 7e-17
 Identities = 42/92 (45%), Positives = 59/92 (64%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L+  D   RGID+Q V++VIN+D P   E YLHRIGRSGRFG  G
Sbjct: 373 RNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLG 432

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           +AIN +T DD   L  I++     ++ +P+N+
Sbjct: 433 LAINLITYDDRFNLKSIEEQLGTEIKPIPSNI 464



>gb:AB013609_2043770 Cavia porcellus mRNA for DEAD box protein,
           complete cds.
          Length = 472

 Score = 88.6 bits (218), Expect = 7e-17
 Identities = 42/92 (45%), Positives = 59/92 (64%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L+  D   RGID+Q V++VIN+D P   E YLHRIGRSGRFG  G
Sbjct: 362 RNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLG 421

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           +AIN +T DD   L  I++     ++ +P+N+
Sbjct: 422 LAINLITYDDRFNLKSIEEQLGTEIKPIPSNI 453



>gb:HUMRCK_2036239 Homo sapiens mRNA for RCK, complete cds.
          Length = 472

 Score = 88.6 bits (218), Expect = 7e-17
 Identities = 42/92 (45%), Positives = 59/92 (64%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L+  D   RGID+Q V++VIN+D P   E YLHRIGRSGRFG  G
Sbjct: 362 RNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLG 421

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           +AIN +T DD   L  I++     ++ +P+N+
Sbjct: 422 LAINLITYDDRFNLKSIEEQLGTEIKPIPSNI 453



>gb:AF399934_1268224 Spisula solidissima RNA helicase p47 mRNA,
           complete cds.
          Length = 449

 Score = 88.6 bits (218), Expect = 7e-17
 Identities = 41/92 (44%), Positives = 57/92 (61%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L+  D   RGID+Q V++VIN+D P   E YLHRIGRSGR+G  G
Sbjct: 329 RNRVFHDFRQGLCRNLVCSDLFTRGIDIQAVNVVINFDFPKHAETYLHRIGRSGRYGHLG 388

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           +AIN +T DD   L  I+      ++ +P N+
Sbjct: 389 IAINLITYDDRFSLHKIESELGTEIKPIPKNI 420



>pir|S22651|S22651 probable RNA helicase (EC 3.6.1.-) RCK -
           human>gb:BC065007_1986715 Homo sapiens DEAD
           (Asp-Glu-Ala-Asp) box polypeptide 6, mRNA (cDNA clone
           MGC:74611 IMAGE:6163439), complete cds.
          Length = 483

 Score = 88.6 bits (218), Expect = 7e-17
 Identities = 42/92 (45%), Positives = 59/92 (64%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L+  D   RGID+Q V++VIN+D P   E YLHRIGRSGRFG  G
Sbjct: 373 RNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLG 432

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           +AIN +T DD   L  I++     ++ +P+N+
Sbjct: 433 LAINLITYDDRFNLKSIEEQLGTEIKPIPSNI 464



>sp|P54823|DDX6_MOUSE Probable ATP-dependent RNA helicase p54
           (Oncogene RCK homolog) (DEAD- box protein
           6).>gb:BC021452_2093470 Mus musculus DEAD
           (Asp-Glu-Ala-Asp) box polypeptide 6, mRNA (cDNA clone
           MGC:29113 IMAGE:5043599), complete
           cds.>gb:MUSMRCK_2129227 Mus musculus mRNA for RCK,
           complete cds.
          Length = 483

 Score = 88.6 bits (218), Expect = 7e-17
 Identities = 42/92 (45%), Positives = 59/92 (64%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L+  D   RGID+Q V++VIN+D P   E YLHRIGRSGRFG  G
Sbjct: 373 RNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLG 432

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           +AIN +T DD   L  I++     ++ +P+N+
Sbjct: 433 LAINLITYDDRFNLKSIEEQLGTEIKPIPSNI 464



>sp|P26196|DDX6_HUMAN Probable ATP-dependent RNA helicase p54
           (Oncogene RCK) (DEAD-box protein 6).
          Length = 483

 Score = 88.6 bits (218), Expect = 7e-17
 Identities = 42/92 (45%), Positives = 59/92 (64%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L+  D   RGID+Q V++VIN+D P   E YLHRIGRSGRFG  G
Sbjct: 373 RNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLG 432

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           +AIN +T DD   L  I++     ++ +P+N+
Sbjct: 433 LAINLITYDDRFNLKSIEEQLGTEIKPIPSNI 464



>gb:AP004225_1838944 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1156H12.
          Length = 583

 Score = 88.2 bits (217), Expect = 9e-17
 Identities = 42/111 (37%), Positives = 64/111 (57%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ ++  FR G S +L+  D  ARG+D++ + +VINYD PT  E+Y+HRIGR+GR G  G
Sbjct: 224 REKVLSHFRSGRSPILVATDVAARGLDIKDIRVVINYDFPTGIEDYVHRIGRTGRAGATG 283

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL*CGFCSGKKKGEWGS 259
           VA  F    D +   D+ K      + +P ++AD    G   G+K+  W +
Sbjct: 284 VAYTFFCDQDSKYAADLIKILEGANQRVPRDLADMASRGGRGGRKRNRWAT 334



>gb:AP004225_1838943 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1156H12.
          Length = 792

 Score = 88.2 bits (217), Expect = 9e-17
 Identities = 42/111 (37%), Positives = 64/111 (57%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ ++  FR G S +L+  D  ARG+D++ + +VINYD PT  E+Y+HRIGR+GR G  G
Sbjct: 433 REKVLSHFRSGRSPILVATDVAARGLDIKDIRVVINYDFPTGIEDYVHRIGRTGRAGATG 492

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL*CGFCSGKKKGEWGS 259
           VA  F    D +   D+ K      + +P ++AD    G   G+K+  W +
Sbjct: 493 VAYTFFCDQDSKYAADLIKILEGANQRVPRDLADMASRGGRGGRKRNRWAT 543



>gb:CR382123_1656205 Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 514

 Score = 88.2 bits (217), Expect = 9e-17
 Identities = 42/92 (45%), Positives = 59/92 (64%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  EFR G  R L+  D L RGID+Q V++VIN+D P   E YLHRIGRSGRFG  G
Sbjct: 312 RNKVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLG 371

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           +AIN +  +D   L+ I++  N  +  +P+ +
Sbjct: 372 LAINLINWNDRFNLYKIEQELNTEIAPIPSQI 403



>gb:AY223366_1176826 Schistosoma japonicum clone ZZZ211 mRNA
           sequence.
          Length = 162

 Score = 88.2 bits (217), Expect = 9e-17
 Identities = 41/100 (41%), Positives = 69/100 (69%), Gaps = 6/100 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R+ ++++FR    RVLIT +  +RG+D+ QV+L+IN+++PT        E YLHRIGRSG
Sbjct: 61  REKVIQDFRSANFRVLITTNVCSRGLDIPQVNLIINWNMPTTKTGNADWETYLHRIGRSG 120

Query: 429 RFGRKGVAINFVTKDDDRMLFDIQKFYNVLVEELPANVAD 310
           RFG++GVA+NF+T ++  ++ +++  + + + EL A   D
Sbjct: 121 RFGKEGVAVNFITNEEMYLIKELESHFEIEIPELTAEDLD 160



>gb:AE014187_939029 Plasmodium falciparum 3D7 chromosome 14 complete
           sequence.>gb:AE014825_1228105 Plasmodium falciparum 3D7
           chromosome 14 section 10 of 13 of the complete sequence.
          Length = 741

 Score = 87.8 bits (216), Expect = 1e-16
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 18/106 (16%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLP------------------TQ 466
           RD +M +F+ G S+VLI  D L+RGIDV  +SLVIN+DLP                    
Sbjct: 620 RDTLMADFKKGISKVLICTDLLSRGIDVPSISLVINFDLPYIYQGRIGDTLNNTSNQRVN 679

Query: 465 PENYLHRIGRSGRFGRKGVAINFVTKDDDRMLFDIQKFYNVLVEEL 328
            E Y+HRIGR+GRFG KG+AINF++K+    +  I+++Y   + +L
Sbjct: 680 METYIHRIGRTGRFGTKGMAINFISKNQMSHIKQIEEYYKCSIADL 725



>gb:BC035388_1981561 Homo sapiens, DEAD/H (Asp-Glu-Ala-Asp/His) box
           polypeptide 25, clone IMAGE:5166189, mRNA, partial cds.
          Length = 482

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 46/100 (46%), Positives = 65/100 (65%), Gaps = 6/100 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  I++ FR G  +VLIT +  ARGIDV+QV++V+N+DLP +       E YLHRIGR+G
Sbjct: 376 RASIIQRFRDGKEKVLITTNVCARGIDVKQVTIVVNFDLPVKQGEEPDYETYLHRIGRTG 435

Query: 429 RFGRKGVAINFVTKDDDRMLFDIQKFYNVLVEELPANVAD 310
           RFG+KG+A N +  D+   L  IQ  +N  +++L A   D
Sbjct: 436 RFGKKGLAFNMIEVDELPSLMKIQDHFNSSIKQLNAEDMD 475



>gb:AY080837_1568530 Arabidopsis thaliana putative RNA helicase
           (At4g00660) mRNA, complete cds.>gb:AY113985_1578396
           Arabidopsis thaliana putative RNA helicase (At4g00660)
           mRNA, complete cds.
          Length = 505

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 39/98 (39%), Positives = 62/98 (63%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L+  D   RGID+Q V++VIN+D P   E YLHR+GRSGRFG  G
Sbjct: 407 RNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNAETYLHRVGRSGRFGHLG 466

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL*C 298
           +A+N +T +D   L+ I++     ++++P ++   + C
Sbjct: 467 LAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYC 504



>gb:AK054144_1170718 Mus musculus 2 days pregnant adult female
           oviduct cDNA, RIKEN full-length enriched library,
           clone:E230023J21 product:DEAD
           (aspartate-glutamate-alanine-aspartate) box polypeptide
           6, full insert sequence.
          Length = 483

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 41/92 (44%), Positives = 59/92 (64%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L+  D   RGID+Q V++V+N+D P   E YLHRIGRSGRFG  G
Sbjct: 373 RNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVMNFDFPKLAETYLHRIGRSGRFGHLG 432

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           +AIN +T DD   L  I++     ++ +P+N+
Sbjct: 433 LAINLITYDDRFNLKSIEEQLGTEIKPIPSNI 464



>pir|T01230|T01230 probable RNA helicase (EC 3.6.1.-) F6N23.6 -
           Arabidopsis thaliana>gb:ATCHRIV2_1544484 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           2.>gb:F6N23_1678531 Arabidopsis thaliana BAC F6N23.
          Length = 499

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 39/98 (39%), Positives = 62/98 (63%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L+  D   RGID+Q V++VIN+D P   E YLHR+GRSGRFG  G
Sbjct: 401 RNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNAETYLHRVGRSGRFGHLG 460

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL*C 298
           +A+N +T +D   L+ I++     ++++P ++   + C
Sbjct: 461 LAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYC 498



>pir|T51741|T51741 RNA helicase RH8 [imported] - Arabidopsis
           thaliana>gb:ATH010460_1551893 Arabidopsis thaliana mRNA
           for DEAD box RNA helicase, RH8.
          Length = 505

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 39/98 (39%), Positives = 62/98 (63%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L+  D   RGID+Q V++VIN+D P   E YLHR+GRSGRFG  G
Sbjct: 407 RNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKNAETYLHRVGRSGRFGHLG 466

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL*C 298
           +A+N +T +D   L+ I++     ++++P ++   + C
Sbjct: 467 LAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYC 504



>sp|Q9UHL0|DD25_HUMAN ATP-dependent RNA helicase DDX25 (DEAD-box
           protein 25) (Gonadotropin- regulated testicular RNA
           helicase).>gb:BC050360_1984298 Homo sapiens DEAD
           (Asp-Glu-Ala-Asp) box polypeptide 25, mRNA (cDNA clone
           MGC:51751 IMAGE:5742404), complete cds.
          Length = 483

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 46/100 (46%), Positives = 65/100 (65%), Gaps = 6/100 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  I++ FR G  +VLIT +  ARGIDV+QV++V+N+DLP +       E YLHRIGR+G
Sbjct: 377 RASIIQRFRDGKEKVLITTNVCARGIDVKQVTIVVNFDLPVKQGEEPDYETYLHRIGRTG 436

Query: 429 RFGRKGVAINFVTKDDDRMLFDIQKFYNVLVEELPANVAD 310
           RFG+KG+A N +  D+   L  IQ  +N  +++L A   D
Sbjct: 437 RFGKKGLAFNMIEVDELPSLMKIQDHFNSSIKQLNAEDMD 476



>gb:AE017341_1754546 Cryptococcus neoformans var. neoformans JEC21
           chromosome 1, complete sequence.
          Length = 430

 Score = 87.0 bits (214), Expect = 2e-16
 Identities = 41/88 (46%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = -1

Query: 576 REFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINF 397
           ++F+    R+L+  D   RGIDV++V++VINYD P+  ++YLHR+GR+GRFG KG+AI+F
Sbjct: 335 QQFKAFEKRILVATDIFGRGIDVERVNVVINYDAPSDADSYLHRVGRAGRFGTKGLAISF 394

Query: 396 VTKD-DDRMLFDIQKFYNVLVEELPANV 316
           V+ D D  +L  IQ+ + V +  LP  V
Sbjct: 395 VSSDADQEVLQRIQERFTVAIPTLPETV 422



>gb:AE017341_1754545 Cryptococcus neoformans var. neoformans JEC21
           chromosome 1, complete sequence.
          Length = 442

 Score = 87.0 bits (214), Expect = 2e-16
 Identities = 41/88 (46%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = -1

Query: 576 REFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINF 397
           ++F+    R+L+  D   RGIDV++V++VINYD P+  ++YLHR+GR+GRFG KG+AI+F
Sbjct: 347 QQFKAFEKRILVATDIFGRGIDVERVNVVINYDAPSDADSYLHRVGRAGRFGTKGLAISF 406

Query: 396 VTKD-DDRMLFDIQKFYNVLVEELPANV 316
           V+ D D  +L  IQ+ + V +  LP  V
Sbjct: 407 VSSDADQEVLQRIQERFTVAIPTLPETV 434



>gb:AE016816_1746887 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome III, complete sequence.
          Length = 484

 Score = 87.0 bits (214), Expect = 2e-16
 Identities = 42/92 (45%), Positives = 58/92 (63%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  EFR G  R L+  D L RGID+Q V++VIN+D P   E YLHRIGRSGRFG  G
Sbjct: 305 RNKVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLG 364

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           +AIN +  +D   L+ I++     +  +PA +
Sbjct: 365 LAINLINWNDRFNLYKIEQELGTEIAAIPAQI 396



>gb:D89270_1675387 Schizosaccharomyces pombe mRNA, partial cds,
           clone: SY 1777.
          Length = 339

 Score = 87.0 bits (214), Expect = 2e-16
 Identities = 37/80 (46%), Positives = 58/80 (72%), Gaps = 1/80 (1%)
 Frame = -1

Query: 552 RVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDDRM 373
           R+ +  D   RGID+++V++VINYD+P  P++YLHR+GR+GRFG KG+AI F + ++D  
Sbjct: 252 RICVATDVFGRGIDIERVNIVINYDMPDSPDSYLHRVGRAGRFGTKGLAITFSSSEEDSQ 311

Query: 372 LFD-IQKFYNVLVEELPANV 316
           + D IQ+ + V + ELP  +
Sbjct: 312 ILDKIQERFEVNITELPDEI 331



>gb:CR382138_1670944 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 362

 Score = 87.0 bits (214), Expect = 2e-16
 Identities = 39/90 (43%), Positives = 61/90 (67%), Gaps = 1/90 (1%)
 Frame = -1

Query: 576 REFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINF 397
           + F+    R+ ++ D   RGID+++++L INYDLP + + YLHR+GR+GRFG KG+A++ 
Sbjct: 266 KSFKEFNKRICVSTDVFGRGIDIERINLAINYDLPNEADQYLHRVGRAGRFGTKGLAVSL 325

Query: 396 V-TKDDDRMLFDIQKFYNVLVEELPANVAD 310
           V TKDD+ +L  IQ  ++V + E P    D
Sbjct: 326 VSTKDDEEVLEKIQSRFDVKITEFPEEGVD 355



>gb:CNS07EGI_1374506 chromosome IX of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 425

 Score = 87.0 bits (214), Expect = 2e-16
 Identities = 43/93 (46%), Positives = 64/93 (68%), Gaps = 2/93 (2%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPT--QPENYLHRIGRSGRFGR 418
           R+  +  FR G  R LI+   L+RGID+Q +S+V   D+P+  +   Y+HRIGRSGR+GR
Sbjct: 329 RERTLNRFRGGTGRCLISSGLLSRGIDIQNLSVVFCLDVPSFERKSTYIHRIGRSGRYGR 388

Query: 417 KGVAINFVTKDDDRMLFDIQKFYNVLVEELPAN 319
           KG+AIN V + + + L  I++FYN  ++ELPA+
Sbjct: 389 KGIAINIVYEHELKNLKAIERFYNTTIKELPAD 421



>pir|T37846|T37846 probable ATP-dependent RNA helicase - fission
           yeast  (Schizosaccharomyces pombe)>gb:SPAC17G6_1716759
           S.pombe chromosome I cosmid c17G6.
          Length = 434

 Score = 87.0 bits (214), Expect = 2e-16
 Identities = 37/80 (46%), Positives = 58/80 (72%), Gaps = 1/80 (1%)
 Frame = -1

Query: 552 RVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDDRM 373
           R+ +  D   RGID+++V++VINYD+P  P++YLHR+GR+GRFG KG+AI F + ++D  
Sbjct: 347 RICVATDVFGRGIDIERVNIVINYDMPDSPDSYLHRVGRAGRFGTKGLAITFSSSEEDSQ 406

Query: 372 LFD-IQKFYNVLVEELPANV 316
           + D IQ+ + V + ELP  +
Sbjct: 407 ILDKIQERFEVNITELPDEI 426



>pir|T43199|T43199 probable nuclear RNA helicase (DEAD family) -
           fission yeast  (Schizosaccharomyces pombe) (fragment)
          Length = 339

 Score = 87.0 bits (214), Expect = 2e-16
 Identities = 37/80 (46%), Positives = 58/80 (72%), Gaps = 1/80 (1%)
 Frame = -1

Query: 552 RVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDDRM 373
           R+ +  D   RGID+++V++VINYD+P  P++YLHR+GR+GRFG KG+AI F + ++D  
Sbjct: 252 RICVATDVFGRGIDIERVNIVINYDMPDSPDSYLHRVGRAGRFGTKGLAITFSSSEEDSQ 311

Query: 372 LFD-IQKFYNVLVEELPANV 316
           + D IQ+ + V + ELP  +
Sbjct: 312 ILDKIQERFEVNITELPDEI 331



>sp|P39517|DHH1_YEAST Putative ATP-dependent RNA helicase
           DHH1.>pir|S31229|S31229 probable RNA helicase (EC
           3.6.1.-) DHH1 - yeast  (Saccharomyces
           cerevisiae)>gb:SC41KCIV_1705246 S.cerevisiae DNA (cosmid
           31A2; chromosome IV; 41 kb).>gb:SCRNAH_1709362
           S.cerevisiae gene for RNA-helicase.>gb:SCYDL160C_1711734
           S.cerevisiae chromosome IV reading frame ORF YDL160c.
          Length = 506

 Score = 87.0 bits (214), Expect = 2e-16
 Identities = 42/92 (45%), Positives = 58/92 (63%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  EFR G  R L+  D L RGID+Q V++VIN+D P   E YLHRIGRSGRFG  G
Sbjct: 322 RNKVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLG 381

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           +AIN +  +D   L+ I++     +  +PA +
Sbjct: 382 LAINLINWNDRFNLYKIEQELGTEIAAIPATI 413



>sp|O61305|DB80_DROME DEAD-box helicase Dbp80.>gb:AF005239_1231200
           Drosophila melanogaster DEAD-box helicase (Dbp80) mRNA,
           complete cds.
          Length = 460

 Score = 87.0 bits (214), Expect = 2e-16
 Identities = 43/98 (43%), Positives = 65/98 (66%), Gaps = 7/98 (7%)
 Frame = -1

Query: 582 IMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLP------TQPENYLHRIGRSGRFG 421
           ++  FR G  +VLIT + L+RGID++Q+ +V+N+DLP         E YLHRIGR+GRFG
Sbjct: 356 VLDRFRSGLEKVLITTNILSRGIDIEQLQVVVNFDLPVDLDGMADCETYLHRIGRTGRFG 415

Query: 420 RKGVAINFVTKDDD-RMLFDIQKFYNVLVEELPANVAD 310
           + G+AIN +T +   ++  DI+K +N  +E L  + AD
Sbjct: 416 KSGIAINLITDEKTMKVCSDIEKHFNKKIEVLNTDSAD 453



>gb:AF155140_1886636 Homo sapiens gonadotropin-regulated testicular
           RNA helicase mRNA, complete cds.>gb:AY735301S1_1960704
           Homo sapiens gonadotropin-regulated testicular RNA
           helicase-GRTH/DDX25 gene, complete cds; and exon 12.
          Length = 483

 Score = 86.7 bits (213), Expect = 3e-16
 Identities = 46/100 (46%), Positives = 64/100 (64%), Gaps = 6/100 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  I + FR G  +VLIT +  ARGIDV+QV++V+N+DLP +       E YLHRIGR+G
Sbjct: 377 RASITQRFRDGKEKVLITTNVCARGIDVKQVTIVVNFDLPVKQGEEPDYETYLHRIGRTG 436

Query: 429 RFGRKGVAINFVTKDDDRMLFDIQKFYNVLVEELPANVAD 310
           RFG+KG+A N +  D+   L  IQ  +N  +++L A   D
Sbjct: 437 RFGKKGLAFNMIEVDELPSLMKIQDHFNSSIKQLNAEDMD 476



>gb:AE017343_1755891 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 625

 Score = 86.7 bits (213), Expect = 3e-16
 Identities = 41/90 (45%), Positives = 59/90 (65%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G +R L+  D L RGID+Q V++VIN+D P   E+YLHRIGRSGRFG  G
Sbjct: 313 RNRVFHDFRNGMTRNLVCSDLLTRGIDIQAVNVVINFDFPRTAESYLHRIGRSGRFGHLG 372

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPA 322
           +AI+ +T +D   L+ I+      +  +PA
Sbjct: 373 LAISLLTLEDRHNLYRIESELGTEIAPIPA 402



>gb:CR380958_1653504 Candida glabrata strain CBS138 chromosome L
           complete sequence.
          Length = 504

 Score = 86.7 bits (213), Expect = 3e-16
 Identities = 47/88 (53%), Positives = 62/88 (70%), Gaps = 7/88 (7%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPE------NYLHRIGRSG 430
           RD ++ +FR G S+VLIT + LARGID+  VS+V+NYDLPT P        Y+HRIGR+G
Sbjct: 391 RDRLIDDFREGRSKVLITTNVLARGIDIPSVSMVVNYDLPTLPNGMPDYATYVHRIGRTG 450

Query: 429 RFGRKGVAINFV-TKDDDRMLFDIQKFY 349
           RFGR GVAI+FV  K   ++L  IQ ++
Sbjct: 451 RFGRTGVAISFVHDKKSFKILSAIQDYF 478



>gb:BX842646_823349 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 1/11.
          Length = 412

 Score = 86.7 bits (213), Expect = 3e-16
 Identities = 40/92 (43%), Positives = 61/92 (66%)
 Frame = -1

Query: 582 IMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAI 403
           +M+ FR G  ++LI  D  ARGID+  V+ VINYDLP +PENY+HRIGR+GR   KGVA+
Sbjct: 287 VMKTFRKGDCKILIATDLSARGIDIPDVTHVINYDLPEKPENYVHRIGRTGRGFNKGVAV 346

Query: 402 NFVTKDDDRMLFDIQKFYNVLVEELPANVADF 307
           +F + ++  +L +++      +E L  +  D+
Sbjct: 347 SFCSTEEKPLLAEVESLITKKIEVLKVSKQDY 378



>pir|C97238|C97238 ATP dependent RNA helicase DeaD, superfamily II
           [imported] - Clostridium
           acetobutylicum>gb:AE007772_230055 Clostridium
           acetobutylicum ATCC 824 section 260 of 356 of the
           complete genome.>gb:AE001437_1093010 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 481

 Score = 86.7 bits (213), Expect = 3e-16
 Identities = 42/90 (46%), Positives = 63/90 (70%), Gaps = 1/90 (1%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R  +M  F+ G    LI  D  ARGIDV+ V+ VINYD+P + E+Y+HRIGR+GR G KG
Sbjct: 281 RIAVMNAFKRGEFTFLIATDVAARGIDVENVTHVINYDIPMEKESYIHRIGRTGRMGNKG 340

Query: 411 VAINFVTKDDDRMLFDIQKFYNV-LVEELP 325
           +AI FVT  ++R L +I++ +++ +++E P
Sbjct: 341 IAITFVTSKEERFLKEIEEQFSLEIIKEEP 370



>sp|P54824|DDX6_XENLA ATP-dependent RNA helicase p54
           (Xp54).>gb:XLRNAP54H_2583102 X.laevis mRNA for RNA
           helicase p54.
          Length = 481

 Score = 86.7 bits (213), Expect = 3e-16
 Identities = 41/92 (44%), Positives = 59/92 (64%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L+  D   RGID+Q V++VIN+D P   E YLHRIGRSGRFG  G
Sbjct: 372 RNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLG 431

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           +AIN +T DD   L  I++     ++ +P+++
Sbjct: 432 LAINLITYDDRFNLKSIEEQLGTEIKPIPSSI 463



>gb:AF038995_2051892 Mus musculus putative RNA helicase RCK mRNA,
           partial cds.
          Length = 453

 Score = 86.3 bits (212), Expect = 3e-16
 Identities = 40/92 (43%), Positives = 58/92 (63%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +F  G  R L+  D   RGID+Q V++VIN+D P   E YLHR+GRSGRFG  G
Sbjct: 348 RNRVFHDFENGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRVGRSGRFGHLG 407

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           +AIN +T DD   L  I++     ++ +P+N+
Sbjct: 408 LAINLITYDDRFNLKSIEEQLGTEIKPIPSNI 439



>gb:DROHELI_1382110 D.melanogaster RNA helicase mRNA, complete cds.
          Length = 459

 Score = 86.3 bits (212), Expect = 3e-16
 Identities = 42/89 (47%), Positives = 56/89 (62%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L+  D   RGIDVQ V++VIN+D P   E YLHRIGRSGRFG  G
Sbjct: 334 RNRVFHDFRQGLCRNLVCSDLFTRGIDVQAVNVVINFDFPRMAETYLHRIGRSGRFGHLG 393

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELP 325
           +AIN +T +D   L  I+K     ++ +P
Sbjct: 394 IAINLITYEDRFDLHRIEKELGTEIKPIP 422



>gb:AE014134_1128513 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003628_1218620 Drosophila melanogaster
           chromosome 2L, section 37 of 83 of the complete
           sequence.
          Length = 428

 Score = 86.3 bits (212), Expect = 3e-16
 Identities = 42/89 (47%), Positives = 56/89 (62%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L+  D   RGIDVQ V++VIN+D P   E YLHRIGRSGRFG  G
Sbjct: 303 RNRVFHDFRQGLCRNLVCSDLFTRGIDVQAVNVVINFDFPRMAETYLHRIGRSGRFGHLG 362

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELP 325
           +AIN +T +D   L  I+K     ++ +P
Sbjct: 363 IAINLITYEDRFDLHRIEKELGTEIKPIP 391



>pir|G71614|G71614 eIF-4A-like DEAD family RNA helicase PFB0445c -
           malaria parasite (Plasmodium
           falciparum)>gb:AE001362_939330 Plasmodium falciparum 3D7
           chromosome 2 complete sequence.>gb:AE001395_1208641
           Plasmodium falciparum 3D7 chromosome 2 section 32 of 73
           of the complete sequence.
          Length = 457

 Score = 86.3 bits (212), Expect = 3e-16
 Identities = 35/81 (43%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = -1

Query: 555 SRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDDR 376
           +R+L++ D   RGID+++V++VINYD+P   ++YLHR+GR+GRFG KG+A+ FV+  +D 
Sbjct: 369 NRILVSTDLFGRGIDIERVNIVINYDMPENSDSYLHRVGRAGRFGTKGLAVTFVSSQEDT 428

Query: 375 M-LFDIQKFYNVLVEELPANV 316
           + L ++Q  + V + E+P  +
Sbjct: 429 LALNEVQTRFEVAISEMPNKI 449



>pir|A39157|A39157 probable RNA helicase (EC 3.6.1.-) - fruit fly
           (Drosophila melanogaster) (fragment)
          Length = 369

 Score = 86.3 bits (212), Expect = 3e-16
 Identities = 42/89 (47%), Positives = 56/89 (62%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L+  D   RGIDVQ V++VIN+D P   E YLHRIGRSGRFG  G
Sbjct: 272 RNRVFHDFRQGLCRNLVCSDLFTRGIDVQAVNVVINFDFPRMAETYLHRIGRSGRFGHLG 331

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELP 325
           +AIN +T +D   L  I+K     ++ +P
Sbjct: 332 IAINLITYEDRFDLHRIEKELGTEIKPIP 360



>sp|P23128|ME31_DROME Putative ATP-dependent RNA helicase me31b
           (Maternal expression at 31B).>gb:AE014134_1128512
           Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003628_1218619 Drosophila melanogaster
           chromosome 2L, section 37 of 83 of the complete
           sequence.>gb:AY051663_1290257 Drosophila melanogaster
           LD21247 full length cDNA.
          Length = 459

 Score = 86.3 bits (212), Expect = 3e-16
 Identities = 42/89 (47%), Positives = 56/89 (62%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L+  D   RGIDVQ V++VIN+D P   E YLHRIGRSGRFG  G
Sbjct: 334 RNRVFHDFRQGLCRNLVCSDLFTRGIDVQAVNVVINFDFPRMAETYLHRIGRSGRFGHLG 393

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELP 325
           +AIN +T +D   L  I+K     ++ +P
Sbjct: 394 IAINLITYEDRFDLHRIEKELGTEIKPIP 422



>gb:AE016817_1747644 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 438

 Score = 85.9 bits (211), Expect = 4e-16
 Identities = 37/82 (45%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = -1

Query: 552 RVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFV-TKDDDR 376
           R+ ++ D   RGID+++++L INYD+P++ + YLHR+GR+GRFG KG+AI+ V +KDD+ 
Sbjct: 350 RICVSTDVFGRGIDIERINLAINYDMPSEADQYLHRVGRAGRFGTKGLAISLVSSKDDEE 409

Query: 375 MLFDIQKFYNVLVEELPANVAD 310
           +L  IQ+ ++V + E P    D
Sbjct: 410 VLAKIQERFDVKITEFPEEGVD 431



>gb:CR382127_1659975 Yarrowia lipolytica chromosome A of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 377

 Score = 85.9 bits (211), Expect = 4e-16
 Identities = 40/90 (44%), Positives = 61/90 (67%), Gaps = 1/90 (1%)
 Frame = -1

Query: 576 REFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINF 397
           +EF+    R+ ++ D   RGID+++++L INYDLP + + YLHR+GR+GRFG KG+AI+F
Sbjct: 281 KEFKEFKKRICVSTDVFGRGIDIERINLAINYDLPAEADQYLHRVGRAGRFGTKGLAISF 340

Query: 396 V-TKDDDRMLFDIQKFYNVLVEELPANVAD 310
           V T +D  +L  IQ+ + V +   PA   D
Sbjct: 341 VSTPEDKEVLAKIQERFEVNIAPYPAEGVD 370



>gb:CR380955_1651662 Candida glabrata strain CBS138 chromosome I
           complete sequence.
          Length = 507

 Score = 85.9 bits (211), Expect = 4e-16
 Identities = 41/92 (44%), Positives = 58/92 (63%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L+  D L RGID+Q V++VIN+D P   E YLHRIGRSGRFG  G
Sbjct: 307 RNKVFHDFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLG 366

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           +AIN +  +D   L+ I++     +  +PA +
Sbjct: 367 LAINLINWNDRFNLYKIEQELGTEIAAIPATI 398



>gb:AX716945_1473722 Sequence 56 from Patent WO03020757.
          Length = 437

 Score = 85.9 bits (211), Expect = 4e-16
 Identities = 37/82 (45%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = -1

Query: 552 RVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFV-TKDDDR 376
           R+ ++ D   RGID+++++L INYD+P++ + YLHR+GR+GRFG KG+AI+ V +KDD+ 
Sbjct: 350 RICVSTDVFGRGIDIERINLAINYDMPSEADQYLHRVGRAGRFGTKGLAISLVSSKDDEE 409

Query: 375 MLFDIQKFYNVLVEELPANVAD 310
           +L  IQ+ ++V + E P    D
Sbjct: 410 VLAKIQERFDVKITEFPEEGVD 431



>gb:CR857097_1181350 Pongo pygmaeus mRNA; cDNA DKFZp469I1738 (from
           clone DKFZp469I1738).
          Length = 483

 Score = 85.9 bits (211), Expect = 4e-16
 Identities = 41/92 (44%), Positives = 58/92 (63%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L+  D   RGID+Q V++VIN+D P   E YLHRIG SGRFG  G
Sbjct: 373 RNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGGSGRFGHLG 432

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           +AIN +T DD   L  I++     ++ +P+N+
Sbjct: 433 LAINLITYDDRFNLKSIEEQLGTEIKPIPSNI 464



>gb:BC078791_2106950 Rattus norvegicus DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 25, mRNA (cDNA clone MGC:93350
           IMAGE:7112991), complete cds.
          Length = 483

 Score = 85.5 bits (210), Expect = 6e-16
 Identities = 44/94 (46%), Positives = 62/94 (65%), Gaps = 6/94 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  I++ FR G  +VLIT +  ARGIDV+QV++V+N+DLP         E YLHRIGR+G
Sbjct: 377 RASIIQRFRDGKEKVLITTNVCARGIDVKQVTIVVNFDLPVNQSEEPDYETYLHRIGRTG 436

Query: 429 RFGRKGVAINFVTKDDDRMLFDIQKFYNVLVEEL 328
           RFG+KG+A N +  D   +L  IQ  +N  +++L
Sbjct: 437 RFGKKGLAFNMIEVDKLPLLMKIQDHFNSSIKQL 470



>gb:AP004133_1838092 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1112_G03.
          Length = 483

 Score = 85.5 bits (210), Expect = 6e-16
 Identities = 39/98 (39%), Positives = 60/98 (61%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L+  D   RGID+Q V++VIN+D P   E YLHR+GRSGRFG  G
Sbjct: 385 RNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKTAETYLHRVGRSGRFGHLG 444

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL*C 298
           +A+N +T +D   L+ I++     ++ +P  +   + C
Sbjct: 445 LAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDQAIYC 482



>gb:AP004133_1838091 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1112_G03.
          Length = 508

 Score = 85.5 bits (210), Expect = 6e-16
 Identities = 39/98 (39%), Positives = 60/98 (61%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L+  D   RGID+Q V++VIN+D P   E YLHR+GRSGRFG  G
Sbjct: 410 RNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKTAETYLHRVGRSGRFGHLG 469

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL*C 298
           +A+N +T +D   L+ I++     ++ +P  +   + C
Sbjct: 470 LAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDQAIYC 507



>sp|Q09181|ST13_SCHPO Putative ATP-dependent RNA helicase
           ste13.>pir|S46654|S46654 probable ATP-dependent RNA
           helicase ste13p - fission yeast  (Schizosaccharomyces
           pombe)>gb:SPBC776_1720412 S.pombe chromosome II cosmid
           c776.>gb:YSPSTE13_1731232 Yeast ste13+ gene for RNA
           helicase, complete cds.
          Length = 485

 Score = 85.5 bits (210), Expect = 6e-16
 Identities = 40/92 (43%), Positives = 59/92 (64%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +   FR G  R L+  D L RGID+Q V++VIN+D P   E YLHRIGRSGRFG +G
Sbjct: 320 RNRVFHNFRNGVCRNLVCSDLLTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGRFGHRG 379

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           +AI+F++  D   L+ I+      ++ +P ++
Sbjct: 380 LAISFISWADRFNLYRIENELGTEIQPIPPSI 411



>sp|Q9QY16|DD25_RAT ATP-dependent RNA helicase DDX25 (DEAD-box
           protein 25) (Gonadotropin- regulated testicular RNA
           helicase).>gb:AF142629_2056169 Rattus norvegicus
           gonadotropin-regulated testicular RNA helicase mRNA,
           complete cds.
          Length = 483

 Score = 85.5 bits (210), Expect = 6e-16
 Identities = 44/94 (46%), Positives = 62/94 (65%), Gaps = 6/94 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  I++ FR G  +VLIT +  ARGIDV+QV++V+N+DLP         E YLHRIGR+G
Sbjct: 377 RASIIQRFRDGKEKVLITTNVCARGIDVKQVTIVVNFDLPVNQSEEPDYETYLHRIGRTG 436

Query: 429 RFGRKGVAINFVTKDDDRMLFDIQKFYNVLVEEL 328
           RFG+KG+A N +  D   +L  IQ  +N  +++L
Sbjct: 437 RFGKKGLAFNMIEVDKLPLLMKIQDHFNSSIKQL 470



>gb:OSJN00204_1696668 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0039L24, complete sequence.
          Length = 498

 Score = 85.1 bits (209), Expect = 8e-16
 Identities = 39/98 (39%), Positives = 60/98 (61%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L+  D   RGID+Q V++VIN+D P   E YLHR+GRSGRFG  G
Sbjct: 400 RNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKSAETYLHRVGRSGRFGHLG 459

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL*C 298
           +A+N +T +D   L+ I++     ++ +P  +   + C
Sbjct: 460 LAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDRAIYC 497



>gb:PFMAL3P7_1394581 Plasmodium falciparum MAL3P7, complete
           sequence.
          Length = 433

 Score = 85.1 bits (209), Expect = 8e-16
 Identities = 39/92 (42%), Positives = 58/92 (63%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L++ D   RGID+Q V++VIN+D P   E YLHRIGRSGR+G  G
Sbjct: 336 RNRVFHDFRNGACRCLVSSDLFTRGIDIQSVNVVINFDFPKNSETYLHRIGRSGRYGHLG 395

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           +AIN +T +D   L+ I+      ++ +P  +
Sbjct: 396 LAINLITFEDRFNLYKIEVELGTEIQPIPNEI 427



>gb:AK050693_1169432 Mus musculus 9 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:D030005A14
           product:DEAD (aspartate-glutamate-alanine-aspartate) box
           polypeptide 25 (GONADOTROPIN-REGULATED TESTICULAR RNA
           HELICASE), full insert sequence.>gb:AK078340_1172278 Mus
           musculus 10 days neonate cerebellum cDNA, RIKEN
           full-length enriched library, clone:6530402H01
           product:DEAD (aspartate-glutamate-alanine-aspartate) box
           polypeptide 25 (GONADOTROPIN-REGULATED TESTICULAR RNA
           HELICASE), full insert sequence.
          Length = 369

 Score = 85.1 bits (209), Expect = 8e-16
 Identities = 44/94 (46%), Positives = 62/94 (65%), Gaps = 6/94 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  I++ FR G  +VLIT +  ARGIDV+QV++V+N+DLP         E YLHRIGR+G
Sbjct: 263 RASIIQRFRDGKEKVLITTNVCARGIDVKQVTIVVNFDLPVNQSEEPDYETYLHRIGRTG 322

Query: 429 RFGRKGVAINFVTKDDDRMLFDIQKFYNVLVEEL 328
           RFG+KG+A N +  D   +L  IQ  +N  +++L
Sbjct: 323 RFGKKGLAFNMIEVDKLPLLMKIQDHFNSNIKQL 356



>sp|Q89AF9|DEAD_BUCBP Cold-shock DEAD-box protein A homolog
           (ATP-dependent RNA helicase deaD
           homolog).>gb:AE014017_302740 Buchnera aphidicola str. Bp
           (Baizongia pistaciae), section 2 of 2 of the complete
           genome.>gb:AE016826_981341 Buchnera aphidicola str. Bp
           (Baizongia pistaciae), complete genome.
          Length = 602

 Score = 85.1 bits (209), Expect = 8e-16
 Identities = 41/96 (42%), Positives = 63/96 (65%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+  + + + G   +LI  D  ARG+DV ++S VINYD+P   E+Y+HRIGR+GR GRKG
Sbjct: 283 REQTLEKLKDGRLDILIATDVAARGLDVDRISFVINYDIPMDSESYVHRIGRTGRAGRKG 342

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL 304
            A+ FV   + R+L +I++  N+ + E+    +DFL
Sbjct: 343 KALLFVENRERRLLRNIERAMNISISEVNLPKSDFL 378



>sp|Q9QY15|DD25_MOUSE ATP-dependent RNA helicase DDX25 (DEAD-box
           protein 25) (Gonadotropin- regulated testicular RNA
           helicase).>gb:AF142630_2056170 Mus musculus
           gonadotropin-regulated testicular RNA helicase mRNA,
           complete cds.>gb:AY380080S1_2084405 Mus musculus DDX25
           (Ddx25) gene, exon 12 and complete
           cds.>gb:BC061130_2104345 Mus musculus DEAD
           (Asp-Glu-Ala-Asp) box polypeptide 25, mRNA (cDNA clone
           MGC:74260 IMAGE:6774579), complete cds.
          Length = 484

 Score = 85.1 bits (209), Expect = 8e-16
 Identities = 44/94 (46%), Positives = 62/94 (65%), Gaps = 6/94 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  I++ FR G  +VLIT +  ARGIDV+QV++V+N+DLP         E YLHRIGR+G
Sbjct: 378 RASIIQRFRDGKEKVLITTNVCARGIDVKQVTIVVNFDLPVNQSEEPDYETYLHRIGRTG 437

Query: 429 RFGRKGVAINFVTKDDDRMLFDIQKFYNVLVEEL 328
           RFG+KG+A N +  D   +L  IQ  +N  +++L
Sbjct: 438 RFGKKGLAFNMIEVDKLPLLMKIQDHFNSNIKQL 471



>gb:BC079094_2107227 Rattus norvegicus cDNA clone MGC:94068
           IMAGE:7123989, complete cds.
          Length = 478

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 46/101 (45%), Positives = 65/101 (64%), Gaps = 7/101 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  ++  FR G  +VL+T +  ARGIDV+QVS+VIN+DLP         E YLHRIGR+G
Sbjct: 371 RAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG 430

Query: 429 RFGRKGVAINFV-TKDDDRMLFDIQKFYNVLVEELPANVAD 310
           RFG++G+A+N V +K    +L  IQ+ +N  +E L  +  D
Sbjct: 431 RFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLD 471



>gb:BC025594_2095092 Mus musculus DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 19b, mRNA (cDNA clone MGC:36422
           IMAGE:5342859), complete cds.
          Length = 479

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 46/101 (45%), Positives = 65/101 (64%), Gaps = 7/101 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  ++  FR G  +VL+T +  ARGIDV+QVS+VIN+DLP         E YLHRIGR+G
Sbjct: 372 RAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG 431

Query: 429 RFGRKGVAINFV-TKDDDRMLFDIQKFYNVLVEELPANVAD 310
           RFG++G+A+N V +K    +L  IQ+ +N  +E L  +  D
Sbjct: 432 RFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLD 472



>gb:AY751756_2088403 Rattus norvegicus zinc responsive protein Zd10A
           mRNA, complete cds, alternatively spliced.
          Length = 482

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 46/101 (45%), Positives = 65/101 (64%), Gaps = 7/101 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  ++  FR G  +VL+T +  ARGIDV+QVS+VIN+DLP         E YLHRIGR+G
Sbjct: 375 RAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG 434

Query: 429 RFGRKGVAINFV-TKDDDRMLFDIQKFYNVLVEELPANVAD 310
           RFG++G+A+N V +K    +L  IQ+ +N  +E L  +  D
Sbjct: 435 RFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLD 475



>gb:AY303540_2081902 Rattus norvegicus zinc responsive protein ZD10B
           mRNA, complete cds, alternatively spliced.
          Length = 482

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 46/101 (45%), Positives = 65/101 (64%), Gaps = 7/101 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  ++  FR G  +VL+T +  ARGIDV+QVS+VIN+DLP         E YLHRIGR+G
Sbjct: 375 RAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG 434

Query: 429 RFGRKGVAINFV-TKDDDRMLFDIQKFYNVLVEELPANVAD 310
           RFG++G+A+N V +K    +L  IQ+ +N  +E L  +  D
Sbjct: 435 RFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLD 475



>gb:CR533509_1993714 Homo sapiens full open reading frame cDNA clone
           RZPDo834A0919D for gene DDX19, DEAD (Asp-Glu-Ala-As) box
           polypeptide 19; complete cds, incl. stopcodon.
          Length = 448

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 46/101 (45%), Positives = 65/101 (64%), Gaps = 7/101 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  ++  FR G  +VL+T +  ARGIDV+QVS+VIN+DLP         E YLHRIGR+G
Sbjct: 341 RAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG 400

Query: 429 RFGRKGVAINFV-TKDDDRMLFDIQKFYNVLVEELPANVAD 310
           RFG++G+A+N V +K    +L  IQ+ +N  +E L  +  D
Sbjct: 401 RFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLD 441



>gb:CR457215_1993422 Homo sapiens full open reading frame cDNA clone
           RZPDo834G0312D for gene DDX19, DEAD (Asp-Glu-Ala-As) box
           polypeptide 19; complete cds, incl. stopcodon.
          Length = 479

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 46/101 (45%), Positives = 65/101 (64%), Gaps = 7/101 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  ++  FR G  +VL+T +  ARGIDV+QVS+VIN+DLP         E YLHRIGR+G
Sbjct: 372 RAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG 431

Query: 429 RFGRKGVAINFV-TKDDDRMLFDIQKFYNVLVEELPANVAD 310
           RFG++G+A+N V +K    +L  IQ+ +N  +E L  +  D
Sbjct: 432 RFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLD 472



>gb:AF353720_1898762 Homo sapiens testicular DEAD-box helicase
           protein (TDBP) mRNA, complete cds.>gb:BC010008_1972420
           Homo sapiens DEAD (Asp-Glu-Ala-As) box polypeptide 19,
           mRNA (cDNA clone MGC:15082 IMAGE:4298615), complete cds.
          Length = 370

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 46/101 (45%), Positives = 65/101 (64%), Gaps = 7/101 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  ++  FR G  +VL+T +  ARGIDV+QVS+VIN+DLP         E YLHRIGR+G
Sbjct: 263 RAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG 322

Query: 429 RFGRKGVAINFV-TKDDDRMLFDIQKFYNVLVEELPANVAD 310
           RFG++G+A+N V +K    +L  IQ+ +N  +E L  +  D
Sbjct: 323 RFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLD 363



>gb:AF183422_1888524 Homo sapiens RNA helicase mRNA, complete cds.
          Length = 478

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 46/101 (45%), Positives = 65/101 (64%), Gaps = 7/101 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  ++  FR G  +VL+T +  ARGIDV+QVS+VIN+DLP         E YLHRIGR+G
Sbjct: 371 RAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG 430

Query: 429 RFGRKGVAINFV-TKDDDRMLFDIQKFYNVLVEELPANVAD 310
           RFG++G+A+N V +K    +L  IQ+ +N  +E L  +  D
Sbjct: 431 RFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLD 471



>gb:AF136175_1885745 Homo sapiens RNA helicase mRNA, complete cds.
          Length = 479

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 46/101 (45%), Positives = 65/101 (64%), Gaps = 7/101 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  ++  FR G  +VL+T +  ARGIDV+QVS+VIN+DLP         E YLHRIGR+G
Sbjct: 372 RAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG 431

Query: 429 RFGRKGVAINFV-TKDDDRMLFDIQKFYNVLVEELPANVAD 310
           RFG++G+A+N V +K    +L  IQ+ +N  +E L  +  D
Sbjct: 432 RFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLD 472



>gb:AE016816_1746768 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome III, complete sequence.
          Length = 467

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 47/102 (46%), Positives = 67/102 (65%), Gaps = 8/102 (7%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLP------TQPENYLHRIGRSG 430
           RD ++ +FR G S+VLIT + LARGID+  VS+V+NYDLP        P  Y+HRIGR+G
Sbjct: 355 RDRLIGDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPMTANGQPDPSTYVHRIGRTG 414

Query: 429 RFGRKGVAINFV-TKDDDRMLFDIQKFY-NVLVEELPANVAD 310
           RFGR GVAI+F+  K     L  IQ ++ ++ + ++P +  D
Sbjct: 415 RFGRTGVAISFIHDKKSYETLAAIQSYFGDIQITKVPTDDMD 456



>gb:ATAC011623_1543314 Arabidopsis thaliana chromosome III BAC
           F24P17 genomic sequence, complete sequence.
          Length = 1088

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 42/94 (44%), Positives = 59/94 (62%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD ++ +FR G S VLI  D  ARG+D++ + +VINYD PT  E+Y+HRIGR+GR G  G
Sbjct: 718 RDWVLNQFRSGKSCVLIATDVAARGLDIKDIRVVINYDFPTGVEDYVHRIGRTGRAGATG 777

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVAD 310
           VA  F T+ D +   D+ K      +++P  V D
Sbjct: 778 VAFTFFTEQDWKYAPDLIKVLEGANQQVPPQVRD 811



>gb:HSM804281_1187156 Homo sapiens mRNA; cDNA DKFZp666D212 (from
           clone DKFZp666D212).>gb:AX877953_1477233 Sequence 12858
           from Patent EP1074617.>gb:AK001988_1908768 Homo sapiens
           cDNA FLJ11126 fis, clone PLACE1006196, weakly similar to
           PUTATIVE ATP-DEPENDENT RNA HELICASE
           C12C2.06.>gb:BC005162_1969650 Homo sapiens DEAD
           (Asp-Glu-Ala-As) box polypeptide 19-like, mRNA (cDNA
           clone MGC:4651 IMAGE:3530064), complete
           cds.>gb:BC006544_1970374 Homo sapiens DEAD
           (Asp-Glu-Ala-As) box polypeptide 19-like, mRNA (cDNA
           clone MGC:2395 IMAGE:2964377), complete cds.
          Length = 478

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 46/101 (45%), Positives = 65/101 (64%), Gaps = 7/101 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  ++  FR G  +VL+T +  ARGIDV+QVS+VIN+DLP         E YLHRIGR+G
Sbjct: 371 RAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG 430

Query: 429 RFGRKGVAINFV-TKDDDRMLFDIQKFYNVLVEELPANVAD 310
           RFG++G+A+N V +K    +L  IQ+ +N  +E L  +  D
Sbjct: 431 RFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLD 471



>gb:HSM804212_1187110 Homo sapiens mRNA; cDNA DKFZp762C1313 (from
           clone DKFZp762C1313).
          Length = 360

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 46/101 (45%), Positives = 65/101 (64%), Gaps = 7/101 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  ++  FR G  +VL+T +  ARGIDV+QVS+VIN+DLP         E YLHRIGR+G
Sbjct: 253 RAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG 312

Query: 429 RFGRKGVAINFV-TKDDDRMLFDIQKFYNVLVEELPANVAD 310
           RFG++G+A+N V +K    +L  IQ+ +N  +E L  +  D
Sbjct: 313 RFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLD 353



>gb:HSM801612_1186301 Homo sapiens mRNA; cDNA DKFZp564C183 (from
           clone DKFZp564C183).
          Length = 448

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 46/101 (45%), Positives = 65/101 (64%), Gaps = 7/101 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  ++  FR G  +VL+T +  ARGIDV+QVS+VIN+DLP         E YLHRIGR+G
Sbjct: 341 RAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG 400

Query: 429 RFGRKGVAINFV-TKDDDRMLFDIQKFYNVLVEELPANVAD 310
           RFG++G+A+N V +K    +L  IQ+ +N  +E L  +  D
Sbjct: 401 RFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLD 441



>gb:CR749227_1180858 Homo sapiens mRNA; cDNA DKFZp686C21137 (from
           clone DKFZp686C21137).
          Length = 328

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 46/101 (45%), Positives = 65/101 (64%), Gaps = 7/101 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  ++  FR G  +VL+T +  ARGIDV+QVS+VIN+DLP         E YLHRIGR+G
Sbjct: 221 RAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG 280

Query: 429 RFGRKGVAINFV-TKDDDRMLFDIQKFYNVLVEELPANVAD 310
           RFG++G+A+N V +K    +L  IQ+ +N  +E L  +  D
Sbjct: 281 RFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLD 321



>gb:AK049467_1168810 Mus musculus 7 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:C430015B03
           product:DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 19,
           full insert sequence.>gb:BC011270_2091341 Mus musculus
           DEAD (Asp-Glu-Ala-Asp) box polypeptide 19a, mRNA (cDNA
           clone MGC:18475 IMAGE:3674608), complete cds.
          Length = 478

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 46/101 (45%), Positives = 65/101 (64%), Gaps = 7/101 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  ++  FR G  +VL+T +  ARGIDV+QVS+VIN+DLP         E YLHRIGR+G
Sbjct: 371 RAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG 430

Query: 429 RFGRKGVAINFV-TKDDDRMLFDIQKFYNVLVEELPANVAD 310
           RFG++G+A+N V +K    +L  IQ+ +N  +E L  +  D
Sbjct: 431 RFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLD 471



>gb:AK033235_1163249 Mus musculus 15 days embryo male testis cDNA,
           RIKEN full-length enriched library, clone:8030471P14
           product:ATP-DEPENDENT RNA HELICASE DDX19 (DEAD-BOX
           PROTEIN 19) (DEAD-BOX RNA HELICASE DEAD5) homolog [Homo
           sapiens], full insert sequence.
          Length = 494

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 46/101 (45%), Positives = 65/101 (64%), Gaps = 7/101 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  ++  FR G  +VL+T +  ARGIDV+QVS+VIN+DLP         E YLHRIGR+G
Sbjct: 387 RAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG 446

Query: 429 RFGRKGVAINFV-TKDDDRMLFDIQKFYNVLVEELPANVAD 310
           RFG++G+A+N V +K    +L  IQ+ +N  +E L  +  D
Sbjct: 447 RFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLD 487



>sp|Q61655|DD19_MOUSE ATP-dependent RNA helicase DDX19 (DEAD-box
           protein 19) (DEAD-box RNA helicase DEAD5) (mDEAD5)
           (Eukaryotic translation initiation factor 4A related
           sequence 1).>pir|I49731|I49731 RNA helicase -
           mouse>gb:MUSHELATP_2126176 Mouse RNA helicase and
           RNA-dependent ATPase from the DEAD box family mRNA,
           complete cds.
          Length = 478

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 46/101 (45%), Positives = 65/101 (64%), Gaps = 7/101 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  ++  FR G  +VL+T +  ARGIDV+QVS+VIN+DLP         E YLHRIGR+G
Sbjct: 371 RAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG 430

Query: 429 RFGRKGVAINFV-TKDDDRMLFDIQKFYNVLVEELPANVAD 310
           RFG++G+A+N V +K    +L  IQ+ +N  +E L  +  D
Sbjct: 431 RFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLD 471



>sp|Q9UMR2|DD19_HUMAN ATP-dependent RNA helicase DDX19 (DEAD-box
           protein 19) (DEAD-box RNA helicase
           DEAD5).>gb:AX879015_1477641 Sequence 13920 from Patent
           EP1074617.>gb:BC003626_1968937 Homo sapiens DEAD
           (Asp-Glu-Ala-As) box polypeptide 19, mRNA (cDNA clone
           MGC:2430 IMAGE:3030038), complete
           cds.>gb:HSA237946_2000677 Homo sapiens mRNA for DEAD Box
           Protein 5.
          Length = 479

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 46/101 (45%), Positives = 65/101 (64%), Gaps = 7/101 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  ++  FR G  +VL+T +  ARGIDV+QVS+VIN+DLP         E YLHRIGR+G
Sbjct: 372 RAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG 431

Query: 429 RFGRKGVAINFV-TKDDDRMLFDIQKFYNVLVEELPANVAD 310
           RFG++G+A+N V +K    +L  IQ+ +N  +E L  +  D
Sbjct: 432 RFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLD 472



>gb:BC046696_2549686 Xenopus laevis DEAD/H (Asp-Glu-Ala-Asp/His) box
           polypeptide 19 (DBP5 homolog, yeast), mRNA (cDNA clone
           MGC:53158 IMAGE:5542814), complete cds.
          Length = 487

 Score = 84.3 bits (207), Expect = 1e-15
 Identities = 47/101 (46%), Positives = 67/101 (66%), Gaps = 7/101 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  ++  FR G  +VL+T +  ARGIDV+QVS+VIN+DLP         E YLHRIGR+G
Sbjct: 380 RAAVIDRFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG 439

Query: 429 RFGRKGVAINFV-TKDDDRMLFDIQKFYNVLVEELPANVAD 310
           RFG++G+AIN V +K +  +L  IQ+ ++  +E L A+  D
Sbjct: 440 RFGKRGLAINMVDSKHNMEILQRIQQHFSKKIEHLDADDID 480



>gb:CR861435_1185430 Pongo pygmaeus mRNA; cDNA DKFZp459H062 (from
           clone DKFZp459H062).
          Length = 478

 Score = 84.3 bits (207), Expect = 1e-15
 Identities = 46/101 (45%), Positives = 65/101 (64%), Gaps = 7/101 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  ++  FR G  +VL+T +  ARGIDV+QVS+VIN+DLP         E YLHRIGR+G
Sbjct: 371 RAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG 430

Query: 429 RFGRKGVAINFV-TKDDDRMLFDIQKFYNVLVEELPANVAD 310
           RFG++G+A+N V +K    +L  IQ+ +N  +E L  +  D
Sbjct: 431 RFGKRGLAVNMVDSKHSMNILNRIQEHFNRKIERLDTDDLD 471



>gb:AE016959_1023315 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC078840_1541527
           Oryza sativa chromosome 10 BAC OSJNBb0073N24 genomic
           sequence, complete sequence.>gb:AE017110_1753134 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           64 of 77 of the complete sequence.
          Length = 521

 Score = 84.3 bits (207), Expect = 1e-15
 Identities = 38/92 (41%), Positives = 58/92 (63%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L+  D   RGID+Q V++VIN+D P   E YLHR+GRSGRFG  G
Sbjct: 423 RNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPKTSETYLHRVGRSGRFGHLG 482

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANV 316
           +A+N +T +D   L+ I++     ++ +P  +
Sbjct: 483 LAVNLITYEDRFNLYRIEQELGTEIKTIPPQI 514



>gb:AP006627_564519 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 537

 Score = 84.3 bits (207), Expect = 1e-15
 Identities = 41/79 (51%), Positives = 54/79 (68%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD++M++FR      LI  D  ARGIDV+ V+ VINYD+P  PE+Y+HRIGR+GR GR G
Sbjct: 278 RDVVMKKFRDSSIEFLIATDVAARGIDVENVTHVINYDIPQDPESYVHRIGRTGRAGRTG 337

Query: 411 VAINFVTKDDDRMLFDIQK 355
            AI  VT  + + L  I+K
Sbjct: 338 AAITLVTPREMKHLRSIEK 356



>gb:BC044541_2548843 Danio rerio DEAD/H (Asp-Glu-Ala-Asp/His) box
           polypeptide 19 (DBP5 homolog, yeast), mRNA (cDNA clone
           MGC:55924 IMAGE:3819148), complete cds.
          Length = 487

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 47/101 (46%), Positives = 65/101 (64%), Gaps = 7/101 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  ++  FR G  +VL+T +  ARGIDV+QVS+VIN+DLP         E YLHRIGR+G
Sbjct: 380 RAAVIERFRDGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG 439

Query: 429 RFGRKGVAINFV-TKDDDRMLFDIQKFYNVLVEELPANVAD 310
           RFG++G+AIN V +K    +L  IQ  +N  +E+L  +  D
Sbjct: 440 RFGKRGLAINMVDSKFSMNILNRIQDHFNKKIEKLDTDDLD 480



>gb:BC024852_2094757 Mus musculus DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 25, mRNA (cDNA clone MGC:36004
           IMAGE:5358404), complete cds.
          Length = 369

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 44/94 (46%), Positives = 62/94 (65%), Gaps = 6/94 (6%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQP------ENYLHRIGRSG 430
           R  I++ FR G  +VLIT +  ARGIDV+QV++V+N+DLP         E YLHRIGR+G
Sbjct: 263 RASIIQRFRDGKEKVLITTNVCARGIDVKQVTIVVNFDLPVNQSEEPDYETYLHRIGRTG 322

Query: 429 RFGRKGVAINFVTKDDDRMLFDIQKFYNVLVEEL 328
           RFG+KG+A N +  D   +L  IQ  +N  +++L
Sbjct: 323 RFGKKGLAFNMIEVDKLPLLMKIQDPFNSNIKQL 356



>gb:CR382125_1658207 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 437

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 35/82 (42%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = -1

Query: 552 RVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFV-TKDDDR 376
           R+ ++ D   RGID+++++L INYD+P + + YLHR+GR+GRFG KG+AI+ + ++DD++
Sbjct: 349 RICVSTDVFGRGIDIERINLAINYDMPNEADQYLHRVGRAGRFGTKGLAISMISSEDDEQ 408

Query: 375 MLFDIQKFYNVLVEELPANVAD 310
           +L  IQ+ ++V + E P    D
Sbjct: 409 VLAKIQERFDVKITEFPEEGVD 430



>gb:AY039862_1560376 Arabidopsis thaliana At2g45810/F4I18.21 mRNA,
           complete cds.>gb:BT002709_1636312 Arabidopsis thaliana
           At2g45810/F4I18.21 gene, complete cds.
          Length = 528

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 38/98 (38%), Positives = 61/98 (62%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L+  D   RGID+Q V++VIN+D P   E+YLHR+GRSGRFG  G
Sbjct: 430 RNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPRTSESYLHRVGRSGRFGHLG 489

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL*C 298
           +A+N VT +D   ++  ++     ++ +P+ +   + C
Sbjct: 490 LAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAIYC 527



>gb:ATH010459_1551892 Arabidopsis thaliana mRNA for DEAD box RNA
           helicase, RH6.
          Length = 145

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 38/98 (38%), Positives = 61/98 (62%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L+  D   RGID+Q V++VIN+D P   E+YLHR+GRSGRFG  G
Sbjct: 47  RNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPRTSESYLHRVGRSGRFGHLG 106

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL*C 298
           +A+N VT +D   ++  ++     ++ +P+ +   + C
Sbjct: 107 LAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAIYC 144



>gb:AK088669_1175543 Mus musculus 2 days neonate thymus thymic cells
           cDNA, RIKEN full-length enriched library,
           clone:E430023D03 product:EUKARYOTIC INITIATION FACTOR
           4A-II (EIF-4A-II) (EIF4A-II), full insert sequence.
          Length = 362

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 41/49 (83%), Positives = 43/49 (87%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHR 445
           RD+IMREFR G SRVLIT D LARGIDVQQVSLVINYDLPT  ENY+HR
Sbjct: 312 RDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHR 360



>gb:BX321863_774368 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 8/10.
          Length = 498

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 38/82 (46%), Positives = 59/82 (71%)
 Frame = -1

Query: 579 MREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAIN 400
           + EF+ G  ++L+  D  ARGID++++S VINY+LP  PE+Y+HRIGR+GR G KG AI+
Sbjct: 294 LAEFKHGDVQILVATDVAARGIDIEKLSHVINYELPGNPEDYVHRIGRTGRAGSKGKAIS 353

Query: 399 FVTKDDDRMLFDIQKFYNVLVE 334
            V++ +  +L +I+K  N  +E
Sbjct: 354 LVSEHEKELLANIEKLLNAKLE 375



>pir|H83947|H83947 ATP-dependent RNA helicase BH2384 [imported] -
           Bacillus halodurans (strain C-125)>gb:BA000004_656330
           Bacillus halodurans C-125 DNA, complete genome.
          Length = 539

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 42/79 (53%), Positives = 54/79 (68%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD +MR+FR      LI  D  ARGIDV  VS VINYD+P  PE+Y+HRIGR+GR GRKG
Sbjct: 282 RDAVMRKFRDSSIEFLIATDVAARGIDVGNVSHVINYDIPQDPESYVHRIGRTGRAGRKG 341

Query: 411 VAINFVTKDDDRMLFDIQK 355
           +A+  VT  + + L  I++
Sbjct: 342 LALTLVTPREMKHLRSIEQ 360



>pir|T51740|T51740 RNA helicase RH6 [imported] - Arabidopsis
           thaliana  (fragment)
          Length = 145

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 38/98 (38%), Positives = 61/98 (62%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L+  D   RGID+Q V++VIN+D P   E+YLHR+GRSGRFG  G
Sbjct: 47  RNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPRTSESYLHRVGRSGRFGHLG 106

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL*C 298
           +A+N VT +D   ++  ++     ++ +P+ +   + C
Sbjct: 107 LAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAIYC 144



>pir|T02466|T02466 probable ATP-dependent RNA helicase [imported] -
           Arabidopsis thaliana>gb:AC004665_1531936 Arabidopsis
           thaliana chromosome 2 clone F4I18 map CIC02E07, complete
           sequence.
          Length = 528

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 38/98 (38%), Positives = 61/98 (62%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+ +  +FR G  R L+  D   RGID+Q V++VIN+D P   E+YLHR+GRSGRFG  G
Sbjct: 430 RNRVFHDFRNGACRNLVCTDLFTRGIDIQAVNVVINFDFPRTSESYLHRVGRSGRFGHLG 489

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL*C 298
           +A+N VT +D   ++  ++     ++ +P+ +   + C
Sbjct: 490 LAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAIYC 527



>gb:PFA17288_1392028 Plasmodium falciparum gene encoding RNA
           helicase-2.
          Length = 182

 Score = 83.6 bits (205), Expect = 2e-15
 Identities = 39/51 (76%), Positives = 44/51 (86%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIG 439
           RD+IMREFR G +RVL+T D LARGIDVQQVSLVINYDLP  P+ Y+HRIG
Sbjct: 132 RDLIMREFRSGSTRVLVTTDLLARGIDVQQVSLVINYDLPCSPDTYIHRIG 182



>sp|Q07478|SUB2_YEAST Probable ATP-dependent RNA helicase
           SUB2.>pir|S67620|S67620 hypothetical protein YDL084w -
           yeast (Saccharomyces cerevisiae)>gb:AY692907_1622954
           Saccharomyces cerevisiae clone FLH112723.01X YDL084W
           gene, complete cds.>gb:SCYDL084W_1711650 S.cerevisiae
           chromosome IV reading frame ORF YDL084w.
          Length = 446

 Score = 83.6 bits (205), Expect = 2e-15
 Identities = 37/82 (45%), Positives = 59/82 (71%), Gaps = 1/82 (1%)
 Frame = -1

Query: 552 RVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFV-TKDDDR 376
           R+ ++ D   RGID+++++L INYDL  + + YLHR+GR+GRFG KG+AI+FV +K+D+ 
Sbjct: 358 RICVSTDVFGRGIDIERINLAINYDLTNEADQYLHRVGRAGRFGTKGLAISFVSSKEDEE 417

Query: 375 MLFDIQKFYNVLVEELPANVAD 310
           +L  IQ+ ++V + E P    D
Sbjct: 418 VLAKIQERFDVKIAEFPEEGID 439



>gb:CR382136_1669388 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 493

 Score = 83.2 bits (204), Expect = 3e-15
 Identities = 42/72 (58%), Positives = 53/72 (73%), Gaps = 6/72 (8%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPT------QPENYLHRIGRSG 430
           RD ++ +FR G S+VLIT + LARGID+  VS+V+NYDLP        P  YLHRIGR+G
Sbjct: 380 RDRLIDDFREGRSKVLITTNVLARGIDIASVSMVVNYDLPVDQKGAPDPSTYLHRIGRTG 439

Query: 429 RFGRKGVAINFV 394
           RFGR GV+I+FV
Sbjct: 440 RFGRVGVSISFV 451



>pir|T46157|T46157 RNA helicase-like protein - Arabidopsis
           thaliana>gb:ATT4D2_1556012 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T4D2.>gb:BT002444_1636047
           Arabidopsis thaliana RNA helicase -like protein
           (At3g53110) mRNA, complete cds.>gb:BT008867_1640063
           Arabidopsis thaliana At3g53110 mRNA, complete cds.
          Length = 496

 Score = 83.2 bits (204), Expect = 3e-15
 Identities = 43/97 (44%), Positives = 64/97 (65%), Gaps = 9/97 (9%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPEN-------YLHRIGRS 433
           RD I++EF+   ++VLI  D +ARG D Q+V+LV+NY+LPT+ E        YLHR+GR+
Sbjct: 379 RDKIVKEFKECLTQVLIATDVIARGFDQQRVNLVVNYNLPTKYETGEPDYEVYLHRVGRA 438

Query: 432 GRFGRKGVAINFVTKD--DDRMLFDIQKFYNVLVEEL 328
           GRFGRKG   N +  D  D  ++  I+K++   V+E+
Sbjct: 439 GRFGRKGAVFNLLLDDGWDKEVMEKIEKYFEANVKEI 475



>gb:CR380958_1653373 Candida glabrata strain CBS138 chromosome L
           complete sequence.
          Length = 439

 Score = 82.8 bits (203), Expect = 4e-15
 Identities = 37/82 (45%), Positives = 59/82 (71%), Gaps = 1/82 (1%)
 Frame = -1

Query: 552 RVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT-KDDDR 376
           R+ ++ D   RGID+++++L INYDL  + + YLHR+GR+GRFG KG+AI+FV+ K+D+ 
Sbjct: 351 RICVSTDVFGRGIDIERINLAINYDLLNEADQYLHRVGRAGRFGTKGLAISFVSNKEDEE 410

Query: 375 MLFDIQKFYNVLVEELPANVAD 310
           +L  IQ+ ++V + E P    D
Sbjct: 411 VLSKIQERFDVKIAEFPEEGID 432



>gb:AE015582_315787 Shewanella oneidensis MR-1 section 131 of 457 of
           the complete genome.>gb:AE014299_951384 Shewanella
           oneidensis MR-1 complete genome.
          Length = 433

 Score = 82.8 bits (203), Expect = 4e-15
 Identities = 37/75 (49%), Positives = 56/75 (74%)
 Frame = -1

Query: 579 MREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAIN 400
           +REF  G  RVL+  +  ARG+D+  +  V+N+DLP   E+Y+HRIGR+GR G+ GVAI+
Sbjct: 287 LREFVSGKVRVLVATEVAARGLDIPSLEYVVNFDLPFLAEDYVHRIGRTGRAGKSGVAIS 346

Query: 399 FVTKDDDRMLFDIQK 355
           FV+++++R L DI+K
Sbjct: 347 FVSREEERTLADIEK 361



>gb:AP003282_1827231 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0583G08.
          Length = 759

 Score = 82.4 bits (202), Expect = 5e-15
 Identities = 41/112 (36%), Positives = 62/112 (55%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD ++ EFR G   +L+  D  ARG+D++ + +V+NYD PT  E+Y+HRIGR+GR G  G
Sbjct: 514 RDSVLSEFRSGRCPILVATDVAARGLDIKDIRVVVNYDFPTGVEDYVHRIGRTGRAGATG 573

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL*CGFCSGKKKGEWGSS 256
           VA  F    D +   D+ K      + +   + D +  G   G+ +  W SS
Sbjct: 574 VAYTFFCDQDSKYASDLVKILEGANQSVSQQLRDMVSRGGYGGRSR-RWASS 624



>gb:AP003282_1827230 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0583G08.
          Length = 708

 Score = 82.4 bits (202), Expect = 5e-15
 Identities = 41/112 (36%), Positives = 62/112 (55%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           RD ++ EFR G   +L+  D  ARG+D++ + +V+NYD PT  E+Y+HRIGR+GR G  G
Sbjct: 463 RDSVLSEFRSGRCPILVATDVAARGLDIKDIRVVVNYDFPTGVEDYVHRIGRTGRAGATG 522

Query: 411 VAINFVTKDDDRMLFDIQKFYNVLVEELPANVADFL*CGFCSGKKKGEWGSS 256
           VA  F    D +   D+ K      + +   + D +  G   G+ +  W SS
Sbjct: 523 VAYTFFCDQDSKYASDLVKILEGANQSVSQQLRDMVSRGGYGGRSR-RWASS 573



>gb:CNS07EGI_1374552 chromosome IX of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 489

 Score = 82.4 bits (202), Expect = 5e-15
 Identities = 36/78 (46%), Positives = 52/78 (66%)
 Frame = -1

Query: 591 RDIIMREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKG 412
           R+I+   F  G  ++L+  D + RG+D    + VIN+D+   PE+YLHRIGR+GRFG  G
Sbjct: 384 RNIVFHNFLKGKCKILVATDLITRGVDAPNTNYVINFDISKSPESYLHRIGRAGRFGAPG 443

Query: 411 VAINFVTKDDDRMLFDIQ 358
           VAI+ VT ++  ML DI+
Sbjct: 444 VAISLVTTEEKEMLMDIE 461



>gb:AL646059_545467 Ralstonia solanacearum GMI1000 chromosome,
           complete sequence; segment 3/19.
          Length = 540

 Score = 82.4 bits (202), Expect = 5e-15
 Identities = 41/88 (46%), Positives = 59/88 (67%)
 Frame = -1

Query: 579 MREFRFGFSRVLITPDFLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAIN 400
           + EF+ G  RVL+  D  ARGID+ Q+  V+N+DLP  PE+Y+HRIGR+GR G +G AI+
Sbjct: 293 LSEFKAGTLRVLVATDIAARGIDIDQLPHVVNFDLPNVPEDYVHRIGRTGRAGAQGEAIS 352

Query: 399 FVTKDDDRMLFDIQKFYNVLVEELPANV 316
            V  D+  +L DI++   ++  ELP  V
Sbjct: 353 LVCVDEHGLLRDIER---LIKRELPRTV 377


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 639,281,851
Number of Sequences: 1806583
Number of extensions: 13160451
Number of successful extensions: 40598
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 39519
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 40475
length of database: 581,917,975
effective HSP length: 118
effective length of database: 368,741,181
effective search space used: 28761812118
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)