BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10405
         (875 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|G96611|G96611 probable cytochrome P450 T8L23.21 [imported] -...   189   5e-47   Arabidopsis thaliana [mouse-ear cress]
pir|T09364|T09364 cytochrome P450 homolog F23K16.110 - Arabidops...   180   3e-44   Arabidopsis thaliana [mouse-ear cress]
pir|T09365|T09365 cytochrome P450 homolog F23K16.120 - Arabidops...   179   8e-44   Arabidopsis thaliana [mouse-ear cress]
pir|T00514|T00514 cytochrome P450 homolog T20D16.19 - Arabidopsi...   175   9e-43   Arabidopsis thaliana [mouse-ear cress]
pir|T09366|T09366 cytochrome P450 homolog F23K16.130 - Arabidops...   168   1e-40   Arabidopsis thaliana [mouse-ear cress]
pir|F84606|F84606 probable cytochrome P450 [imported] - Arabidop...   168   1e-40   Arabidopsis thaliana [mouse-ear cress]
pir|T02357|T02357 cytochrome P450 homolog T8F5.12 - Arabidopsis ...   166   5e-40   Arabidopsis thaliana [mouse-ear cress]
pir|B96517|B96517 hypothetical protein F16N3.8 [imported] - Arab...   166   7e-40   Arabidopsis thaliana [mouse-ear cress]
pir|T04628|T04628 cytochrome P450 homolog F10M6.190 - Arabidopsi...   165   1e-39   Arabidopsis thaliana [mouse-ear cress]
pir|C96517|C96517 hypothetical protein F16N3.7 [imported] - Arab...   162   8e-39   Arabidopsis thaliana [mouse-ear cress]
gb:AB019226_1514059 Arabidopsis thaliana genomic DNA, chromosome...   161   2e-38   
gb:AK118220_1816210 Arabidopsis thaliana At5g52320 mRNA for puta...   159   7e-38   
pir|T09367|T09367 cytochrome P450 homolog F23K16.140 - Arabidops...   158   1e-37   Arabidopsis thaliana [mouse-ear cress]
gb:AP002484_1822231 Oryza sativa (japonica cultivar-group) genom...   157   2e-37   
gb:AE016959_1023166 Oryza sativa (japonica cultivar-group) chrom...   157   3e-37   
gb:AJ606074_1811952 Gossypium hirsutum mRNA for cytochrome P450-...   155   1e-36   
gb:AC135425_1742343 Oryza sativa (japonica cultivar-group) chrom...   153   4e-36   
gb:AY485644_1608500 Triticum monococcum phosphatidylserine decar...   149   5e-35   
gb:AP002484_1822232 Oryza sativa (japonica cultivar-group) genom...   149   7e-35   
gb:AY136363_1581864 Arabidopsis thaliana cytochrome P450-like pr...   149   9e-35   
pir|T50510|T50510 cytochrome P450-like protein - Arabidopsis tha...   149   9e-35   Arabidopsis thaliana [mouse-ear cress]
gb:AB007648_1510195 Arabidopsis thaliana genomic DNA, chromosome...   147   2e-34   
pir|T48311|T48311 cytochrome P450 52A3 homolog F9G14.210 [simila...   147   3e-34   Arabidopsis thaliana [mouse-ear cress]
pir|G86265|G86265 F3F19.17 protein - Arabidopsis thaliana>gb:AE0...   140   4e-32   Arabidopsis thaliana [mouse-ear cress]
gb:BT003907_1637033 Arabidopsis thaliana clone RAFL15-15-K01 (R2...   139   9e-32   
gb:CRO238402_1673463 Catharanthus roseus mRNA for cytochrome P450.    136   6e-31   
gb:AY029178_1559207 Brassica rapa subsp. pekinensis cytochrome P...   136   6e-31   
pir|JC5965|JC5965 cytochrome P450 CYP86A1 - Arabidopsis thaliana...   135   8e-31   Arabidopsis thaliana [mouse-ear cress]
pir|B86379|B86379 protein F21J9.20 [imported] - Arabidopsis thal...   135   1e-30   Arabidopsis thaliana [mouse-ear cress]
gb:AY081266_1568612 Arabidopsis thaliana cytochrome P450 (At5g58...   134   2e-30   
pir|F86265|F86265 hypothetical protein F3F19.16 - Arabidopsis th...   134   2e-30   Arabidopsis thaliana [mouse-ear cress]
sp|P48422|C861_ARATH|C861_ARATH Cytochrome P450 86A1 (EC 1.14.-.-) (CYPLXXX...   134   2e-30   Arabidopsis thaliana [mouse-ear cress]
gb:AP004139_1838160 Oryza sativa (japonica cultivar-group) genom...   133   4e-30   
gb:AY074851_1567703 Arabidopsis thaliana AT4g00360/A_IG005I10_21...   132   1e-29   
sp|O23066|C862_ARATH|C862_ARATH Cytochrome P450 86A2 (EC 1.14.-.-).>pir|T01...   131   1e-29   Arabidopsis thaliana [mouse-ear cress]
gb:AK117400_1815436 Arabidopsis thaliana At1g01600 mRNA for unkn...   129   1e-28   
pir|G86146|G86146 hypothetical protein F22L4.14 [imported] - Ara...   129   1e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AP003442_1829432 Oryza sativa (japonica cultivar-group) genom...   127   2e-28   
gb:AX023066_1456725 Sequence 10 from Patent EP0911404.>gb:AX0230...   127   2e-28   
gb:OSJN00087_1694652 Oryza sativa genomic DNA, chromosome 4, BAC...   127   3e-28   
pir|T02450|T02450 probable cytochrome P450 F4I18.5 - Arabidopsis...   127   3e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AP005697_1856238 Oryza sativa (japonica cultivar-group) genom...   127   4e-28   
gb:AY087670_1572698 Arabidopsis thaliana clone 37538 mRNA, compl...   125   8e-28   
pir|B96662|B96662 probable cytochrome P450 F24D7.10 [imported] -...   125   8e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AF366297_1791632 Zea mays cytochrome P450-like protein (ms*-s...   125   1e-27   
gb:AX453572_1468811 Sequence 1 from Patent WO0226789.                 125   1e-27   
gb:AC073556_1541121 Oryza sativa chromosome 3 BAC OSJNBa0091P11 ...   124   2e-27   
gb:AE005172_892252 Arabidopsis thaliana chromosome 1, top arm co...   123   4e-27   
gb:AP003232_1825816 Oryza sativa (japonica cultivar-group) genom...   122   7e-27   
gb:AF092916_1767574 Nicotiana tabacum cytochrome P450-dependent ...   122   9e-27   
pir|T49064|T49064 cytochrome P450-like protein - Arabidopsis tha...   120   3e-26   Arabidopsis thaliana [mouse-ear cress]
gb:AP004092_1837565 Oryza sativa (japonica cultivar-group) genom...   119   6e-26   
sp|O81117|C941_VICSA|C941_VICSA Cytochrome P450 94A1 (EC 1.14.-.-) (P450-de...   119   1e-25   Vicia sativa [spring vetch]
gb:AP003232_1825823 Oryza sativa (japonica cultivar-group) genom...   118   1e-25   
gb:AP003232_1825826 Oryza sativa (japonica cultivar-group) genom...   118   2e-25   
gb:AE016959_1023524 Oryza sativa (japonica cultivar-group) chrom...   117   2e-25   
gb:AP003232_1825814 Oryza sativa (japonica cultivar-group) genom...   117   3e-25   
gb:AE016959_1023525 Oryza sativa (japonica cultivar-group) chrom...   117   3e-25   
gb:AK118803_1816762 Arabidopsis thaliana At1g69500 mRNA for unkn...   117   4e-25   
gb:AC073178_1541004 Arabidopsis thaliana chromosome 1 BAC F10D13...   117   4e-25   
pir|G84675|G84675 probable cytochrome P450 [imported] - Arabidop...   115   8e-25   Arabidopsis thaliana [mouse-ear cress]
gb:AP003232_1825813 Oryza sativa (japonica cultivar-group) genom...   115   1e-24   
gb:AF092913_1767571 Nicotiana tabacum cytochrome P450-dependent ...   115   1e-24   
gb:AF092915_1767573 Nicotiana tabacum cytochrome P450-dependent ...   115   1e-24   
gb:AP003735_1832643 Oryza sativa (japonica cultivar-group) genom...   114   2e-24   
pir|T00864|T00864 cytochrome P450 homolog F17K2.4 - Arabidopsis ...   114   3e-24   Arabidopsis thaliana [mouse-ear cress]
gb:AF092914_1767572 Vicia sativa cytochrome P450-dependent fatty...   113   5e-24   
pir|T00404|T00404 probable cytochrome P450 At2g44890 [imported] ...   113   5e-24   Arabidopsis thaliana [mouse-ear cress]
sp|P98188|C942_VICSA|C942_VICSA Cytochrome P450 94A2 (EC 1.14.-.-) (P450-de...   113   5e-24   Vicia sativa [spring vetch]
gb:AY084262_1569354 Arabidopsis thaliana clone 101598 mRNA, comp...   112   7e-24   
gb:AB007649_1510220 Arabidopsis thaliana genomic DNA, chromosome...   112   7e-24   
gb:OSJN00071_1694301 Oryza sativa genomic DNA, chromosome 4, BAC...   112   1e-23   
gb:BT005906_1638828 Arabidopsis thaliana At5g63450 gene, complet...   112   1e-23   
gb:AC078894_1541591 Oryza sativa chromosome 10 BAC OSJNBa0096G08...   112   1e-23   
gb:AE016959_1023522 Oryza sativa (japonica cultivar-group) chrom...   112   1e-23   
pir|T46196|T46196 cytochrome P450-like protein - Arabidopsis tha...   112   1e-23   Arabidopsis thaliana [mouse-ear cress]
gb:AP003735_1832644 Oryza sativa (japonica cultivar-group) genom...   110   5e-23   
gb:AP003289_1827379 Oryza sativa (japonica cultivar-group) genom...   109   6e-23   
gb:AP000391_1819978 Oryza sativa (japonica cultivar-group) genom...   108   1e-22   
gb:AC136222_1743105 Oryza sativa (japonica cultivar-group) chrom...   107   3e-22   
gb:AC105364_1737973 Oryza sativa (japonica cultivar-group) chrom...   106   7e-22   
gb:AP003232_1825817 Oryza sativa (japonica cultivar-group) genom...   105   9e-22   
gb:AC137004_1743400 Oryza sativa (japonica cultivar-group) chrom...   105   9e-22   
gb:ATAC010797_1543165 Arabidopsis thaliana chromosome III BAC F2...   103   3e-21   
gb:AJ698923_1813455 Populus deltoides x Populus maximowiczii par...    84   3e-15   
gb:AY316198_1598411 Rhodotorula sp. CBS 8446 cytochrome P450 gen...    79   9e-14   
gb:AY113688_1299603 Helicoverpa zea cytochrome P450 monooxygenas...    78   2e-13   
gb:BC054222_2550872 Xenopus laevis hypothetical protein MGC64404...    77   3e-13   
gb:AE017343_1755698 Cryptococcus neoformans var. neoformans JEC2...    77   6e-13   
gb:AY063501_1293657 Mamestra brassicae cytochrome P450 CYP4L4 (C...    76   7e-13   
gb:AF124372_1770245 Nicotiana tabacum NT7 mRNA, partial cds.           75   2e-12   
gb:YSAP450ALK_1728133 Candida tropicalis cytochrome P-450-alk2 (...    75   2e-12   
gb:CTP450ALK_1674222 C.tropicalis DNA for alkane-inducible cytoc...    75   2e-12   
gb:AB010392_1511072 Yarrowia lipolytica gene for ALK5, complete ...    75   2e-12   
pir|T52515|T52515 related to n-alkane-inducible cytochrome P450 ...    75   2e-12   Neurospora crassa
sp|P30607|CP5B_CANTR|CP5B_CANTR Cytochrome P450 52A2 (EC 1.14.14.-) (CYPLII...    75   2e-12   Candida tropicalis
pir|A40576|A40576 cytochrome P450 ALK2-A - yeast (Candida maltos...    74   3e-12   Candida maltosa
sp|Q9VMS8|C4A2_DROME|C4A2_DROME Probable cytochrome P450 4ac2 (EC 1.14.-.-)...    74   3e-12   Drosophila melanogaster
gb:AK126473_1916330 Homo sapiens cDNA FLJ44509 fis, clone UTERU3...    74   5e-12   
gb:AK122600_1915255 Homo sapiens cDNA FLJ16007 fis, clone KIDNE2...    74   5e-12   
gb:YSACYP_1728101 Candida maltosa gene for cytochrome P-450alk, ...    74   5e-12   
gb:YSAAHCP_1728058 Candida maltosa alkane hydroxylating cytochro...    74   5e-12   
pir|C83722|C83722 cytochrome P450 BH0579 [imported] - Bacillus h...    74   5e-12   Bacillus halodurans
pir|B56578|O4CKA3 cytochrome P450 52A3-a - yeast (Candida maltos...    74   5e-12   
sp|P16496|CP5C_CANMA|CP5C_CANMA Cytochrome P450 52A3 (EC 1.14.14.-) (CYPLII...    74   5e-12   Candida maltosa
sp|Q9T0K2|C71K_ARATH|C71K_ARATH Cytochrome P450 71A20 (EC 1.14.-.-).>pir|T0...    74   5e-12   Arabidopsis thaliana [mouse-ear cress]
gb:CR858234_1182419 Pongo pygmaeus mRNA; cDNA DKFZp469M1818 (fro...    73   6e-12   
gb:AY574044_1338497 Capitella capitata cytochrome P450 CYP4AT1 m...    73   8e-12   
sp|Q27519|YRVA_CAEEL|YRVA_CAEEL Putative cytochrome P450 CYP13A7 (EC 1.14.-...    73   8e-12   Caenorhabditis elegans [roundworm]
sp|Q9Y6A2|CP46_HUMAN|CP46_HUMAN Cytochrome p450 46A1 (EC 1.14.-.-) (Cholest...    72   1e-11   Homo sapiens [man]
gb:OSJN00014_1693289 Oryza sativa genomic DNA, chromosome 4, BAC...    72   1e-11   
pir|A96695|A96695 hypothetical protein F5A8.3 [imported] - Arabi...    72   1e-11   Arabidopsis thaliana [mouse-ear cress]
sp|Q9WVK8|CP46_MOUSE|CP46_MOUSE Cytochrome p450 46A1 (EC 1.14.-.-) (Cholest...    72   1e-11   Mus musculus [mouse]
sp|Q9STK7|C71Q_ARATH|C71Q_ARATH Cytochrome P450 71A26 (EC 1.14.-.-).>pir|T0...    72   1e-11   Arabidopsis thaliana [mouse-ear cress]
sp|Q9V557|C4P2_DROME|C4P2_DROME Probable cytochrome P450 4p2 (EC 1.14.-.-) ...    72   1e-11   Drosophila melanogaster
gb:AB114054_2465687 Xenopus laevis CYP4V4 mRNA for Cytochrome P4...    72   2e-11   
gb:AY230499_1591458 Candida tropicalis CYP52A13 (CYP52A13) gene,...    72   2e-11   
gb:AF254755_1256301 Tribolium castaneum cytochrome P450 monooxig...    72   2e-11   
sp|P15128|CP4B_RABIT|CP4B_RABIT Cytochrome P450 4B1 (EC 1.14.14.1) (CYPIVB1...    72   2e-11   Oryctolagus cuniculus [domestic rabbit]
sp|Q9VMS9|C4A1_DROME|C4A1_DROME Probable cytochrome P450 4ac1 (EC 1.14.-.-)...    72   2e-11   Drosophila melanogaster
gb:AY230500_1591459 Candida tropicalis CYP52A14 (CYP52A14) gene,...    71   2e-11   
gb:AP003822_1833821 Oryza sativa (japonica cultivar-group) genom...    71   3e-11   
gb:AB010389_1511069 Yarrowia lipolytica gene for ALK2, complete ...    71   3e-11   
gb:AB005248_1509649 Arabidopsis thaliana genomic DNA, chromosome...    71   3e-11   
gb:AY151046_1425780 Capra hircus pulmonary cytochrome P450 4B2 m...    71   3e-11   
gb:AY337337_1320753 Tribolium castaneum strain GA-1 cytochrome P...    71   3e-11   
gb:AF261080_1256994 Boophilus microplus P450 CYP319A1 (CYP319A1)...    71   3e-11   
gb:AK004724_1152539 Mus musculus adult male lung cDNA, RIKEN ful...    71   3e-11   
pir|H84663|H84663 probable cytochrome P450 [imported] - Arabidop...    71   3e-11   Arabidopsis thaliana [mouse-ear cress]
sp|Q9STL0|C71N_ARATH|C71N_ARATH Cytochrome P450 71A23 (EC 1.14.-.-).>pir|T0...    71   3e-11   Arabidopsis thaliana [mouse-ear cress]
gb:HUMCP45IV_2030261 Human lung cytochrome P450 (IV subfamily) B...    70   4e-11   
gb:AY064486_1935725 Homo sapiens cytochrome P450 (CYP4B1) mRNA, ...    70   4e-11   
gb:AY064485_1935724 Homo sapiens cytochrome P450 (CYP4B1) mRNA, ...    70   4e-11   
gb:AL356793_1924734 Human DNA sequence from clone RP4-732G19 on ...    70   4e-11   
gb:AL356793_1924732 Human DNA sequence from clone RP4-732G19 on ...    70   4e-11   
gb:AF491285_1904958 Homo sapiens cytochrome P450 (CYP4B1) mRNA, ...    70   4e-11   
gb:CEY80D3A_1371166 Caenorhabditis elegans YAC Y80D3A, complete ...    70   4e-11   
sp|P13584|CP4B_HUMAN|CP4B_HUMAN Cytochrome P450 4B1 (EC 1.14.14.1) (CYPIVB1...    70   4e-11   Homo sapiens [man]
sp|Q9VMS7|C4A3_DROME|C4A3_DROME Probable cytochrome P450 4ac3 (EC 1.14.-.-)...    70   4e-11   Drosophila melanogaster
gb:AY036882_1560057 Phanerochaete chrysosporium cytochrome P450 ...    70   5e-11   
sp|Q9T0K0|C71J_ARATH|C71J_ARATH Cytochrome P450 71A19 (EC 1.14.-.-).>pir|T0...    70   5e-11   Arabidopsis thaliana [mouse-ear cress]
gb:BC055637_2551497 Danio rerio hypothetical protein LOC402831, ...    70   7e-11   
gb:CR382131_1664525 Yarrowia lipolytica chromosome E of strain C...    70   7e-11   
gb:CR382128_1661198 Yarrowia lipolytica chromosome B of strain C...    70   7e-11   
gb:AB010394_1511074 Yarrowia lipolytica gene for ALK7, complete ...    70   7e-11   
gb:AB010390_1511070 Yarrowia lipolytica gene for ALK3, complete ...    70   7e-11   
gb:AB010388_1511068 Yarrowia lipolytica gene for ALK1, complete ...    70   7e-11   
gb:AY596297_631617 Haloarcula marismortui ATCC 43049 chromosome ...    70   7e-11   
sp|Q9Y758|CP5M_DEBHA|CP5M_DEBHA Cytochrome P450 52A13 (EC 1.14.14.-) (Alkan...    70   7e-11   Debaryomyces hansenii
sp|P24458|CP5E_CANMA|CP5E_CANMA Cytochrome P450 52A5 (EC 1.14.14.-) (CYPLII...    70   7e-11   Candida maltosa
sp|P15129|CP4B_RAT|CP4B_RAT Cytochrome P450 4B1 (EC 1.14.14.1) (CYPIVB1) ...    70   7e-11   Rattus norvegicus [brown rat]
sp|O65438|C71R_ARATH|C71R_ARATH Cytochrome P450 71A27 (EC 1.14.-.-).              70   7e-11   Arabidopsis thaliana [mouse-ear cress]
pir|T02192|T02192 probable cytochrome P450 At2g46950 [imported] ...    69   9e-11   Arabidopsis thaliana [mouse-ear cress]
pir|S38535|S38535 cytochrome P450 76A1 - eggplant (fragment)           69   9e-11   Solanum melongena [aubergine]
sp|P37122|C762_SOLME|C762_SOLME Cytochrome P450 76A2 (EC 1.14.-.-) (CYPLXXV...    69   9e-11   Solanum melongena [aubergine]
sp|P37121|C761_SOLME|C761_SOLME Cytochrome P450 76A1 (EC 1.14.-.-) (CYPLXXV...    69   9e-11   Solanum melongena [aubergine]
sp|Q12588|CP5J_CANMA|CP5J_CANMA Cytochrome P450 52A10 (EC 1.14.14.-) (CYPLI...    69   1e-10   Candida maltosa
gb:AP005682_1855932 Oryza sativa (japonica cultivar-group) genom...    69   2e-10   
gb:NCB14A6_1689278 Neurospora crassa DNA linkage group V BAC con...    69   2e-10   
gb:CAALK8_1644730 Candida albicans alk8 gene.                          69   2e-10   
gb:BT004038_1637150 Arabidopsis thaliana clone RAFL15-05-J07 (R2...    69   2e-10   
gb:AB010395_1511075 Yarrowia lipolytica gene for ALK8, complete ...    69   2e-10   
gb:AY113687_1299602 Helicoverpa zea cytochrome P450 monooxygenas...    69   2e-10   
pir|S66374|S66374 cytochrome P450 4M2 - tobacco hornworm>gb:MOTC...    69   2e-10   Manduca sexta [Carolina sphinx]
sp|Q9LVD2|C72A_ARATH|C72A_ARATH Cytochrome P450 71B10 (EC 1.14.-.-).>gb:AB0...    69   2e-10   Arabidopsis thaliana [mouse-ear cress]
gb:AY858838_1965104 Homo sapiens vitamin D 24-hydroxylase splice...    68   2e-10   
gb:AP003575_1831142 Oryza sativa (japonica cultivar-group) genom...    68   2e-10   
gb:YSAALK8B_1728065 C. maltosa ALK8-B gene for n-alkane-inducibl...    68   2e-10   
pir|G84200|G84200 cytochrome P450 [imported] - Halobacterium sp....    68   2e-10   Halobacterium salinarum
sp|Q27517|YRV5_CAEEL|YRV5_CAEEL Putative cytochrome P450 CYP13A3 (EC 1.14.-...    68   2e-10   Caenorhabditis elegans [roundworm]
sp|Q12589|CP5K_CANMA|CP5K_CANMA Cytochrome P450 52A11 (EC 1.14.14.-) (CYPLI...    68   2e-10   Candida maltosa
sp|Q07973|CP24_HUMAN|CP24_HUMAN Cytochrome P450 24A1, mitochondrial precurs...    68   2e-10   Homo sapiens [man]
gb:AY390259_1325008 Mamestra brassicae antennal cytochrome P450 ...    68   3e-10   
sp|Q9VYQ5|C318_DROME|C318_DROME Probable cytochrome P450 318a1 (EC 1.14.-.-...    68   3e-10   Drosophila melanogaster
gb:BC075285_2558391 Xenopus tropicalis cytochrome P450, family 2...    67   3e-10   
gb:AF321858_1786038 Lolium rigidum clone BXH putative cytochrome...    67   3e-10   
gb:AB196795_1203115 Antheraea yamamai mRNA for cytochrome P450 C...    67   3e-10   
sp|O64636|C7C1_ARATH|C7C1_ARATH Cytochrome P450 76C1 (EC 1.14.-.-).>pir|T00...    67   3e-10   Arabidopsis thaliana [mouse-ear cress]
gb:S67623_2040918 25-hydroxyvitamin D 24-hydroxylase cytochrome ...    67   5e-10   
gb:AP001298_1820965 Arabidopsis thaliana genomic DNA, chromosome...    67   5e-10   
gb:AF175278_1774495 Pisum sativum wound-inducible P450 hydroxyla...    67   5e-10   
gb:CR382127_1660284 Yarrowia lipolytica chromosome A of strain C...    67   5e-10   
gb:AY588580_1339442 Helicoverpa armigera cytochrome P450 (CYP4) ...    67   5e-10   
pir|I55488|I55488 25-hydroxyvitamin D 24-hydroxylase cytochrome ...    67   5e-10   Homo sapiens [man]
sp|P58045|C71E_ARATH|C71E_ARATH Cytochrome P450 71A14 (EC 1.14.-.-).              67   5e-10   Arabidopsis thaliana [mouse-ear cress]
sp|Q9VA27|C4C3_DROME|C4C3_DROME Cytochrome P450 4c3 (EC 1.14.-.-) (CYPIVC3)...    67   5e-10   Drosophila melanogaster
gb:AP004617_1842154 Oryza sativa (japonica cultivar-group) genom...    67   6e-10   
gb:AP004264_1839405 Oryza sativa (japonica cultivar-group) genom...    67   6e-10   
gb:AY230498_1591457 Candida tropicalis CYP52A12 (CYP52A12) gene,...    67   6e-10   
gb:AB052131_1521171 Asparagus officinalis Asp-3 mRNA for cytochr...    67   6e-10   
gb:DMU89746_1381108 Drosophila mettleri cytochrome P450 monooxyg...    67   6e-10   
gb:AY309972_1318073 Culex pipiens pallens cytochrome P450 mRNA, ...    67   6e-10   
pir|H96672|H96672 probable cytochrome P450 F13O11.24 [imported] ...    67   6e-10   Arabidopsis thaliana [mouse-ear cress]
sp|Q27518|YRV7_CAEEL|YRV7_CAEEL Putative cytochrome P450 CYP13A2 (EC 1.14.-...    67   6e-10   Caenorhabditis elegans [roundworm]
sp|Q64462|CP4B_MOUSE|CP4B_MOUSE Cytochrome P450 4B1 (EC 1.14.14.1) (CYPIVB1...    67   6e-10   Mus musculus [mouse]
sp|O64637|C7C2_ARATH|C7C2_ARATH Cytochrome P450 76C2 (EC 1.14.-.-).>pir|T00...    67   6e-10   Arabidopsis thaliana [mouse-ear cress]
gb:GGA250337_2572715 Gallus gallus mRNA for Cytochrome P450 prot...    66   8e-10   
gb:AX034665_1457599 Sequence 2 from Patent EP1035206.                  66   8e-10   
gb:AY094906_1298080 Drosophila melanogaster RH12404 full insert ...    66   8e-10   
gb:AC006720_1203859 Caenorhabditis elegans cosmid Y17G9B, comple...    66   8e-10   
gb:AE014298_1125353 Drosophila melanogaster chromosome X, comple...    66   8e-10   
pir|T52168|T52168 cytochrome P450 monooxygenase [imported] - Ara...    66   8e-10   Arabidopsis thaliana [mouse-ear cress]
sp|P30608|CP5F_CANTR|CP5F_CANTR Cytochrome P450 52A6 (EC 1.14.14.-) (CYPLII...    66   8e-10   Candida tropicalis
sp|Q64441|CP24_MOUSE|CP24_MOUSE Cytochrome P450 24A1, mitochondrial precurs...    66   8e-10   Mus musculus [mouse]
sp|Q9FH66|C71G_ARATH|C71G_ARATH Cytochrome P450 71A16 (EC 1.14.-.-).>gb:AB0...    66   8e-10   Arabidopsis thaliana [mouse-ear cress]
sp|O18596|C4DA_DROMT|C4DA_DROMT Cytochrome P450 4d10 (EC 1.14.-.-) (CYPIVD1...    66   8e-10   Drosophila mettleri
sp|Q9VYQ7|C311_DROME|C311_DROME Probable cytochrome P450 311a1 (EC 1.14.-.-...    66   8e-10   Drosophila melanogaster
gb:BC081244_2562140 Xenopus laevis MGC86179 protein, mRNA (cDNA ...    66   1e-09   
gb:AP003434_1829313 Oryza sativa (japonica cultivar-group) genom...    66   1e-09   
gb:AF005475_1760795 Phanerochaete chrysosporium cytochrome P450 ...    66   1e-09   
gb:CRO251269_1673471 Catharanthus roseus mRNA for geraniol 10-hy...    66   1e-09   
gb:AB045593_1520404 Perilla frutescens SHT12 mRNA for flavonoid ...    66   1e-09   
gb:CEF22B3_1362801 Caenorhabditis elegans cosmid F22B3, complete...    66   1e-09   
gb:AY571901_1338101 Helicoverpa armigera cytochrome P450 CYP4 mR...    66   1e-09   
gb:AF243506_1254903 Diabrotica virgifera virgifera insecticide r...    66   1e-09   
gb:AF016998_1232868 Drosophila melanogaster cytochrome P450 (CYP...    66   1e-09   
gb:AE014298_1124004 Drosophila melanogaster chromosome X, comple...    66   1e-09   
gb:AE014298_1124003 Drosophila melanogaster chromosome X, comple...    66   1e-09   
pir|T20908|T20908 hypothetical protein F14F7.3 - Caenorhabditis ...    66   1e-09   Caenorhabditis elegans [roundworm]
pir|T21236|T21236 hypothetical protein H02I12.8 - Caenorhabditis...    66   1e-09   Caenorhabditis elegans [roundworm]
sp|Q27516|YRV4_CAEEL|YRV4_CAEEL Putative cytochrome P450 CYP13A8 (EC 1.14.-...    66   1e-09   Caenorhabditis elegans [roundworm]
sp|P43083|CP5V_CANAP|CP5V_CANAP Cytochrome P450 52E1 (EC 1.14.14.-) (CYPLII...    66   1e-09   Starmerella apicola
sp|P33269|C4D1_DROME|C4D1_DROME Cytochrome P450 4d1 (EC 1.14.-.-) (CYPIVD1)...    66   1e-09   Drosophila melanogaster
gb:BC089709_2566256 Xenopus tropicalis cDNA clone MGC:108307 IMA...    65   1e-09   
gb:AP003434_1829310 Oryza sativa (japonica cultivar-group) genom...    65   1e-09   
gb:AC134348_1741777 Oryza sativa (japonica cultivar-group) chrom...    65   1e-09   
gb:YSAP450ALK_1728134 Candida tropicalis cytochrome P-450-alk2 (...    65   1e-09   
gb:AY052668_1562828 Arabidopsis thaliana At1g64950/F13O11_25 mRN...    65   1e-09   
gb:AE016959_1021094 Oryza sativa (japonica cultivar-group) chrom...    65   1e-09   
pir|JS0203|JS0203 cytochrome P450 52A1, alkane-inducible - yeast...    65   1e-09   Candida tropicalis
sp|Q27514|YRV2_CAEEL|YRV2_CAEEL Putative cytochrome P450 CYP13A5 (EC 1.14.-...    65   1e-09   Caenorhabditis elegans [roundworm]
sp|Q05047|CP72_CATRO|CP72_CATRO Cytochrome P450 72A1 (EC 1.3.3.9) (CYPLXXII...    65   1e-09   Catharanthus roseus [chatas]
sp|Q9Y757|CP5L_DEBHA|CP5L_DEBHA Cytochrome P450 52A12 (EC 1.14.14.-) (Alkan...    65   1e-09   Debaryomyces hansenii
sp|P10615|CP5A_CANTR|CP5A_CANTR Cytochrome P450 52A1 (EC 1.14.14.-) (CYPLII...    65   1e-09   Candida tropicalis
sp|Q43068|C821_PEA|C821_PEA Cytochrome P450 82A1 (EC 1.14.-.-) (CYPLXXXII...    65   1e-09   Pisum sativum [garden pea]
sp|O16805|C4D1_DROSI|C4D1_DROSI Cytochrome P450 4d1 (EC 1.14.-.-) (CYPIVD1)...    65   1e-09   Drosophila simulans
gb:AF097664_1767890 Mesembryanthemum crystallinum cinnamate 4-hy...    65   2e-09   
gb:AB010393_1511073 Yarrowia lipolytica gene for ALK6, complete ...    65   2e-09   
pir|A96673|A96673 probable cytochrome P450 F13O11.25 [imported] ...    65   2e-09   Arabidopsis thaliana [mouse-ear cress]
pir|S08668|O4CKA4 cytochrome P450 52A4 - yeast (Candida maltosa)...    65   2e-09   
pir|B40576|B40576 cytochrome P450 ALK3-A - yeast (Candida maltos...    65   2e-09   Candida maltosa
sp|P16141|CP5D_CANMA|CP5D_CANMA Cytochrome P450 52A4 (EC 1.14.14.-) (CYPLII...    65   2e-09   Candida maltosa
sp|O81972|C822_SOYBN|C822_SOYBN Cytochrome P450 82A2 (EC 1.14.-.-) (P450 CP...    65   2e-09   Glycine max [soybeans]
gb:AP005732_1856806 Oryza sativa (japonica cultivar-group) genom...    65   2e-09   
gb:CR382137_1670370 Debaryomyces hansenii chromosome E of strain...    65   2e-09   
gb:AY230501_1591460 Candida tropicalis CYP52A15 (CYP52A15) gene,...    65   2e-09   
gb:AF355145_1264968 Musca domestica cytochrome P450 CYP4G13v2 mR...    65   2e-09   
pir|E86249|E86249 hypothetical protein [imported] - Arabidopsis ...    65   2e-09   Arabidopsis thaliana [mouse-ear cress]
sp|O42563|CP3R_ONCMY|CP3R_ONCMY Cytochrome P450 3A27 (EC 1.14.14.1) (CYPIII...    65   2e-09   Oncorhynchus mykiss
sp|Q9STK8|C71P_ARATH|C71P_ARATH Cytochrome P450 71A25 (EC 1.14.-.-).>pir|T0...    65   2e-09   Arabidopsis thaliana [mouse-ear cress]
sp|Q9SAB6|C71I_ARATH|C71I_ARATH Cytochrome P450 71A18 (EC 1.14.-.-).              65   2e-09   Arabidopsis thaliana [mouse-ear cress]
sp|Q9VG40|C134_DROME|C134_DROME Probable cytochrome P450 313a4 (EC 1.14.-.-...    65   2e-09   Drosophila melanogaster
gb:BC084618_2563924 Xenopus laevis cDNA clone MGC:98318 IMAGE:70...    64   3e-09   
gb:AF236085_1892309 Homo sapiens CYP4F11 mRNA, complete cds.           64   3e-09   
gb:AP003752_1832889 Oryza sativa (japonica cultivar-group) genom...    64   3e-09   
gb:AJ583531_1811351 Triticum aestivum mRNA for cytochrome P450 (...    64   3e-09   
gb:CR382137_1670372 Debaryomyces hansenii chromosome E of strain...    64   3e-09   
gb:BT015411_1642239 Arabidopsis thaliana At4g12320 gene, complet...    64   3e-09   
gb:AY036885_1560059 Phanerochaete chrysosporium cytochrome P450 ...    64   3e-09   
gb:AY036881_1560056 Phanerochaete chrysosporium cytochrome P450 ...    64   3e-09   
gb:AB016062_1512755 Petunia x hybrida IMT-7 mRNA for cytochrome ...    64   3e-09   
gb:AF059700_474478 Rhodococcus sp. X309 plasmid pSOX putative re...    64   3e-09   
pir|T48142|T48142 cytochrome P450 homolog T4C9.160 [similarity] ...    64   3e-09   Arabidopsis thaliana [mouse-ear cress]
pir|E84501|E84501 probable cytochrome P450 [imported] - Arabidop...    64   3e-09   Arabidopsis thaliana [mouse-ear cress]
pir|A47436|A47436 1,25-dihydroxyvitamin D3 24-hydroxylase (EC 1....    64   3e-09   Homo sapiens [man]
sp|Q27513|YRV1_CAEEL|YRV1_CAEEL Putative cytochrome P450 CYP13A4 (EC 1.14.-...    64   3e-09   Caenorhabditis elegans [roundworm]
gb:AK118163_1816156 Arabidopsis thaliana At2g45580 mRNA for puta...    64   4e-09   
gb:STU296346_1723032 Solanum tuberosum mRNA for cytochrome P450 ...    64   4e-09   
gb:HVU495774_1682727 Hordeum vulgare partial mRNA for putative c...    64   4e-09   
gb:AB010697_1511191 Arabidopsis thaliana genomic DNA, chromosome...    64   4e-09   
gb:CR859792_1183895 Pongo pygmaeus mRNA; cDNA DKFZp469H0334 (fro...    64   4e-09   
gb:CR857756_1181969 Pongo pygmaeus mRNA; cDNA DKFZp469M2229 (fro...    64   4e-09   
pir|D96781|D96781 cytochrome P450, probable, 64213-66051 [import...    64   4e-09   Arabidopsis thaliana [mouse-ear cress]
sp|Q09128|CP24_RAT|CP24_RAT Cytochrome P450 24A1, mitochondrial precursor...    64   4e-09   Rattus norvegicus [brown rat]
sp|O48956|C981_SORBI|C981_SORBI Cytochrome P450 98A1 (EC 1.14.-.-).>pir|T14...    64   4e-09   Sorghum bicolor [broomcorn]
sp|Q9VGB4|C132_DROME|C132_DROME Probable cytochrome P450 313a2 (EC 1.14.-.-...    64   4e-09   Drosophila melanogaster
gb:AJ786769_2068650 Mus musculus mRNA for cytochrome P450 (CYP4X...    64   5e-09   
gb:BC035350_1981548 Homo sapiens cytochrome P450, family 4, subf...    64   5e-09   
gb:AC004523_1874612 Homo sapiens chromosome 19, cosmid F22329, c...    64   5e-09   
gb:AB035131_1866352 Homo sapiens CYP4F12 L mRNA for cytochrome P...    64   5e-09   
gb:AF135485_1771085 Glycine max cytochrome P450 monooxygenaseCYP...    64   5e-09   
gb:CR382137_1670371 Debaryomyces hansenii chromosome E of strain...    64   5e-09   
gb:AY424805_1605499 Arabidopsis thaliana chloroplast carotenoid ...    64   5e-09   
gb:AY230506_1591465 Candida tropicalis CYP52A19 (CYP52A19) gene,...    64   5e-09   
gb:AY091083_1574310 Arabidopsis thaliana putative cytochrome P45...    64   5e-09   
gb:ATU61231_1557120 Arabidopsis thaliana cytochrome P450 (CYP89A...    64   5e-09   
gb:AY337337_1320754 Tribolium castaneum strain GA-1 cytochrome P...    64   5e-09   
gb:AF081807_1239640 Boophilus microplus cytochrome P450 4W1 (CYP...    64   5e-09   
gb:CR860956_1184998 Pongo pygmaeus mRNA; cDNA DKFZp470O1933 (fro...    64   5e-09   
gb:AK038526_1165073 Mus musculus adult male hypothalamus cDNA, R...    64   5e-09   
pir|T46159|T46159 cytochrome P450-like protein - Arabidopsis tha...    64   5e-09   
pir|T00871|T00871 probable cytochrome P450 At2g45580 [imported] ...    64   5e-09   
sp|Q9HCS2|CPFC_HUMAN|CPFC_HUMAN Cytochrome P450 4F12 (EC 1.14.14.1) (CYPIVF...    64   5e-09   
sp|P17549|CP53_ASPNG|CP53_ASPNG Benzoate 4-monooxygenase (EC 1.14.13.12) (B...    64   5e-09   
sp|O64635|C7C4_ARATH|C7C4_ARATH Cytochrome P450 76C4 (EC 1.14.-.-).>pir|T00...    64   5e-09   
sp|O64638|C7C3_ARATH|C7C3_ARATH Cytochrome P450 76C3 (EC 1.14.-.-).               64   5e-09   
sp|Q9STL2|C71L_ARATH|C71L_ARATH Cytochrome P450 71A21 (EC 1.14.-.-).>pir|T0...    64   5e-09   
gb:BC074131_2557649 Xenopus laevis MGC81840 protein, mRNA (cDNA ...    63   7e-09   
gb:AB114053_2465686 Xenopus laevis CYP4F42 mRNA for Cytochrome P...    63   7e-09   
gb:AP003752_1832893 Oryza sativa (japonica cultivar-group) genom...    63   7e-09   
gb:AP003434_1829312 Oryza sativa (japonica cultivar-group) genom...    63   7e-09   
gb:AC132485_1741144 Oryza sativa (japonica cultivar-group) chrom...    63   7e-09   
gb:CR382135_1667745 Debaryomyces hansenii chromosome C of strain...    63   7e-09   
gb:AY700570_1623594 Fusarium heterosporum strain ATCC 74349 equi...    63   7e-09   
gb:AY532370_1612053 Ammi majus cytochrome P450 (CYP71AJ1) mRNA, ...    63   7e-09   
gb:AY048583_1561770 Emericella nidulans benzoate-para-hydroxylas...    63   7e-09   
gb:AB016060_1512753 Petunia x hybrida IMT-4 mRNA for cytochrome ...    63   7e-09   
gb:AX473036_1469408 Sequence 1 from Patent WO0218558.                  63   7e-09   
gb:AY588581_1339443 Helicoverpa armigera cytochrome P450 (CYP4) ...    63   7e-09   
gb:AY453408_1327688 Nereis virens CYP4-2 mRNA, partial cds.            63   7e-09   
pir|G96672|G96672 hypothetical protein F13O11.23 [imported] - Ar...    63   7e-09   
pir|T06523|T06523 cytochrome P450 monooxygenase (EC 1.13.-.-) - ...    63   7e-09   
sp|Q9HBI6|CPFB_HUMAN|CPFB_HUMAN Cytochrome P450 4F11 (EC 1.14.14.1) (CYPIVF...    63   7e-09   
sp|Q42602|C892_ARATH|C892_ARATH Cytochrome P450 89A2 (EC 1.14.-.-) (CYPLXXX...    63   7e-09   
sp|O48923|C7DA_SOYBN|C7DA_SOYBN Cytochrome P450 71D10 (EC 1.14.-.-).>pir|T0...    63   7e-09   
gb:AB022671_2461027 Xenopus laevis mRNA for cytochrome P450 XL-3...    63   9e-09   
gb:AP003805_1833634 Oryza sativa (japonica cultivar-group) genom...    63   9e-09   
gb:AF479661_1803546 Pastinaca sativa cytochrome P450 (CYP76B7) m...    63   9e-09   
gb:AC112160_1738853 Oryza sativa (japonica cultivar-group) chrom...    63   9e-09   
gb:RHTP450RM_1703476 Rhodotorula minuta DNA for isobutene-formin...    63   9e-09   
gb:CR382135_1667822 Debaryomyces hansenii chromosome C of strain...    63   9e-09   
gb:AY230502_1591461 Candida tropicalis CYP52A16 (CYP52A16) gene,...    63   9e-09   
gb:AB010073_1510946 Arabidopsis thaliana genomic DNA, chromosome...    63   9e-09   
gb:CEZK1320_1371507 Caenorhabditis elegans cosmid ZK1320, comple...    63   9e-09   
gb:AF251548_1255884 Tribolium castaneum cytochrome P450 monooxig...    63   9e-09   
pir|T20907|T20907 hypothetical protein F14F7.2 - Caenorhabditis ...    63   9e-09   
pir|T27750|T27750 hypothetical protein ZK1320.4 - Caenorhabditis...    63   9e-09   
pir|T48141|T48141 flavonoid 3',5'-hydroxylase homolog T4C9.150 [...    63   9e-09   
pir|G86460|G86460 probable cytochrome P450 [imported] - Arabidop...    63   9e-09   
sp|Q09653|YS24_CAEEL|YS24_CAEEL Putative cytochrome P450 CYP13A10 (EC 1.14....    63   9e-09   
sp|Q27520|YRV8_CAEEL|YRV8_CAEEL Putative cytochrome P450 CYP13A1 (EC 1.14.-...    63   9e-09   
sp|P11707|CP36_RABIT|CP36_RABIT Cytochrome P450 3A6 (EC 1.14.14.1) (CYPIIIA...    63   9e-09   
sp|Q9LTM1|C72M_ARATH|C72M_ARATH Cytochrome P450 71B22 (EC 1.14.-.-).>gb:AB0...    63   9e-09   
sp|Q9LW27|C72F_ARATH|C72F_ARATH Cytochrome P450 71B15 (EC 1.14.-.-).>gb:AB0...    63   9e-09   
gb:AK131190_1917777 Homo sapiens cDNA FLJ16008 fis, clone NT2NE2...    62   1e-08   
gb:AY230504_1591463 Candida tropicalis CYP52A17 (CYP52A17) gene,...    62   1e-08   
gb:AF245504_1416691 Sus scrofa 25-hydroxyvitamin D3-24-hydroxyla...    62   1e-08   
gb:AY453407_1327687 Nereis virens CYP4-1 mRNA, partial cds.            62   1e-08   
pir|AG2769|AG2769 cytochrome P450 cyc [imported] - Agrobacterium...    62   1e-08   
pir|T50525|T50525 cytochrome P450 monooxygenase-like protein - A...    62   1e-08   
sp|Q43255|C7C2_MAIZE|C7C2_MAIZE Cytochrome P450 71C2 (EC 1.14.-.-).>pir|T03...    62   1e-08   
gb:BC067437_1987338 Homo sapiens cytochrome P450, family 4, subf...    62   1e-08   
gb:AP005308_1850270 Oryza sativa (japonica cultivar-group) genom...    62   1e-08   
gb:AP003434_1829309 Oryza sativa (japonica cultivar-group) genom...    62   1e-08   
gb:AJ583530_1811350 Triticum aestivum mRNA for cytochrome P450 (...    62   1e-08   
gb:AY281025_1594663 Mentha x gracilis limonene-6-hydroxylase mRN...    62   1e-08   
gb:AY094484_1575777 Arabidopsis thaliana At2g30750/T11J7.14 mRNA...    62   1e-08   
gb:AX028834_1457178 Sequence 18 from Patent WO9732023.                 62   1e-08   
gb:AX025034_1456917 Sequence 2 from Patent WO0031273.>gb:AX06055...    62   1e-08   
pir|T06713|T06713 probable cytochrome P450 T29H11.190 - Arabidop...    62   1e-08   
pir|A34286|A34286 NADPH-ferrihemoprotein reductase (EC 1.6.2.4) ...    62   1e-08   
sp|P14779|CPXB_BACME|CPXB_BACME Bifunctional P-450:NADPH-P450 reductase (Cy...    62   1e-08   
sp|P78329|CPF2_HUMAN|CPF2_HUMAN Cytochrome P450 4F2 (EC 1.14.13.30) (CYPIVF...    62   1e-08   
sp|O49858|C823_SOYBN|C823_SOYBN Cytochrome P450 82A3 (EC 1.14.-.-) (P450 CP...    62   1e-08   
sp|Q9STK9|C71O_ARATH|C71O_ARATH Cytochrome P450 71A24 (EC 1.14.-.-).              62   1e-08   
sp|O49340|C71C_ARATH|C71C_ARATH Cytochrome P450 71A12 (EC 1.14.-.-).>pir|C8...    62   1e-08   
sp|Q9VS79|C4D8_DROME|C4D8_DROME Cytochrome P450 4d8 (EC 1.14.-.-) (CYPIVD8)...    62   1e-08   
gb:BC090091_2566321 Xenopus tropicalis cDNA clone MGC:97602 IMAG...    62   2e-08   
gb:AP004850_1845959 Oryza sativa (japonica cultivar-group) genom...    62   2e-08   
gb:AP004850_1845955 Oryza sativa (japonica cultivar-group) genom...    62   2e-08   
gb:CTRP450B_1674251 Catharanthus roseus Cp3 cytochrome 450 (CYP7...    62   2e-08   
gb:BT011240_1640990 Arabidopsis thaliana At5g24900 gene, complet...    62   2e-08   
gb:AY641449_1619074 Triticum aestivum cultivar Darius cytochrome...    62   2e-08   
gb:AY230505_1591464 Candida tropicalis CYP52A18 (CYP52A18) gene,...    62   2e-08   
gb:AY226829_1591041 Vitis vinifera cytochrome P-450-like protein...    62   2e-08   
gb:AY056284_1563598 Arabidopsis thaliana putative cytochrome P45...    62   2e-08   
gb:AB023038_1515404 Arabidopsis thaliana genomic DNA, chromosome...    62   2e-08   
gb:AB010391_1511071 Yarrowia lipolytica gene for ALK4, complete ...    62   2e-08   
gb:MDU09231_1389521 Musca domestica cytochrome P450 (CYP6A3) gen...    62   2e-08   
pir|T10000|T10000 cytochrome P450 (CYP72C) - Madagascar periwink...    62   2e-08   
pir|T48140|T48140 flavonoid 3',5'-hydroxylase homolog T4C9.140 [...    62   2e-08   
sp|Q9SCN2|C72U_ARATH|C72U_ARATH Cytochrome P450 71B31 (EC 1.14.-.-).>pir|T4...    62   2e-08   
sp|Q9STL1|C71M_ARATH|C71M_ARATH Cytochrome P450 71A22 (EC 1.14.-.-).>pir|T0...    62   2e-08   
sp|P58046|C71F_ARATH|C71F_ARATH Cytochrome P450 71A15 (EC 1.14.-.-).              62   2e-08   
sp|O49342|C71D_ARATH|C71D_ARATH Cytochrome P450 71A13 (EC 1.14.-.-).>pir|E8...    62   2e-08   
sp|O46054|C4AE_DROME|C4AE_DROME Cytochrome P450 4ae1 (EC 1.14.-.-) (CYPIVAE...    62   2e-08   
gb:BC077308_2560022 Xenopus laevis cytochrome P450, family 27, s...    61   2e-08   
gb:AY398422_2531952 Danio rerio clone RK064A2E01 thromboxane A s...    61   2e-08   
gb:AF267126_2483298 Oncorhynchus mykiss cytochrome P450 3A45 mRN...    61   2e-08   
gb:AP003989_1835991 Oryza sativa (japonica cultivar-group) genom...    61   2e-08   
gb:AF124817_1770303 Mentha x piperita cytochrome p450 isoform PM...    61   2e-08   
gb:AY437442_1606171 Triticum aestivum cultivar Ning 7840 cytochr...    61   2e-08   
gb:AJ605545_526759 Streptomyces peucetius cyp0812 gene for putat...    61   2e-08   
sp|Q27515|YRV3_CAEEL|YRV3_CAEEL Putative cytochrome P450 CYP13A6 (EC 1.14.-...    61   2e-08   
gb:BC072702_2556632 Danio rerio cDNA clone IMAGE:7036636, partia...    61   3e-08   
gb:HSU02388_2021419 Homo sapiens cytochrome P450 4F2 (CYP4F2) mR...    61   3e-08   
gb:BC067440_1987341 Homo sapiens cytochrome P450, family 4, subf...    61   3e-08   
gb:BC067438_1987339 Homo sapiens cytochrome P450, family 4, subf...    61   3e-08   
gb:AK090886_1913355 Homo sapiens cDNA FLJ33567 fis, clone BRAMY2...    61   3e-08   
gb:AB01529S12_1864691 Homo sapiens CYP4F2 gene for leukotoriene ...    61   3e-08   
gb:AP005160_1848464 Oryza sativa (japonica cultivar-group) genom...    61   3e-08   
gb:AP000383_1819909 Arabidopsis thaliana genomic DNA, chromosome...    61   3e-08   
gb:AF155773_1772991 Gibberella moniliformis fumonisin biosynthet...    61   3e-08   
gb:AY566988_1615411 Verbena x hybrida flavonoid 3',5'-hydroxylas...    61   3e-08   
gb:AB057672_1521704 Torenia hybrida tht mRNA for flavonoid 3'-hy...    61   3e-08   
gb:AB028462_1517854 Petunia x hybrida imt-5 mRNA for cytochrome ...    61   3e-08   
gb:AX028821_1457170 Sequence 5 from Patent WO9732023.                  61   3e-08   
pir|F86460|F86460 probable cytochrome P450 [imported] - Arabidop...    61   3e-08   
sp|O08394|CYPD_BACSU|CYPD_BACSU Probable bifunctional P-450:NADPH-P450 redu...    61   3e-08   
sp|P98187|CPF8_HUMAN|CPF8_HUMAN Cytochrome P450 4F8 (EC 1.14.14.1) (CYPIVF8...    61   3e-08   
sp|Q9V558|C4P1_DROME|C4P1_DROME Cytochrome P450 4p1 (EC 1.14.-.-) (CYPIVP1)...    61   3e-08   
gb:AF204959_2058958 Mus musculus cytochrome P450 3A25 (CYP3A25) ...    60   4e-08   
gb:AF488522_1804421 Oryza sativa Cyt-P450 monooxygenase (PM-II) ...    60   4e-08   
gb:AF368376_1791919 Nicotiana tabacum elicitor-inducible cytochr...    60   4e-08   
gb:AF249329_1780699 Lycopersicon esculentum putative cytochrome ...    60   4e-08   
gb:OSJN00039_1693725 Oryza sativa genomic DNA, chromosome 4, BAC...    60   4e-08   
gb:AB127340_1528330 Muscari armeniacum MaP450 mRNA for cytochrom...    60   4e-08   
gb:AB122079_1528034 Panax ginseng mRNA for cytochrome P450, comp...    60   4e-08   
gb:AB120221_1527944 Alternaria solani alt1, alt2, alt3, alt4, al...    60   4e-08   
gb:AB026647_1517200 Arabidopsis thaliana genomic DNA, chromosome...    60   4e-08   
gb:AB017064_1513350 Arabidopsis thaliana genomic DNA, chromosome...    60   4e-08   
gb:AF246236_1416692 Ovis aries prostaglandin omega-hydroxylase C...    60   4e-08   
gb:AY593869_1339817 Helicoverpa armigera isolate 14 cytochrome P...    60   4e-08   
gb:AY588586_1339448 Helicoverpa armigera cytochrome P450 (CYP4) ...    60   4e-08   
pir|T05876|T05876 cytochrome P450 homolog T29A15.200 - Arabidops...    60   4e-08   
sp|Q12573|CP5W_CANAP|CP5W_CANAP Cytochrome P450 52E2 (EC 1.14.14.-) (CYPLII...    60   4e-08   
sp|O09158|CP3P_MOUSE|CP3P_MOUSE Cytochrome P450 3A25 (EC 1.14.14.1) (CYPIII...    60   4e-08   
gb:BC021377_2093408 Mus musculus cytochrome P450, family 4, subf...    60   6e-08   
gb:BC069351_1987963 Homo sapiens hypothetical protein FLJ39501, ...    60   6e-08   
gb:AK096820_1914680 Homo sapiens cDNA FLJ39501 fis, clone PROST2...    60   6e-08   
gb:AP005697_1856243 Oryza sativa (japonica cultivar-group) genom...    60   6e-08   
gb:AP004757_1844510 Oryza sativa (japonica cultivar-group) genom...    60   6e-08   
gb:AP001298_1820969 Arabidopsis thaliana genomic DNA, chromosome...    60   6e-08   
gb:AF150881_1772612 Lycopersicon esculentum x Lycopersicon peruv...    60   6e-08   
gb:AC120537_1739920 Oryza sativa chromosome 3 BAC OSJNBb0042N11 ...    60   6e-08   
gb:BT010585_1640531 Arabidopsis thaliana At4g37400 gene, complet...    60   6e-08   
gb:AY087977_1573001 Arabidopsis thaliana clone 40095 mRNA, compl...    60   6e-08   
gb:AY072298_1567116 Zea mays cytochrome P450 monooxygenase CYP71...    60   6e-08   
gb:AX031179_1457266 Sequence 20 from Patent WO9846762.                 60   6e-08   
gb:AY588589_1339451 Helicoverpa armigera cytochrome P450 (CYP4) ...    60   6e-08   
gb:AK028950_1161253 Mus musculus 10 days neonate skin cDNA, RIKE...    60   6e-08   
pir|JC8026|JC8026 cytochrome P450 enzyme, CYP4C39 enzyme - green...    60   6e-08   
pir|T04734|T04734 cytochrome P450 homolog F6G17.50 - Arabidopsis...    60   6e-08   
sp|P51869|CPF4_RAT|CPF4_RAT Cytochrome P450 4F4 (EC 1.14.14.1) (CYPIVF4)....    60   6e-08   
sp|P30610|CP5H_CANTR|CP5H_CANTR Cytochrome P450 52A8 (EC 1.14.14.-) (CYPLII...    60   6e-08   
sp|Q9LIP3|C72Y_ARATH|C72Y_ARATH Cytochrome P450 71B37 (EC 1.14.-.-).              60   6e-08   
gb:BC088492_2565625 Xenopus tropicalis hypothetical LOC496805, m...    60   7e-08   
gb:BC059313_2552351 Xenopus laevis hypothetical protein MGC68990...    60   7e-08   
gb:AY452279_2533398 Danio rerio cytochrome P450 3A65 mRNA, compl...    60   7e-08   
gb:BC078713_2106878 Rattus norvegicus cytochrome P450 4F6, mRNA ...    60   7e-08   
gb:AF368377_1791920 Nicotiana tabacum elicitor-inducible cytochr...    60   7e-08   
gb:HTCYP76B1_1682162 H.tuberosus mRNA for 7-ethoxycoumarin O-dee...    60   7e-08   
gb:AY462227_1607540 Hordeum lechleri Bx2-like protein mRNA, comp...    60   7e-08   
gb:AY281026_1594664 Mentha x gracilis cytochrome P450 mRNA, comp...    60   7e-08   
gb:AB078738_1523758 Aspergillus oryzae CYP505A3 gene for fatty a...    60   7e-08   
gb:AB042630_1519903 Triticum aestivum CYP71C9v1 mRNA for P450, c...    60   7e-08   
gb:HAU86005_1385688 Helicoverpa armigera cytochrome p450 (CYP4M4...    60   7e-08   
gb:AF072851_1238870 Lytechinus anamesis cytochrome p450 CYP4C20 ...    60   7e-08   
gb:AY596297_634467 Haloarcula marismortui ATCC 43049 chromosome ...    60   7e-08   
pir|T10895|T10895 cytochrome P450 76B1, xenobiotic-inducible - J...    60   7e-08   
sp|P51871|CPF6_RAT|CPF6_RAT Cytochrome P450 4F6 (EC 1.14.14.1) (CYPIVF6)....    60   7e-08   
sp|Q43257|C7C4_MAIZE|C7C4_MAIZE Cytochrome P450 71C4 (EC 1.14.-.-).>pir|T03...    60   7e-08   
sp|O23976|C76B_HELTU|C76B_HELTU Cytochrome P450 76B1 (EC 1.14.-.-) (7-ethox...    60   7e-08   
gb:AP006237_1861516 Oryza sativa (japonica cultivar-group) genom...    59   9e-08   
gb:AP005308_1850271 Oryza sativa (japonica cultivar-group) genom...    59   9e-08   
gb:AP003765_1833195 Oryza sativa (japonica cultivar-group) genom...    59   9e-08   
gb:AF124816_1770302 Mentha x piperita cytochrome p450 isoform PM...    59   9e-08   
gb:AC082644_1733155 Oryza sativa chromosome 3 BAC OSJNBa0013M12 ...    59   9e-08   
gb:CRO011862_1673459 Catharanthus roseus mRNA for flavonoid 3',5...    59   9e-08   
gb:AB019226_1514067 Arabidopsis thaliana genomic DNA, chromosome...    59   9e-08   
gb:AB012925_1511971 Torenia hybrida mRNA for flavonoid 3',5'-hyd...    59   9e-08   
gb:AX028819_1457169 Sequence 3 from Patent WO9732023.                  59   9e-08   
gb:AY062206_1293546 Anopheles gambiae cytochrome P450 CYP4H24 (C...    59   9e-08   
gb:AE016959_1021110 Oryza sativa (japonica cultivar-group) chrom...    59   9e-08   
sp|Q42716|C718_MENPI|C718_MENPI Cytochrome P450 71A8 (EC 1.14.-.-).>pir|S45...    59   9e-08   
gb:AP005160_1848456 Oryza sativa (japonica cultivar-group) genom...    59   1e-07   
gb:AP003909_1835059 Oryza sativa (japonica cultivar-group) genom...    59   1e-07   
gb:AF488521_1804420 Oryza sativa Cyt-P450 monooxygenase (PM-I) m...    59   1e-07   
gb:AF321868_1786048 Lolium rigidum clone Lol-78 putative cytochr...    59   1e-07   
gb:AF321867_1786047 Lolium rigidum clone Lol-62 putative cytochr...    59   1e-07   
gb:AF321855_1786035 Lolium rigidum clone FHH-v putative cytochro...    59   1e-07   
gb:AF313490_1785223 Lycianthes rantonnei flavonoid 3',5'-hydroxy...    59   1e-07   
gb:AF156976_1773054 Gerbera hybrida flavone synthase II (CYP93B2...    59   1e-07   
gb:AF122821_1769853 Capsicum annuum cytochrome P450 (PepCYP) mRN...    59   1e-07   
gb:CR382129_1661729 Yarrowia lipolytica chromosome C of strain C...    59   1e-07   
gb:AY870918_1631571 Tanacetum vulgare isolate cy450P3D4_4 cytoch...    59   1e-07   
gb:AY675561_1621950 Solanum tuberosum flavonoid 3',5'-hydroxylas...    59   1e-07   
gb:AY085385_1570455 Arabidopsis thaliana clone 149380 mRNA, comp...    59   1e-07   
gb:AY345971_1321639 Solenopsis invicta cytochrome P450 CYP4AB2 (...    59   1e-07   
gb:SCO939106_174476 Streptomyces coelicolor A3(2) complete genom...    59   1e-07   
pir|A29487|A29487 cytochrome P450 3A6 (version 1) - rabbit>gb:RA...    59   1e-07   
sp|Q12587|CP5Q_CANMA|CP5Q_CANMA Cytochrome P450 52C2 (EC 1.14.14.-) (CYPLII...    59   1e-07   
sp|O04164|C716_NEPRA|C716_NEPRA Cytochrome P450 71A6 (EC 1.14.-.-) (Fragmen...    59   1e-07   
sp|Q9VJ71|C310_DROME|C310_DROME Probable cytochrome P450 310a1 (EC 1.14.-.-...    59   1e-07   
gb:BC076033_2558916 Danio rerio cDNA clone IMAGE:7046264, partia...    59   2e-07   
gb:BC060001_2552781 Xenopus laevis cDNA clone MGC:68549 IMAGE:40...    59   2e-07   
gb:AY540622_2536835 Anguilla japonica cytochrome P450 aromatase ...    59   2e-07   
gb:AB164064_2466751 Cynops pyrrhogaster P450 arom mRNA for cytoc...    59   2e-07   
gb:AF321870_1786050 Lolium rigidum clone Lol-83 putative cytochr...    59   2e-07   
gb:AF166332_1774015 Nicotiana tabacum cytochrome P450 gene, comp...    59   2e-07   
gb:AF123602_1769932 Triticum aestivum clone CYP71C2-21TA cytochr...    59   2e-07   
gb:AC135564_1742594 Oryza sativa chromosome 3 BAC OSJNBb0056O10 ...    59   2e-07   
gb:PAJ10324_1698705 Populus trichocarpa cv trichobel mRNA for fe...    59   2e-07   
gb:AY532371_1612054 Ammi majus cytochrome P450 (CYP98A21) mRNA, ...    59   2e-07   
gb:AY230507_1591466 Candida tropicalis CYP52A20 (CYP52A20) gene,...    59   2e-07   
gb:AB067685_1522605 Solanum tuberosum mRNA for putative cytochro...    59   2e-07   
gb:AB042631_1519904 Triticum aestivum CYP71C9v2 mRNA for P450, c...    59   2e-07   
gb:AF072850_1238869 Lytechinus anamesis cytochrome p450 CYP4C19 ...    59   2e-07   
gb:AE017333_448680 Bacillus licheniformis DSM 13, complete genom...    59   2e-07   
pir|JC7120|JC7120 cytochrome P450 enzyme CYP4C15 - spinycheek cr...    59   2e-07   


>pir|G96611|G96611 probable cytochrome P450 T8L23.21 [imported] -
           Arabidopsis thaliana>gb:AE005173_893568 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AY090941_1574216 Arabidopsis thaliana
           putative cytochrome P450 (At1g57750) mRNA, complete
           cds.>gb:BT005810_1638732 Arabidopsis thaliana
           At1g57750/T8L23_21 gene, complete
           cds.>gb:AC079733_1732764 Arabidopsis thaliana chromosome
           1 BAC T8L23 genomic sequence, complete
           sequence.>gb:AF419610_1798472 Arabidopsis thaliana
           At1g57750/T8L23_21 mRNA, complete cds.
          Length = 497

 Score =  189 bits (481), Expect = 5e-47
 Identities = 89/176 (50%), Positives = 126/176 (71%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           PQV AK+ H+I         F  E+ +KL YLHAA  ES+ L+PP+P NHK+P + D+LP
Sbjct: 329 PQVMAKLRHEI------NTKFDNEDLEKLVYLHAALSESMRLYPPLPFNHKSPAKPDVLP 382

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
           SGH V  N+KI++  Y++GRM +VWGED ++FKPERWIS +GG++ +PSYKF  FN+GPR
Sbjct: 383 SGHKVDANSKIVICIYALGRMRSVWGEDALDFKPERWISDNGGLRHEPSYKFMAFNSGPR 442

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           TC+G+++A   +KMVA  II +Y F+++E H +E +   S++L  KHGLKV   K+
Sbjct: 443 TCLGKNLALLQMKMVALEIIRNYDFKVIEGHKVEPI--PSILLRMKHGLKVTVTKK 496



>pir|T09364|T09364 cytochrome P450 homolog F23K16.110 - Arabidopsis
           thaliana>gb:ATCHRIV91_1547932 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           91.>gb:ATF23K16_1549773 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F23K16 (ESSA project).
          Length = 516

 Score =  180 bits (457), Expect = 3e-44
 Identities = 88/160 (55%), Positives = 110/160 (68%)
 Frame = -1

Query: 827 DKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFY 648
           D   F  +E +KL YLH A CE+L L+PPVP NHK+P + D+LPSGH V  N++I+   Y
Sbjct: 356 DSDSFNPQEVKKLVYLHGAVCEALRLYPPVPFNHKSPAKPDVLPSGHKVKANSRILFCLY 415

Query: 647 SMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVA 468
           S+GRM +VWGED MEFKPERWIS  G    +PSYKF  FNAGPRTC+G+++A T +K VA
Sbjct: 416 SLGRMKSVWGEDAMEFKPERWISESGRSVHEPSYKFLSFNAGPRTCLGKEVAMTQMKTVA 475

Query: 467 ATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
             II +Y   +VE H  +I    S+IL  KHGLKV   KR
Sbjct: 476 VKIIQNYDINVVEGH--KIKPAPSVILHMKHGLKVTVSKR 513



>pir|T09365|T09365 cytochrome P450 homolog F23K16.120 - Arabidopsis
           thaliana>gb:ATCHRIV91_1547933 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           91.>gb:ATF23K16_1549774 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F23K16 (ESSA project).
          Length = 479

 Score =  179 bits (453), Expect = 8e-44
 Identities = 86/160 (53%), Positives = 109/160 (68%)
 Frame = -1

Query: 827 DKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFY 648
           D   F  +E +KL YLH A CESL L+PPVP  HK+P + D+LPSGH V  N+KI+   Y
Sbjct: 319 DSDSFSPQELKKLVYLHGAICESLRLYPPVPFQHKSPTKPDVLPSGHKVDANSKILFCLY 378

Query: 647 SMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVA 468
           S+GRM +VWGED +EFKPERWIS  G    +PSYKF  FNAGPRTC+G+++A   +K VA
Sbjct: 379 SLGRMKSVWGEDALEFKPERWISESGNSVHEPSYKFLSFNAGPRTCLGKEVAMMQMKSVA 438

Query: 467 ATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
             II +Y+ ++VE   +E     S+IL  KHGLKV   KR
Sbjct: 439 VKIIQNYEMKIVEGQQIEP--APSVILHMKHGLKVTVTKR 476



>pir|T00514|T00514 cytochrome P450 homolog T20D16.19 - Arabidopsis
           thaliana>gb:AC002391_1530640 Arabidopsis thaliana
           chromosome 2 clone T20D16 map CIC06C07, complete
           sequence.>gb:AF370589_1792372 Arabidopsis thaliana
           putative cytochrome P450 (At2g23180; T20D16.19) mRNA,
           complete cds.>gb:AK117717_1815737 Arabidopsis thaliana
           At2g23180 mRNA for putative cytochrome P450, complete
           cds, clone: RAFL17-39-M03.
          Length = 516

 Score =  175 bits (444), Expect = 9e-43
 Identities = 83/156 (53%), Positives = 109/156 (69%)
 Frame = -1

Query: 815 FKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGR 636
           F  +E  KL Y+H A CE+L L+PPVP  HK+P + D+LPSGH V  ++KI+   YS+GR
Sbjct: 359 FNAQELNKLVYVHGALCEALRLYPPVPFQHKSPTKSDVLPSGHRVDASSKIVFCLYSLGR 418

Query: 635 MDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVAATII 456
           M +VWGED  EFKPERWIS  G +   PS+KF  FNAGPRTC+G+++A T +K VA  II
Sbjct: 419 MKSVWGEDASEFKPERWISESGRLIHVPSFKFLSFNAGPRTCLGKEVAMTQMKTVAVKII 478

Query: 455 CHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
            +Y+ ++VE H +E +   S+IL  KHGLKV   KR
Sbjct: 479 QNYEIKVVEGHKIEPV--PSIILHMKHGLKVTVTKR 512



>pir|T09366|T09366 cytochrome P450 homolog F23K16.130 - Arabidopsis
           thaliana>gb:ATCHRIV91_1547934 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           91.>gb:ATF23K16_1549775 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F23K16 (ESSA project).
          Length = 469

 Score =  168 bits (426), Expect = 1e-40
 Identities = 77/175 (44%), Positives = 115/175 (65%)
 Frame = -1

Query: 872 QVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPS 693
           QV +KI  +I+     K     E   KL YLH A CE++ L+PPV    K+P++ D+LPS
Sbjct: 294 QVVSKIRQEIINTNPSKNGNGQENLDKLVYLHGALCEAMRLYPPVSFGRKSPIKSDVLPS 353

Query: 692 GHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRT 513
           GH V  N+KII+  Y++GRM  VWG+D +EFKPERW+S  G ++ +PS+KF  FN+GPRT
Sbjct: 354 GHKVQANSKIIICLYALGRMRAVWGDDALEFKPERWVSDKGSLRHEPSFKFLSFNSGPRT 413

Query: 512 CIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           C+G+ +A T +KMVA  I+ +Y+ ++++   ++ +     IL  KHGL++   KR
Sbjct: 414 CLGKHLAMTQMKMVAVEILHNYEIKVIKGQKIKPVL--GFILSMKHGLRITITKR 466



>pir|F84606|F84606 probable cytochrome P450 [imported] - Arabidopsis
           thaliana>gb:AC007019_1535014 Arabidopsis thaliana
           chromosome 2 clone F7D8 map mi238, complete sequence.
          Length = 510

 Score =  168 bits (425), Expect = 1e-40
 Identities = 83/178 (46%), Positives = 116/178 (65%), Gaps = 2/178 (1%)
 Frame = -1

Query: 875 PQVEAKILHDI-LQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDIL 699
           P+   KI  +I   L         ++  K+ YLH A CESL L+ P+P   K P+++D+L
Sbjct: 331 PEAVTKIRQEINTNLPGSGMSLDADKLNKMVYLHGALCESLRLYAPIPFERKTPIKQDVL 390

Query: 698 PSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISP-DGGIKRQPSYKFSVFNAG 522
           PSGH+V  N KI+   Y++GRM +VWG+D  EFKPERWIS  +GG+K +PS+KF VFN+G
Sbjct: 391 PSGHMVDKNWKILFSVYALGRMRSVWGQDASEFKPERWISERNGGLKHEPSFKFFVFNSG 450

Query: 521 PRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           PR C+G++++F  +K VA  II +Y  ++VE H +E     S+IL  KHGLKV   KR
Sbjct: 451 PRNCLGKNLSFLQMKTVAVEIIRNYDIKVVEGHKIEP--ASSIILHMKHGLKVTVSKR 506



>pir|T02357|T02357 cytochrome P450 homolog T8F5.12 - Arabidopsis
           thaliana>gb:AE005173_894187 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:T8F5_1724147 Arabidopsis thaliana
           chromosome 1 BAC T8F5 sequence, complete sequence.
          Length = 503

 Score =  166 bits (420), Expect = 5e-40
 Identities = 76/155 (49%), Positives = 105/155 (67%)
 Frame = -1

Query: 815 FKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGR 636
           F   + +KL YLH A CE+L L+PPVP NHK+P + D+LPSGH V    KI++  Y++GR
Sbjct: 350 FDPADLEKLVYLHGAVCETLRLYPPVPFNHKSPAKPDVLPSGHRVDEKWKIVISMYALGR 409

Query: 635 MDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVAATII 456
           M +VWG+D  +F+PERWIS  G +K +PSYKF  FNAGPR C+G+ + F  +K VAA II
Sbjct: 410 MKSVWGDDAEDFRPERWISDSGRLKHEPSYKFLAFNAGPRACLGKKLTFLQMKTVAAEII 469

Query: 455 CHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIK 351
            +Y  ++VE H  E +   S++   +HGLKV   +
Sbjct: 470 RNYDIKVVEGHKTEPV--PSVLFRMQHGLKVNITR 502



>pir|B96517|B96517 hypothetical protein F16N3.8 [imported] -
           Arabidopsis thaliana>gb:AE005173_892720 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:BT010614_1640560 Arabidopsis thaliana
           At1g47620 gene, complete cds.>gb:F16N3_1677612 Sequence
           of BAC F16N3 from Arabidopsis thaliana chromosome 1,
           complete sequence.>gb:AK176279_1818267 Arabidopsis
           thaliana mRNA for hypothetical protein, complete cds,
           clone: RAFL23-20-L10.>gb:AK176323_1818311 Arabidopsis
           thaliana mRNA for hypothetical protein, complete cds,
           clone: RAFL23-29-H14.
          Length = 520

 Score =  166 bits (419), Expect = 7e-40
 Identities = 75/149 (50%), Positives = 104/149 (69%)
 Frame = -1

Query: 794 KLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGE 615
           KL YLH A  ES+ L+PP+P   K+P+++D+LPSGH V  N  I++  Y+MGRM T+WGE
Sbjct: 369 KLVYLHGALSESMRLYPPIPFQRKSPIKEDVLPSGHKVKSNINIMIFIYAMGRMKTIWGE 428

Query: 614 DCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQL 435
           D MEFKPERWIS  GG++ +PSYKF  FNAGPRTC+G+++A  ++K V   I+ +Y+ ++
Sbjct: 429 DAMEFKPERWISETGGVRHEPSYKFLSFNAGPRTCLGKNLAMNLMKTVIVEILQNYEIKI 488

Query: 434 VEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           V    +E      +IL  KHGLKV   K+
Sbjct: 489 VSGQKIEP--KPGLILHMKHGLKVTMTKK 515



>pir|T04628|T04628 cytochrome P450 homolog F10M6.190 - Arabidopsis
           thaliana>gb:ATCHRIV76_1547138 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 76.>gb:ATF10M6_1548205
           Arabidopsis thaliana DNA chromosome 4, BAC clone F10M6
           (ESSAII project).>gb:ATF10N7_1548208 Arabidopsis
           thaliana DNA chromosome 4, BAC clone F10N7 (ESSA
           project).
          Length = 506

 Score =  165 bits (417), Expect = 1e-39
 Identities = 82/177 (46%), Positives = 115/177 (64%), Gaps = 1/177 (0%)
 Frame = -1

Query: 875 PQVEAKILHDI-LQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDIL 699
           P V AKI  +I +     +     E   KL YLH A CE++ L+PPV    K+P++ D+L
Sbjct: 329 PHVVAKIHQEININTDLSRTGNSQENVDKLVYLHGALCEAMRLYPPVSFGRKSPIKSDVL 388

Query: 698 PSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGP 519
           PSGH V  N+KII+  Y++GRM  VWGED  +FKPERWIS +GGIK +PS+KF  FNAGP
Sbjct: 389 PSGHKVDANSKIIICLYALGRMRAVWGEDASQFKPERWISENGGIKHEPSFKFLSFNAGP 448

Query: 518 RTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           RTC+G+ +A T +K+VA  I+ +Y  ++++    +I+     IL  KHGL++   KR
Sbjct: 449 RTCLGKHLAMTQMKIVAVEILRNYDIKVLQGQ--KIVPALGFILSMKHGLQITVTKR 503



>pir|C96517|C96517 hypothetical protein F16N3.7 [imported] -
           Arabidopsis thaliana>gb:AE005173_892721 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:F16N3_1677611 Sequence of BAC F16N3 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 512

 Score =  162 bits (410), Expect = 8e-39
 Identities = 73/144 (50%), Positives = 101/144 (70%)
 Frame = -1

Query: 794 KLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGE 615
           KL YLH A  ES+ L+PP+P   K+P++ D+LPSGH V  N  I++  Y+MGRM T+WGE
Sbjct: 361 KLVYLHGALNESMRLYPPIPFERKSPIKDDVLPSGHKVKSNLNIMIFIYAMGRMKTIWGE 420

Query: 614 DCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQL 435
           D MEFKPERWIS  GG++ +PSYKF  FNAGPRTC+G+++A  ++K V   I+ +Y+ ++
Sbjct: 421 DAMEFKPERWISETGGLRHEPSYKFFSFNAGPRTCLGKNLAMNLMKTVIVEILQNYEIKI 480

Query: 434 VEFHHLEILFTDSMILEKKHGLKV 363
           V    +E      ++L  KHGLKV
Sbjct: 481 VSGQKIEA--KPGLVLHMKHGLKV 502



>gb:AB019226_1514059 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K24M7.
          Length = 502

 Score =  161 bits (407), Expect = 2e-38
 Identities = 80/177 (45%), Positives = 116/177 (65%), Gaps = 2/177 (1%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVE--ECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDI 702
           P+   KI  +I     +KK+ K +  +  KL YL  A CE+L L+P VP NHK+P + D+
Sbjct: 332 PEAMTKIRQEI-----NKKMPKFDPADLDKLVYLDGAVCETLRLYPSVPFNHKSPAKPDV 386

Query: 701 LPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAG 522
           LPSGH V  N ++++P YS+GRM +VWG+D  +F+PERWIS  G ++++ SYKF  FNAG
Sbjct: 387 LPSGHKVDKNWRVVIPIYSLGRMKSVWGDDAEDFRPERWISDSGMLRQESSYKFLAFNAG 446

Query: 521 PRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIK 351
           PRTC+G+ + F  +K VA  II +Y  ++VE H  + +   S++L  +HGLKV   K
Sbjct: 447 PRTCLGKRLTFLQMKTVAVEIIRNYDIKVVEGHKPKPV--PSVLLRMQHGLKVSVTK 501



>gb:AK118220_1816210 Arabidopsis thaliana At5g52320 mRNA for
           putative cytochrome P450, complete cds, clone:
           RAFL19-53-N09.
          Length = 502

 Score =  159 bits (402), Expect = 7e-38
 Identities = 79/177 (44%), Positives = 115/177 (64%), Gaps = 2/177 (1%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVE--ECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDI 702
           P+   KI  +I     +KK+ K +  +  KL YL  A CE+L L+P VP NHK+P + D+
Sbjct: 332 PEAMTKIRQEI-----NKKMPKFDPADLDKLVYLDGAVCETLRLYPSVPFNHKSPAKPDV 386

Query: 701 LPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAG 522
           LPSGH V  N ++++P YS+GRM +VWG+D  +F+PERWIS  G ++++  YKF  FNAG
Sbjct: 387 LPSGHKVDKNWRVVIPIYSLGRMKSVWGDDAEDFRPERWISDSGMLRQESPYKFLAFNAG 446

Query: 521 PRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIK 351
           PRTC+G+ + F  +K VA  II +Y  ++VE H  + +   S++L  +HGLKV   K
Sbjct: 447 PRTCLGKRLTFLQMKTVAVEIIRNYDIKVVEGHKPKPV--PSVLLRMQHGLKVSVTK 501



>pir|T09367|T09367 cytochrome P450 homolog F23K16.140 - Arabidopsis
           thaliana>gb:ATCHRIV91_1547935 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           91.>gb:ATF23K16_1549776 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F23K16 (ESSA
           project).>gb:AY058837_1564374 Arabidopsis thaliana
           AT4g39510/F23K16_140 mRNA, complete
           cds.>gb:BT003025_1636607 Arabidopsis thaliana
           At4g39510/F23K16_140 gene, complete cds.
          Length = 508

 Score =  158 bits (399), Expect = 1e-37
 Identities = 81/181 (44%), Positives = 112/181 (61%), Gaps = 5/181 (2%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFK-----VEECQKLTYLHAAFCESLGLFPPVPLNHKNPME 711
           PQV  KI  +I+    DK + K      E   KL YLHAA  ES+ L+PPV    K+P++
Sbjct: 331 PQVVTKIRKEII----DKNISKDGRNGQENLDKLVYLHAALYESMRLYPPVAFQRKSPIK 386

Query: 710 KDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVF 531
            D+LPSGH V  N+ II+  +++GRM  VWGED  EFKPERW+S  GG++  PS+KF  F
Sbjct: 387 PDVLPSGHKVEANSVIIIFLFALGRMRAVWGEDATEFKPERWVSESGGLRHAPSFKFLSF 446

Query: 530 NAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIK 351
           NAGPRTC G+ +A T++K V   I+ +Y   +++   +E      ++L  KHGL+V   K
Sbjct: 447 NAGPRTCPGKQLAMTLMKTVVVEILQNYDIDVIKGQKIEP--EPGLMLHMKHGLRVTITK 504

Query: 350 R 348
           R
Sbjct: 505 R 505



>gb:AP002484_1822231 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0489A01.
          Length = 510

 Score =  157 bits (398), Expect = 2e-37
 Identities = 75/181 (41%), Positives = 120/181 (66%), Gaps = 5/181 (2%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQ-----DKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPME 711
           P VEA+IL ++  L+      D  VF+ +  +   YL AA  E+L LFP  P   K  + 
Sbjct: 329 PHVEARILQELKGLQSSTWPGDLHVFEWDTLRSAIYLQAALLETLRLFPATPFEEKEALV 388

Query: 710 KDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVF 531
            D+LP+G  V+ NT+II   Y+MGR++ +WG+DCMEFKPERW+S  G ++ +PSYKF  F
Sbjct: 389 DDVLPNGTKVSRNTRIIFSLYAMGRIEGIWGKDCMEFKPERWVSKSGRLRHEPSYKFLSF 448

Query: 530 NAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIK 351
           N GPR+C+G++++ + +K++ A+II +++ +LVE H  E++   S+IL  ++G+ V+  +
Sbjct: 449 NTGPRSCLGKELSLSNMKIIVASIIHNFKVELVEGH--EVMPQSSVILHTQNGMMVRLKR 506

Query: 350 R 348
           R
Sbjct: 507 R 507



>gb:AE016959_1023166 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC087182_1733971
           Oryza sativa chromosome 10 BAC OSJNBa0029C15 genomic
           sequence, complete sequence.>gb:AE017107_1752985 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           61 of 77 of the complete sequence.
          Length = 560

 Score =  157 bits (396), Expect = 3e-37
 Identities = 81/194 (41%), Positives = 116/194 (59%), Gaps = 18/194 (9%)
 Frame = -1

Query: 875 PQVEAKILHDILQL------------------KQDKKVFKVEECQKLTYLHAAFCESLGL 750
           P VEAKIL +I  +                   +D  VF  EE +K+ YLHAA  E+L L
Sbjct: 365 PAVEAKILEEIDDIVAARRSSPPAPAVAANGADEDDLVFHPEEVKKMEYLHAALSEALRL 424

Query: 749 FPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDG 570
           +P VP++HK  +E ++ P G V+   TK+I   Y+MGRM+++WGEDC E+KPERW+  DG
Sbjct: 425 YPSVPVDHKEVVEDEVFPDGTVLKKGTKVIYAMYTMGRMESIWGEDCREYKPERWLR-DG 483

Query: 569 GIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMI 390
               + +YKF+ FN GPR C+G+D A+  +K  AA+I+  Y  ++V+ H +      +M 
Sbjct: 484 RFMGESAYKFTAFNGGPRLCLGKDFAYYQMKFAAASILRRYHVRVVDGHPVAPKMALTMY 543

Query: 389 LEKKHGLKVKFIKR 348
           +  KHGLKVK  KR
Sbjct: 544 M--KHGLKVKLTKR 555



>gb:AJ606074_1811952 Gossypium hirsutum mRNA for cytochrome
           P450-like protein (cyP450 gene), strain Xuzhou 142.
          Length = 511

 Score =  155 bits (391), Expect = 1e-36
 Identities = 81/183 (44%), Positives = 118/183 (64%), Gaps = 7/183 (3%)
 Frame = -1

Query: 875 PQVEAKILHDI---LQLKQDKKVFKV----EECQKLTYLHAAFCESLGLFPPVPLNHKNP 717
           P VE KI  +I   L +KQ +   ++    +E  KLTYLHAA CE+L L+PP+P + +  
Sbjct: 329 PVVENKIREEIKRHLSMKQVEGSLQIPSNYDELSKLTYLHAALCETLRLYPPIPFDFRTC 388

Query: 716 MEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFS 537
            +++ LPSGH V  NT+II+  ++MGRM+++WGEDC  FKPERWI  DG IKR+   KFS
Sbjct: 389 TKQEYLPSGHRVDQNTRIIIGIHAMGRMESLWGEDCYAFKPERWIGEDGKIKRESPTKFS 448

Query: 536 VFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKF 357
            F AGPR C G++++F ++K  A  II +Y   +VE  ++     +S++ + K GL V+ 
Sbjct: 449 AFLAGPRICPGKEVSFLLMKATATAIIHNYNVHVVEGQNIGP--KNSVVYQMKKGLMVRI 506

Query: 356 IKR 348
            KR
Sbjct: 507 KKR 509



>gb:AC135425_1742343 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0453H11, complete sequence.
          Length = 467

 Score =  153 bits (387), Expect = 4e-36
 Identities = 77/187 (41%), Positives = 117/187 (62%), Gaps = 10/187 (5%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKK----VFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEK 708
           P VEAKIL ++  L         VF  +E +  TYLHAA  E+L L+P  P   K  +  
Sbjct: 281 PHVEAKILDELRSLHTTTTAGAVVFDADELRAATYLHAAVLETLRLYPSAPFEEKEAVGD 340

Query: 707 DILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISP---DGG---IKRQPSY 546
           D+LP G  V   T+++   Y+MGR++ +WG DC EF+PERW+S    DGG   ++++PSY
Sbjct: 341 DVLPGGTAVRKGTRVVFCLYAMGRVEGIWGSDCREFRPERWLSTGDGDGGAGKVRQEPSY 400

Query: 545 KFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLK 366
           KF+ FNAGPR+C+G+D+  + +K+ AA I+ ++  +LV  H +E    DS++L  K+GL 
Sbjct: 401 KFAAFNAGPRSCLGKDLGLSNIKIAAAAIVYNFTVELVAGHVVEP--KDSVVLHTKNGLM 458

Query: 365 VKFIKRK 345
           V+  +R+
Sbjct: 459 VRVKRRE 465



>gb:AY485644_1608500 Triticum monococcum phosphatidylserine
           decarboxylase, ZCCT2, ZCCT1, and SNF2P genes, complete
           cds; nucellin pseudogene, complete sequence; putative
           transposase, phosphatidylinositol phosphatidylcholine
           transfer protein sec14 cytosolic-like protein, and
           phytochrome P450-like protein genes, complete cds; and
           unknown genes.
          Length = 516

 Score =  149 bits (377), Expect = 5e-35
 Identities = 73/186 (39%), Positives = 114/186 (61%), Gaps = 9/186 (4%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQ---------DKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHK 723
           P VEA+I+ +I  L Q            V   +  ++  YL AAF E+L LFP  P    
Sbjct: 329 PHVEARIIEEITALLQLQSTTMPAGSLSVLDGDMLRQAVYLQAAFLETLRLFPASPFEEV 388

Query: 722 NPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYK 543
             +  D LP+G  ++  T+I+   Y+MGR++ +WG+DC EF+PERW+S  G ++ QP YK
Sbjct: 389 EAVNDDALPNGTRLSKGTRIVFSLYAMGRLEGIWGKDCAEFRPERWLSKSGRLRHQPGYK 448

Query: 542 FSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKV 363
           F  FNAGPR+C+G+D+A   +KM+AA+II +++ QLVE H   ++   S++L  ++G+ V
Sbjct: 449 FPAFNAGPRSCVGKDLALGSMKMIAASIIYNFKVQLVEGH--AVMPGSSIVLHTRNGIMV 506

Query: 362 KFIKRK 345
              +R+
Sbjct: 507 SLKRRE 512



>gb:AP002484_1822232 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0489A01.
          Length = 505

 Score =  149 bits (376), Expect = 7e-35
 Identities = 79/179 (44%), Positives = 107/179 (59%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P VEA+IL    +L+         E ++L YLHAA  ESL L+PPVP  HK     D LP
Sbjct: 333 PGVEARIL---AELRAHPPSPTGAELKRLVYLHAALSESLRLYPPVPFEHKAAARPDTLP 389

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
           SG  V P  ++I+  YSMGRM+ VWG+ C EF+PERW++P G  + + S KF+ FN GPR
Sbjct: 390 SGAAVGPTRRVIVSLYSMGRMEAVWGKGCEEFRPERWLTPAGRFRHERSCKFAAFNVGPR 449

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKRK*D 339
           TC+GRD+AF  +K V A ++  ++           L   S+IL  + GLKVK  +R+ D
Sbjct: 450 TCLGRDLAFAQMKAVVAAVVPRFRVAAAAAPPRPKL---SIILHMRDGLKVKVHRRQED 505



>gb:AY136363_1581864 Arabidopsis thaliana cytochrome P450-like
           protein (At5g08250) mRNA, complete
           cds.>gb:BT000178_1634456 Arabidopsis thaliana cytochrome
           P450-like protein (At5g08250) mRNA, complete cds.
          Length = 488

 Score =  149 bits (375), Expect = 9e-35
 Identities = 74/189 (39%), Positives = 114/189 (60%), Gaps = 13/189 (6%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDK-------------KVFKVEECQKLTYLHAAFCESLGLFPPVP 735
           P+VE KI+  I ++ + +              VF+ EE +K+ YL AA  E+L L+P VP
Sbjct: 291 PEVEEKIMMGICKILEQRVDHGDTKKNMEYEPVFRPEEIKKMDYLQAALSETLRLYPSVP 350

Query: 734 LNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQ 555
           ++HK  +E D+ P G  +    K+I   Y+MGRM+T+WG+DC EFKPERW+  DG    +
Sbjct: 351 VDHKEVLEDDVFPDGTKLKKGEKVIYAIYAMGRMETIWGKDCREFKPERWLR-DGRYMSE 409

Query: 554 PSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKH 375
            +YKF+ FN GPR C+G+D A+  ++ VAA II  Y+ ++ +    ++    ++ +  KH
Sbjct: 410 SAYKFTAFNGGPRLCLGKDFAYYQMRYVAAAIIYRYKVRVDDKGGHKVEPKMALTMYMKH 469

Query: 374 GLKVKFIKR 348
           GLKV  +KR
Sbjct: 470 GLKVNMVKR 478



>pir|T50510|T50510 cytochrome P450-like protein - Arabidopsis
           thaliana>gb:ATT22D6_1555236 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T22D6 (ESSA project).
          Length = 550

 Score =  149 bits (375), Expect = 9e-35
 Identities = 74/189 (39%), Positives = 114/189 (60%), Gaps = 13/189 (6%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDK-------------KVFKVEECQKLTYLHAAFCESLGLFPPVP 735
           P+VE KI+  I ++ + +              VF+ EE +K+ YL AA  E+L L+P VP
Sbjct: 353 PEVEEKIMMGICKILEQRVDHGDTKKNMEYEPVFRPEEIKKMDYLQAALSETLRLYPSVP 412

Query: 734 LNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQ 555
           ++HK  +E D+ P G  +    K+I   Y+MGRM+T+WG+DC EFKPERW+  DG    +
Sbjct: 413 VDHKEVLEDDVFPDGTKLKKGEKVIYAIYAMGRMETIWGKDCREFKPERWLR-DGRYMSE 471

Query: 554 PSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKH 375
            +YKF+ FN GPR C+G+D A+  ++ VAA II  Y+ ++ +    ++    ++ +  KH
Sbjct: 472 SAYKFTAFNGGPRLCLGKDFAYYQMRYVAAAIIYRYKVRVDDKGGHKVEPKMALTMYMKH 531

Query: 374 GLKVKFIKR 348
           GLKV  +KR
Sbjct: 532 GLKVNMVKR 540



>gb:AB007648_1510195 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MKD15.>gb:BT002045_1635648 Arabidopsis thaliana
           cytochrome P450-like protein (At5g23190) mRNA, complete
           cds.>gb:AF345898_1789924 Arabidopsis thaliana CYP86B1
           mRNA, complete cds; nuclear gene for chloroplast
           product.
          Length = 559

 Score =  147 bits (372), Expect = 2e-34
 Identities = 76/188 (40%), Positives = 113/188 (60%), Gaps = 12/188 (6%)
 Frame = -1

Query: 875 PQVEAKILHD---ILQLKQD---------KKVFKVEECQKLTYLHAAFCESLGLFPPVPL 732
           P+VE KI+ +   IL+ + D         + VF  EE +K+ YL AA  E+L L+P VP+
Sbjct: 356 PEVEEKIMVEMCKILRQRDDHGNAEKSDYEPVFGPEEIKKMDYLQAALSEALRLYPSVPV 415

Query: 731 NHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQP 552
           +HK   E D+ P G ++    K+I   Y+MGRM+ +WG+DC+EF+PERW+  DG    + 
Sbjct: 416 DHKEVQEDDVFPDGTMLKKGDKVIYAIYAMGRMEAIWGKDCLEFRPERWLR-DGRFMSES 474

Query: 551 SYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHG 372
           +YKF+ FN GPR C+G+D A+  +K  AA I+  Y+ ++V  H +E     +M +  KHG
Sbjct: 475 AYKFTAFNGGPRLCLGKDFAYYQMKSTAAAIVYRYKVKVVNGHKVEPKLALTMYM--KHG 532

Query: 371 LKVKFIKR 348
           L V  I R
Sbjct: 533 LMVNLINR 540



>pir|T48311|T48311 cytochrome P450 52A3 homolog F9G14.210
           [similarity] - Arabidopsis thaliana>gb:ATF9G14_1551393
           Arabidopsis thaliana DNA chromosome 5, BAC clone F9G14
           (ESSA project).
          Length = 480

 Score =  147 bits (370), Expect = 3e-34
 Identities = 76/179 (42%), Positives = 111/179 (62%), Gaps = 3/179 (1%)
 Frame = -1

Query: 875 PQVEAKILHDILQLK--QDKKVFK-VEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKD 705
           PQV  KI  +I      Q+K   + +E    L YLH A  E++ L+PPVP    +P++ D
Sbjct: 302 PQVVTKIRQEINTSNGGQEKPSCEPMEYLNNLVYLHGALYEAMRLYPPVPFERMSPIKPD 361

Query: 704 ILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNA 525
           +LPSGH V  + KI++  Y++GRM  VWGED  EFKPERW+S    ++ +PS+KF  FNA
Sbjct: 362 VLPSGHKVDSSMKILIFIYALGRMRAVWGEDASEFKPERWLSETTSLRHEPSFKFLAFNA 421

Query: 524 GPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           GPR+CIG+ +A T++K+V   I+ +Y  ++V+    +I      IL  KHGL+V   K+
Sbjct: 422 GPRSCIGKQLAMTLMKIVVVEILQNYDIKVVK-GQKKIEPAPGPILRMKHGLRVTLTKK 479



>pir|G86265|G86265 F3F19.17 protein - Arabidopsis
           thaliana>gb:AE005172_890326 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F3F19_1678240 Arabidopsis thaliana
           chromosome 1 BAC F3F19 sequence, complete sequence.
          Length = 529

 Score =  140 bits (352), Expect = 4e-32
 Identities = 69/185 (37%), Positives = 111/185 (60%), Gaps = 9/185 (4%)
 Frame = -1

Query: 875 PQVEAKILHDILQL---------KQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHK 723
           P+VE KI+ +I ++          +++ +F V+E   + YL AA  E+L LFPP+P+  K
Sbjct: 336 PEVENKIICEIREILRQRGDSPTSKNESLFTVKELNNMVYLQAALSETLRLFPPIPMEMK 395

Query: 722 NPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYK 543
             +E D+LP G  V   +++    Y+MGRM+++WG+DC  F+PERWI   G       +K
Sbjct: 396 QAIEDDVLPDGTFVRKGSRVYFSIYAMGRMESIWGKDCEIFRPERWIQA-GKFVSDDQFK 454

Query: 542 FSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKV 363
           + VFNAGPR CIG+  A+  +KM+AA+++  Y  ++V+ H +    T ++ +  K+GLKV
Sbjct: 455 YVVFNAGPRLCIGKTFAYLQMKMIAASVLLRYSIKVVQDHVIAPRVTTNLYM--KYGLKV 512

Query: 362 KFIKR 348
               R
Sbjct: 513 TITPR 517



>gb:BT003907_1637033 Arabidopsis thaliana clone RAFL15-15-K01
           (R20657) putative cytochrome P450 (At1g13150) mRNA,
           complete cds.
          Length = 529

 Score =  139 bits (349), Expect = 9e-32
 Identities = 68/185 (36%), Positives = 111/185 (60%), Gaps = 9/185 (4%)
 Frame = -1

Query: 875 PQVEAKILHDILQL---------KQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHK 723
           P+VE KI+ +I ++          +++ +F V+E   + YL AA  E+L LFPP+P+  K
Sbjct: 336 PEVENKIICEIREILRQRGDSPTSKNESLFTVKELNNMVYLQAALSETLRLFPPIPMEMK 395

Query: 722 NPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYK 543
             +E D+LP G  V   +++    Y+MGRM+++WG+DC  F+PERWI   G       +K
Sbjct: 396 QAIEDDVLPDGTFVRKGSRVYFSIYAMGRMESIWGKDCEIFRPERWIQA-GKFVSDDQFK 454

Query: 542 FSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKV 363
           + VFNAGPR CIG+  A+  ++M+AA+++  Y  ++V+ H +    T ++ +  K+GLKV
Sbjct: 455 YVVFNAGPRLCIGKTFAYLQMRMIAASVLLRYSIKVVQDHVIAPRVTTNLYM--KYGLKV 512

Query: 362 KFIKR 348
               R
Sbjct: 513 TITPR 517



>gb:CRO238402_1673463 Catharanthus roseus mRNA for cytochrome P450.
          Length = 501

 Score =  136 bits (342), Expect = 6e-31
 Identities = 67/153 (43%), Positives = 95/153 (62%), Gaps = 5/153 (3%)
 Frame = -1

Query: 875 PQVEAKILHDI-LQLKQDKKVFKV----EECQKLTYLHAAFCESLGLFPPVPLNHKNPME 711
           P+VE KI  +I L LKQ      +    EE  +L YLHAA  E++ L+P  P   +  ++
Sbjct: 322 PRVEQKIREEIELYLKQKNGEHGLYTNPEELNELMYLHAAIYETMRLYPAAPFTSRKSIQ 381

Query: 710 KDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVF 531
            D+ P+GH V PNT I+M +Y++GRM ++WGEDC+EFKPERW+S  G +    + KF  F
Sbjct: 382 ADVFPTGHQVNPNTTIVMAYYAVGRMKSIWGEDCLEFKPERWLSDKGKLIPVQTNKFLAF 441

Query: 530 NAGPRTCIGRDMAFTVVKMVAATIICHYQFQLV 432
             GPR C G+++    VK VAA II  Y F+++
Sbjct: 442 GTGPRICPGKELGLNRVKAVAAAIIPKYSFKIM 474



>gb:AY029178_1559207 Brassica rapa subsp. pekinensis cytochrome P450
           (mf-CYP450) mRNA, complete cds.
          Length = 525

 Score =  136 bits (342), Expect = 6e-31
 Identities = 70/182 (38%), Positives = 108/182 (59%), Gaps = 6/182 (3%)
 Frame = -1

Query: 875 PQVEAKILHDILQ-LKQ-----DKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPM 714
           PQVE KI+ +I + LKQ     D  +F V E   + YL AA  E+L L+PP+P+  K  +
Sbjct: 335 PQVENKIIQEIREILKQRGDPSDSSLFTVRELNNMVYLQAAISETLRLYPPIPMEMKQAI 394

Query: 713 EKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSV 534
           E D+ P G  +   +++    Y+MGRM++VWG+DC +F PERWI     +    S K+ V
Sbjct: 395 EDDMFPDGTFIKKGSRVYFSIYAMGRMESVWGKDCEDFGPERWIHAGKFVSGDQS-KYVV 453

Query: 533 FNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFI 354
           FNAGPR C+G+  A+  +KM+AA+++  Y  ++ + H +    T ++ +  K+GLKV   
Sbjct: 454 FNAGPRLCLGKTFAYLQMKMIAASVLLRYSIKVAQDHVVVPRVTTNLYM--KYGLKVTIT 511

Query: 353 KR 348
            R
Sbjct: 512 PR 513



>pir|JC5965|JC5965 cytochrome P450 CYP86A1 - Arabidopsis
           thaliana>gb:ATRNACYTO_1554062 A.thaliana mRNA for
           cytochrome P450.
          Length = 513

 Score =  135 bits (341), Expect = 8e-31
 Identities = 72/182 (39%), Positives = 108/182 (59%), Gaps = 12/182 (6%)
 Frame = -1

Query: 872 QVEAKILHDIL----------QLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHK 723
           +VE KI++++           Q K  ++  + +E  +L YL AA  E+L L+P VP + K
Sbjct: 324 EVETKIVNELSMVLKETRGNDQEKWTEEPLEFDEADRLVYLKAALAETLRLYPSVPQDFK 383

Query: 722 NPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQP--S 549
             +E D+LP G  V   + +    YS+GRM T+WGEDC+EF+PERW++ DG     P   
Sbjct: 384 YVVEHDVLPDGTFVPRGSTVTYSIYSIGRMKTIWGEDCLEFRPERWLTADGERFETPKDG 443

Query: 548 YKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGL 369
           YKF  FNAGPRTC+G+D+A+  +K VA+ ++  Y+   V  H +E     S+ L  K+GL
Sbjct: 444 YKFVAFNAGPRTCLGKDLAYNQMKSVASAVLLRYRVFPVPGHRVEQKM--SLTLFMKNGL 501

Query: 368 KV 363
           +V
Sbjct: 502 RV 503



>pir|B86379|B86379 protein F21J9.20 [imported] - Arabidopsis
           thaliana>gb:AE005172_891407 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC000103_1530013 Genomic sequence for
           Arabidopsis thaliana BAC F21J9 from chromosome I,
           complete sequence.
          Length = 522

 Score =  135 bits (340), Expect = 1e-30
 Identities = 69/177 (38%), Positives = 109/177 (61%), Gaps = 6/177 (3%)
 Frame = -1

Query: 875 PQVEAKILHDILQLK------QDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPM 714
           P+VE +IL +I ++K      + +  F+ E+ +++ YL AA  ESL L+P VP+  K  +
Sbjct: 342 PEVEKRILREIREIKRKLTTQETEDQFEAEDFREMVYLQAALTESLRLYPSVPMEMKQAL 401

Query: 713 EKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSV 534
           E D+LP G  V    +I    YSMGR++++WG+D  EFKPERWI  +G I  +  +K+ V
Sbjct: 402 EDDVLPDGTRVKKGARIHYSVYSMGRIESIWGKDWEEFKPERWIK-EGRIVSEDQFKYVV 460

Query: 533 FNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKV 363
           FN GPR C+G+  A+T +KMVAA I+  Y  ++V+   +    T ++ +  K+G+ V
Sbjct: 461 FNGGPRLCVGKKFAYTQMKMVAAAILMRYSVKVVQGQEIVPKLTTTLYM--KNGMNV 515



>gb:AY081266_1568612 Arabidopsis thaliana cytochrome P450
           (At5g58860) mRNA, complete cds.>gb:BT003345_1636768
           Arabidopsis thaliana cytochrome P450 (At5g58860) mRNA,
           complete cds.
          Length = 513

 Score =  134 bits (338), Expect = 2e-30
 Identities = 70/182 (38%), Positives = 109/182 (59%), Gaps = 12/182 (6%)
 Frame = -1

Query: 872 QVEAKILHDILQL----------KQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHK 723
           +VE KI++++ ++          K  ++  + +E  +L YL AA  E+L L+P VP + K
Sbjct: 324 EVETKIVNELSKVLKETRGNDQEKWTEEPLEFDEADRLVYLKAALAETLRLYPSVPQDFK 383

Query: 722 NPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQP--S 549
             ++ D+LP G  V   + +    YS+GRM T+WGEDC+EF+PERW++ DG     P   
Sbjct: 384 YVVDDDVLPDGTFVPRGSTVTYSIYSIGRMKTIWGEDCLEFRPERWLTADGERFETPKDG 443

Query: 548 YKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGL 369
           YKF  FNAGPRTC+G+D+A+  +K VA+ ++  Y+   V  H +E     S+ L  K+GL
Sbjct: 444 YKFVAFNAGPRTCLGKDLAYNQMKSVASAVLLRYRVFPVPGHRVEQKM--SLTLFMKNGL 501

Query: 368 KV 363
           +V
Sbjct: 502 RV 503



>pir|F86265|F86265 hypothetical protein F3F19.16 - Arabidopsis
           thaliana>gb:AE005172_890325 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F3F19_1678239 Arabidopsis thaliana
           chromosome 1 BAC F3F19 sequence, complete sequence.
          Length = 519

 Score =  134 bits (338), Expect = 2e-30
 Identities = 62/180 (34%), Positives = 107/180 (59%), Gaps = 9/180 (5%)
 Frame = -1

Query: 875 PQVEAKILHDILQL---------KQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHK 723
           P+VE KI+ +I ++          +++ +F V+E   + YL AA  E++ L+PP+P+  K
Sbjct: 328 PEVENKIIREISEILRQRGDSPTSKNESLFTVKELNDMVYLQAALSETMRLYPPIPMEMK 387

Query: 722 NPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYK 543
             +E D+ P G  +   +++    Y+MGRM+++WG+DC  FKPERWI   G       +K
Sbjct: 388 QAIEDDVFPDGTFIRKGSRVYFATYAMGRMESIWGKDCESFKPERWIQ-SGNFVNDDQFK 446

Query: 542 FSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKV 363
           + VFNAGPR C+G+  A+  +K +AA+++  Y  ++ + H +    T ++ +  +HGLKV
Sbjct: 447 YVVFNAGPRLCLGKTFAYLQMKTIAASVLSRYSIKVAKDHVVVPRVTTTLYM--RHGLKV 504



>sp|P48422|C861_ARATH Cytochrome P450 86A1 (EC 1.14.-.-) (CYPLXXXVI)
           (P450-dependent fatty acid
           omega-hydroxylase).>gb:AB016885_1513113 Arabidopsis
           thaliana genomic DNA, chromosome 5, TAC clone:K19M22.
          Length = 513

 Score =  134 bits (338), Expect = 2e-30
 Identities = 71/182 (39%), Positives = 108/182 (59%), Gaps = 12/182 (6%)
 Frame = -1

Query: 872 QVEAKILHDIL----------QLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHK 723
           +VE KI++++           Q K  ++  + +E  +L YL AA  E+L L+P VP + K
Sbjct: 324 EVETKIVNELSMVLKETRGNDQEKWTEEPLEFDEADRLVYLKAALAETLRLYPSVPQDFK 383

Query: 722 NPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQP--S 549
             ++ D+LP G  V   + +    YS+GRM T+WGEDC+EF+PERW++ DG     P   
Sbjct: 384 YVVDDDVLPDGTFVPRGSTVTYSIYSIGRMKTIWGEDCLEFRPERWLTADGERFETPKDG 443

Query: 548 YKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGL 369
           YKF  FNAGPRTC+G+D+A+  +K VA+ ++  Y+   V  H +E     S+ L  K+GL
Sbjct: 444 YKFVAFNAGPRTCLGKDLAYNQMKSVASAVLLRYRVFPVPGHRVEQKM--SLTLFMKNGL 501

Query: 368 KV 363
           +V
Sbjct: 502 RV 503



>gb:AP004139_1838160 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1486_E07.>gb:AP005108_1847985 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0461B08.
          Length = 532

 Score =  133 bits (335), Expect = 4e-30
 Identities = 69/184 (37%), Positives = 105/184 (57%), Gaps = 12/184 (6%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKK-----------VFKVEECQKLTYLHAAFCESLGLFPPVPLN 729
           P VE K++H++  +    +            F  EE   L YL AA  E+L L+P VP +
Sbjct: 326 PAVERKVVHELCAVLAASRGAHDPALWLAAPFTFEELDSLVYLKAALSETLRLYPSVPED 385

Query: 728 HKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGG-IKRQP 552
            K+ +  D LP G  V   + +    YS GRM TVWGEDC+EF+PERW+S DG   +   
Sbjct: 386 SKHVVADDYLPDGTFVPAGSSVTYSIYSAGRMKTVWGEDCLEFRPERWLSADGSKFEPHD 445

Query: 551 SYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHG 372
           SYKF  FNAGPR C+G+D+A+  +K +A +++  ++  + + H +E     S+ L  K+G
Sbjct: 446 SYKFVAFNAGPRICLGKDLAYLQMKNIAGSVLLRHRLAVAQGHRVEQKM--SLTLFMKNG 503

Query: 371 LKVK 360
           L+++
Sbjct: 504 LRME 507



>gb:AY074851_1567703 Arabidopsis thaliana AT4g00360/A_IG005I10_21
           mRNA, complete cds.>gb:AY133539_1581362 Arabidopsis
           thaliana At4g00360/A_IG005I10_21 mRNA, complete cds.
          Length = 553

 Score =  132 bits (331), Expect = 1e-29
 Identities = 72/187 (38%), Positives = 104/187 (55%), Gaps = 11/187 (5%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKV----------EECQKLTYLHAAFCESLGLFPPVPLNH 726
           P VE KI+ +I  +  + +   V          +E  +L YL AA  E+L L+P VP + 
Sbjct: 327 PTVEDKIVREICSVLIETRGTDVSSWTAEPLEFDEVDRLVYLKAALSETLRLYPSVPEDS 386

Query: 725 KNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGG-IKRQPS 549
           K+ +  DILP G  V   + +    Y+ GRM + WGEDC+EFKPERWISPD G       
Sbjct: 387 KHVVNDDILPDGTFVPAGSSVTYSIYAAGRMKSTWGEDCLEFKPERWISPDDGKFVNHDQ 446

Query: 548 YKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGL 369
           Y+F  FNAGPR C+G+D+A+  +K +AA ++  ++  +   H +E     S+ L  K+GL
Sbjct: 447 YRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRHRLTVAPGHEVEQKM--SLTLFMKNGL 504

Query: 368 KVKFIKR 348
            V   KR
Sbjct: 505 LVNVHKR 511



>sp|O23066|C862_ARATH Cytochrome P450 86A2 (EC
           1.14.-.-).>pir|T01535|T01535 probable cytochrome P450
           A_IG005I10.21 - Arabidopsis thaliana>gb:ATCHRIV1_1544215
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 1.>gb:F5I10_1678367 Arabidopsis thaliana BAC
           F5I10.>gb:IG005I10_1683067 Arabidopsis thaliana BAC
           IG005I10.
          Length = 553

 Score =  131 bits (330), Expect = 1e-29
 Identities = 72/187 (38%), Positives = 104/187 (55%), Gaps = 11/187 (5%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKV----------EECQKLTYLHAAFCESLGLFPPVPLNH 726
           P VE KI+ +I  +  + +   V          +E  +L YL AA  E+L L+P VP + 
Sbjct: 327 PTVEDKIVREICSVLIETRGTDVSSWTAEPLEFDEVDRLVYLKAALSETLRLYPSVPEDS 386

Query: 725 KNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGG-IKRQPS 549
           K+ +  DILP G  V   + +    Y+ GRM + WGEDC+EFKPERWISPD G       
Sbjct: 387 KHVVNDDILPDGTFVPAGSSVTYSIYAAGRMKSTWGEDCLEFKPERWISPDDGKFVNHDQ 446

Query: 548 YKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGL 369
           Y+F  FNAGPR C+G+D+A+  +K +AA ++  ++  +   H +E     S+ L  K+GL
Sbjct: 447 YRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRHRLTVAPGHKVEQKM--SLTLFMKNGL 504

Query: 368 KVKFIKR 348
            V   KR
Sbjct: 505 LVNVHKR 511



>gb:AK117400_1815436 Arabidopsis thaliana At1g01600 mRNA for unknown
           protein, complete cds, clone: RAFL16-98-J04.
          Length = 554

 Score =  129 bits (323), Expect = 1e-28
 Identities = 70/188 (37%), Positives = 103/188 (54%), Gaps = 12/188 (6%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQD-----------KKVFKVEECQKLTYLHAAFCESLGLFPPVPLN 729
           P VE KI+ +I  +  +           ++    +E  +L YL AA  E+L L+P VP +
Sbjct: 328 PTVEDKIVREICSVLIETRGTDDVASWTEEPLGFDEIDRLVYLKAAISETLRLYPSVPED 387

Query: 728 HKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISP-DGGIKRQP 552
            K+    D+LP G  V   + +    Y+ GRM + WGEDC+EF PERWISP DG      
Sbjct: 388 SKHVENDDVLPDGTFVPAGSSVTYSIYAAGRMKSTWGEDCLEFNPERWISPIDGKFINHD 447

Query: 551 SYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHG 372
            Y+F  FNAGPR C+G+D+A+  +K +AA ++  ++  +V  H +E     S+ L  K+G
Sbjct: 448 QYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRHRLTVVPGHKVEQKM--SLTLFMKNG 505

Query: 371 LKVKFIKR 348
           L V   KR
Sbjct: 506 LLVNLYKR 513



>pir|G86146|G86146 hypothetical protein F22L4.14 [imported] -
           Arabidopsis thaliana>gb:AE005172_889208 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:F22L4_1677889 Sequence of BAC F22L4 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 554

 Score =  129 bits (323), Expect = 1e-28
 Identities = 70/188 (37%), Positives = 103/188 (54%), Gaps = 12/188 (6%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQD-----------KKVFKVEECQKLTYLHAAFCESLGLFPPVPLN 729
           P VE KI+ +I  +  +           ++    +E  +L YL AA  E+L L+P VP +
Sbjct: 328 PTVEDKIVREICSVLIETRGTDDVASWTEEPLGFDEIDRLVYLKAAISETLRLYPSVPED 387

Query: 728 HKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISP-DGGIKRQP 552
            K+    D+LP G  V   + +    Y+ GRM + WGEDC+EF PERWISP DG      
Sbjct: 388 SKHVENDDVLPDGTFVPAGSSVTYSIYAAGRMKSTWGEDCLEFNPERWISPIDGKFINHD 447

Query: 551 SYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHG 372
            Y+F  FNAGPR C+G+D+A+  +K +AA ++  ++  +V  H +E     S+ L  K+G
Sbjct: 448 QYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLLRHRLTVVPGHKVEQKM--SLTLFMKNG 505

Query: 371 LKVKFIKR 348
           L V   KR
Sbjct: 506 LLVNLYKR 513



>gb:AP003442_1829432 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1096A10.
          Length = 545

 Score =  127 bits (320), Expect = 2e-28
 Identities = 63/151 (41%), Positives = 97/151 (64%), Gaps = 3/151 (1%)
 Frame = -1

Query: 806 EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDT 627
           +E ++L YL AA  E+L L+P VP + K  +  D+LP G VV   + I    YS+GRM++
Sbjct: 365 DELERLVYLKAALTETLRLYPSVPQDSKYVVADDVLPDGTVVPAGSAITYSIYSVGRMES 424

Query: 626 VWGEDCMEFKPERWISPDGGIKRQP---SYKFSVFNAGPRTCIGRDMAFTVVKMVAATII 456
           +WG+DC EF+PERW+S DG  + +P   +Y+F  FN GPRTC+G+D+A+  +K +A+ ++
Sbjct: 425 IWGKDCAEFRPERWLSADGS-RFEPVKDAYRFVAFNGGPRTCLGKDLAYLQMKSIASAVL 483

Query: 455 CHYQFQLVEFHHLEILFTDSMILEKKHGLKV 363
                +LV  H +E     S+ L  K+GL+V
Sbjct: 484 LRNSVELVPGHKVEQKM--SLTLFMKNGLRV 512



>gb:AX023066_1456725 Sequence 10 from Patent
           EP0911404.>gb:AX023070_1456726 Sequence 14 from Patent
           EP0911404.>gb:AX031111_1457257 Sequence 10 from Patent
           FR2768748.>gb:AX031115_1457258 Sequence 14 from Patent
           FR2768748.>gb:AF123609_1769935 Triticum aestivum clone
           CYP86-TA cytochrome P450 mRNA, complete cds.
          Length = 541

 Score =  127 bits (320), Expect = 2e-28
 Identities = 68/184 (36%), Positives = 103/184 (55%), Gaps = 12/184 (6%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKK-----------VFKVEECQKLTYLHAAFCESLGLFPPVPLN 729
           P VE KI+ ++  +    +            F  EE  +L YL AA  E+L L+P VP +
Sbjct: 327 PAVERKIVRELCSVLAASRGAHDPALWLAEPFTFEELDRLVYLKAALSETLRLYPSVPED 386

Query: 728 HKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDG-GIKRQP 552
            K+ +  D LP G  V   + +    YS GRM  VWGEDC+EF+PERW+S DG   ++  
Sbjct: 387 SKHVVADDYLPDGTFVPAGSSVTYSIYSAGRMKGVWGEDCLEFRPERWLSADGTKFEQHD 446

Query: 551 SYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHG 372
           SYKF  FNAGPR C+G+D+A+  +K +A +++  ++  +   H +E     S+ L  K G
Sbjct: 447 SYKFVAFNAGPRVCLGKDLAYLQMKNIAGSVLLRHRLTVAPGHRVEQKM--SLTLFMKGG 504

Query: 371 LKVK 360
           L+++
Sbjct: 505 LRME 508



>gb:OSJN00087_1694652 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0084K11, complete sequence.
          Length = 545

 Score =  127 bits (319), Expect = 3e-28
 Identities = 62/151 (41%), Positives = 96/151 (63%), Gaps = 2/151 (1%)
 Frame = -1

Query: 806 EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDT 627
           EE  +L YL AA  E+L L+P VP + K+ +  D+LP G  V   + +    YS GRM T
Sbjct: 368 EELDQLVYLKAALSETLRLYPSVPEDSKHVVADDVLPDGTFVPAGSSVTYSIYSAGRMKT 427

Query: 626 VWGEDCMEFKPERWISPDGGIKRQP--SYKFSVFNAGPRTCIGRDMAFTVVKMVAATIIC 453
           VWG+DC+EF+PERW+S D G K +P  S++F  FNAGPR C+G+D+A+  ++ +A +++ 
Sbjct: 428 VWGDDCLEFRPERWLSAD-GTKFEPHDSFRFVAFNAGPRICLGKDLAYLQMRNIAGSVLL 486

Query: 452 HYQFQLVEFHHLEILFTDSMILEKKHGLKVK 360
            ++  +   H +E     S+ L  KHGL+++
Sbjct: 487 RHRLAVAPGHRVEQKM--SLTLFMKHGLRME 515



>pir|T02450|T02450 probable cytochrome P450 F4I18.5 - Arabidopsis
           thaliana>gb:AC004665_1531920 Arabidopsis thaliana
           chromosome 2 clone F4I18 map CIC02E07, complete
           sequence.>gb:ATH301678_1552425 Arabidopsis thaliana LCR
           gene for cytochrome P450 fatty-acid omega-hydroxylase
           CYP86A8, exon 1.>gb:AY064966_1566143 Arabidopsis
           thaliana At2g45970/F4I18.5 mRNA, complete
           cds.>gb:BT002239_1635842 Arabidopsis thaliana
           At2g45970/F4I18.5 mRNA, complete cds.
          Length = 537

 Score =  127 bits (319), Expect = 3e-28
 Identities = 74/189 (39%), Positives = 107/189 (56%), Gaps = 13/189 (6%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKV----------EECQKLTYLHAAFCESLGLFPPVPLNH 726
           P +E KIL +I  +  + +   V          EE  +L +L AA  E+L L+P VP + 
Sbjct: 325 PAIEDKILREICTVLVETRGDDVALWTDEPLSCEELDRLVFLKAALSETLRLYPSVPEDS 384

Query: 725 KNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWIS-PDGG--IKRQ 555
           K  ++ D+LP G  V   + I    YS GRM + WGEDC+EFKPERWIS  DGG  I   
Sbjct: 385 KRAVKDDVLPDGTFVPAGSSITYSIYSAGRMKSTWGEDCLEFKPERWISQSDGGRFINHD 444

Query: 554 PSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKH 375
           P +KF  FNAGPR C+G+D+A+  +K +A+ ++  ++  +V  H +E     S+ L  K+
Sbjct: 445 P-FKFVAFNAGPRICLGKDLAYLQMKSIASAVLLRHRLTVVTGHKVEQKM--SLTLFMKY 501

Query: 374 GLKVKFIKR 348
           GL V   +R
Sbjct: 502 GLLVNVHER 510



>gb:AP005697_1856238 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OSJNBb0005C03.
          Length = 520

 Score =  127 bits (318), Expect = 4e-28
 Identities = 61/160 (38%), Positives = 101/160 (63%), Gaps = 3/160 (1%)
 Frame = -1

Query: 818 VFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMG 639
           +F  E+ + L YLHAA  E+L L+PP  +  K  +  D++PSGH V     +++  YSMG
Sbjct: 361 MFSPEDTKSLVYLHAALFETLRLYPPGWIERKTVVADDVMPSGHEVRAGDAVLISIYSMG 420

Query: 638 RMDTVWGEDCMEFKPERWISPDGG---IKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVA 468
           RM+++WGEDC  ++PERW+    G   ++  PS+KF  FN+GPR C G+++A   +K++A
Sbjct: 421 RMESLWGEDCRVYRPERWLYDSRGGRKMRHVPSHKFLSFNSGPRMCPGKNIAVMQMKIIA 480

Query: 467 ATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           A ++ ++  ++VE     ++   S +L+ K+G+ VK  KR
Sbjct: 481 AAVVWNFDLEVVEGQ--AVVPKLSCLLQMKNGVMVKVKKR 518



>gb:AY087670_1572698 Arabidopsis thaliana clone 37538 mRNA, complete
           sequence.
          Length = 523

 Score =  125 bits (315), Expect = 8e-28
 Identities = 70/186 (37%), Positives = 106/186 (56%), Gaps = 10/186 (5%)
 Frame = -1

Query: 875 PQVEAKILHDILQL---KQDKKVFK-------VEECQKLTYLHAAFCESLGLFPPVPLNH 726
           P+VE KI+++I  +    +D  V K        +E  +L YL AA  E+L L+P VP + 
Sbjct: 325 PRVEEKIINEICTILIKTRDTNVSKWTDEPLTFDEIDQLVYLKAALSETLRLYPSVPEDS 384

Query: 725 KNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSY 546
           K  +  D+LP G  V   + +    YS+GRM  +WGEDC+EFKPERW+  +   ++   Y
Sbjct: 385 KFVVANDVLPDGTFVPSGSNVTYSIYSVGRMKFIWGEDCLEFKPERWLE-ESRDEKCNQY 443

Query: 545 KFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLK 366
           KF  FNAGPR C+G+D+A+  +K + A+I+  ++  +   H +E     S+ L  K GLK
Sbjct: 444 KFVAFNAGPRICLGKDLAYLQMKSITASILLRHRLTVAPGHRVEQKM--SLTLFMKFGLK 501

Query: 365 VKFIKR 348
           +   KR
Sbjct: 502 MDVHKR 507



>pir|B96662|B96662 probable cytochrome P450 F24D7.10 [imported] -
           Arabidopsis thaliana>gb:AE005173_894035 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC011622_1537268 Arabidopsis thaliana
           chromosome 1 BAC F24D7 genomic sequence, complete
           sequence.
          Length = 523

 Score =  125 bits (315), Expect = 8e-28
 Identities = 70/186 (37%), Positives = 106/186 (56%), Gaps = 10/186 (5%)
 Frame = -1

Query: 875 PQVEAKILHDILQL---KQDKKVFK-------VEECQKLTYLHAAFCESLGLFPPVPLNH 726
           P+VE KI+++I  +    +D  V K        +E  +L YL AA  E+L L+P VP + 
Sbjct: 325 PRVEEKIINEICTILIKTRDTNVSKWTDEPLTFDEIDQLVYLKAALSETLRLYPSVPEDS 384

Query: 725 KNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSY 546
           K  +  D+LP G  V   + +    YS+GRM  +WGEDC+EFKPERW+  +   ++   Y
Sbjct: 385 KFVVANDVLPDGTFVPSGSNVTYSIYSVGRMKFIWGEDCLEFKPERWLE-ESRDEKCNQY 443

Query: 545 KFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLK 366
           KF  FNAGPR C+G+D+A+  +K + A+I+  ++  +   H +E     S+ L  K GLK
Sbjct: 444 KFVAFNAGPRICLGKDLAYLQMKSITASILLRHRLTVAPGHRVEQKM--SLTLFMKFGLK 501

Query: 365 VKFIKR 348
           +   KR
Sbjct: 502 MDVHKR 507



>gb:AF366297_1791632 Zea mays cytochrome P450-like protein
           (ms*-sb200) mRNA, complete cds.
          Length = 543

 Score =  125 bits (314), Expect = 1e-27
 Identities = 62/145 (42%), Positives = 85/145 (58%)
 Frame = -1

Query: 794 KLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGE 615
           KL YLHA   E+L L+P VP + K  +E D+LP G  V     +    YSMGRM+  WG 
Sbjct: 396 KLVYLHACVTETLRLYPAVPQDPKGILEDDVLPDGTKVRAGGMVTYVPYSMGRMEYNWGP 455

Query: 614 DCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQL 435
           D   F+PERWI+ DG  +    +KF+ F AGPR C+G+D A+  +KM  A +   Y F+L
Sbjct: 456 DAASFRPERWINEDGAFRNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILFRFYSFRL 515

Query: 434 VEFHHLEILFTDSMILEKKHGLKVK 360
           +E H ++  +    IL   HGLKV+
Sbjct: 516 LEGHPVQ--YRMMTILSMAHGLKVR 538



>gb:AX453572_1468811 Sequence 1 from Patent WO0226789.
          Length = 588

 Score =  125 bits (314), Expect = 1e-27
 Identities = 62/145 (42%), Positives = 85/145 (58%)
 Frame = -1

Query: 794 KLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGE 615
           KL YLHA   E+L L+P VP + K  +E D+LP G  V     +    YSMGRM+  WG 
Sbjct: 399 KLVYLHACVTETLRLYPAVPQDPKGILEDDVLPDGTKVRAGGMVTYVPYSMGRMEYNWGP 458

Query: 614 DCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQL 435
           D   F+PERWI+ DG  +    +KF+ F AGPR C+G+D A+  +KM  A +   Y F+L
Sbjct: 459 DAASFRPERWINEDGAFRNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILFRFYSFRL 518

Query: 434 VEFHHLEILFTDSMILEKKHGLKVK 360
           +E H ++  +    IL   HGLKV+
Sbjct: 519 LEGHPVQ--YRMMTILSMAHGLKVR 541



>gb:AC073556_1541121 Oryza sativa chromosome 3 BAC OSJNBa0091P11
           genomic sequence, complete sequence.
          Length = 544

 Score =  124 bits (312), Expect = 2e-27
 Identities = 66/146 (45%), Positives = 85/146 (58%), Gaps = 1/146 (0%)
 Frame = -1

Query: 794 KLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGE 615
           KL YLHA   E+L L+P VP + K  +E D+LP G  V     +    YSMGRM+  WG 
Sbjct: 396 KLVYLHACVTETLRLYPAVPQDPKGIVEDDVLPDGTKVRAGGMVTYVPYSMGRMEYNWGP 455

Query: 614 DCMEFKPERWISPDGGIKRQPS-YKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQ 438
           D   F+PERW+S DGG  R  S +KF+ F AGPR C+G+D A+  +KM  A +   Y F 
Sbjct: 456 DAASFRPERWLSGDGGAFRNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILFRFYTFD 515

Query: 437 LVEFHHLEILFTDSMILEKKHGLKVK 360
           LVE H   + +    IL   HGLKV+
Sbjct: 516 LVEDH--PVKYRMMTILSMAHGLKVR 539



>gb:AE005172_892252 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC023279_1539163 Genomic sequence
           for Arabidopsis thaliana BAC F12K21 from chromosome I,
           complete sequence.
          Length = 498

 Score =  123 bits (309), Expect = 4e-27
 Identities = 69/182 (37%), Positives = 104/182 (57%), Gaps = 6/182 (3%)
 Frame = -1

Query: 875 PQVEAKILHDILQL-----KQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPME 711
           P+VE KIL ++  +     K+  +V+  E  + + YLHAA  ESL L+PPVP++ K+  E
Sbjct: 318 PEVEDKILQELNSIRARTGKRIGEVYGFEHLKMMNYLHAAITESLRLYPPVPVDIKSCAE 377

Query: 710 KDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKR-QPSYKFSV 534
            ++LP G  V     I    ++MGRM+++WG+DC  F PERWI    G  R +   KF  
Sbjct: 378 DNVLPDGTFVGKGWAITYNIFAMGRMESIWGKDCDRFDPERWIDETNGCFRGEDPSKFPA 437

Query: 533 FNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFI 354
           F+AGPR C+G+DMA+  +K + A ++  +  ++      EIL   SM L  K GL  +  
Sbjct: 438 FHAGPRMCVGKDMAYIQMKSIVAAVLERFVVEVPGKERPEILL--SMTLRIKGGLFARVQ 495

Query: 353 KR 348
           +R
Sbjct: 496 ER 497



>gb:AP003232_1825816 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0034E02.
          Length = 511

 Score =  122 bits (307), Expect = 7e-27
 Identities = 61/181 (33%), Positives = 100/181 (55%), Gaps = 4/181 (2%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDK----KVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEK 708
           P VE +++ +I  ++         F  +E ++  YLHAA  ES+ L+PPV ++  +  E 
Sbjct: 331 PDVEDRVVREIRAVRASSGSTDATFSFDELREKHYLHAAITESMRLYPPVAIDTHSCKED 390

Query: 707 DILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFN 528
           D LP G  V     ++   Y+MGRM+ +WG DC E++PERW+   G  + + ++K+ VFN
Sbjct: 391 DFLPDGTFVGKGWLVMYSAYAMGRMEGIWGADCEEYRPERWLDEAGAFRPESTFKYPVFN 450

Query: 527 AGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           AGPR CIG++MA+  +K + A ++  +  +     +       S+ L  K GL +K   R
Sbjct: 451 AGPRICIGKEMAYIQMKSIVACVLEKFSLRYASDANERPRSVLSLTLRMKWGLPMKVTIR 510

Query: 347 K 345
           K
Sbjct: 511 K 511



>gb:AF092916_1767574 Nicotiana tabacum cytochrome P450-dependent
           fatty acid hydroxylase (CYP94A5) mRNA, complete cds.
          Length = 511

 Score =  122 bits (306), Expect = 9e-27
 Identities = 64/181 (35%), Positives = 104/181 (57%), Gaps = 5/181 (2%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+VE++I+ ++ +  +   ++  +E + + Y HA+ CES+  +PPVP++ K   + DILP
Sbjct: 332 PEVESQIMKEVGEKSESLLLY--DEVKNMMYTHASLCESMRFYPPVPMDSKEATKDDILP 389

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPD---GGIKRQP--SYKFSVF 531
            G  V   T++    Y+MGR++ VWGED  EFKPERW+  D   G     P  +Y + VF
Sbjct: 390 DGTFVKKGTRVTYHPYAMGRVEKVWGEDWAEFKPERWLDKDEVTGNWTFVPKDAYTYPVF 449

Query: 530 NAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIK 351
            AGPR C+G++MAF  +K V A ++  ++   V    +E +F   +  + K G  V   +
Sbjct: 450 QAGPRICLGKEMAFLQMKRVVAGVLRRFKVVPVVEQGVEPVFISYLTAKMKGGFPVTIEE 509

Query: 350 R 348
           R
Sbjct: 510 R 510



>pir|T49064|T49064 cytochrome P450-like protein - Arabidopsis
           thaliana>gb:ATT5P19_1556268 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T5P19.
          Length = 499

 Score =  120 bits (302), Expect = 3e-26
 Identities = 65/183 (35%), Positives = 110/183 (60%), Gaps = 7/183 (3%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDK-----KVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPME 711
           P+V+ KIL ++  +++       +V+  E+ + + YLHAA  ESL L+PPVP++  +  E
Sbjct: 318 PEVKDKILQELNSIRERTGKRIGEVYGFEDLKLMNYLHAAITESLRLYPPVPVDTMSCAE 377

Query: 710 KDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWI-SPDGGIKRQPSYKFSV 534
            ++LP G  +  +  I    Y+MGRM+++WG+DC  F PERWI   +GG + +  YKF  
Sbjct: 378 DNVLPDGTFIGKDWGISYNAYAMGRMESIWGKDCDRFDPERWIDETNGGFRGENPYKFPA 437

Query: 533 FNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLV-EFHHLEILFTDSMILEKKHGLKVKF 357
           F+AGPR C+G++MA+  +K + A ++  +  ++  +    EIL   S+ L  + GL V+ 
Sbjct: 438 FHAGPRMCLGKEMAYIQMKSIVAAVLERFVVEVPGKKERPEILM--SVTLRIRGGLNVRV 495

Query: 356 IKR 348
            +R
Sbjct: 496 QER 498



>gb:AP004092_1837565 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1568_B05.
          Length = 392

 Score =  119 bits (299), Expect = 6e-26
 Identities = 60/176 (34%), Positives = 101/176 (57%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P VE++++ D+L    D K        ++ YLHAA  E++ L+PPVP++ K  +  D+LP
Sbjct: 189 PDVESRVVGDVLAAGGDIK--------RMDYLHAALTEAMRLYPPVPVDFKEALADDVLP 240

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G  V    ++I   Y++GR    WG+D   F+PERW+        +  +K++VFNAGPR
Sbjct: 241 DGTPVRARQRVIYYTYAIGRDPASWGDDAAAFRPERWMRGGAFAGGESPFKYAVFNAGPR 300

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
            CIG+  A+T +K  AA ++  +  ++V    ++   T ++ +  K+GL V+F +R
Sbjct: 301 LCIGKRFAYTQMKTAAAAVLSRFAVEVVPGQEVKPKLTTTLYM--KNGLMVRFRRR 354



>sp|O81117|C941_VICSA Cytochrome P450 94A1 (EC 1.14.-.-)
           (P450-dependent fatty acid omega-
           hydroxylase).>pir|T08014|T08014 cytochrome P450 CYP94A1
           - spring vetch>gb:AF030260_1762470 Vicia sativa CYP94A1
           (vagh111) mRNA, complete cds.
          Length = 514

 Score =  119 bits (297), Expect = 1e-25
 Identities = 66/183 (36%), Positives = 106/183 (57%), Gaps = 7/183 (3%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+VE +I+++   L +  ++   +E +++ Y HAA  ES+ L+PPVP++ K  +  D+LP
Sbjct: 335 PRVEEEIVNE---LSKKSELMVYDEVKEMVYTHAALSESMRLYPPVPMDSKEAVNDDVLP 391

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKR-----QPSYKFSVF 531
            G VV   T +    Y+MGRM ++WG+D  EF+PERW+  D    +     + SY + VF
Sbjct: 392 DGWVVKKGTIVTYHVYAMGRMKSLWGDDWAEFRPERWLEKDEVNGKWVFVGRDSYSYPVF 451

Query: 530 NAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHL--EILFTDSMILEKKHGLKVKF 357
            AGPR C+G++MAF  +K + A I+   +F++V   HL  E  F   +  + + G  V  
Sbjct: 452 QAGPRVCLGKEMAFMQMKRIVAGIV--GKFKVVPEAHLAQEPGFISFLSSQMEGGFPVTI 509

Query: 356 IKR 348
            KR
Sbjct: 510 QKR 512



>gb:AP003232_1825823 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0034E02.
          Length = 511

 Score =  118 bits (296), Expect = 1e-25
 Identities = 53/148 (35%), Positives = 88/148 (59%), Gaps = 8/148 (5%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKK--------VFKVEECQKLTYLHAAFCESLGLFPPVPLNHKN 720
           P VE KI+ +I  ++Q            F ++E + + YLHAA  ES+ L+PPVP +  +
Sbjct: 327 PDVEDKIVREIRAVRQSSAGSEGTRGATFSLDELRDMQYLHAAITESMRLYPPVPFDTHS 386

Query: 719 PMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKF 540
             E++ LP G        +    Y+MGR++ +WG DC EF+PERW+   G  + + ++K+
Sbjct: 387 CKEEEFLPDGTFAGKGWLVTYCAYAMGRVEDIWGADCEEFRPERWLDEAGAFRPESTFKY 446

Query: 539 SVFNAGPRTCIGRDMAFTVVKMVAATII 456
            VF+AGPR C+G++MA+  +K + A ++
Sbjct: 447 PVFHAGPRMCLGKEMAYIQMKSIVACVL 474



>gb:AP003232_1825826 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0034E02.
          Length = 276

 Score =  118 bits (295), Expect = 2e-25
 Identities = 60/182 (32%), Positives = 101/182 (55%), Gaps = 5/182 (2%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQ-----DKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPME 711
           P VE +I  +I  ++      D   F  +E +++ YLHAA  E++ L+PPV ++      
Sbjct: 92  PDVEDRIAREIRAVRASSGSTDAAAFSFDELREMHYLHAAITEAMRLYPPVAMDSHCCQN 151

Query: 710 KDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVF 531
            D+LP G  V    ++    Y+M R++ +WG DC EF+PERW+  DG  + +  +K+ VF
Sbjct: 152 DDVLPDGTFVGKGWQVTYSAYAMARLEELWGADCEEFRPERWLDEDGVFRPESPFKYPVF 211

Query: 530 NAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIK 351
           + GPR C+G++MA+  +K +AA +   + F+ V       L   S+ L  + GL ++  K
Sbjct: 212 HGGPRMCLGKEMAYIQMKSIAACVFERFSFRFVGGEGRPGL-VFSVTLRMEGGLPMRVKK 270

Query: 350 RK 345
           R+
Sbjct: 271 RR 272



>gb:AE016959_1023524 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC074232_1541285
           Oryza sativa chromosome 10 BAC OSJNBb0005J14 genomic
           sequence, complete sequence.>gb:AE017114_1753343 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           68 of 77 of the complete sequence.
          Length = 515

 Score =  117 bits (294), Expect = 2e-25
 Identities = 54/156 (34%), Positives = 93/156 (59%), Gaps = 9/156 (5%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEE---------CQKLTYLHAAFCESLGLFPPVPLNHK 723
           P+V+ KI H+ ++     +   ++E           K+ YLHAA  E+L L+P VPL++K
Sbjct: 332 PEVQEKICHEAMEATNAGEAASIDEFSQSLTDEALNKMHYLHAALTETLRLYPAVPLDNK 391

Query: 722 NPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYK 543
                D+LP+G  V+    +    Y+MGRM+++WG+D   F+PERW+  +G  +++  +K
Sbjct: 392 QCFSDDVLPNGFNVSKGDIVFYIPYAMGRMESLWGKDAESFRPERWLDENGVFQQESPFK 451

Query: 542 FSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQL 435
           F+ F AGPR C+G+D A+  +K+ AA ++  +  +L
Sbjct: 452 FTAFQAGPRICLGKDFAYRQMKIFAAVLLRFFVLKL 487



>gb:AP003232_1825814 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0034E02.
          Length = 512

 Score =  117 bits (293), Expect = 3e-25
 Identities = 54/147 (36%), Positives = 85/147 (57%), Gaps = 7/147 (4%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQ-------DKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNP 717
           P VE KI+H+I  ++            F  +E + + YLHAA  ES+ L+PPV L+  + 
Sbjct: 330 PDVEDKIVHEIRAVRSASSSGGTSSATFSFDELRDMHYLHAAITESMRLYPPVHLDTHSC 389

Query: 716 MEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFS 537
            E D LP G  V     +    Y+MGR++ +WG DC EF+PERW+   G  +    +K+ 
Sbjct: 390 KEDDFLPDGTFVGKGWLVTYCAYAMGRVEDIWGADCEEFRPERWLDEAGAFRPDSPFKYP 449

Query: 536 VFNAGPRTCIGRDMAFTVVKMVAATII 456
           +F+AGPR C+G++MA+  +K + A ++
Sbjct: 450 IFHAGPRMCLGKEMAYIQMKSIVACVL 476



>gb:AE016959_1023525 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC074232_1541284
           Oryza sativa chromosome 10 BAC OSJNBb0005J14 genomic
           sequence, complete sequence.>gb:AE017114_1753344 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           68 of 77 of the complete sequence.
          Length = 516

 Score =  117 bits (293), Expect = 3e-25
 Identities = 56/156 (35%), Positives = 90/156 (57%), Gaps = 9/156 (5%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEE---------CQKLTYLHAAFCESLGLFPPVPLNHK 723
           P+V+ KI  ++++         ++E           K+ YLHAA  E+L L+P VPL +K
Sbjct: 333 PEVQEKIFDEVMETTNAGDCASIDEFLTSLTDQALNKMHYLHAALTETLRLYPSVPLENK 392

Query: 722 NPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYK 543
                D+LP+G  V+    +    Y+MGRM+ +WG+D   F+PERW+   G  +++  +K
Sbjct: 393 QCFSDDVLPNGFSVSKGDGVFYMPYAMGRMEFLWGKDAEAFRPERWLDEHGVFQQESPFK 452

Query: 542 FSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQL 435
           F+ F AGPR CIG+D A+  +K+ AA +I  + F+L
Sbjct: 453 FTAFQAGPRICIGKDFAYRQMKIFAAVLIRSFVFKL 488



>gb:AK118803_1816762 Arabidopsis thaliana At1g69500 mRNA for unknown
           protein, complete cds, clone: RAFL21-14-E14.
          Length = 478

 Score =  117 bits (292), Expect = 4e-25
 Identities = 63/149 (42%), Positives = 84/149 (56%)
 Frame = -1

Query: 794 KLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGE 615
           KL YLHA   E+L L+P VP + K  +E D+LP+G  V     +    YSMGRM+  WG 
Sbjct: 332 KLHYLHAVITETLRLYPAVPQDPKGVLEDDMLPNGTKVKAGGMVTYVPYSMGRMEYNWGS 391

Query: 614 DCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQL 435
           D   FKPERW+  DG  +    +KF+ F AGPR C+G+D A+  +KM  A +   Y+F L
Sbjct: 392 DAALFKPERWLK-DGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMAMAILCRFYKFHL 450

Query: 434 VEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           V  H   + +    IL   HGLKV   +R
Sbjct: 451 VPNH--PVKYRMMTILSMAHGLKVTVSRR 477



>gb:AC073178_1541004 Arabidopsis thaliana chromosome 1 BAC F10D13
           genomic sequence, complete sequence.
          Length = 524

 Score =  117 bits (292), Expect = 4e-25
 Identities = 63/149 (42%), Positives = 84/149 (56%)
 Frame = -1

Query: 794 KLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGE 615
           KL YLHA   E+L L+P VP + K  +E D+LP+G  V     +    YSMGRM+  WG 
Sbjct: 378 KLHYLHAVITETLRLYPAVPQDPKGVLEDDMLPNGTKVKAGGMVTYVPYSMGRMEYNWGS 437

Query: 614 DCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQL 435
           D   FKPERW+  DG  +    +KF+ F AGPR C+G+D A+  +KM  A +   Y+F L
Sbjct: 438 DAALFKPERWLK-DGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMAMAILCRFYKFHL 496

Query: 434 VEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           V  H   + +    IL   HGLKV   +R
Sbjct: 497 VPNH--PVKYRMMTILSMAHGLKVTVSRR 523



>pir|G84675|G84675 probable cytochrome P450 [imported] - Arabidopsis
           thaliana>gb:AC005824_1533043 Arabidopsis thaliana
           chromosome 2 clone F15K20 map B68, complete
           sequence.>gb:AF370593_1792376 Arabidopsis thaliana
           putative cytochrome P450 (At2g27690; F15K20.21) mRNA,
           complete cds.>gb:AF462844_1801954 Arabidopsis thaliana
           At2g27690/F15K20.21 mRNA, complete cds.
          Length = 495

 Score =  115 bits (289), Expect = 8e-25
 Identities = 63/180 (35%), Positives = 96/180 (53%), Gaps = 4/180 (2%)
 Frame = -1

Query: 875 PQVEAKI---LHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKD 705
           P+VE +I   L  ++    D    + +E +++ YLHA+  ES+ LFPPV  + K  +  D
Sbjct: 315 PEVENRIREELDRVMGTGFDSVTARCDEMREMDYLHASLYESMRLFPPVQFDSKFALNDD 374

Query: 704 ILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNA 525
           +L  G  V   T++    Y+MGRMD +WG D  EFKPERW+  +G  + +   K+ VF A
Sbjct: 375 VLSDGTFVNSGTRVTYHAYAMGRMDRIWGPDYEEFKPERWLDNEGKFRPENPVKYPVFQA 434

Query: 524 GPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEIL-FTDSMILEKKHGLKVKFIKR 348
           G R CIG++MA   +K +A  II  ++ ++      E L F   +      GL V   +R
Sbjct: 435 GARVCIGKEMAIMEMKSIAVAIIRRFETRVASPETTETLRFAPGLTATVNGGLPVMIQER 494



>gb:AP003232_1825813 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0034E02.
          Length = 303

 Score =  115 bits (288), Expect = 1e-24
 Identities = 60/183 (32%), Positives = 102/183 (55%), Gaps = 7/183 (3%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDK-----KVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPME 711
           P VE KI+ +I  +++         F ++E + + YLHAA  ES+ L+PPV ++  +  E
Sbjct: 123 PDVEDKIVREIHAVRRASGGTGDPTFNLDELRDMQYLHAAITESMRLYPPVAMDSHSCKE 182

Query: 710 KDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVF 531
            D LP G  V     +    Y+M R++ +WG DC EF+PERW+   G  + +  +K+ VF
Sbjct: 183 DDFLPDGTFVGKGWFVSYSAYAMARVEDIWGADCEEFRPERWLDEAGAFRPESPFKYPVF 242

Query: 530 NAGPRTCIGRDMAFTVVKMVAATIICHYQFQLV--EFHHLEILFTDSMILEKKHGLKVKF 357
           +AGPR C+G++MA+  +K + A+++  +  +    E H   +L+   + L  K GL ++ 
Sbjct: 243 HAGPRMCLGKEMAYIQMKSIVASVLERFSLRYAGGEGHPGFVLW---LTLRMKGGLPMQV 299

Query: 356 IKR 348
             R
Sbjct: 300 TTR 302



>gb:AF092913_1767571 Nicotiana tabacum cytochrome P450-dependent
           fatty acid hydroxylase (CYP94A6) mRNA, complete cds.
          Length = 510

 Score =  115 bits (288), Expect = 1e-24
 Identities = 60/181 (33%), Positives = 100/181 (55%), Gaps = 5/181 (2%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+VE++IL +I +  +   ++  +E + + Y HA+ CES+  +PPVP++ K   + DILP
Sbjct: 331 PEVESQILKEIGEKSESLLLY--DEVKNMIYTHASLCESMRFYPPVPMDTKEATKDDILP 388

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPD-----GGIKRQPSYKFSVF 531
            G  V    ++    Y+MGR++ VWG+D  EF+PERW+  D          + +Y + VF
Sbjct: 389 DGTFVKKGNRVTYHPYAMGRVEKVWGKDWAEFRPERWLDKDEVTGNWTFVSKDAYTYPVF 448

Query: 530 NAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIK 351
            AGPR C+G++MAF  +K V A ++  ++   V     E +F   +  + K    V   +
Sbjct: 449 QAGPRVCLGKEMAFLQMKRVVAGVLRRFKVVPVVEQGAEPVFISYLTAKMKEVFPVTIEE 508

Query: 350 R 348
           R
Sbjct: 509 R 509



>gb:AF092915_1767573 Nicotiana tabacum cytochrome P450-dependent
           fatty acid hydroxylase (CYP94A4) mRNA, complete cds.
          Length = 511

 Score =  115 bits (287), Expect = 1e-24
 Identities = 59/181 (32%), Positives = 101/181 (55%), Gaps = 5/181 (2%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+ E +IL +  + K +  V+  +E + + Y HA+ CES+  +PP+P++ K   E +ILP
Sbjct: 329 PETENQILKEA-KAKSESPVY--DEVKDMIYTHASLCESMRFYPPIPIDTKAATEDNILP 385

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGG-----IKRQPSYKFSVF 531
            G  V   T++    Y+MGR++ +WG+D  EF+PERW+  D          + +Y + VF
Sbjct: 386 DGTFVKKGTRVSYHIYAMGRVENLWGKDWAEFRPERWLDKDEASGNWTFVARDTYTYPVF 445

Query: 530 NAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIK 351
            AGPR C+G++MAF  +K V A ++  ++   +    +E +F   +  + K G  V   +
Sbjct: 446 QAGPRICLGKEMAFLQMKRVVAGVLRRFKVVPLAEKGVEPVFLSYLTAKMKGGFPVTIEE 505

Query: 350 R 348
           R
Sbjct: 506 R 506



>gb:AP003735_1832643 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1147A04.
          Length = 546

 Score =  114 bits (286), Expect = 2e-24
 Identities = 62/163 (38%), Positives = 93/163 (57%), Gaps = 7/163 (4%)
 Frame = -1

Query: 806 EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDT 627
           +E +++ YLHAA  E++ L+PPVP++ +  +  D LP G  V          Y+MGRM  
Sbjct: 381 DELRRMHYLHAAISEAMRLYPPVPIDSRVAVAADALPDGTAVRAGWFADYSAYAMGRMPQ 440

Query: 626 VWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHY 447
           +WGEDC EF+PERW+S  G      + ++ VF+AGPR C+GR+MA+  +K VAA +I  +
Sbjct: 441 LWGEDCREFRPERWLSDGGEFVAVDAARYPVFHAGPRACLGREMAYVQMKAVAAAVIRRF 500

Query: 446 QFQLVEF-------HHLEILFTDSMILEKKHGLKVKFIKRK*D 339
             + V+           E+  T    L+ K GL V+  KR+ D
Sbjct: 501 AVEPVQAPASMETPPACEVTTT----LKMKGGLLVRIRKREDD 539



>pir|T00864|T00864 cytochrome P450 homolog F17K2.4 - Arabidopsis
           thaliana>gb:AC003680_1531183 Arabidopsis thaliana
           chromosome 2 BAC F17K2 genomic sequence, complete
           sequence.>gb:BT004736_1637770 Arabidopsis thaliana
           At2g45510 gene, complete cds.
          Length = 511

 Score =  114 bits (284), Expect = 3e-24
 Identities = 56/153 (36%), Positives = 92/153 (60%)
 Frame = -1

Query: 806 EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDT 627
           E   ++ YLHAA  E+L L+PPVP++ +     D+LP GH V+    I    Y+MGRM  
Sbjct: 358 EALDEMHYLHAALSETLRLYPPVPVDMRCAENDDVLPDGHRVSKGDNIYYIAYAMGRMTY 417

Query: 626 VWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHY 447
           +WG+D  EFKPERW+  DG  + +  +KF  F+AGPR C+G+D A+  +K+V+  ++  +
Sbjct: 418 IWGQDAEEFKPERWLK-DGLFQPESPFKFISFHAGPRICLGKDFAYRQMKIVSMALLHFF 476

Query: 446 QFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           +F++ +  + ++ +   + L    GL +  I R
Sbjct: 477 RFKMAD-ENSKVYYKRMLTLHVDGGLHLCAIPR 508



>gb:AF092914_1767572 Vicia sativa cytochrome P450-dependent fatty
           acid hydroxylase (CYP94A3) mRNA, complete cds.
          Length = 512

 Score =  113 bits (282), Expect = 5e-24
 Identities = 60/178 (33%), Positives = 93/178 (52%), Gaps = 4/178 (2%)
 Frame = -1

Query: 869 VEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSG 690
           VE +IL ++    +       +E + + Y HAA CES+ L+PPVP++ K     D+LP G
Sbjct: 333 VETEILKEVTAKSES---VSYDEVKDMVYTHAALCESMRLYPPVPVDTKEVAYDDVLPDG 389

Query: 689 HVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPD----GGIKRQPSYKFSVFNAG 522
             V    ++    Y+MGR + +WG D  EF+PERW+  D            Y + VF AG
Sbjct: 390 TFVKKGWRVAYHIYAMGRSEKIWGSDWAEFRPERWLRRDEDGMWSFVGMDPYAYPVFQAG 449

Query: 521 PRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           PR C+G++MAF  +K VAA ++  ++      + +E  +T  +    K G  V+  KR
Sbjct: 450 PRVCLGKEMAFLQMKRVAAGVLREFRVVPAMENGIEPEYTAHLTALMKGGFPVRIEKR 507



>pir|T00404|T00404 probable cytochrome P450 At2g44890 [imported] -
           Arabidopsis thaliana>gb:AC002388_1530614 Arabidopsis
           thaliana chromosome 2 clone T13E15 map m336, complete
           sequence.
          Length = 490

 Score =  113 bits (282), Expect = 5e-24
 Identities = 56/153 (36%), Positives = 91/153 (59%)
 Frame = -1

Query: 806 EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDT 627
           E   ++ YLHAA  E++ L+PPVP + +     D+LP GH V+    I    Y+MGRM  
Sbjct: 337 EALAQMQYLHAALSETMRLYPPVPEHMRCAENDDVLPDGHRVSKGDNIYYISYAMGRMTY 396

Query: 626 VWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHY 447
           +WG+D  EFKPERW+  DG  + +  +KF  F+AGPR CIG+D A+  +K+V+  ++  +
Sbjct: 397 IWGQDAEEFKPERWLK-DGVFQPESQFKFISFHAGPRICIGKDFAYRQMKIVSMALLHFF 455

Query: 446 QFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           +F++ +  + ++ +   + L    GL +  I R
Sbjct: 456 RFKMAD-ENSKVSYKKMLTLHVDGGLHLCAIPR 487



>sp|P98188|C942_VICSA Cytochrome P450 94A2 (EC 1.14.-.-)
           (P450-dependent fatty acid omega-
           hydroxylase).>gb:AF092917_1767575 Vicia sativa
           cytochrome P450-dependent fatty acid hydroxylase
           (CYP94A2) mRNA, complete cds.
          Length = 513

 Score =  113 bits (282), Expect = 5e-24
 Identities = 59/157 (37%), Positives = 86/157 (54%), Gaps = 4/157 (2%)
 Frame = -1

Query: 806 EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDT 627
           +E + + Y HAA CES+ L+PP+P++ K  +  D+LP G +V    ++    Y+MGR + 
Sbjct: 353 DEVKDMVYTHAALCESMRLYPPLPVDTKVAVHDDVLPDGTLVKKGWRVTYHIYAMGRSEK 412

Query: 626 VWGEDCMEFKPERWISPDGGIKRQ----PSYKFSVFNAGPRTCIGRDMAFTVVKMVAATI 459
           +WG D  EF+PERW+S D   K        Y + VF AGPR CIG++MAF  +K V A I
Sbjct: 413 IWGPDWAEFRPERWLSRDEVGKWSFVGIDYYSYPVFQAGPRVCIGKEMAFLQMKRVVAGI 472

Query: 458 ICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           +  ++        +E  +T       K G  VK  KR
Sbjct: 473 MGRFRVVPAMVEGIEPEYTAHFTSVMKGGFPVKIEKR 509



>gb:AY084262_1569354 Arabidopsis thaliana clone 101598 mRNA,
           complete sequence.
          Length = 508

 Score =  112 bits (281), Expect = 7e-24
 Identities = 63/181 (34%), Positives = 98/181 (54%), Gaps = 6/181 (3%)
 Frame = -1

Query: 869 VEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSG 690
           VE KIL ++    +       E+ ++++Y  A  CE++ L+PPV  + K+    DILP G
Sbjct: 325 VETKILDELRN--KGSLGLGFEDLREMSYTKACLCEAMRLYPPVAWDSKHAANDDILPDG 382

Query: 689 HVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQP------SYKFSVFN 528
             +    K+    Y MGRM+ VWG+D  EFKP RW   +     +P      S+KF VF 
Sbjct: 383 TPLKKGDKVTYFPYGMGRMEKVWGKDWDEFKPNRWFEEEPSYGTKPVLKSVSSFKFPVFQ 442

Query: 527 AGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           AGPR CIG++MAFT +K V  +++   +F+++   +   +F   +      GLKVK  +R
Sbjct: 443 AGPRVCIGKEMAFTQMKYVVGSVLS--RFKIIPVCNNRPVFVPLLTAHMAGGLKVKIKRR 500

Query: 347 K 345
           +
Sbjct: 501 E 501



>gb:AB007649_1510220 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MLE2.
          Length = 510

 Score =  112 bits (281), Expect = 7e-24
 Identities = 63/181 (34%), Positives = 98/181 (54%), Gaps = 6/181 (3%)
 Frame = -1

Query: 869 VEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSG 690
           VE KIL ++    +       E+ ++++Y  A  CE++ L+PPV  + K+    DILP G
Sbjct: 327 VETKILDELRN--KGSLGLGFEDLREMSYTKACLCEAMRLYPPVAWDSKHAANDDILPDG 384

Query: 689 HVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQP------SYKFSVFN 528
             +    K+    Y MGRM+ VWG+D  EFKP RW   +     +P      S+KF VF 
Sbjct: 385 TPLKKGDKVTYFPYGMGRMEKVWGKDWDEFKPNRWFEEEPSYGTKPVLKSVSSFKFPVFQ 444

Query: 527 AGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           AGPR CIG++MAFT +K V  +++   +F+++   +   +F   +      GLKVK  +R
Sbjct: 445 AGPRVCIGKEMAFTQMKYVVGSVLS--RFKIIPVCNNRPVFVPLLTAHMAGGLKVKIKRR 502

Query: 347 K 345
           +
Sbjct: 503 E 503



>gb:OSJN00071_1694301 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0019K04, complete sequence.
          Length = 506

 Score =  112 bits (279), Expect = 1e-23
 Identities = 53/133 (39%), Positives = 79/133 (59%), Gaps = 1/133 (0%)
 Frame = -1

Query: 830 QDKKVFKVEEC-QKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMP 654
           QD   F  E+   K+ YLHAA  E+L L+P VPL+ K     D LP GH V     +   
Sbjct: 346 QDFSSFLTEDAINKMQYLHAALTETLRLYPGVPLDVKYCFSDDTLPDGHAVKKGDMVNYQ 405

Query: 653 FYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKM 474
            Y MGRM  +WG++  EFKPERW+   G    +  +KF+ F AGPR C+G++ A+  +K+
Sbjct: 406 PYPMGRMKFLWGDNAEEFKPERWLDDSGMFVAESPFKFTAFQAGPRICLGKEFAYRQMKI 465

Query: 473 VAATIICHYQFQL 435
           V+A ++  ++F++
Sbjct: 466 VSAVLLYFFRFEM 478



>gb:BT005906_1638828 Arabidopsis thaliana At5g63450 gene, complete
           cds.>gb:AK118560_1816530 Arabidopsis thaliana At5g63450
           mRNA for putative cytochrome P450, complete cds, clone:
           RAFL19-79-C02.
          Length = 510

 Score =  112 bits (279), Expect = 1e-23
 Identities = 63/181 (34%), Positives = 98/181 (54%), Gaps = 6/181 (3%)
 Frame = -1

Query: 869 VEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSG 690
           VE KIL ++    +       E+ ++++Y  A  CE++ L+PPV  + K+    DILP G
Sbjct: 327 VETKILDELRN--KGSLGLGFEDLREMSYTKACLCEAMRLYPPVAWDSKHAANDDILPDG 384

Query: 689 HVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQP------SYKFSVFN 528
             +    K+    Y MGRM+ VWG+D  EFKP RW   +     +P      S+KF VF 
Sbjct: 385 TPLKKGDKVTYFPYGMGRMEKVWGKDWDEFKPNRWFEEEPSYGTKPVLKSVSSFKFPVFQ 444

Query: 527 AGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           AGPR CIG++MAFT +K V  +++   +F+++   +   +F   +      GLKVK  +R
Sbjct: 445 AGPRVCIGKEMAFTQMKDVVGSVLS--RFKIIPVCNNRPVFVPLLTAHMAGGLKVKIKRR 502

Query: 347 K 345
           +
Sbjct: 503 E 503



>gb:AC078894_1541591 Oryza sativa chromosome 10 BAC OSJNBa0096G08
           genomic sequence, complete sequence.
          Length = 404

 Score =  112 bits (279), Expect = 1e-23
 Identities = 55/156 (35%), Positives = 91/156 (58%), Gaps = 9/156 (5%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEE-CQKLT--------YLHAAFCESLGLFPPVPLNHK 723
           P+V+ KI H+ +          V+E  Q LT        YLHAA  E+L L+P VP+ +K
Sbjct: 221 PEVQEKICHEAMVATSAGDTASVDEFLQSLTDQALNNMHYLHAALTETLRLYPSVPMENK 280

Query: 722 NPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYK 543
                D+LP+G  V+    +    Y+MGRM+++WG+D   F+PERW+  +G  +++  +K
Sbjct: 281 QCFSDDVLPNGFNVSKGDIVFFIPYAMGRMESLWGKDAEYFRPERWLDENGVFQQESPFK 340

Query: 542 FSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQL 435
           F+ F AGPR C+G++ A+  +K+ AA ++  +  +L
Sbjct: 341 FTAFQAGPRICLGKEFAYRQMKIFAAVLLRFFVLKL 376



>gb:AE016959_1023522 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC074232_1541287
           Oryza sativa chromosome 10 BAC OSJNBb0005J14 genomic
           sequence, complete sequence.>gb:AE017113_1753341 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           67 of 77 of the complete sequence.
          Length = 495

 Score =  112 bits (279), Expect = 1e-23
 Identities = 55/156 (35%), Positives = 91/156 (58%), Gaps = 9/156 (5%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEE-CQKLT--------YLHAAFCESLGLFPPVPLNHK 723
           P+V+ KI H+ +          V+E  Q LT        YLHAA  E+L L+P VP+ +K
Sbjct: 312 PEVQEKICHEAMVATSAGDTASVDEFLQSLTDQALNNMHYLHAALTETLRLYPSVPMENK 371

Query: 722 NPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYK 543
                D+LP+G  V+    +    Y+MGRM+++WG+D   F+PERW+  +G  +++  +K
Sbjct: 372 QCFSDDVLPNGFNVSKGDIVFFIPYAMGRMESLWGKDAEYFRPERWLDENGVFQQESPFK 431

Query: 542 FSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQL 435
           F+ F AGPR C+G++ A+  +K+ AA ++  +  +L
Sbjct: 432 FTAFQAGPRICLGKEFAYRQMKIFAAVLLRFFVLKL 467



>pir|T46196|T46196 cytochrome P450-like protein - Arabidopsis
           thaliana>gb:ATT8P19_1556527 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T8P19.>gb:BT015332_1642160
           Arabidopsis thaliana At3g48520 gene, complete
           cds.>gb:BT015841_1642459 Arabidopsis thaliana At3g48520
           gene, complete cds.
          Length = 506

 Score =  112 bits (279), Expect = 1e-23
 Identities = 64/179 (35%), Positives = 95/179 (53%), Gaps = 5/179 (2%)
 Frame = -1

Query: 869 VEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSG 690
           VE KIL ++  L      F  E+ +++ Y  A  CE++ L+PPV  + K+    D+LP G
Sbjct: 325 VERKILEEVDPLVSLGLGF--EDLKEMAYTKACLCEAMRLYPPVSWDSKHAANDDVLPDG 382

Query: 689 HVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGG-----IKRQPSYKFSVFNA 525
             V    K+    Y MGRM+T+WG D  EF P RW   + G     +K    YKF VF A
Sbjct: 383 TRVKRGDKVTYFPYGMGRMETLWGTDSEEFNPNRWFDSEPGSTRPVLKPISPYKFPVFQA 442

Query: 524 GPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           GPR C+G++MAF  +K V  +++   +F++V  +    +F   +      GLKVK  +R
Sbjct: 443 GPRVCVGKEMAFMQMKYVVGSVLS--RFEIVPVNKDRPVFVPLLTAHMAGGLKVKIKRR 499



>gb:AP003735_1832644 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1147A04.
          Length = 549

 Score =  110 bits (274), Expect = 5e-23
 Identities = 55/156 (35%), Positives = 90/156 (57%), Gaps = 8/156 (5%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQD----KKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEK 708
           P+ E ++  ++  L+ D    ++    EE +++ YLHAA  E++ L+PPVPL  +     
Sbjct: 354 PECERRVYEEVTALRGDTAGDERDDGYEELKRMHYLHAAITETMRLYPPVPLASRVAAAD 413

Query: 707 DILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGG----IKRQPSYKF 540
           D+LP G VV          Y+MGRM  +W  DC EF+PERW+   GG         + ++
Sbjct: 414 DVLPDGTVVRAGWFADYSSYAMGRMPQLWERDCGEFRPERWLDGGGGGGGRFVAVDAARY 473

Query: 539 SVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLV 432
            VF+AGPR+C+G++MA+  +K VAA ++  +  ++V
Sbjct: 474 PVFHAGPRSCLGKEMAYVQMKAVAAAVVRRFSVEVV 509



>gb:AP003289_1827379 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0683F02.
          Length = 524

 Score =  109 bits (273), Expect = 6e-23
 Identities = 60/180 (33%), Positives = 91/180 (50%), Gaps = 3/180 (1%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLT---YLHAAFCESLGLFPPVPLNHKNPMEKD 705
           P+V   I  ++ ++  D          KL    Y+HAA  ES+ LFPPV  + K     D
Sbjct: 336 PEVATAIRDEVARVTGDGNRTMAATFDKLKDMHYVHAAMYESMRLFPPVQFDSKFAAGDD 395

Query: 704 ILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNA 525
            LP G VV   T++    Y+MGRM++VWG DC EF+PERW+  DG    +  Y++ VF A
Sbjct: 396 TLPDGTVVAKGTRVTYHAYAMGRMESVWGPDCAEFRPERWLR-DGRFVPESPYRYPVFQA 454

Query: 524 GPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKRK 345
           G R CIG+++A   +K V   ++  +  + +        F   +      GL V+  +R+
Sbjct: 455 GVRVCIGKELALMEMKAVIVAVVRSFDIEAIARSSRRPKFAPGLTATFAGGLPVRVRRRR 514



>gb:AP000391_1819978 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0538C01.
          Length = 525

 Score =  108 bits (270), Expect = 1e-22
 Identities = 57/142 (40%), Positives = 87/142 (61%)
 Frame = -1

Query: 794 KLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGE 615
           K+ YL A   E+L L+P VP++ K   E D+LP+G+ V     I    Y+MGRM  +WGE
Sbjct: 375 KMHYLQATISETLRLYPAVPVDAKMADEDDVLPNGYRVVKGDGINYMIYAMGRMTYLWGE 434

Query: 614 DCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQL 435
           D  EF+PERW+  +G  +++  +KF  FNAGPR C+G++ A   +K++AAT+I  ++F+L
Sbjct: 435 DAQEFRPERWL-VNGVYQQESPFKFVSFNAGPRICLGKEFAHRQMKIMAATLIHFFKFRL 493

Query: 434 VEFHHLEILFTDSMILEKKHGL 369
            E    E ++     L   +GL
Sbjct: 494 -EDESKEPIYKTMFTLHIDNGL 514



>gb:AC136222_1743105 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0088M05, complete sequence.
          Length = 526

 Score =  107 bits (267), Expect = 3e-22
 Identities = 47/117 (40%), Positives = 72/117 (61%)
 Frame = -1

Query: 785 YLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCM 606
           YLHAA  E++ L+PPVP N +  +  D+LP G  V          Y+MGRM+ +WGE C+
Sbjct: 377 YLHAAITEAMRLYPPVPFNGRVAVGDDVLPGGAAVRAGWFANYSAYAMGRMERLWGEGCL 436

Query: 605 EFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQL 435
           EF PERW+   G      + ++ VF+AGPR C+G++MA+  +K VAA ++  +  ++
Sbjct: 437 EFSPERWLRDGGEFVAVDAARYPVFHAGPRACLGKEMAYVQMKTVAAAVLRRFSVEV 493



>gb:AC105364_1737973 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1743A09, complete sequence.
          Length = 523

 Score =  106 bits (264), Expect = 7e-22
 Identities = 49/149 (32%), Positives = 87/149 (58%), Gaps = 9/149 (6%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQ-------DKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNP 717
           P VE +I  ++  ++        D+  F ++E +++ Y+HAA  ES+ L+PPVP++  + 
Sbjct: 339 PDVERRIREEVATVRARRGDGDVDRVGFDLDELREMQYVHAAITESMRLYPPVPVDSLHA 398

Query: 716 MEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPS--YK 543
            E D+LP G  V     +    Y+MGRM++VWG+D  EF+ ERW+        +P   ++
Sbjct: 399 QEDDVLPDGTAVEAGWFVAYNSYAMGRMESVWGKDAAEFRAERWLEDAAAATFRPESPFR 458

Query: 542 FSVFNAGPRTCIGRDMAFTVVKMVAATII 456
           +  F+ GPR C+G++MA+  +K + A ++
Sbjct: 459 YVSFHGGPRVCLGKEMAYIQMKSIIACVL 487



>gb:AP003232_1825817 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0034E02.
          Length = 515

 Score =  105 bits (263), Expect = 9e-22
 Identities = 50/147 (34%), Positives = 83/147 (56%), Gaps = 8/147 (5%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKK--------VFKVEECQKLTYLHAAFCESLGLFPPVPLNHKN 720
           P VE  I+ +I  +++            F   E + + YLHAA  ES+ L+PPV L+   
Sbjct: 325 PDVEDNIVREIRAVRRASSSNGVTSGAAFSPHELRDMHYLHAAITESMRLYPPVSLDTYV 384

Query: 719 PMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKF 540
             E+D LP G  V    ++    Y+M R++ +WG DC EF+PERW+   G  + + S+K+
Sbjct: 385 CKEEDFLPDGTFVGKGWQVTYCAYAMARVEDIWGTDCEEFRPERWLDEAGVFRPESSFKY 444

Query: 539 SVFNAGPRTCIGRDMAFTVVKMVAATI 459
            VF+ GPR C+G+++A+  +K + + +
Sbjct: 445 PVFHGGPRMCLGKEIAYIQMKSIVSCV 471



>gb:AC137004_1743400 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0615D12, complete sequence.
          Length = 519

 Score =  105 bits (263), Expect = 9e-22
 Identities = 55/180 (30%), Positives = 92/180 (51%), Gaps = 4/180 (2%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKV----FKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEK 708
           P+V A I  ++ ++   +      F  ++ + + Y+HAA  ES+ LFPPV  + K     
Sbjct: 335 PEVAAAIRDEVFRVAGGRDPTAASFDFDKLKDMHYVHAALYESMRLFPPVQFDSKFAAGD 394

Query: 707 DILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFN 528
           D LP G  V   T++    Y+MGRM+++WG DC  F+PERW+S    +   P Y++ VF 
Sbjct: 395 DTLPDGTFVAKGTRVTYHAYAMGRMESLWGPDCAVFRPERWLSGGRFVPESP-YRYPVFQ 453

Query: 527 AGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
            G R C+G+D+A   +K V   ++  +  + V+       F   +      G+ V+  +R
Sbjct: 454 GGVRVCVGKDLAIMEMKAVIVAVVLSFDVEAVDRSSRRPKFAPGLTATFAGGVPVRVRRR 513



>gb:ATAC010797_1543165 Arabidopsis thaliana chromosome III BAC F28J7
           genomic sequence, complete
           sequence.>gb:ATAC011664_1543362 Arabidopsis thaliana
           chromosome III BAC F1C9 genomic sequence, complete
           sequence.
          Length = 496

 Score =  103 bits (258), Expect = 3e-21
 Identities = 53/151 (35%), Positives = 85/151 (56%), Gaps = 6/151 (3%)
 Frame = -1

Query: 872 QVEAKILHDILQLKQD-KKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           + E  ++ +I  +K++    F  E  +KL+ L A  CE + L+PPVP + K+ +  D LP
Sbjct: 312 ETEHDLVSEIRSVKEEITGGFDYESLKKLSLLKACLCEVMRLYPPVPWDSKHALTDDRLP 371

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGG-----IKRQPSYKFSVF 531
            G +V    ++    Y MGRM+ +WGED  EFKP RW           +K+   +KF VF
Sbjct: 372 DGTLVRAGDRVTYFPYGMGRMEELWGEDWDEFKPNRWAESYDKTCCRVLKKVNPFKFPVF 431

Query: 530 NAGPRTCIGRDMAFTVVKMVAATIICHYQFQ 438
            AGPR C+G +MA+  +K + A+I+  ++ +
Sbjct: 432 QAGPRVCLGEEMAYVQMKYIVASILDRFEIE 462



>gb:AJ698923_1813455 Populus deltoides x Populus maximowiczii
           partial mRNA for putative cytochrome P450.
          Length = 112

 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 45/106 (42%), Positives = 69/106 (65%), Gaps = 5/106 (4%)
 Frame = -1

Query: 650 YSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPS-YKFSVFNAGPRTCIGRDMAFTVVKM 474
           Y+MGRM+++WG++C +F PERW+  + GI RQ S +KF VF+AGPR C+G+DMA+  +K 
Sbjct: 14  YAMGRMESIWGKNCRDFVPERWL--ENGIYRQESPFKFPVFHAGPRMCLGKDMAYIQMKS 71

Query: 473 VAATIICHYQFQLVEFH----HLEILFTDSMILEKKHGLKVKFIKR 348
           +AA++I  ++  +        HL      S+ L  K GL+VK  +R
Sbjct: 72  IAASVIERFEIDVQNKEKCPDHLL-----SLTLRMKGGLQVKVKER 112



>gb:AY316198_1598411 Rhodotorula sp. CBS 8446 cytochrome P450 gene,
           complete cds.
          Length = 535

 Score = 79.3 bits (194), Expect = 9e-14
 Identities = 45/132 (34%), Positives = 67/132 (50%), Gaps = 1/132 (0%)
 Frame = -1

Query: 839 QLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGH-VVTPNTKI 663
           QL    +   +E  + L    AA  ESL L PPVP   K  ++ D LP+G  ++     I
Sbjct: 357 QLAGGTEPVTLENVKNLVQTQAAHLESLRLHPPVPRIVKQAVKDDALPNGGPLIKAGEFI 416

Query: 662 IMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTV 483
            +  +++GR + VWG D  E+KP RWI  +G   +   +K   FN GPR C+G+ +A   
Sbjct: 417 RLSDWALGRNEEVWGADAKEWKPSRWIDDEGRPIQYSQWKAHFFNGGPRICLGKSLATLE 476

Query: 482 VKMVAATIICHY 447
              V A ++  Y
Sbjct: 477 GVAVIANLLHRY 488



>gb:AY113688_1299603 Helicoverpa zea cytochrome P450 monooxygenase
           CYP4M7 mRNA, complete cds.
          Length = 502

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 51/176 (28%), Positives = 93/176 (52%), Gaps = 1/176 (0%)
 Frame = -1

Query: 869 VEAKILHDILQLKQDK-KVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPS 693
           ++ KI+ ++ ++  D  +   +++  K+ Y+     ESL ++PPV    +   E  +L S
Sbjct: 332 IQDKIVEELNEILGDSDRWLTMDDLAKMKYMERCIKESLRIYPPVHFISRKLNETTVL-S 390

Query: 692 GHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRT 513
           G+ V  +T   +P Y M   + ++ ED   F P+R++ P+  + R P Y +  F+AGPR 
Sbjct: 391 GYQVPADTLCHIPIYDMHHREDLF-EDPERFDPDRFL-PENSVGRHP-YAYIPFSAGPRN 447

Query: 512 CIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKRK 345
           CIG+  A   +K+  A ++  ++ + V     EI F   ++L     +KV F+KRK
Sbjct: 448 CIGQKFAMLEMKIAVAEVLRKFELKPVT-KPSEIEFIADLVLRNNGPVKVNFVKRK 502



>gb:BC054222_2550872 Xenopus laevis hypothetical protein MGC64404,
           mRNA (cDNA clone MGC:64404 IMAGE:6879036), complete cds.
          Length = 503

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 50/161 (31%), Positives = 82/161 (50%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+   K   +I ++   K+  + E+  KL YL     E+L L+P  P      +EK+I+ 
Sbjct: 328 PETLKKAQAEIDEVIGSKRDIEYEDLSKLKYLSQVLKETLRLYPTAP-GTSRALEKEIVI 386

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G  + PN  + +  Y MGRM+  + ED + F P+R+ SPD     +P + +  F+ GPR
Sbjct: 387 EGVRIPPNVTVTLNSYVMGRMEQFY-EDPLTFNPDRF-SPDAP---KPYFTYFPFSLGPR 441

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSM 393
            CIG+  +    K+V A  +  Y F+L      +IL T ++
Sbjct: 442 NCIGQVFSQMEAKVVLAKFLQRYDFELANGQSFKILDTGTL 482



>gb:AE017343_1755698 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 575

 Score = 76.6 bits (187), Expect = 6e-13
 Identities = 48/141 (34%), Positives = 70/141 (49%), Gaps = 12/141 (8%)
 Frame = -1

Query: 869 VEAKILHDILQLKQDKKVFKV--EECQ-------KLTYLHAAFCESLGLFPPVPLNHKNP 717
           V A +LH     +   +VF +  +EC+       +L Y  A   E L LFPPVPLN +  
Sbjct: 354 VYAIVLHPDFAARLKDEVFTIANQECEVTKDTIRQLRYCRAFINEVLRLFPPVPLNIRRT 413

Query: 716 MEKDILPSGH---VVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSY 546
           +   +LP+ +    +  NT II+    M R   VWGED   F P+RW+  +GG   +   
Sbjct: 414 LRPSLLPTPNHLAYMPANTSIILATILMQRDPAVWGEDAQVFNPDRWL--EGGGLGKEKE 471

Query: 545 KFSVFNAGPRTCIGRDMAFTV 483
            F  +N GPR C+G+  A  +
Sbjct: 472 GFMSWNLGPRMCLGQSFALAI 492



>gb:AY063501_1293657 Mamestra brassicae cytochrome P450 CYP4L4
           (Cyp4L4) mRNA, complete cds.
          Length = 492

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 49/153 (32%), Positives = 83/153 (54%)
 Frame = -1

Query: 803 ECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTV 624
           E Q++ YL     ES+ LFPPVPL  +  M KD    G  +   T ++M  + + R   +
Sbjct: 350 ELQQMKYLELVIKESMRLFPPVPLIERRIM-KDCEVGGLKLVKGTSVVMNIFQIQRQPDL 408

Query: 623 WGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQ 444
           + +D +EF+PER+ +P      +  + +  F+AGPR CIG+  A   +K+  + I+ ++ 
Sbjct: 409 F-DDPLEFRPERFEAP-----LKNPFSWLAFSAGPRNCIGQKFAMMELKITISEIVKNF- 461

Query: 443 FQLVEFHHLEILFTDSMILEKKHGLKVKFIKRK 345
           F L      E+  +  ++L  K+G+ VKF+ RK
Sbjct: 462 FILPAAEEPEL--SADLVLRSKNGVNVKFLPRK 492



>gb:AF124372_1770245 Nicotiana tabacum NT7 mRNA, partial cds.
          Length = 275

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 47/165 (28%), Positives = 80/165 (48%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           PQ   K+   I    ++ ++  V +  KL YL+    E+L L+PPVPL   +   +D   
Sbjct: 16  PQAFTKLRAAIACKVENDRLLNVSDIPKLPYLYCVINETLRLYPPVPLLLPHYSLEDCTV 75

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G+ V  +T +++  +++ R   +W E   +F PER+ + D G K    YKF  F  G R
Sbjct: 76  GGYAVPKHTILMIIAWAIHRDPKLWDEPA-KFTPERFAAMDLGEKEGFLYKFVPFGMGRR 134

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEK 381
            C G  M    V +V  +++  + ++ VE   L+  +   + L K
Sbjct: 135 ACPGATMGLRTVSLVLGSLLQWFDWESVEKEKLDACYNSRITLHK 179



>gb:YSAP450ALK_1728133 Candida tropicalis cytochrome P-450-alk2
           (CYP52A2) and cytochrome P-450-alk1 (CYP52A1) genes,
           complete cds.
          Length = 522

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 51/166 (30%), Positives = 75/166 (45%), Gaps = 13/166 (7%)
 Frame = -1

Query: 875 PQVEAKI---LHDILQLKQDKKVFKV--EECQKLTYLHAAFCESLGLFPPVPLNHKNPME 711
           P+V  K+   + D   L QD +V ++  E  +   YL A   E L L+P VP N +    
Sbjct: 338 PRVANKLREEIEDKFGLGQDARVEEISFESLKSCEYLKAVLNECLRLYPSVPQNFRVATR 397

Query: 710 KDILPSGH--------VVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQ 555
              LP G         +V     ++   Y+  R   ++GED +EF+PERW  P+    ++
Sbjct: 398 NTTLPRGGGKDGLSPVLVRKGQTVMYSVYAAHRNKQIYGEDALEFRPERWFEPE---TKK 454

Query: 554 PSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHL 417
             + F  FN GPR C+G+  A T    V   +       L EF HL
Sbjct: 455 LGWAFLPFNGGPRICLGQQFALTEASYVTVRL-------LQEFSHL 493



>gb:CTP450ALK_1674222 C.tropicalis DNA for alkane-inducible
           cytochrome P450alk2 gene.
          Length = 213

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 51/166 (30%), Positives = 75/166 (45%), Gaps = 13/166 (7%)
 Frame = -1

Query: 875 PQVEAKI---LHDILQLKQDKKVFKV--EECQKLTYLHAAFCESLGLFPPVPLNHKNPME 711
           P+V  K+   + D   L QD +V ++  E  +   YL A   E L L+P VP N +    
Sbjct: 29  PRVANKLREEIEDKFGLGQDARVEEISFESLKSCEYLKAVLNECLRLYPSVPQNFRVATR 88

Query: 710 KDILPSGH--------VVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQ 555
              LP G         +V     ++   Y+  R   ++GED +EF+PERW  P+    ++
Sbjct: 89  NTTLPRGGGKDGLSPVLVRKGQTVMYSVYAAHRNKQIYGEDALEFRPERWFEPE---TKK 145

Query: 554 PSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHL 417
             + F  FN GPR C+G+  A T    V   +       L EF HL
Sbjct: 146 LGWAFLPFNGGPRICLGQQFALTEASYVTVRL-------LQEFSHL 184



>gb:AB010392_1511072 Yarrowia lipolytica gene for ALK5, complete
           cds.>gb:CR382128_1660904 Yarrowia lipolytica chromosome
           B of strain CLIB99 of Yarrowia lipolytica.
          Length = 531

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 53/185 (28%), Positives = 84/185 (45%), Gaps = 10/185 (5%)
 Frame = -1

Query: 875 PQVEAKILHDILQ-LKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDIL 699
           P++ AK+   IL+      +    E  ++  YL     E+L L+P VP+N +       L
Sbjct: 345 PKLYAKLRSAILEDFGTTPEAITFESLKQCDYLRYVLNEALRLYPVVPINGRTATRDTTL 404

Query: 698 PSGHVVTPNTKIIMP--------FYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYK 543
           P G     +  I +P         Y   R    WGED  EF PERW   +G I R   ++
Sbjct: 405 PRGGGPDQSQPIFIPKGQTVSYSVYWTHRDPRFWGEDAEEFIPERWDPRNGNIGR--GWE 462

Query: 542 FSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQ-FQLVEFHHLEILFTDSMILEKKHGLK 366
           +  FN GPR C+G+  A T V  V + ++  Y+  +  +   L  L+  ++ +  + G+ 
Sbjct: 463 YLPFNGGPRICLGQQFALTEVGYVLSRLVQTYETLETCDHKPLPPLYNHALTMCHEEGVW 522

Query: 365 VKFIK 351
           VK  K
Sbjct: 523 VKMYK 527



>pir|T52515|T52515 related to n-alkane-inducible cytochrome P450
           [imported] - Neurospora crassa>gb:NCB2J23_1690017
           Neurospora crassa DNA linkage group I BAC clone B2J23.
          Length = 495

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 41/141 (29%), Positives = 71/141 (50%), Gaps = 8/141 (5%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+   K+  +I  ++ +   +  E+ + + YL+    E L LFPP   N + P++  +LP
Sbjct: 317 PEAVKKLRKEIFDMEDEMPTW--EQLKNMKYLNMIIKEGLRLFPPASTNSRAPIKDTVLP 374

Query: 695 SGHVVTPNTKIIMP--------FYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKF 540
            G        I++P         YS+ R   +WGED  EF+PERW   D  ++    +++
Sbjct: 375 RGGGPDGKQPILVPKGQVVRWSLYSLHRRKDIWGEDAHEFRPERW---DENLR--VGWEY 429

Query: 539 SVFNAGPRTCIGRDMAFTVVK 477
             F+ GPR C+G+  A T ++
Sbjct: 430 IPFSGGPRICLGQQFALTQIE 450



>sp|P30607|CP5B_CANTR Cytochrome P450 52A2 (EC 1.14.14.-) (CYPLIIA2)
           (Alkane-inducible P450- ALK2).>pir|JT0980|JT0980
           cytochrome P450 52A2, alkane-inducible - yeast (Candida
           tropicalis)
          Length = 522

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 51/166 (30%), Positives = 75/166 (45%), Gaps = 13/166 (7%)
 Frame = -1

Query: 875 PQVEAKI---LHDILQLKQDKKVFKV--EECQKLTYLHAAFCESLGLFPPVPLNHKNPME 711
           P+V  K+   + D   L QD +V ++  E  +   YL A   E L L+P VP N +    
Sbjct: 338 PRVANKLREEIEDKFGLGQDARVEEISFESLKSCEYLKAVLNECLRLYPSVPQNFRVATR 397

Query: 710 KDILPSGH--------VVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQ 555
              LP G         +V     ++   Y+  R   ++GED +EF+PERW  P+    ++
Sbjct: 398 NTTLPRGGGKDGLSPVLVRKGQTVMYSVYAAHRNKQIYGEDALEFRPERWFEPE---TKK 454

Query: 554 PSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHL 417
             + F  FN GPR C+G+  A T    V   +       L EF HL
Sbjct: 455 LGWAFLPFNGGPRICLGQQFALTEASYVTVRL-------LQEFSHL 493



>pir|A40576|A40576 cytochrome P450 ALK2-A - yeast (Candida
           maltosa)>gb:CMALK_1647980 C.maltosa ALK2-A and ALK3-A
           genes for n-alkane inducible cytochrome P-450.
          Length = 526

 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 46/153 (30%), Positives = 74/153 (48%), Gaps = 13/153 (8%)
 Frame = -1

Query: 875 PQVEAKILHDI---LQLKQDKKVFKV--EECQKLTYLHAAFCESLGLFPPVPLNHKNPME 711
           P V AK+  +I     L +D ++ ++  E  ++  YL A   E L L+P VP N +   +
Sbjct: 342 PDVVAKLKDEIDTKFGLGEDARIEEITFESLKQCEYLKAVLNECLRLYPSVPQNFRVATK 401

Query: 710 KDILPSGH--------VVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQ 555
              LP G         +V     ++   Y+  RM++V+G+D   F+PERW  P+    R+
Sbjct: 402 NTTLPRGGGKDGLSPILVRKGQTVMYSVYATHRMESVYGKDATTFRPERWFEPE---TRK 458

Query: 554 PSYKFSVFNAGPRTCIGRDMAFTVVKMVAATII 456
             + F  FN GPR C+G+  A T    V   ++
Sbjct: 459 LGWAFVPFNGGPRICLGQQFALTEASYVTVRLL 491



>sp|Q9VMS8|C4A2_DROME Probable cytochrome P450 4ac2 (EC 1.14.-.-)
           (CYPIVAC2).>gb:AE014134_1127636 Drosophila melanogaster
           chromosome 2L, complete sequence.>gb:AE003609_1217743
           Drosophila melanogaster chromosome 2L, section 18 of 83
           of the complete sequence.
          Length = 497

 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 50/175 (28%), Positives = 90/175 (51%)
 Frame = -1

Query: 869 VEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSG 690
           V+ K   +I  L  D     V +  +L Y+     ESL LFP VP   +  +E+ ++ +G
Sbjct: 326 VQKKCYEEIKYLPDDSDDISVFQFNELVYMECVIKESLRLFPSVPFIGRRCVEEGVV-NG 384

Query: 689 HVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTC 510
            ++  NT+I +  Y + R D     +   F+P+R+  P+  + R P + F  F+AG R C
Sbjct: 385 LIMPKNTQINIHLYEIMR-DARHFSNPKMFQPDRFF-PENTVNRHP-FAFVPFSAGQRNC 441

Query: 509 IGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKRK 345
           IG+  A   +K++ A +I +++   V     ++ F + ++L  K  +KVK + R+
Sbjct: 442 IGQKFAILEIKVLLAAVIRNFKILPVTLLD-DLTFENGIVLRTKQNIKVKLVHRE 495



>gb:AK126473_1916330 Homo sapiens cDNA FLJ44509 fis, clone
           UTERU3001585, weakly similar to Cytochrome P450 4c3 (EC
           1.14.-.-).
          Length = 503

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 55/181 (30%), Positives = 96/181 (53%), Gaps = 2/181 (1%)
 Frame = -1

Query: 875 PQVEAKILHDILQL--KQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDI 702
           P+V+ K+ H++  +  K D+    VE+ +KL YL     E+L LFP VPL  ++ + +D 
Sbjct: 327 PEVQKKVDHELDDVFGKSDRPA-TVEDLKKLRYLECVIKETLRLFPSVPLFARS-VSEDC 384

Query: 701 LPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAG 522
             +G+ V   T+ ++  Y++ R D  +  +  EF+PER+  P+    R P Y +  F+AG
Sbjct: 385 EVAGYRVLKGTEAVIIPYALHR-DPRYFPNPEEFQPERFF-PENAQGRHP-YAYVPFSAG 441

Query: 521 PRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKRK* 342
           PR CIG+  A    K + + I+ H+  +  +    E+     +IL   +G+ +K  +R  
Sbjct: 442 PRNCIGQKFAVMEEKTILSCILRHFWIESNQKRE-ELGLEGQLILRPSNGIWIKLKRRNA 500

Query: 341 D 339
           D
Sbjct: 501 D 501



>gb:AK122600_1915255 Homo sapiens cDNA FLJ16007 fis, clone
           KIDNE2006580, weakly similar to CYTOCHROME P450 4C1 (EC
           1.14.14.1).>gb:AY422002_1949806 Homo sapiens cytochrome
           P450 4V2 (CYP4V2) mRNA, complete
           cds.>gb:BC060857_1985756 Homo sapiens cytochrome P450,
           family 4, subfamily V, polypeptide 2, mRNA (cDNA clone
           MGC:71790 IMAGE:30333559), complete cds.
          Length = 525

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 55/181 (30%), Positives = 96/181 (53%), Gaps = 2/181 (1%)
 Frame = -1

Query: 875 PQVEAKILHDILQL--KQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDI 702
           P+V+ K+ H++  +  K D+    VE+ +KL YL     E+L LFP VPL  ++ + +D 
Sbjct: 349 PEVQKKVDHELDDVFGKSDRPA-TVEDLKKLRYLECVIKETLRLFPSVPLFARS-VSEDC 406

Query: 701 LPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAG 522
             +G+ V   T+ ++  Y++ R D  +  +  EF+PER+  P+    R P Y +  F+AG
Sbjct: 407 EVAGYRVLKGTEAVIIPYALHR-DPRYFPNPEEFQPERFF-PENAQGRHP-YAYVPFSAG 463

Query: 521 PRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKRK* 342
           PR CIG+  A    K + + I+ H+  +  +    E+     +IL   +G+ +K  +R  
Sbjct: 464 PRNCIGQKFAVMEEKTILSCILRHFWIESNQKRE-ELGLEGQLILRPSNGIWIKLKRRNA 522

Query: 341 D 339
           D
Sbjct: 523 D 523



>gb:YSACYP_1728101 Candida maltosa gene for cytochrome P-450alk,
           complete cds.
          Length = 523

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 41/124 (33%), Positives = 58/124 (46%), Gaps = 8/124 (6%)
 Frame = -1

Query: 806 EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMP--------F 651
           E  +K  YL A   E+L ++P VP+N +       LP G     N+ I +P         
Sbjct: 368 ETLKKCEYLKAVLNETLRMYPSVPINFRTATRDTTLPRGGGKDGNSPIFVPKGSSVVYSV 427

Query: 650 YSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMV 471
           Y   R+   +GED  EF+PERW  P     R+  + +  FN GPR C+G+  A T    V
Sbjct: 428 YKTHRLKQFYGEDAYEFRPERWFEPS---TRKLGWAYLPFNGGPRICLGQQFALTEASYV 484

Query: 470 AATI 459
            A +
Sbjct: 485 IARL 488



>gb:YSAAHCP_1728058 Candida maltosa alkane hydroxylating cytochrome
           P-450 mRNA, complete cds.
          Length = 521

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 41/124 (33%), Positives = 58/124 (46%), Gaps = 8/124 (6%)
 Frame = -1

Query: 806 EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMP--------F 651
           E  +K  YL A   E+L ++P VP+N +       LP G     N+ I +P         
Sbjct: 366 ETLKKCEYLKAVLNETLRMYPSVPINFRTATRDTTLPRGGGKDGNSPIFVPKGSSVVYSV 425

Query: 650 YSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMV 471
           Y   R+   +GED  EF+PERW  P     R+  + +  FN GPR C+G+  A T    V
Sbjct: 426 YKTHRLKQFYGEDAYEFRPERWFEPS---TRKLGWAYLPFNGGPRICLGQQFALTEASYV 482

Query: 470 AATI 459
            A +
Sbjct: 483 IARL 486



>pir|C83722|C83722 cytochrome P450 BH0579 [imported] - Bacillus
           halodurans  (strain C-125)>gb:BA000004_654525 Bacillus
           halodurans C-125 DNA, complete genome.
          Length = 453

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 51/176 (28%), Positives = 86/176 (48%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P VE K+  ++ Q+  ++    +E+  KL+Y      E+L + P V L  +   EKD+  
Sbjct: 286 PHVEEKLYQEVSQVLGNRPA-TLEDMPKLSYAEHVIKETLRVQPTVWLISRRA-EKDVTL 343

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
             + ++  ++I++  + M R    +  D + F PERW   D    +   Y +  F  GPR
Sbjct: 344 GDYHISAGSEIMISQWGMHRNPRYFN-DPLTFLPERW---DNNDNKPSKYVYFPFGGGPR 399

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
            CIG   A     ++ ATI+  ++ +LV+   L I    S+ L  KHG+ +K  KR
Sbjct: 400 VCIGERFALMEATLIMATIVREFRMELVD--ELPIKMEPSITLRPKHGVTMKLRKR 453



>pir|B56578|O4CKA3 cytochrome P450 52A3-a - yeast (Candida
           maltosa)>gb:CMP450CM1_1648039 Candida maltosa mRNA for
           cytochrome P450cm1.
          Length = 523

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 41/124 (33%), Positives = 58/124 (46%), Gaps = 8/124 (6%)
 Frame = -1

Query: 806 EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMP--------F 651
           E  +K  YL A   E+L ++P VP+N +       LP G     N+ I +P         
Sbjct: 368 ETLKKCEYLKAVLNETLRMYPSVPINFRTATRDTTLPRGGGKDGNSPIFVPKGSSVVYSV 427

Query: 650 YSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMV 471
           Y   R+   +GED  EF+PERW  P     R+  + +  FN GPR C+G+  A T    V
Sbjct: 428 YKTHRLKQFYGEDAYEFRPERWFEPS---TRKLGWAYLPFNGGPRICLGQQFALTEASYV 484

Query: 470 AATI 459
            A +
Sbjct: 485 IARL 488



>sp|P16496|CP5C_CANMA Cytochrome P450 52A3 (EC 1.14.14.-) (CYPLIIA3)
           (Alkane-inducible P450- ALK1-A) (P450-CM1) (CYP52A3-A)
           (Cytochrome P-450ALK).
          Length = 522

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 41/124 (33%), Positives = 58/124 (46%), Gaps = 8/124 (6%)
 Frame = -1

Query: 806 EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMP--------F 651
           E  +K  YL A   E+L ++P VP+N +       LP G     N+ I +P         
Sbjct: 367 ETLKKCEYLKAVLNETLRMYPSVPINFRTATRDTTLPRGGGKDGNSPIFVPKGSSVVYSV 426

Query: 650 YSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMV 471
           Y   R+   +GED  EF+PERW  P     R+  + +  FN GPR C+G+  A T    V
Sbjct: 427 YKTHRLKQFYGEDAYEFRPERWFEPS---TRKLGWAYLPFNGGPRICLGQQFALTEASYV 483

Query: 470 AATI 459
            A +
Sbjct: 484 IARL 487



>sp|Q9T0K2|C71K_ARATH Cytochrome P450 71A20 (EC
           1.14.-.-).>pir|T06288|T06288 probable cytochrome P450
           T9E8.50 - Arabidopsis thaliana>gb:ATCHRIV36_1545095
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 36.>gb:ATT9E8_1556615 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T9E8, partial sequence (ESSA
           project).
          Length = 495

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 41/147 (27%), Positives = 72/147 (48%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+V  K+  +I            +E +K+ YL A   E+L L PP PL     + +D+  
Sbjct: 318 PKVMKKLQEEIRSSSPQDLFVTEKEAEKMNYLQAVIKEALRLRPPAPLLVPRVLSEDVKL 377

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G+ +   T++I+  +++ R  T WG D  EFKPER +  +   + Q  +KF  F +G R
Sbjct: 378 KGYNIPAGTQVIVNAWAIQRDTTTWGTDAEEFKPERHLDTNLDFQGQ-DFKFIPFGSGKR 436

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQL 435
            C G      ++ +  A I+  + +++
Sbjct: 437 ICPGIGFTSALIGVTLANIVKRFNWRM 463



>gb:CR858234_1182419 Pongo pygmaeus mRNA; cDNA DKFZp469M1818 (from
           clone DKFZp469M1818).
          Length = 525

 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 55/181 (30%), Positives = 96/181 (53%), Gaps = 2/181 (1%)
 Frame = -1

Query: 875 PQVEAKILHDILQL--KQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDI 702
           P+V+ K+ H++  +  K D+    VE+ +KL YL     E+L LFP VPL  ++ + +D 
Sbjct: 349 PEVQQKVDHELDDVFGKSDRPA-TVEDLKKLRYLECVIKETLRLFPSVPLFARS-VSEDC 406

Query: 701 LPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAG 522
             +G+ V   T+ ++  Y++ R D  +  +  EF+PER+  P+    R P Y +  F+AG
Sbjct: 407 EVAGYRVLKGTEAVIIPYALHR-DPRYFPNPEEFQPERFF-PENAQGRHP-YAYVPFSAG 463

Query: 521 PRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKRK* 342
           PR CIG+  A    K + + I+ H+  +  +    E+     +IL   +G+ +K  +R  
Sbjct: 464 PRNCIGQKFAVMEEKTILSCILRHFWIESNQKRE-ELGLEGQLILRPSNGIWIKLKRRDA 522

Query: 341 D 339
           D
Sbjct: 523 D 523



>gb:AY574044_1338497 Capitella capitata cytochrome P450 CYP4AT1
           mRNA, complete cds.
          Length = 490

 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 46/172 (26%), Positives = 87/172 (50%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+ + +   +++ +  D+   + ++  KLT+L     ESL L P VP   ++  +    P
Sbjct: 319 PEYQDRCRKEVMDVMGDRSDVEWDDMSKLTFLTMCIKESLRLHPAVPNIGRSLTKPMTFP 378

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G  V   T + +  Y       +W E+  ++ PER+ + +   K +P + F  F+AGPR
Sbjct: 379 DGRTVPAETDLGIAIYGCHHNSALW-ENPEQYDPERFNAENS--KDRPPHSFIPFSAGPR 435

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVK 360
            CIG+  A   ++ V A  + ++Q ++ +   LE+L    ++L+ K GL +K
Sbjct: 436 NCIGQHFAMHEMRSVLAVCLKNFQLRIDDTRILELL--PQLVLKAKGGLWLK 485



>sp|Q27519|YRVA_CAEEL Putative cytochrome P450 CYP13A7 (EC
           1.14.-.-).>pir|T24783|T24783 hypothetical protein
           T10B9.10 - Caenorhabditis elegans>gb:CET10B9_1367563
           Caenorhabditis elegans cosmid T10B9, complete sequence.
          Length = 518

 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 46/146 (31%), Positives = 70/146 (47%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+++ K+  ++ +   D +V   ++  KL YL     E+L L+P   L H     K    
Sbjct: 346 PEIQKKLQEEVDRECPDPEV-TFDQLSKLKYLECVVKEALRLYPLASLVHNRKCLKTTNV 404

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G  +   T I +  +S+     VWG+D  EFKPERW S D     +  Y    F  GPR
Sbjct: 405 LGMEIEAGTNINVDTWSLHHDPKVWGDDVNEFKPERWESGDELFFAKGGY--LPFGMGPR 462

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQ 438
            CIG  +A   +KM+   I+ +Y F+
Sbjct: 463 ICIGMRLAMMEMKMLLTNILKNYTFE 488



>sp|Q9Y6A2|CP46_HUMAN Cytochrome p450 46A1 (EC 1.14.-.-)
           (Cholesterol 24-hydroxylase).>gb:AF094480_1882720 Homo
           sapiens cholesterol 24-hydroxylase mRNA, complete
           cds.>gb:BC022539_1977943 Homo sapiens cytochrome P450,
           family 46, subfamily A, polypeptide 1, mRNA (cDNA clone
           MGC:26700 IMAGE:4819975), complete cds.
          Length = 500

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 47/148 (31%), Positives = 79/148 (53%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P++ A++  ++ ++   K+    E+  +L YL     ESL L+PP        +E++ L 
Sbjct: 322 PEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQVLKESLRLYPPA-WGTFRLLEEETLI 380

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G  V  NT ++   Y MGRMDT + ED + F P+R+    G    +P + +  F+ G R
Sbjct: 381 DGVRVPGNTPLLFSTYVMGRMDTYF-EDPLTFNPDRF----GPGAPKPRFTYFPFSLGHR 435

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLV 432
           +CIG+  A   VK+V A ++   +F+LV
Sbjct: 436 SCIGQQFAQMEVKVVMAKLLQRLEFRLV 463



>gb:OSJN00014_1693289 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0068L06, complete
           sequence.>gb:OSJN00294_1698095 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: B1160F02, complete sequence.
          Length = 499

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 46/172 (26%), Positives = 87/172 (50%), Gaps = 3/172 (1%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+   K+  +I  +    ++    +  +L YL AA+ E+L L P  P+ H+   E +I  
Sbjct: 315 PEALRKVREEIEAVVGRDRIAGEGDLPRLPYLQAAYKETLRLRPAAPIAHRQSTE-EIQI 373

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQP---SYKFSVFNA 525
            G  V   T + +  +++GR    W E+ +EF+PER+++  GG   +P    ++F  F +
Sbjct: 374 RGFRVPAQTAVFINVWAIGRDPAYW-EEPLEFRPERFLAGGGGEGVEPRGQHFQFMPFGS 432

Query: 524 GPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGL 369
           G R C G  +A   V  V A ++  + +Q ++   +++   D ++  +KH L
Sbjct: 433 GRRGCPGMGLALQSVPAVVAALLQCFDWQCMDNKLIDMEEADGLVCARKHRL 484



>pir|A96695|A96695 hypothetical protein F5A8.3 [imported] -
           Arabidopsis thaliana>gb:AE005173_894333 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC004146_1531493 Arabidopsis thaliana
           chromosome I BAC F5A8, complete
           sequence.>gb:BT011622_1641144 Arabidopsis thaliana
           At1g67110 mRNA, complete cds.>gb:BT012626_1641696
           Arabidopsis thaliana At1g67110 gene, complete cds.
          Length = 512

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 48/172 (27%), Positives = 82/172 (47%), Gaps = 1/172 (0%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P  +  +  ++ Q+     V  VE+   LT L+    ESL L+PP  L  +   E DI  
Sbjct: 342 PTWQDNVRDEVRQVCGQDGVPSVEQLSSLTSLNKVINESLRLYPPATLLPRMAFE-DIKL 400

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
              ++     I +P  ++   + +WGED  EF PER+ +      R     F  F AGPR
Sbjct: 401 GDLIIPKGLSIWIPVLAIHHSNELWGEDANEFNPERFTTRSFASSRH----FMPFAAGPR 456

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVE-FHHLEILFTDSMILEKKHGLKV 363
            CIG+  A    K++ A ++  + F + E + H  I+    + ++ K+G+++
Sbjct: 457 NCIGQTFAMMEAKIILAMLVSKFSFAISENYRHAPIVV---LTIKPKYGVQL 505



>sp|Q9WVK8|CP46_MOUSE Cytochrome p450 46A1 (EC 1.14.-.-)
           (Cholesterol 24-hydroxylase).>gb:AF094479_2054251 Mus
           musculus cholesterol 24-hydroxylase mRNA, complete
           cds.>gb:BC018307_2092640 Mus musculus cytochrome P450,
           family 46, subfamily a, polypeptide 1, mRNA (cDNA clone
           MGC:18311 IMAGE:4195579), complete cds.
          Length = 500

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 47/148 (31%), Positives = 79/148 (53%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P++ A++  ++ ++   K+    E+  +L YL     ESL L+PP        +E++ L 
Sbjct: 322 PEIVARLQAEVDEVVGSKRHLDYEDLGRLQYLSQVLKESLRLYPPA-WGTFRLLEEETLI 380

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G  V  NT ++   Y MGRMDT + ED + F P+R+    G    +P + +  F+ G R
Sbjct: 381 DGVRVPGNTPLLFSTYVMGRMDTYF-EDPLTFNPDRF----GPGAPKPRFTYFPFSLGHR 435

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLV 432
           +CIG+  A   VK+V A ++   +F+LV
Sbjct: 436 SCIGQQFAQMEVKVVMAKLLQRIEFRLV 463



>sp|Q9STK7|C71Q_ARATH Cytochrome P450 71A26 (EC
           1.14.-.-).>pir|T06715|T06715 probable cytochrome P450
           T29H11.210 - Arabidopsis thaliana>gb:ATT29H11_1555639
           Arabidopsis thaliana DNA chromosome 3, BAC clone T29H11.
          Length = 489

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 38/147 (25%), Positives = 75/147 (51%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+   ++  ++  + +DK     EE Q ++YL A   E+L L PP+PL   +   +D+  
Sbjct: 311 PKCLKRLQEEVRTICKDKSSVSEEEIQNMSYLKAVIKEALRLHPPLPLMVPHESTQDVRL 370

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
             H +   T++++  +++GR    WG D  EF+PER +      + Q +++   F +G R
Sbjct: 371 GDHHIPAGTQVLINAWAIGREAATWGPDVEEFRPERHLDSSVDYRGQ-AFELIPFGSGRR 429

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQL 435
            C     A  + ++V A ++  + ++L
Sbjct: 430 ICPAISFAVVLNEVVLANLVHRFDWRL 456



>sp|Q9V557|C4P2_DROME Probable cytochrome P450 4p2 (EC 1.14.-.-)
           (CYPIVP2).>gb:AE013599_1130819 Drosophila melanogaster
           chromosome 2R, complete sequence.>gb:AE003834_1226923
           Drosophila melanogaster chromosome 2R, section 16 of 74
           of the complete sequence.>gb:AY051564_1290158 Drosophila
           melanogaster GH21174 full length cDNA.
          Length = 520

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 48/175 (27%), Positives = 89/175 (50%)
 Frame = -1

Query: 872 QVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPS 693
           +++  IL D+  L        + +  KL YL     E++ L+P +P+  +  +++  L +
Sbjct: 354 EIQEHILDDLSNLN-------LSQLSKLNYLGYFIKETMRLYPSIPIMGRQTLQETELEN 406

Query: 692 GHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRT 513
           G ++   ++I +  + + R    W E   EF+PER++ P   +KR P Y +  F+AG R 
Sbjct: 407 GLILPKRSQINIHVFDIHRNPKYW-ESPEEFRPERFL-PQNCLKRHP-YAYIPFSAGQRN 463

Query: 512 CIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           CIG+  A   +K +   I+ H++  L       I+F   + L  K+ +KVK ++R
Sbjct: 464 CIGQKYAMQEMKTLMVVILKHFKI-LPVIDPKSIVFQVGITLRFKNKIKVKLVRR 517



>gb:AB114054_2465687 Xenopus laevis CYP4V4 mRNA for Cytochrome P450,
           complete cds.
          Length = 520

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 54/163 (33%), Positives = 83/163 (50%)
 Frame = -1

Query: 833 KQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMP 654
           K D+ V  +++ +KL YL A   ESL +FPPVP+  +   E D    G  V     II+ 
Sbjct: 359 KSDRPV-TMDDLKKLRYLEAVIKESLRIFPPVPMFGRTVTE-DCTVRGFKVPKGVNIIVI 416

Query: 653 FYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKM 474
            YS+ R D  +  +  EF+PER+  P+    R P Y +  F+AG R CIG+  A    K+
Sbjct: 417 TYSLHR-DPEYFPEPEEFRPERFF-PENASGRNP-YAYIPFSAGLRNCIGQRFALMEEKV 473

Query: 473 VAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKRK 345
           V ++I+  Y  +  +    E L    +IL  + G+ +K   R+
Sbjct: 474 VLSSILRKYWVEATQKRD-ECLLVGELILRPQDGMWIKLKNRE 515



>gb:AY230499_1591458 Candida tropicalis CYP52A13 (CYP52A13) gene,
           complete cds.
          Length = 522

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 44/140 (31%), Positives = 64/140 (45%), Gaps = 8/140 (5%)
 Frame = -1

Query: 806 EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGH--------VVTPNTKIIMPF 651
           E  +   YL A   E+L L+P VP N +   +   LP G         +V     +I   
Sbjct: 366 ESLKSCEYLKAVLNETLRLYPSVPQNFRVATKNTTLPRGGGKDGLSPVLVRKGQTVIYGV 425

Query: 650 YSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMV 471
           Y+  R   V+G+D +EF+PERW  P+    ++  + F  FN GPR C+G+  A T    V
Sbjct: 426 YAAHRNPAVYGKDALEFRPERWFEPE---TKKLGWAFLPFNGGPRICLGQQFALTEASYV 482

Query: 470 AATIICHYQFQLVEFHHLEI 411
              +       L EF HL +
Sbjct: 483 TVRL-------LQEFAHLSM 495



>gb:AF254755_1256301 Tribolium castaneum cytochrome P450
           monooxigenase CYP4Q7 (CYP4Q7) mRNA, complete cds.
          Length = 505

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 48/176 (27%), Positives = 90/176 (51%), Gaps = 1/176 (0%)
 Frame = -1

Query: 872 QVEAKILHDILQLKQD-KKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           +V+ KI+ ++ ++  D KK    ++ Q++ YL     E L L+P V    +   E  +  
Sbjct: 333 EVQDKIVEEMNEVLGDIKKKPTYQDLQEMKYLERCVKEVLRLYPSVHFISRKLGEDLVTH 392

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
           SGH +   + + +  Y +     ++  D  +F P+R++ P+   KR P + +  F+AGPR
Sbjct: 393 SGHKLAKGSIVNLHIYDLHHNPAIY-PDPEKFDPDRFL-PENCQKRHP-FAYLPFSAGPR 449

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
            CIG+  A   +K     I+ ++  + ++     +L  D ++L  K G+KV+FI R
Sbjct: 450 NCIGKKFAMLELKAAICGILANFTLEPIDIPETIVLVVD-IVLRTKEGIKVRFIPR 504



>sp|P15128|CP4B_RABIT Cytochrome P450 4B1 (EC 1.14.14.1) (CYPIVB1)
           (P450-isozyme 5).>pir|A40164|A40164 cytochrome P450 4B1
           - rabbit>gb:AF176914_1415541 Oryctolagus cuniculus
           hypoxia-induced corneal CYP4B1-like isozyme mRNA short
           form, complete cds.>gb:AF332576_1418512 Oryctolagus
           cuniculus CYP4B1 isoform mRNA long form, complete
           cds.>gb:RABCY450DA_1443648 Rabbit cytochrome P-450
           isozyme 5 (P450 IVB1) mRNA, complete cds.
          Length = 506

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 49/169 (28%), Positives = 83/169 (49%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+ + +   ++ ++  D+  F+ E+  K+TYL     E   L+PPVP  ++   +     
Sbjct: 330 PEHQQRCREEVREILGDQDSFQWEDLAKMTYLTMCMKECFRLYPPVPQVYRQLSKPVSFV 389

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G  +   + I +  Y++ R   VW  D   F P R+ SP+    R P Y F  F+AGPR
Sbjct: 390 DGRSLPAGSLISLHIYALHRNSDVW-PDPEVFDPLRF-SPENSSGRHP-YAFIPFSAGPR 446

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGL 369
            CIG+  A   +K+V A  +  ++F  V+   L I     ++L  K+G+
Sbjct: 447 NCIGQQFAMNEMKVVTALCLLRFEFS-VDPLRLPIKL-PQLVLRSKNGI 493



>sp|Q9VMS9|C4A1_DROME Probable cytochrome P450 4ac1 (EC 1.14.-.-)
           (CYPIVAC1).>gb:AE014134_1127635 Drosophila melanogaster
           chromosome 2L, complete sequence.>gb:AE003609_1217742
           Drosophila melanogaster chromosome 2L, section 18 of 83
           of the complete sequence.>gb:AY051602_1290196 Drosophila
           melanogaster GH24257 full length cDNA.
          Length = 509

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 50/175 (28%), Positives = 93/175 (53%), Gaps = 1/175 (0%)
 Frame = -1

Query: 869 VEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSG 690
           V+ K   ++  L +D     + +  KL YL     ESL +FP VP   +  +E+ ++ +G
Sbjct: 339 VQKKCYEEVENLPEDSDDISMFQFNKLVYLECVIKESLRMFPSVPFIGRQCVEETVV-NG 397

Query: 689 HVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTC 510
            V+  +T+I +  Y + R    + +  + F+P+R++ P+  + R P + +  F+AG R C
Sbjct: 398 MVMPKDTQISIHIYDIMRDPRHFPKPDL-FQPDRFL-PENTVNRHP-FAYVPFSAGQRNC 454

Query: 509 IGRDMAFTVVKMVAATIICHYQFQLVEFHHLE-ILFTDSMILEKKHGLKVKFIKR 348
           IG+  A   +K++ A +I    F+L+    LE + F + ++L  +  +KVK  KR
Sbjct: 455 IGQKFAILEMKVLLAAVI--RNFKLLPATQLEDLTFENGIVLRTQENIKVKLSKR 507



>gb:AY230500_1591459 Candida tropicalis CYP52A14 (CYP52A14) gene,
           complete cds.
          Length = 522

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 49/168 (29%), Positives = 77/168 (45%), Gaps = 13/168 (7%)
 Frame = -1

Query: 875 PQVEAKI---LHDILQLKQDKKVFKV--EECQKLTYLHAAFCESLGLFPPVPLNHKNPME 711
           P+V  K+   + D   L ++ +V  +  E  +   YL A   E+L L+P VP N +   +
Sbjct: 338 PEVTNKLREEIEDKFGLGENARVEDISFESLKSCEYLKAVLNETLRLYPSVPQNFRVATK 397

Query: 710 KDILPSGH--------VVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQ 555
              LP G         +V     ++   Y+  R   V+G+D +EF+PERW  P+    ++
Sbjct: 398 NTTLPRGGGKDGLSPVLVRKGQTVMYGVYAAHRNPAVYGKDALEFRPERWFEPE---TKK 454

Query: 554 PSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEI 411
             + F  FN GPR C+G+  A T    V   +       L EF HL +
Sbjct: 455 LGWAFLPFNGGPRICLGQQFALTEASYVTVRL-------LQEFGHLSM 495



>gb:AP003822_1833821 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1316_A04.>gb:AP005455_1852134 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0503D09.
          Length = 537

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 46/148 (31%), Positives = 71/148 (47%), Gaps = 2/148 (1%)
 Frame = -1

Query: 794 KLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGE 615
           KL  L     E+L L+PP     +   E D+   G VV   T++++P  ++      WG+
Sbjct: 387 KLKTLGMILNETLRLYPPAVAMIRTAKE-DVELGGCVVPAGTEVMIPIMAVHHDAAAWGD 445

Query: 614 DCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQL 435
           D  EF P R+ + D G +R+    F  F  G R CIG++MA    K+  A ++  ++F+L
Sbjct: 446 DAAEFNPARFAADDDGGRRRHPMAFMPFGGGARVCIGQNMALMEAKVALAVVLRRFEFRL 505

Query: 434 --VEFHHLEILFTDSMILEKKHGLKVKF 357
                H   +L    MIL  + G  V F
Sbjct: 506 SPAYVHAPRVL----MILSPQFGAPVIF 529



>gb:AB010389_1511069 Yarrowia lipolytica gene for ALK2, complete
           cds.>gb:CR382132_1664983 Yarrowia lipolytica chromosome
           F of strain CLIB99 of Yarrowia lipolytica.
          Length = 523

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 46/150 (30%), Positives = 65/150 (43%), Gaps = 11/150 (7%)
 Frame = -1

Query: 875 PQVEAKI---LHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKD 705
           P+V  K+   +H       D      E  ++  YL     E+L L+P VPLN +      
Sbjct: 328 PEVWKKLRAEIHQDFGDGSDLSQITFEGLKRCEYLRFVINETLRLYPSVPLNVRYASRDT 387

Query: 704 ILPSGH--------VVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPS 549
            LP G         +V     I+   +SM R +  WG+DC EF+PERW       K    
Sbjct: 388 TLPRGGGPDESKPILVRKGDTIVYNVFSMHRTEEFWGKDCDEFRPERWAE-----KGSRG 442

Query: 548 YKFSVFNAGPRTCIGRDMAFTVVKMVAATI 459
           +++  FN GPR C+G+  A T    V   I
Sbjct: 443 WEYLPFNGGPRICLGQQYALTETSYVITRI 472



>gb:AB005248_1509649 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MXI10.
          Length = 518

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 47/172 (27%), Positives = 83/172 (48%), Gaps = 1/172 (0%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P  + K+  ++ ++     +  V++  KLT L     ESL L+PP  L  +   E D+  
Sbjct: 348 PTWQEKVREEVREVFGRNGLPSVDQLSKLTSLSKVINESLRLYPPATLLPRMAFE-DLKL 406

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
               +     I +P  ++   + +WG+D  +F PER+    GG        F  F AGPR
Sbjct: 407 GDLTIPKGLSIWIPVLAIHHSEELWGKDANQFNPERF----GGRPFASGRHFIPFAAGPR 462

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVE-FHHLEILFTDSMILEKKHGLKV 363
            CIG+  A    K++ AT+I  + F + + + H  I+    + ++ K+G++V
Sbjct: 463 NCIGQQFALMEAKIILATLISKFNFTISKNYRHAPIVV---LTIKPKYGVQV 511



>gb:AY151046_1425780 Capra hircus pulmonary cytochrome P450 4B2
           mRNA, complete cds.
          Length = 511

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 42/149 (28%), Positives = 72/149 (48%), Gaps = 4/149 (2%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+ + +   +I ++  D+   K E+  ++TYL     ES  L+PPVP  ++   +     
Sbjct: 335 PEHQRRCREEIQEILGDRDSLKWEDLAEMTYLTMCIKESFRLYPPVPQVYRQLSKPVNFV 394

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGE----DCMEFKPERWISPDGGIKRQPSYKFSVFN 528
            G  +   + I +  Y++ R  TVW +    D + F PE        +  + S+ F  F+
Sbjct: 395 DGRSLPAGSLISLHIYALHRNSTVWTDPEVFDPLRFSPE-------NVAGRHSFAFIPFS 447

Query: 527 AGPRTCIGRDMAFTVVKMVAATIICHYQF 441
           AGPR CIG+  A   VK+V A  +  ++F
Sbjct: 448 AGPRNCIGQQFAMNEVKVVTALCLLRFEF 476



>gb:AY337337_1320753 Tribolium castaneum strain GA-1 cytochrome P450
           monooxygenase gene cluster, complete sequence.
          Length = 505

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 48/176 (27%), Positives = 90/176 (51%), Gaps = 1/176 (0%)
 Frame = -1

Query: 872 QVEAKILHDILQLKQD-KKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           +V+ KI+ ++ ++  D KK    ++ Q++ YL     E L L+P V    +   E  +  
Sbjct: 333 EVQDKIVEEMNEVLGDIKKKPTYQDLQEMKYLERCVKEVLRLYPSVHFISRKLGEDLVTH 392

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
           SGH +   + + +  Y +     ++  D  +F P+R++ P+   KR P + +  F+AGPR
Sbjct: 393 SGHKLAKASIVNLHIYDLHHNPAIY-PDPEKFDPDRFL-PENCQKRHP-FAYLPFSAGPR 449

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
            CIG+  A   +K     I+ ++  + ++     +L  D ++L  K G+KV+FI R
Sbjct: 450 NCIGKKFAMLELKAAICGILANFTLEPIDIPETIVLVVD-IVLRTKEGIKVRFIPR 504



>gb:AF261080_1256994 Boophilus microplus P450 CYP319A1 (CYP319A1)
           mRNA, complete cds.
          Length = 531

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 56/177 (31%), Positives = 91/177 (51%), Gaps = 3/177 (1%)
 Frame = -1

Query: 869 VEAKI---LHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDIL 699
           V+AKI   L  +LQ   D  +  +E+ ++L Y      E   LFP VP+  +   E DI 
Sbjct: 357 VQAKIHKELDSVLQSDLDADI-TLEKIKELKYFDRVLKECQRLFPSVPVIGRATSE-DIS 414

Query: 698 PSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGP 519
              HVV  ++ + +  Y++ R D V   D   F P+R++ P+  +   P Y +  F+AGP
Sbjct: 415 LGKHVVPADSDVDIFIYALHR-DQVCFPDPEVFDPDRFL-PENVVHPAP-YAYVPFSAGP 471

Query: 518 RTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           R CIG+  A   VK++ ATI+  +  + V+    +++    ++L   +GLKV F  R
Sbjct: 472 RNCIGQRYALMEVKIIVATILRRFTLEAVD-QRDQLMLACELVLRPLNGLKVSFTPR 527



>gb:AK004724_1152539 Mus musculus adult male lung cDNA, RIKEN
           full-length enriched library, clone:1200012E24
           product:kallikrein B, plasma 1, full insert
           sequence.>gb:AB056457_2046486 Mus musculus Cyp4v3 mRNA
           for family 4 cytochrome P450, complete cds.
          Length = 525

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 53/180 (29%), Positives = 94/180 (52%), Gaps = 1/180 (0%)
 Frame = -1

Query: 875 PQVEAKILHDILQL-KQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDIL 699
           P+V+ K+  ++ ++  +  +   +E+ +KL YL     E+L +FP VPL  ++ + +D  
Sbjct: 349 PEVQRKVDQELDEVFGRSHRPVTLEDLKKLKYLDCVIKETLRVFPSVPLFARS-LSEDCE 407

Query: 698 PSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGP 519
             G+ VT  T+ I+  Y++ R D  +  D  EF+PER+  P+    R P Y +  F+AGP
Sbjct: 408 VGGYKVTKGTEAIIIPYALHR-DPRYFPDPEEFRPERFF-PENSQGRHP-YAYVPFSAGP 464

Query: 518 RTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKRK*D 339
           R CIG+  A    K + A I+  +  +  +    E+     +IL   +G+ +K  +R  D
Sbjct: 465 RNCIGQKFAVMEEKTILACILRQFWVESNQKRE-ELGLAGDLILRPNNGIWIKLKRRHED 523



>pir|H84663|H84663 probable cytochrome P450 [imported] - Arabidopsis
           thaliana>gb:AC003105_1531088 Arabidopsis thaliana
           chromosome 2 clone F18A8 map B68, complete
           sequence.>gb:BT010564_1640510 Arabidopsis thaliana
           At2g26710 gene, complete cds.>gb:AK175232_1817220
           Arabidopsis thaliana mRNA for putative cytochrome P450,
           complete cds, clone: RAFL21-66-D24.
          Length = 520

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 48/176 (27%), Positives = 83/176 (47%), Gaps = 3/176 (1%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+ +AK   ++L++   + V   +   KL  L     ESL L+PP+    +   + D+  
Sbjct: 344 PEWQAKARDEVLRVCGSRDVPTKDHVVKLKTLSMILNESLRLYPPIVATIRRA-KSDVKL 402

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYK--FSVFNAG 522
            G+ +   T++++P  ++     +WG D  EF P R+     G+ R   +   F  F  G
Sbjct: 403 GGYKIPCGTELLIPIIAVHHDQAIWGNDVNEFNPARFAD---GVPRAAKHPVGFIPFGLG 459

Query: 521 PRTCIGRDMAFTVVKMVAATIICHYQFQLV-EFHHLEILFTDSMILEKKHGLKVKF 357
            RTCIG+++A    K+  A +I  + F L   + H     T  M+L  +HG  + F
Sbjct: 460 VRTCIGQNLAILQAKLTLAVMIQRFTFHLAPTYQHAP---TVLMLLYPQHGAPITF 512



>sp|Q9STL0|C71N_ARATH Cytochrome P450 71A23 (EC
           1.14.-.-).>pir|T06712|T06712 probable cytochrome P450
           T29H11.180 - Arabidopsis thaliana>gb:ATT29H11_1555642
           Arabidopsis thaliana DNA chromosome 3, BAC clone T29H11.
          Length = 483

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 42/171 (24%), Positives = 82/171 (47%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P    K+  ++  + + K     ++ Q + YL A   E+L L PPVPL   +   +D+  
Sbjct: 309 PTCLKKLQEEVRTICKGKSSVSEDDIQGMEYLKAVVKEALRLHPPVPLMVPHQSTQDVRL 368

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
             + +   T++I+  +++GR    WG D  EF+PER +      + Q  ++   F AG R
Sbjct: 369 RDNHIPAGTQVIVNLWAVGREAATWGPDANEFRPERHLESPSDFRGQ-DFELIPFGAGRR 427

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKV 363
            C G   A  + ++V A ++  + +Q ++    ++  +   ++ + H L V
Sbjct: 428 MCPGISFAVVLNEVVLANLVHGFDWQSID-DETDVAESIGSVIRRMHPLYV 477



>gb:HUMCP45IV_2030261 Human lung cytochrome P450 (IV subfamily) BI
           protein, complete cds.
          Length = 511

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 41/147 (27%), Positives = 72/147 (48%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+ + +   ++ ++  D+  F+ ++  K+TYL     ES  L+PPVP  ++   +     
Sbjct: 335 PEHQHRCREEVREILGDQDFFQWDDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFV 394

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G  +   + I M  Y++ R   VW +   E       S +   KR P + F  F+AGPR
Sbjct: 395 DGRSLPAGSLISMHIYALHRNSAVWPDP--EVFDSLRFSTENASKRHP-FAFMPFSAGPR 451

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQL 435
            CIG+  A + +K+V A  +  ++F L
Sbjct: 452 NCIGQQFAMSEMKVVTAMCLLRFEFSL 478



>gb:AY064486_1935725 Homo sapiens cytochrome P450 (CYP4B1) mRNA,
           CYP4B1*4 allele, complete cds.
          Length = 511

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 41/147 (27%), Positives = 72/147 (48%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+ + +   ++ ++  D+  F+ ++  K+TYL     ES  L+PPVP  ++   +     
Sbjct: 335 PEHQHRCREEVREILGDQDFFQWDDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFV 394

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G  +   + I M  Y++ R   VW +   E       S +   KR P + F  F+AGPR
Sbjct: 395 DGRSLPAGSLISMHIYALHRNSAVWPDP--EVFDSLRFSTENASKRHP-FAFMPFSAGPR 451

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQL 435
            CIG+  A + +K+V A  +  ++F L
Sbjct: 452 NCIGQQFAMSEMKVVTAMCLLRFEFSL 478



>gb:AY064485_1935724 Homo sapiens cytochrome P450 (CYP4B1) mRNA,
           CYP4B1*3 allele, complete cds.
          Length = 511

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 41/147 (27%), Positives = 72/147 (48%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+ + +   ++ ++  D+  F+ ++  K+TYL     ES  L+PPVP  ++   +     
Sbjct: 335 PEHQHRCREEVREILGDQDFFQWDDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFV 394

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G  +   + I M  Y++ R   VW +   E       S +   KR P + F  F+AGPR
Sbjct: 395 DGRSLPAGSLISMHIYALHRNSAVWPDP--EVFDSLRFSTENASKRHP-FAFMPFSAGPR 451

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQL 435
            CIG+  A + +K+V A  +  ++F L
Sbjct: 452 NCIGQQFAMSEMKVVTAMCLLRFEFSL 478



>gb:AL356793_1924734 Human DNA sequence from clone RP4-732G19 on
           chromosome 1p31.3-32.3 Contains the 3' end of the CYP4B1
           gene for cytochrome P450 family 4 subfamily B
           polypeptide 1 and the 3' end of a cytochrome P450 4Z1
           (CYP4Z1) pseudogene, complete
           sequence.>gb:AL593856_1930586 Human DNA sequence from
           clone RP11-8J9 on chromosome 1 Contains the 5' end of
           the ATPAF1 gene for ATP synthase mitochondrial F1
           complex assembly factor 1, a secreted protein of unknown
           function (SPUF) pseudogene, three novel genes, gene
           KIAA0494, a novel pseudogene and the 5' end of the
           CYP4B1 gene for cytochrome P450 family 4 subfamily B
           polypeptide 1, complete sequence.>gb:AY151049_1937197
           Homo sapiens pulmonary cytochrome P450 4B1 variant mRNA,
           complete cds.
          Length = 497

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 41/147 (27%), Positives = 72/147 (48%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+ + +   ++ ++  D+  F+ ++  K+TYL     ES  L+PPVP  ++   +     
Sbjct: 321 PEHQHRCREEVREILGDQDFFQWDDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFV 380

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G  +   + I M  Y++ R   VW +   E       S +   KR P + F  F+AGPR
Sbjct: 381 DGRSLPAGSLISMHIYALHRNSAVWPDP--EVFDSLRFSTENASKRHP-FAFMPFSAGPR 437

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQL 435
            CIG+  A + +K+V A  +  ++F L
Sbjct: 438 NCIGQQFAMSEMKVVTAMCLLRFEFSL 464



>gb:AL356793_1924732 Human DNA sequence from clone RP4-732G19 on
           chromosome 1p31.3-32.3 Contains the 3' end of the CYP4B1
           gene for cytochrome P450 family 4 subfamily B
           polypeptide 1 and the 3' end of a cytochrome P450 4Z1
           (CYP4Z1) pseudogene, complete
           sequence.>gb:AL593856_1930588 Human DNA sequence from
           clone RP11-8J9 on chromosome 1 Contains the 5' end of
           the ATPAF1 gene for ATP synthase mitochondrial F1
           complex assembly factor 1, a secreted protein of unknown
           function (SPUF) pseudogene, three novel genes, gene
           KIAA0494, a novel pseudogene and the 5' end of the
           CYP4B1 gene for cytochrome P450 family 4 subfamily B
           polypeptide 1, complete sequence.>gb:AY151048_1937196
           Homo sapiens pulmonary cytochrome P450 4B1 mRNA,
           complete cds.>gb:BC017758_1976244 Homo sapiens
           cytochrome P450, family 4, subfamily B, polypeptide 1,
           mRNA (cDNA clone MGC:22150 IMAGE:4693225), complete cds.
          Length = 512

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 41/147 (27%), Positives = 72/147 (48%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+ + +   ++ ++  D+  F+ ++  K+TYL     ES  L+PPVP  ++   +     
Sbjct: 336 PEHQHRCREEVREILGDQDFFQWDDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFV 395

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G  +   + I M  Y++ R   VW +   E       S +   KR P + F  F+AGPR
Sbjct: 396 DGRSLPAGSLISMHIYALHRNSAVWPDP--EVFDSLRFSTENASKRHP-FAFMPFSAGPR 452

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQL 435
            CIG+  A + +K+V A  +  ++F L
Sbjct: 453 NCIGQQFAMSEMKVVTAMCLLRFEFSL 479



>gb:AF491285_1904958 Homo sapiens cytochrome P450 (CYP4B1) mRNA,
           CYP4B1*5 allele, complete cds.
          Length = 511

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 41/147 (27%), Positives = 72/147 (48%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+ + +   ++ ++  D+  F+ ++  K+TYL     ES  L+PPVP  ++   +     
Sbjct: 335 PEHQHRCREEVREILGDQDFFQWDDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFV 394

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G  +   + I M  Y++ R   VW +   E       S +   KR P + F  F+AGPR
Sbjct: 395 DGRSLPAGSLISMHIYALHRNSAVWPDP--EVFDSLRFSTENASKRHP-FAFMPFSAGPR 451

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQL 435
            CIG+  A + +K+V A  +  ++F L
Sbjct: 452 NCIGQQFAMSEMKVVTAMCLLRFEFSL 478



>gb:CEY80D3A_1371166 Caenorhabditis elegans YAC Y80D3A, complete
           sequence.
          Length = 511

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 55/178 (30%), Positives = 92/178 (51%), Gaps = 1/178 (0%)
 Frame = -1

Query: 875 PQVEAKILHDILQ-LKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDIL 699
           P++++K+  +I + L +  +    E+  KL YL A F E+L L+P VPL  +  +E DI 
Sbjct: 333 PEIQSKVQKEIDEVLGEADRPVSYEDLGKLKYLEACFKETLRLYPSVPLIARQCVE-DIQ 391

Query: 698 PSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGP 519
             GH +   T ++M   SM   D  + +D   F PER+I+  G +K    Y +  F+AG 
Sbjct: 392 VRGHTLPSGTAVVM-VPSMVHKDPRYWDDPEIFNPERFIT--GELKH--PYAYIPFSAGS 446

Query: 518 RTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKRK 345
           R CIG   A    K + A I+ + + +  +    E+     +I+   +G ++KF KR+
Sbjct: 447 RNCIGMRFAMMEEKCILAIILKNLKVK-AKLRTDEMRVAAELIIRPLYGNELKFEKRE 503



>sp|P13584|CP4B_HUMAN Cytochrome P450 4B1 (EC 1.14.14.1) (CYPIVB1)
           (P450-HP).>pir|S07765|O4HUB1 cytochrome P450 4B1 -
           human>gb:AL356793_1924733 Human DNA sequence from clone
           RP4-732G19 on chromosome 1p31.3-32.3 Contains the 3' end
           of the CYP4B1 gene for cytochrome P450 family 4
           subfamily B polypeptide 1 and the 3' end of a cytochrome
           P450 4Z1 (CYP4Z1) pseudogene, complete
           sequence.>gb:AL593856_1930587 Human DNA sequence from
           clone RP11-8J9 on chromosome 1 Contains the 5' end of
           the ATPAF1 gene for ATP synthase mitochondrial F1
           complex assembly factor 1, a secreted protein of unknown
           function (SPUF) pseudogene, three novel genes, gene
           KIAA0494, a novel pseudogene and the 5' end of the
           CYP4B1 gene for cytochrome P450 family 4 subfamily B
           polypeptide 1, complete sequence.>gb:HSP450P2_2019349
           Human mRNA for cytochrome P-450HP.
          Length = 511

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 41/147 (27%), Positives = 72/147 (48%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+ + +   ++ ++  D+  F+ ++  K+TYL     ES  L+PPVP  ++   +     
Sbjct: 335 PEHQHRCREEVREILGDQDFFQWDDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFV 394

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G  +   + I M  Y++ R   VW +   E       S +   KR P + F  F+AGPR
Sbjct: 395 DGRSLPAGSLISMHIYALHRNSAVWPDP--EVFDSLRFSTENASKRHP-FAFMPFSAGPR 451

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQL 435
            CIG+  A + +K+V A  +  ++F L
Sbjct: 452 NCIGQQFAMSEMKVVTAMCLLRFEFSL 478



>sp|Q9VMS7|C4A3_DROME Probable cytochrome P450 4ac3 (EC 1.14.-.-)
           (CYPIVAC3).>gb:AE014134_1127637 Drosophila melanogaster
           chromosome 2L, complete sequence.>gb:AE003609_1217744
           Drosophila melanogaster chromosome 2L, section 18 of 83
           of the complete sequence.>gb:AY061002_1292805 Drosophila
           melanogaster HL01677 full length cDNA.
          Length = 509

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 50/175 (28%), Positives = 90/175 (51%), Gaps = 1/175 (0%)
 Frame = -1

Query: 869 VEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSG 690
           V+ +   ++  L +D     + +  +L +L     ESL LFP  P+  +  +E+ ++ +G
Sbjct: 339 VQERCYEELQDLPEDIDEVSMFQFNELIHLECVIKESLRLFPSAPIIGRTCIEESVM-NG 397

Query: 689 HVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTC 510
            V+  N +I +  Y + R D        +F PER++ P+  + R P + F  F+AGPR C
Sbjct: 398 LVLPKNAQISIHIYDIMR-DARHFPKPNQFLPERFL-PENSVNRHP-FAFVPFSAGPRNC 454

Query: 509 IGRDMAFTVVKMVAATIICHYQFQLVEFHHLE-ILFTDSMILEKKHGLKVKFIKR 348
           IG+      +K++ A +I    F+L+    LE + F + ++L  +  +KVKF  R
Sbjct: 455 IGQKFGVLEIKVLLAAVI--RNFKLLPATQLEDLTFENGIVLRTQQNIKVKFEAR 507



>gb:AY036882_1560057 Phanerochaete chrysosporium cytochrome P450
           monooxygenase pc-2 gene, complete cds.
          Length = 538

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 44/158 (27%), Positives = 78/158 (49%), Gaps = 9/158 (5%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+V  ++  +IL+     +    ++ +++ YL A   E+L L+P VP N + P++   +P
Sbjct: 330 PEVLRRLREEILEKVGPTRRPTYDDIREMKYLRAFINETLRLYPAVPWNVRYPVKDTTIP 389

Query: 695 SGHVVTP-----NTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPS---YKF 540
             H   P     NT +    + M R    WG D   F P+R++  D  ++R  +   + F
Sbjct: 390 GPHPDKPYFIPANTPVSYSVHCMHRRTDYWGPDAEAFDPDRFL--DARVQRYLTPNPFIF 447

Query: 539 SVFNAGPRTCIGRDMAFTVVKMVAATIICHY-QFQLVE 429
             FNAGPR C+G+  A+  +      ++ H+ + QL E
Sbjct: 448 LPFNAGPRICLGQQFAYNEMSFFVIRLLQHFDEVQLCE 485



>sp|Q9T0K0|C71J_ARATH Cytochrome P450 71A19 (EC
           1.14.-.-).>pir|T06286|T06286 probable cytochrome P450
           T9E8.30 - Arabidopsis thaliana>gb:ATCHRIV36_1545093
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 36.>gb:ATT9E8_1556613 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T9E8, partial sequence (ESSA
           project).>gb:AY133692_1581512 Arabidopsis thaliana clone
           C103155 putative cytochrome p450 protein (At4g13290)
           mRNA, complete cds.
          Length = 490

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 40/147 (27%), Positives = 71/147 (48%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+V  K+  +I    +       +E +K+ YL A   E+L L PP PL       +D+  
Sbjct: 313 PKVMKKLQEEIRSSSRQGLFVTEKEAEKMDYLQAVIKEALRLRPPAPLMVPRVFSEDVTL 372

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G+ +   T++I+  +++ R  T WG D  EF+PER +      + Q  +KF  F +G R
Sbjct: 373 KGYNIPAGTQVIINAWAIQRDTTTWGIDAEEFRPERHLDSILDFQGQ-DFKFIPFGSGKR 431

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQL 435
            C G      ++ +  A I+  + +++
Sbjct: 432 ICPGIGFTSALIGVTLANIVKRFNWRM 458



>gb:BC055637_2551497 Danio rerio hypothetical protein LOC402831,
           mRNA (cDNA clone IMAGE:5914667), partial cds.
          Length = 531

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 40/140 (28%), Positives = 74/140 (52%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+ +  +  ++  + +D ++   +E   ++YL A   E+L L+P VP+N +   E +++ 
Sbjct: 355 PETQDILYQEVTNVLKDDRIPTAQEVNTMSYLKAVIKETLRLYPVVPMNARLIAENEVVI 414

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            GH+   NT   +  Y++ R + V+ E   +FKPERW+  DG  +  P +    F  G R
Sbjct: 415 GGHLFPKNTTFTLCHYAISRDEKVFPEP-QKFKPERWLR-DGRTRPNP-FGSIPFGFGVR 471

Query: 515 TCIGRDMAFTVVKMVAATII 456
            C+GR +A   + +  A +I
Sbjct: 472 GCVGRRIAELEMYLALARLI 491



>gb:CR382131_1664525 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 523

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 43/150 (28%), Positives = 66/150 (44%), Gaps = 11/150 (7%)
 Frame = -1

Query: 875 PQVEAKILHDILQLK---QDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKD 705
           P+V AK+  ++++     +D      E  ++  YL     E L L+P VP N +      
Sbjct: 332 PEVYAKLREEVIENLGDGEDLSTITFESLKRCDYLRYVLNEVLRLYPSVPANMRYATRDT 391

Query: 704 ILPSGH--------VVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPS 549
            LP G         VV     +    ++  R+   WGED  EF+PERW   + G  +   
Sbjct: 392 TLPRGGGPDGMQPIVVRKGNLVSYHVFTTHRLKEFWGEDAEEFRPERWY--EDGASQAKG 449

Query: 548 YKFSVFNAGPRTCIGRDMAFTVVKMVAATI 459
           +++  FN GPR C+G+  A T      A I
Sbjct: 450 WEYLPFNGGPRICLGQQYALTEAGYALARI 479



>gb:CR382128_1661198 Yarrowia lipolytica chromosome B of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 513

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 44/151 (29%), Positives = 69/151 (45%), Gaps = 11/151 (7%)
 Frame = -1

Query: 875 PQVEAKILHDILQL---KQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKD 705
           P+   K+  +IL       D  +   E  ++  YL     E+L L+P VP+N +      
Sbjct: 328 PETWNKLRDEILSTFGSGSDLSLITFESLKRCEYLRFVINETLRLYPSVPVNVRYATRDT 387

Query: 704 ILPSGH--------VVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPS 549
            LP G         ++  N+ ++   ++  R+   WGED  EF+PERW     GI R   
Sbjct: 388 TLPRGGGPDESQPILIRKNSVLVYSVFATHRLKKFWGEDADEFRPERW---GEGISR--G 442

Query: 548 YKFSVFNAGPRTCIGRDMAFTVVKMVAATII 456
           +++  FN GPR C+G+  A T    V   I+
Sbjct: 443 WEYLPFNGGPRICLGQQYALTETSYVLTRIV 473



>gb:AB010394_1511074 Yarrowia lipolytica gene for ALK7, complete
           cds.>gb:CR382127_1660101 Yarrowia lipolytica chromosome
           A of strain CLIB99 of Yarrowia lipolytica.
          Length = 526

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 48/158 (30%), Positives = 76/158 (48%), Gaps = 9/158 (5%)
 Frame = -1

Query: 806 EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMP-----FYSM 642
           E  +K  YL     ESL ++P VP+N +       LP G     +  I +P      YS+
Sbjct: 369 ESLKKCDYLRYVLNESLRVYPVVPINARTASRDTTLPRGGGPDGSQPIFVPKGQTVSYSV 428

Query: 641 G---RMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMV 471
               R    WG+D  EF PERW + +G I R   +++  FN GPR C+G+  A T V  V
Sbjct: 429 WWTHRDPEFWGQDAEEFIPERWDTKNGSIGR--GWEYLPFNGGPRICLGQQFALTEVGYV 486

Query: 470 AATIICHYQ-FQLVEFHHLEILFTDSMILEKKHGLKVK 360
            + ++  Y+  +  +   L  L+  ++ L  + G+ +K
Sbjct: 487 LSRMVQTYETLESGDTKPLPPLYNHALTLCHQEGVWIK 524



>gb:AB010390_1511070 Yarrowia lipolytica gene for ALK3, complete
           cds.>gb:CR382131_1664428 Yarrowia lipolytica chromosome
           E of strain CLIB99 of Yarrowia lipolytica.
          Length = 513

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 45/162 (27%), Positives = 68/162 (41%), Gaps = 8/162 (4%)
 Frame = -1

Query: 806 EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGH--------VVTPNTKIIMPF 651
           E  +K  YL     E L L P VP+N +  +    LP G          V    KI    
Sbjct: 351 ESLKKCDYLRQVLNEGLRLHPVVPVNLRVAVRDTTLPRGGGPQGDKPIFVAKGQKINYAI 410

Query: 650 YSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMV 471
           +   R    WGED  EF+PERW +  GG   +  ++F  FN GPR C+G+  A T +  V
Sbjct: 411 FWTHRDKEYWGEDAEEFRPERWETTSGGALGK-GWEFLPFNGGPRICLGQQFALTEMGYV 469

Query: 470 AATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKRK 345
              ++  Y    ++     +    S+ +    G+ +   + K
Sbjct: 470 ITRLLQEYSDISIQPSDAAVKVRHSLTMCSAQGINISLTRAK 511



>gb:AB010388_1511068 Yarrowia lipolytica gene for ALK1, complete
           cds.
          Length = 523

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 43/150 (28%), Positives = 66/150 (44%), Gaps = 11/150 (7%)
 Frame = -1

Query: 875 PQVEAKILHDILQLK---QDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKD 705
           P+V AK+  ++++     +D      E  ++  YL     E L L+P VP N +      
Sbjct: 332 PEVYAKLREEVIENLGDGEDLSTITFESLKRCDYLRYVLNEVLRLYPSVPANMRYATRDT 391

Query: 704 ILPSGH--------VVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPS 549
            LP G         VV     +    ++  R+   WGED  EF+PERW   + G  +   
Sbjct: 392 TLPRGGGPDGMQPIVVRKGNLVSYHVFTTHRLKEFWGEDAEEFRPERWY--EDGASQAKG 449

Query: 548 YKFSVFNAGPRTCIGRDMAFTVVKMVAATI 459
           +++  FN GPR C+G+  A T      A I
Sbjct: 450 WEYLPFNGGPRICLGQQYALTEAGYALARI 479



>gb:AY596297_631617 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 445

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 45/156 (28%), Positives = 81/156 (51%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+VE ++  ++  +  D +   +E  ++L YL     E++ L+PPV    + P E D+  
Sbjct: 277 PEVEQRVHEELDDVIGDDRP-GMEHVRELDYLEWVIQEAMRLYPPVYTIFREPTE-DVTL 334

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
           SG+ V   T +++P + + R +  + +D   F PERW  P+   +R P + +  F  GPR
Sbjct: 335 SGYEVEAGTTLMVPQWGVHRSERFY-DDPETFDPERW-KPERASER-PRFAYFPFGGGPR 391

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEIL 408
            CIG+ +A    +++ AT    Y+ +      LE+L
Sbjct: 392 HCIGKHLAMLEAQLITATTASQYRLEFQGETPLELL 427



>sp|Q9Y758|CP5M_DEBHA Cytochrome P450 52A13 (EC 1.14.14.-) (Alkane
           hydroxylase 2) (Alkane- inducible p450alk 2)
           (DH-ALK2).>gb:AF103949_1768236 Debaryomyces hansenii
           cytochrome P450 alkane hydroxylase (ALK2) gene, complete
           cds.
          Length = 519

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 48/164 (29%), Positives = 74/164 (45%), Gaps = 13/164 (7%)
 Frame = -1

Query: 875 PQVEAKILHDILQL---KQDKKVFKV--EECQKLTYLHAAFCESLGLFPPVPLNHKNPME 711
           P+V  K+  +I +      D +V ++  E  +K  YL     E L L+P VP+N +   +
Sbjct: 337 PRVFNKLKEEIYEAFGKGDDARVSEITFESLKKCEYLKWVMNEMLRLYPSVPVNFRVATK 396

Query: 710 KDILPSGH--------VVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQ 555
           +  LP G          V   T +    YS  RM+  +G+D  EFKPERW        R+
Sbjct: 397 RTTLPRGGGPDGNSPIYVGKGTTVAYSVYSTHRMEEYYGKDADEFKPERWAE-----SRK 451

Query: 554 PSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFH 423
             + +  FN GPR C+G+  A T    +   ++    F  +E H
Sbjct: 452 LGWAYVPFNGGPRICLGQQFALTEASYIVTRLL--QMFDKLELH 493



>sp|P24458|CP5E_CANMA Cytochrome P450 52A5 (EC 1.14.14.-) (CYPLIIA5)
           (Alkane-inducible P450- ALK2-A)
           (CYP52A3-B).>pir|JQ1039|JQ1039 cytochrome P450 52A3-b -
           yeast (Candida maltosa)>gb:S77461_1704536 CYP52A3
           (CYP52A3-b)=n-alkane-inducible cytochrome P-450 [Candida
           maltosa, Genomic, 2047 nt].>gb:YSACY52A3_1728098 Candida
           maltosa CYP52A3-b gene for n-alkane-inducible cytochrome
           P-450, complete cds.
          Length = 523

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 37/120 (30%), Positives = 56/120 (46%), Gaps = 8/120 (6%)
 Frame = -1

Query: 806 EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGH--------VVTPNTKIIMPF 651
           E  +K  YL A   E+L ++P VP+N +       LP G          V   + ++   
Sbjct: 368 ETLKKCEYLKAVLNETLRMYPSVPVNFRTATRDTTLPRGGGKDGTSPIFVPKGSSVVYTV 427

Query: 650 YSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMV 471
           Y   R++  +G+D  EF+PERW  P     R+  + +  FN GPR C+G+  A T    V
Sbjct: 428 YKTHRLEEYYGKDAYEFRPERWFEPS---TRKLGWAYVPFNGGPRICLGQQFALTEASYV 484



>sp|P15129|CP4B_RAT Cytochrome P450 4B1 (EC 1.14.14.1) (CYPIVB1)
           (P450-isozyme 5).>pir|B40164|B40164 cytochrome P450 4B1
           - rat>gb:BC074012_2106651 Rattus norvegicus cytochrome
           P450, family 4, subfamily b, polypeptide 1, mRNA (cDNA
           clone MGC:91453 IMAGE:7100197), complete
           cds.>gb:RATP4505_2133279 Rat cytochrome P-450 isozyme 5
           (P450 IVB2) mRNA, complete cds.
          Length = 511

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 43/147 (29%), Positives = 72/147 (48%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+ +     ++  +  D+  F+ ++  K+TYL     E   L+PPVP  ++   +     
Sbjct: 335 PEHQQLCREEVRGILGDQDSFQWDDLAKMTYLTMCMKECFRLYPPVPQVYRQLNKPVTFV 394

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G  +   + I +  Y++ R  TVW  D   F P R+ SP+    R P + F  F+AGPR
Sbjct: 395 DGRSLPAGSLISLHIYALHRNSTVW-PDPEVFDPLRF-SPENAAGRHP-FAFMPFSAGPR 451

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQL 435
            CIG+  A   +K+V A  +  ++F L
Sbjct: 452 NCIGQQFAMNEMKVVTALCLLRFEFSL 478



>sp|O65438|C71R_ARATH Cytochrome P450 71A27 (EC 1.14.-.-).
          Length = 499

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 42/147 (28%), Positives = 71/147 (48%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+   K+  +I            +E +K+ YLH    E L L P  PL  + P E D+  
Sbjct: 319 PECMKKLQDEINSFSTHNLNVTEKEVEKMNYLHCVIKEGLRLHPSGPLLFRLPSE-DVQL 377

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G+ ++  T +I+  +++ R   +WG D  E++PER    + G +R  S KF  F AG R
Sbjct: 378 KGYDISAGTHVIINAWALQRNPAIWGLDANEYRPERHFWYEFGFQRTDS-KFVPFGAGRR 436

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQL 435
            C G   +  + K+  A ++  + ++L
Sbjct: 437 LCPGIGFSLVLSKLALANLVKRFNWRL 463



>pir|T02192|T02192 probable cytochrome P450 At2g46950 [imported] -
           Arabidopsis thaliana>gb:AC004411_1531684 Arabidopsis
           thaliana chromosome 2 clone F14M4 map CIC06C03, complete
           sequence.>gb:BT011625_1641147 Arabidopsis thaliana
           At2g46950 mRNA, complete cds.>gb:BT014808_1641798
           Arabidopsis thaliana At2g46950 gene, complete cds.
          Length = 517

 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 49/171 (28%), Positives = 81/171 (47%), Gaps = 3/171 (1%)
 Frame = -1

Query: 866 EAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGH 687
           + K+  ++       K+   E C KL  ++  F ESL L+ PV LN      +D+     
Sbjct: 347 QEKLREEVFNECGKDKIPDAETCSKLKLMNTVFMESLRLYGPV-LNLLRLASEDMKLGNL 405

Query: 686 VVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSV--FNAGPRT 513
            +   T II+P   M R   VWG D  +F P R+ +   G+ R  ++  ++  F+ GPR 
Sbjct: 406 EIPKGTTIILPIAKMHRDKAVWGSDADKFNPMRFAN---GLSRAANHPNALLAFSMGPRA 462

Query: 512 CIGRDMAFTVVKMVAATIICHYQFQL-VEFHHLEILFTDSMILEKKHGLKV 363
           CIG++ A    K V A I+  ++  L  ++ H      D + L+ ++ L V
Sbjct: 463 CIGQNFAIMEAKTVLAMILQRFRLNLSADYKHAP---ADHLTLQPQYDLPV 510



>pir|S38535|S38535 cytochrome P450 76A1 - eggplant (fragment)
          Length = 467

 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 41/147 (27%), Positives = 75/147 (51%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           PQ  AK+  +ILQ+    K F+  +   L Y+ A   E L L PP+PL       +D   
Sbjct: 291 PQAMAKVKLEILQVIGPNKKFEECDIDSLPYMQAVLKEQLRLHPPLPLLIPRKAIQDTKF 350

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G+ +   T++++  +++GR    W ++  EFKPER++     +K Q +Y+   F AG R
Sbjct: 351 MGYDIPKGTQVLVNAWAIGRDPEYW-DNPFEFKPERFLESKVDVKGQ-NYELIPFGAGRR 408

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQL 435
            C+G  +   ++     +++  + ++L
Sbjct: 409 MCVGLPLGHRMMHFTFGSLLHEFDWEL 435



>sp|P37122|C762_SOLME Cytochrome P450 76A2 (EC 1.14.-.-)
           (CYPLXXVIA2) (P-450EG7).>pir|S38534|S38534 cytochrome
           P450 76A2 - eggplant>gb:SMCYPEG7_1715490 S.melongena
           CYP76A2 mRNA for hydroxylase.
          Length = 505

 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 40/147 (27%), Positives = 75/147 (51%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+  AK+  +I Q  +  + F+  + + L Y+ A   ESL L PP+P        +D   
Sbjct: 329 PEAMAKVKTEISQAIEPNRKFEDSDIENLPYMQAVLKESLRLHPPLPFLIPRETIQDTKF 388

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G+ V  +T++++  +++GR    W +D M FKPER++     +K Q  Y    F AG R
Sbjct: 389 MGYDVPKDTQVLVNAWAIGRDPECW-DDPMSFKPERFLGSKIDVKGQ-HYGLIPFGAGRR 446

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQL 435
            C+G  +   ++     +++  ++++L
Sbjct: 447 MCVGLPLGHRMMHFALGSLLREFEWEL 473



>sp|P37121|C761_SOLME Cytochrome P450 76A1 (EC 1.14.-.-)
           (CYPLXXVIA1) (P-450EG8) (Fragment).>gb:SMCYPEG8_1715491
           S.melongena CYP76A1 mRNA.
          Length = 467

 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 41/147 (27%), Positives = 75/147 (51%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           PQ  AK+  +ILQ+    K F+  +   L Y+ A   E L L PP+PL       +D   
Sbjct: 291 PQAMAKVKLEILQVIGPNKKFEECDIDSLPYMQAVLKEQLRLHPPLPLLIPRKAIQDTKF 350

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G+ +   T++++  +++GR    W ++  EFKPER++     +K Q +Y+   F AG R
Sbjct: 351 MGYDIPKGTQVLVNAWAIGRDPEYW-DNPFEFKPERFLESKVDVKGQ-NYELIPFGAGRR 408

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQL 435
            C+G  +   ++     +++  + ++L
Sbjct: 409 MCVGLPLGHRMMHFTFGSLLHEFDWEL 435



>sp|Q12588|CP5J_CANMA Cytochrome P450 52A10 (EC 1.14.14.-)
           (CYPLIIA10) (Alkane-inducible
           P450-ALK7).>pir|JS0725|JS0725 cytochrome P450 ALK7,
           alkane-inducible - yeast (Candida
           maltosa)>gb:YSAALK78_1728063 Candida maltosa ALK7
           (CYP52A10) and ALK8 (CYP52A11) genes for n-alkane
           inducible cytochrome P-450, complete cds.
          Length = 519

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 39/122 (31%), Positives = 60/122 (49%), Gaps = 8/122 (6%)
 Frame = -1

Query: 785 YLHAAFCESLGLFPPVPLNHKNPMEKDILPSGH--------VVTPNTKIIMPFYSMGRMD 630
           YL A   E+L L+P VP N +   +   LP G         +V     ++   Y++ R +
Sbjct: 370 YLKAVLNETLRLYPSVPRNARFAAKNTTLPHGGGPDGMSPILVRKGQTVMYSVYALQRDE 429

Query: 629 TVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICH 450
             +G+D  EF+PERW  P+    R+  + F  FN GPR C+G+  A T    V A +I  
Sbjct: 430 KYYGKDANEFRPERWFEPE---VRKLGWAFLPFNGGPRICLGQQFALTEASYVLARLIQS 486

Query: 449 YQ 444
           ++
Sbjct: 487 FE 488



>gb:AP005682_1855932 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OJ1531_B07.
          Length = 482

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 48/148 (32%), Positives = 75/148 (50%), Gaps = 2/148 (1%)
 Frame = -1

Query: 872 QVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPL--NHKNPMEKDIL 699
           QV +K+ ++I+Q+   K     E+  KL YL A   E L L PP PL   H + M   I 
Sbjct: 305 QVMSKLQNEIIQVTGSKPTVTEEDLTKLDYLKAVIKEVLRLHPPAPLLIPHHSTMPTTI- 363

Query: 698 PSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGP 519
             G+ +   T   +  +++GR    W +   EF+PER++       R   YKF  F AG 
Sbjct: 364 -QGYHIPAKTIAFINVWAIGRDPAAW-DTPDEFRPERFMGSAVDF-RGNDYKFIPFGAGR 420

Query: 518 RTCIGRDMAFTVVKMVAATIICHYQFQL 435
           R C G  +A   ++MV A+++ H+ ++L
Sbjct: 421 RLCPGIILALPGLEMVIASLLYHFDWEL 448



>gb:NCB14A6_1689278 Neurospora crassa DNA linkage group V BAC contig
           B14A6.
          Length = 510

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 46/155 (29%), Positives = 74/155 (47%), Gaps = 4/155 (2%)
 Frame = -1

Query: 797 QKLTYLHAAFCESLGLFPP----VPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMD 630
           ++L YL A   E L         +P    +   + +   G+ + P T + +P YS+    
Sbjct: 364 KELPYLEAVINEVLRFHSTSGIGLPRQIPHDASQGVHIQGYYLPPGTVLSVPTYSIHHSK 423

Query: 629 TVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICH 450
            +WG D  EFKPERW      +  +    F  F+ GPR+C+GR++A   +K++ AT    
Sbjct: 424 EIWGPDADEFKPERW----ERLTARQKNAFIPFSHGPRSCVGRNVAEMEMKLIVATWARR 479

Query: 449 YQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKRK 345
           Y+ +L++    + + T    L K  GLKV    RK
Sbjct: 480 YEVKLLQ----DYMDTREGFLRKPLGLKVGLKLRK 510



>gb:CAALK8_1644730 Candida albicans alk8 gene.
          Length = 515

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 47/159 (29%), Positives = 70/159 (44%), Gaps = 10/159 (6%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKV-FKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDIL 699
           PQV  K+  +I++   D       E  ++  YL A   E+L L+P VP N +   +   L
Sbjct: 335 PQVWKKLREEIIERYADGVTEISFETLKQCEYLKAVINETLRLYPSVPRNGRFANKNTTL 394

Query: 698 PSGH--------VVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYK 543
           P G         ++     ++   YS  R    +G+D   F+PERW  P+    R+  + 
Sbjct: 395 PRGGGPDGMSTILIKQGQAVMYSIYSTQRDPKYYGKDADVFRPERWFEPE---TRKLGWA 451

Query: 542 FSVFNAGPRTCIGRDMAFTVVKMVAATII-CHYQFQLVE 429
           F  FN GPR C+G+  A T    V   +  C    QL E
Sbjct: 452 FLPFNGGPRICLGQQFALTEASYVLVRLAQCCENLQLTE 490



>gb:BT004038_1637150 Arabidopsis thaliana clone RAFL15-05-J07
           (R20236) putative cytochrome p450 (At5g57260) mRNA,
           complete cds.
          Length = 502

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 49/181 (27%), Positives = 91/181 (50%), Gaps = 6/181 (3%)
 Frame = -1

Query: 875 PQVEAKILHDI-LQLKQDKK--VFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKD 705
           P+V  K+  +I  Q+ ++ K  +  ++E   L+YL+    E+  L P  PL     +  +
Sbjct: 321 PRVMKKVQSEIRAQIGKNNKTRIISLDEINHLSYLNMVIKETCRLHPVAPLLVPREVISE 380

Query: 704 ILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNA 525
              +G+ + P T++ +  +++GR   +W +D  EF PER++  D  +K Q  Y+   F +
Sbjct: 381 FKINGYTIQPKTRLHVNVWAIGRDPEIW-KDPEEFLPERFMDCDIDVKGQ-DYELLPFGS 438

Query: 524 GPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTD---SMILEKKHGLKVKFI 354
           G R C    M  T V+   A ++ H+ ++L E   +E ++ D    +   KKH L +  +
Sbjct: 439 GRRICPAVYMGITTVEFGLANLLYHFDWKLPEGVAVEDIYMDEASGLTSHKKHDLLLVPV 498

Query: 353 K 351
           K
Sbjct: 499 K 499



>gb:AB010395_1511075 Yarrowia lipolytica gene for ALK8, complete
           cds.>gb:CR382129_1661813 Yarrowia lipolytica chromosome
           C of strain CLIB99 of Yarrowia lipolytica.
          Length = 583

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 45/159 (28%), Positives = 69/159 (43%), Gaps = 11/159 (6%)
 Frame = -1

Query: 806 EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGH--------VVTPNTKIIMPF 651
           E  ++  YL     E+L L PPVP+N +   +   LP+G          V  N  +    
Sbjct: 428 ESLKRCVYLRYVINEALRLCPPVPINMRQANKDTTLPTGGGKNHDEPIFVAKNQIVTYSV 487

Query: 650 YSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMV 471
             M     +WG D  EF+PERW  P         +++  FN GPR C+G+  A T    V
Sbjct: 488 LFMHHNQNIWGPDASEFRPERWGEP----ACPKGWEYLPFNGGPRICLGQQYALTEAAYV 543

Query: 470 AATIICHYQFQLVEFHH---LEILFTDSMILEKKHGLKV 363
              ++   +F  +E+     L +LF   + +    GL+V
Sbjct: 544 IVRLV--QEFTEIEWRDRKGLPVLFKTHITMSLGEGLRV 580



>gb:AY113687_1299602 Helicoverpa zea cytochrome P450 monooxygenase
           CYP4M6 mRNA, complete cds.
          Length = 501

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 47/177 (26%), Positives = 89/177 (50%), Gaps = 1/177 (0%)
 Frame = -1

Query: 872 QVEAKILHDILQ-LKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           + + KIL ++ + L  DK+   +E+  K+ YL     ESL LFPPV    ++ + + +  
Sbjct: 330 EAQDKILEELKEILGDDKRPITMEDLPKMKYLERCIKESLRLFPPVHFISRS-LNETVTL 388

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
           S + +   T   +  Y + R   ++ ++   F P+R++ P+  + R P Y +  F+AGPR
Sbjct: 389 SNYKIPAGTLCHIQIYDLHRRADLF-KNPTSFDPDRFL-PENSVGRHP-YAYIPFSAGPR 445

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKRK 345
            CIG+  A   +K+  A ++  ++ Q V     +I      +      ++V F+KR+
Sbjct: 446 NCIGQKFAMMEMKIAVAEVLREFELQPVT-RPSDIRMIADAVFRNDGPVEVTFVKRQ 501



>pir|S66374|S66374 cytochrome P450 4M2 - tobacco
           hornworm>gb:MOTCYP4M2A_1389963 Manduca sexta cytochrome
           P450 (CYP4M2) mRNA, complete cds.
          Length = 503

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 44/155 (28%), Positives = 83/155 (53%)
 Frame = -1

Query: 809 VEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMD 630
           +++  K+ YL     ESL L+PPVP   +  + +D+  SG+ V       +  + + R  
Sbjct: 351 LDDLSKMRYLERCIKESLRLYPPVPAIGRL-LSEDVTLSGYRVPEGAYCHIQCFDLHRRG 409

Query: 629 TVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICH 450
            ++ +D + F P+R++ P+    R P Y +  F+AGPR CIG+  A   +K   ++++ H
Sbjct: 410 DLY-KDPLVFDPDRFL-PENCSDRHP-YAYIPFSAGPRNCIGQKFAILEMKSAISSLLRH 466

Query: 449 YQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKRK 345
           Y+   V     ++ FT  ++L   + + VKF+K++
Sbjct: 467 YELLPVTKPE-DLKFTADLVLRTTNPVYVKFVKKE 500



>sp|Q9LVD2|C72A_ARATH Cytochrome P450 71B10 (EC
           1.14.-.-).>gb:AB019233_1514195 Arabidopsis thaliana
           genomic DNA, chromosome 5, P1 clone:MJB24.
          Length = 502

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 49/181 (27%), Positives = 91/181 (50%), Gaps = 6/181 (3%)
 Frame = -1

Query: 875 PQVEAKILHDI-LQLKQDKK--VFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKD 705
           P+V  K+  +I  Q+ ++ K  +  ++E   L+YL+    E+  L P  PL     +  +
Sbjct: 321 PRVMKKVQSEIRAQIGKNNKTRIISLDEINHLSYLNMVIKETCRLHPVAPLLVPREVISE 380

Query: 704 ILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNA 525
              +G+ + P T++ +  +++GR   +W +D  EF PER++  D  +K Q  Y+   F +
Sbjct: 381 FKINGYTIQPKTRLHVNVWAIGRDPEIW-KDPEEFLPERFMDCDIDVKGQ-DYELLPFGS 438

Query: 524 GPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTD---SMILEKKHGLKVKFI 354
           G R C    M  T V+   A ++ H+ ++L E   +E ++ D    +   KKH L +  +
Sbjct: 439 GRRICPAVYMGITTVEFGLANLLYHFDWKLPEGVAVEDIYMDEASGLTSHKKHDLLLVPV 498

Query: 353 K 351
           K
Sbjct: 499 K 499



>gb:AY858838_1965104 Homo sapiens vitamin D 24-hydroxylase splice
           variant (CYP24) mRNA, complete cds, alternatively
           spliced.
          Length = 372

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 49/181 (27%), Positives = 88/181 (48%), Gaps = 5/181 (2%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVP-----LNHKNPME 711
           PQV+ K+L +I  +  + +V + E+ + + YL A   ES+ L P VP     L+    + 
Sbjct: 204 PQVQQKLLKEIQSVLPENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLG 263

Query: 710 KDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVF 531
           +  LP G V+  NT+++      G  +  + ED  +F+PERW+     I     +    F
Sbjct: 264 EYALPKGTVLMLNTQVL------GSSEDNF-EDSSQFRPERWLQEKEKIN---PFAHLPF 313

Query: 530 NAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIK 351
             G R CIGR +A   + +    I+  Y  Q  +   +E+L + +++  ++  L + F +
Sbjct: 314 GVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRE--LPIAFCQ 371

Query: 350 R 348
           R
Sbjct: 372 R 372



>gb:AP003575_1831142 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0528B02.
          Length = 544

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 42/131 (32%), Positives = 68/131 (51%), Gaps = 7/131 (5%)
 Frame = -1

Query: 806 EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDT 627
           E+  K+T L AA  E++ L PP+PL       +D +  GH V   T++++  +++GR + 
Sbjct: 376 EQLGKMTLLRAAMKEAMRLHPPLPLLIPREAIQDTVLHGHRVAAGTRVMINAWAIGRDEA 435

Query: 626 VWGEDCMEFKPERWISPDGGIKRQPSY-------KFSVFNAGPRTCIGRDMAFTVVKMVA 468
            W ED  EF+P R+   DGG      Y       +F  F AG R C G   A  + ++V 
Sbjct: 436 AW-EDAGEFRPGRF--ADGGDNAGVEYYGGGGDFRFMPFGAGRRGCPGMAFATRLAELVV 492

Query: 467 ATIICHYQFQL 435
           A + C ++++L
Sbjct: 493 ANMACWFEWEL 503



>gb:YSAALK8B_1728065 C. maltosa ALK8-B gene for n-alkane-inducible
           cytochrome P-450, partial sequence.
          Length = 213

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 47/157 (29%), Positives = 74/157 (47%), Gaps = 13/157 (8%)
 Frame = -1

Query: 875 PQVEAKILHDI---LQLKQDKKVFKVE-ECQKLT-YLHAAFCESLGLFPPVPLNHKNPME 711
           P+V +K+  +I     L  D ++  +  E  KL  YL A   E+L L+P VP N +    
Sbjct: 29  PEVWSKLRQEIGDKFGLDSDSRIEDISFELLKLCEYLKAVINETLRLYPSVPRNGRFAAA 88

Query: 710 KDILPSGH--------VVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQ 555
              LP G         +V     ++   Y++ R +  +G+D  EF+PERW  P+    R+
Sbjct: 89  DTTLPHGGGKDGMSPILVRKGQTVMYSVYALQRDEKYYGKDANEFRPERWFEPE---VRK 145

Query: 554 PSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQ 444
             + F  FN GPR C+G+  A T    V   +I  ++
Sbjct: 146 LGWAFLPFNGGPRICLGQQFALTEASYVLVRLIQSFE 182



>pir|G84200|G84200 cytochrome P450 [imported] - Halobacterium sp.
           NRC-1>gb:AE004998_62131 Halobacterium sp. NRC-1 section
           29 of 170 of the complete genome.>gb:AE004437_887050
           Halobacterium sp. NRC-1 complete genome.
          Length = 405

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 46/146 (31%), Positives = 72/146 (49%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P VEA++  ++     D     V + Q L YL     ES+ L+PPV    + P+E   L 
Sbjct: 236 PDVEARLHAELDGALDDGAQPTVAQLQDLDYLEWVLQESMRLYPPVYNVFRTPIEPVEL- 294

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
           +G  V     I++P +++ R    W +D   F PERW  P+    R P + +  F  GPR
Sbjct: 295 AGSEVPAGAPIMLPQWAIHRSPDHW-DDPEAFDPERW-RPERRADR-PRFAYFPFGGGPR 351

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQ 438
            CIG+ +A    K++ AT+   Y+ +
Sbjct: 352 HCIGKQLALLEAKLIVATVASDYRLR 377



>sp|Q27517|YRV5_CAEEL Putative cytochrome P450 CYP13A3 (EC
           1.14.-.-).>pir|T24780|T24780 hypothetical protein
           T10B9.5 - Caenorhabditis elegans>gb:CET10B9_1367559
           Caenorhabditis elegans cosmid T10B9, complete sequence.
          Length = 520

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 42/155 (27%), Positives = 71/155 (45%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+++ K+  ++ +   D +V   ++  KL Y+     E+L L+P   + H     K    
Sbjct: 346 PEIQKKLQEEVDRECPDPEV-TFDQLSKLKYMECVIKETLRLYPLASIVHNRKCMKSTTV 404

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G  +   T +    +++      WGE+  EFKPERW S D     + +Y    F  GPR
Sbjct: 405 LGMKIEEGTNVQADTWTLHYDPKFWGENANEFKPERWESGDEQAVAKGAY--LPFGLGPR 462

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEI 411
            CIG  +A+   KM+ A I+  Y  +     H+ +
Sbjct: 463 ICIGMRLAYMEEKMLLAQILKKYSLETTFETHIPL 497



>sp|Q12589|CP5K_CANMA Cytochrome P450 52A11 (EC 1.14.14.-)
           (CYPLIIA11) (Alkane-inducible
           P450-ALK8).>pir|JS0726|JS0726 cytochrome P450 ALK8,
           alkane-inducible - yeast (Candida
           maltosa)>gb:YSAALK78_1728064 Candida maltosa ALK7
           (CYP52A10) and ALK8 (CYP52A11) genes for n-alkane
           inducible cytochrome P-450, complete cds.
          Length = 519

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 47/157 (29%), Positives = 74/157 (47%), Gaps = 13/157 (8%)
 Frame = -1

Query: 875 PQVEAKILHDI---LQLKQDKKVFKVE-ECQKLT-YLHAAFCESLGLFPPVPLNHKNPME 711
           P+V +K+  +I     L  D ++  +  E  KL  YL A   E+L L+P VP N +    
Sbjct: 335 PEVWSKLREEIGDKFGLDPDSRIEDISFELLKLCEYLKAVINETLRLYPSVPRNGRFAAA 394

Query: 710 KDILPSGH--------VVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQ 555
              LP G         +V     ++   Y++ R +  +G+D  EF+PERW  P+    R+
Sbjct: 395 NTTLPHGGGPDGMSPILVRKGQTVMYSVYALQRDEKYYGKDANEFRPERWFEPE---VRK 451

Query: 554 PSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQ 444
             + F  FN GPR C+G+  A T    V   +I  ++
Sbjct: 452 LGWAFLPFNGGPRICLGQQFALTEASYVLVRLIQSFE 488



>sp|Q07973|CP24_HUMAN Cytochrome P450 24A1, mitochondrial precursor
           (EC 1.14.-.-) (P450- CC24) (Vitamin D(3) 24-hydroxylase)
           (1,25-dihydroxyvitamin D(3) 24- hydroxylase)
           (24-OHase).>gb:AL138805_1919969 Human DNA sequence from
           clone RP5-1075G21 on chromosome 20 Contains the CYP24
           gene for cytochrome P450, subfamily XXIV (vitamin D
           24-hydroxylase) (24-ohase, vitamin D 24-hydroxylase,
           25-@dihydroxyvitamin D3 24-hydroxylase, CP24, P450-CC24)
           and a CpG island, complete sequence.
          Length = 514

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 49/181 (27%), Positives = 88/181 (48%), Gaps = 5/181 (2%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVP-----LNHKNPME 711
           PQV+ K+L +I  +  + +V + E+ + + YL A   ES+ L P VP     L+    + 
Sbjct: 346 PQVQQKLLKEIQSVLPENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLG 405

Query: 710 KDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVF 531
           +  LP G V+  NT+++      G  +  + ED  +F+PERW+     I     +    F
Sbjct: 406 EYALPKGTVLMLNTQVL------GSSEDNF-EDSSQFRPERWLQEKEKIN---PFAHLPF 455

Query: 530 NAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIK 351
             G R CIGR +A   + +    I+  Y  Q  +   +E+L + +++  ++  L + F +
Sbjct: 456 GVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRE--LPIAFCQ 513

Query: 350 R 348
           R
Sbjct: 514 R 514



>gb:AY390259_1325008 Mamestra brassicae antennal cytochrome P450
           CYP4 mRNA, complete cds.
          Length = 557

 Score = 67.8 bits (164), Expect = 3e-10
 Identities = 44/155 (28%), Positives = 79/155 (50%), Gaps = 1/155 (0%)
 Frame = -1

Query: 806 EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPS-GHVVTPNTKIIMPFYSMGRMD 630
           ++  ++ YL     E+L +FPPVP+  ++  +   LPS G  V   T +++  Y + R  
Sbjct: 402 QDTLEMKYLERCLMETLRMFPPVPIIARHLKQDITLPSCGKQVPAGTTVVVATYKLHRRP 461

Query: 629 TVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICH 450
            V+     EF P+ ++ P+    R   Y F  F+AGPR+C+GR  A   +K++ +TI+  
Sbjct: 462 DVYPNPT-EFDPDNFL-PEKSANRH-YYAFVPFSAGPRSCVGRKYAMLKLKIILSTILRS 518

Query: 449 YQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKRK 345
           ++    +    +      +IL++  G KV+   RK
Sbjct: 519 FRVH-SDLKESDFKLQADIILKRAEGFKVRLEPRK 552



>sp|Q9VYQ5|C318_DROME Probable cytochrome P450 318a1 (EC 1.14.-.-)
           (CYPCCCXVIIIA1).>gb:AE014298_1125354 Drosophila
           melanogaster chromosome X, complete
           sequence.>gb:AE003488_1212363 Drosophila melanogaster
           chromosome X, section 40 of 74 of the complete
           sequence.>gb:AY113358_1299306 Drosophila melanogaster
           GM14828 full insert cDNA.
          Length = 536

 Score = 67.8 bits (164), Expect = 3e-10
 Identities = 49/185 (26%), Positives = 93/185 (50%), Gaps = 21/185 (11%)
 Frame = -1

Query: 866 EAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGH 687
           + ++L +I  L  D     +E+ Q+L YL A   ESL L   VP+N ++ + +D   +G 
Sbjct: 339 QRRLLAEIRALVPDVGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRH-VSRDFRLAGR 397

Query: 686 ----VVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPD------------GGIKRQ 555
               +V  N+ +++  ++M R +  WG +  +F P+R++  +             G KR+
Sbjct: 398 QHETIVPQNSIVVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRR 457

Query: 554 P-----SYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMI 390
                 SY F  F+ G R+CIGR     ++K+    +I ++ FQ  +F   ++ F +++ 
Sbjct: 458 QRDRRHSYSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNFDFQ-SDFELEKLQFVENIS 516

Query: 389 LEKKH 375
           L+ K+
Sbjct: 517 LKFKN 521



>gb:BC075285_2558391 Xenopus tropicalis cytochrome P450, family 27,
           subfamily B, polypeptide 1, mRNA (cDNA clone MGC:88925
           IMAGE:6999896), complete cds.
          Length = 506

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 41/176 (23%), Positives = 89/176 (50%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P +++ +  ++ ++ Q K++    +  ++  L A   E L L+P +P N +   ++DI  
Sbjct: 336 PDIQSAVYSEVEEILQGKQIPSPSDVARMPLLKAVVKEVLRLYPVIPGNARVVADRDIQV 395

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
             +++   T I +  Y+  R + V+     EF+P+RW+  +        Y    F  G R
Sbjct: 396 GDYIIPKKTLITLCHYATSRDENVFSNP-NEFQPDRWLKKE---DTHHPYASLPFGFGKR 451

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           +CIGR +A   V +  A I+ H++ +  +   L +  T ++++ +K  + ++F++R
Sbjct: 452 SCIGRRIAELEVYLALARILSHFEVKPEQPGSLVMPMTRTLLVPEKE-INLQFLER 506



>gb:AF321858_1786038 Lolium rigidum clone BXH putative cytochrome
           P450 mRNA, complete cds.
          Length = 507

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 42/154 (27%), Positives = 77/154 (50%), Gaps = 5/154 (3%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           PQV AK+  ++ +     ++   E+   ++YL A   E++ L PP PL   +    D   
Sbjct: 326 PQVMAKLQAEVRRCSTTNQLLTQEDLSSMSYLKAVMKETMRLHPPGPLLLPHASIADCEV 385

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQP-----SYKFSVF 531
            G+VV   T++I+  +++GR  + W E   EF PER++  +G +          ++   F
Sbjct: 386 EGYVVPAGTRVIINVWAIGRHASSW-ERAEEFVPERFL--EGSVDANSDFYGNDFRLLPF 442

Query: 530 NAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVE 429
            +G R C G + A    +++ A +I H+ ++L E
Sbjct: 443 GSGRRMCPGINFATLTFEIILANLIYHFDWELPE 476



>gb:AB196795_1203115 Antheraea yamamai mRNA for cytochrome P450
           CYP4G25, complete cds.
          Length = 557

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 45/155 (29%), Positives = 82/155 (52%), Gaps = 1/155 (0%)
 Frame = -1

Query: 806 EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPS-GHVVTPNTKIIMPFYSMGRMD 630
           ++  ++ YL     E+L L+PPVP+  ++  E+  LPS G  V   T +I+  Y + R  
Sbjct: 402 QDTLEMKYLERCLMETLRLYPPVPIIARHLKEEITLPSNGKKVPIGTTLIVGTYKLHRRP 461

Query: 629 TVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICH 450
            V+     +F P+ ++ P+    R   Y F  F+AGPR+C+GR  A   +K++ +TI+ +
Sbjct: 462 DVYPNP-HKFDPDNFL-PERSANRH-YYAFVPFSAGPRSCVGRKYAMLKLKIILSTILRN 518

Query: 449 YQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKRK 345
           ++    + +  +      +IL++  G KV+   RK
Sbjct: 519 FRV-YSDLNESDFKLQADIILKRAEGFKVRLQPRK 552



>sp|O64636|C7C1_ARATH Cytochrome P450 76C1 (EC
           1.14.-.-).>pir|T00869|T00869 probable cytochrome P450
           [imported] - Arabidopsis thaliana>gb:AY078939_1568100
           Arabidopsis thaliana At2g45560/F17K2.9 mRNA, complete
           cds.>gb:AY124874_1580239 Arabidopsis thaliana
           At2g45560/F17K2.9 mRNA, complete cds.
          Length = 512

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 48/180 (26%), Positives = 90/180 (50%), Gaps = 3/180 (1%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+  AK   +I  +     + +  +  KL YL A   E+  L  PVPL      E D   
Sbjct: 331 PKTMAKAQAEIDCVIGQNGIVEESDISKLPYLQAVVKETFRLHTPVPLLIPRKAESDAEI 390

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G +V  +T++++  +++GR  +VW ++  +F+PER++  D  + R   Y+ + F AG R
Sbjct: 391 LGFMVLKDTQVLVNVWAIGRDPSVW-DNPSQFEPERFLGKDMDV-RGRDYELTPFGAGRR 448

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQL---VEFHHLEILFTDSMILEKKHGLKVKFIKRK 345
            C G  +A   V ++ A+++  + ++L   V    L++  T  + L K + L    +K++
Sbjct: 449 ICPGMPLAMKTVSLMLASLLYSFDWKLPKGVLSEDLDMDETFGLTLHKTNPLHAVPVKKR 508



>gb:S67623_2040918 25-hydroxyvitamin D 24-hydroxylase cytochrome
           P450 subunit {3' region} [human, kidney, mRNA Partial,
           776 nt].
          Length = 257

 Score = 67.0 bits (162), Expect = 5e-10
 Identities = 46/167 (27%), Positives = 81/167 (48%), Gaps = 5/167 (2%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVP-----LNHKNPME 711
           PQV+ K+L +I  +  + +V + E+ + + YL A   ES+ L P VP     L+    + 
Sbjct: 89  PQVQQKLLKEIQSVLPENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLG 148

Query: 710 KDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVF 531
           +  LP G V+  NT+++      G  +  + ED  +F+PERW+     I     +    F
Sbjct: 149 EYALPKGTVLMLNTQVL------GSSEDNF-EDSSQFRPERWLQEKEKIN---PFAHLPF 198

Query: 530 NAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMI 390
             G R CIGR +A   + +    I+  Y  Q  +   +E+L + +++
Sbjct: 199 GVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLV 245



>gb:AP001298_1820965 Arabidopsis thaliana genomic DNA, chromosome 3,
           BAC clone:F20C19.
          Length = 445

 Score = 67.0 bits (162), Expect = 5e-10
 Identities = 47/171 (27%), Positives = 84/171 (49%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P V  K+  +I    +++++   E+ ++L YL     E+  L PP PL     +  +   
Sbjct: 266 PLVMRKVQSEIRNKFENRELISFEDIEQLHYLKTVIKETWRLHPPAPLLLPREVMSEFEI 325

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
           +G+ + P T+I +  +++GR    W +D  EF PER+I  +   K Q +++   F  G R
Sbjct: 326 NGYTMQPKTQIHVNVWAIGRDPNTW-KDPEEFLPERFIDSNIDTKGQ-NFELLPFGGGRR 383

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKV 363
            C    M  T+V+   A ++ H+ ++L E   +E      M +E+  GL V
Sbjct: 384 MCPAMYMGTTMVEFGLANLLYHFDWKLPEGMKVE-----DMDMEEAPGLTV 429



>gb:AF175278_1774495 Pisum sativum wound-inducible P450 hydroxylase
           (CYP82A1) gene, CYP82A1-v2 allele, complete cds.
          Length = 540

 Score = 67.0 bits (162), Expect = 5e-10
 Identities = 38/145 (26%), Positives = 69/145 (47%), Gaps = 1/145 (0%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P V  K+  ++      ++  K  +  KL YLHA   E+L L+PP P +      +D   
Sbjct: 356 PHVLEKLKEELNTYIGKERCVKESDINKLVYLHAIIKETLRLYPPAPFSSPREFTEDCTI 415

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIK-RQPSYKFSVFNAGP 519
            G+ +   T+++   + + R   VW  D +EFKPER++S    +  R  +++   F +G 
Sbjct: 416 GGYHIKKGTRLMPNLWKIHRDPNVW-PDPLEFKPERFLSTHKDVDVRGQNFELLPFGSGR 474

Query: 518 RTCIGRDMAFTVVKMVAATIICHYQ 444
           R C G  +   +V  + A  +  ++
Sbjct: 475 RMCAGMSLGLHMVHYILANFLHSFE 499



>gb:CR382127_1660284 Yarrowia lipolytica chromosome A of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 521

 Score = 67.0 bits (162), Expect = 5e-10
 Identities = 44/159 (27%), Positives = 70/159 (44%), Gaps = 10/159 (6%)
 Frame = -1

Query: 806 EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMP--------F 651
           E  ++  YL     E L L P VP+N +  ++   LP G     +  I +P         
Sbjct: 354 ESLKQCEYLRYVLNEVLRLHPVVPINLRVALKDTTLPRGGGPNGDEPIFVPKGQKINYAV 413

Query: 650 YSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMV 471
           Y   R +  WGED  EFKPERW + +        ++F  FN GPR C+G+  A T +  +
Sbjct: 414 YWTHRDEQYWGEDAEEFKPERWDTTNHPGPLGKGWEFLPFNGGPRICLGQQFALTEMGYI 473

Query: 470 AATIICHYQFQLV--EFHHLEILFTDSMILEKKHGLKVK 360
              ++  Y    +  E+H   +    S+ +    G+ V+
Sbjct: 474 LTRLVQEYSDIGIDEEYHDRPLRVRHSITMSHGDGVHVR 512



>gb:AY588580_1339442 Helicoverpa armigera cytochrome P450 (CYP4)
           mRNA, partial cds.
          Length = 200

 Score = 67.0 bits (162), Expect = 5e-10
 Identities = 46/177 (25%), Positives = 90/177 (50%), Gaps = 1/177 (0%)
 Frame = -1

Query: 872 QVEAKILHDILQLKQD-KKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           + + KIL ++ ++  D K+   +E+  K+ YL     ESL LFPPV    ++ + + +  
Sbjct: 29  EAQDKILEELKEILGDNKRPITMEDLPKMKYLERCIKESLRLFPPVHFISRS-LNETVTL 87

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
           S + +   T   +  Y + R   ++ ++   F P+R++ P+  + R P Y +  F+AGPR
Sbjct: 88  SNYKIPAGTFCHIQIYDLHRRADLF-KNPTAFDPDRFL-PENSVGRHP-YAYIPFSAGPR 144

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKRK 345
            CIG+  A   +K+  A ++  ++ Q V     +I      +   +  ++V F+KR+
Sbjct: 145 NCIGQKFAMMEMKIAVAEVLREFELQPVT-RPSDIRMIADAVFRNEGPVEVTFVKRQ 200



>pir|I55488|I55488 25-hydroxyvitamin D 24-hydroxylase cytochrome
           P450 subunit - human (fragment)
          Length = 257

 Score = 67.0 bits (162), Expect = 5e-10
 Identities = 46/167 (27%), Positives = 81/167 (48%), Gaps = 5/167 (2%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVP-----LNHKNPME 711
           PQV+ K+L +I  +  + +V + E+ + + YL A   ES+ L P VP     L+    + 
Sbjct: 89  PQVQQKLLKEIQSVLPENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLG 148

Query: 710 KDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVF 531
           +  LP G V+  NT+++      G  +  + ED  +F+PERW+     I     +    F
Sbjct: 149 EYALPKGTVLMLNTQVL------GSSEDNF-EDSSQFRPERWLQEKEKIN---PFAHLPF 198

Query: 530 NAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMI 390
             G R CIGR +A   + +    I+  Y  Q  +   +E+L + +++
Sbjct: 199 GVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLV 245



>sp|P58045|C71E_ARATH Cytochrome P450 71A14 (EC 1.14.-.-).
          Length = 497

 Score = 67.0 bits (162), Expect = 5e-10
 Identities = 41/148 (27%), Positives = 74/148 (50%), Gaps = 2/148 (1%)
 Frame = -1

Query: 860 KILHDILQLKQDKKVFKV--EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGH 687
           K L D ++ K  K +  +  E+ + + YL A   E L L PP+PL     + +DI   G+
Sbjct: 323 KKLQDEIRAKATKLILYISEEDVEDMKYLKAVVKEVLRLHPPLPLLVPRELSEDIKLKGY 382

Query: 686 VVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCI 507
            +   T++I+  +++ R    WG D  EF+PER +       R  +++F  F +G R C 
Sbjct: 383 DIAAGTQVIINAWAIQRDTMTWGIDAEEFRPERHLDSLVDF-RGTNFEFIPFGSGRRICP 441

Query: 506 GRDMAFTVVKMVAATIICHYQFQLVEFH 423
           G   A  +V++  A ++  + +++   H
Sbjct: 442 GIGFAMALVEVTLANLVNRFNWRMEVQH 469



>sp|Q9VA27|C4C3_DROME Cytochrome P450 4c3 (EC 1.14.-.-)
           (CYPIVC3).>gb:AE014297_1142263 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE003775_1224256
           Drosophila melanogaster chromosome 3R, section 113 of
           118 of the complete sequence.>gb:BT010108_1357474
           Drosophila melanogaster GH05994 full insert cDNA.
          Length = 535

 Score = 67.0 bits (162), Expect = 5e-10
 Identities = 48/178 (26%), Positives = 89/178 (50%), Gaps = 2/178 (1%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFK--VEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDI 702
           P+ + +++ ++  +  D K     ++    + YL     +SL LFP VP+  +   E D+
Sbjct: 362 PEYQERVVEELDSIFGDDKETPATMKNLMDMRYLECCIKDSLRLFPSVPMMARMVGE-DV 420

Query: 701 LPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAG 522
              G +V   T+ I+  Y++ R   V+ +   +F P+ ++ P+    R P + +  F+AG
Sbjct: 421 NIGGKIVPAGTQAIIMTYALHRNPRVFPKP-EQFNPDNFL-PENCAGRHP-FAYIPFSAG 477

Query: 521 PRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           PR CIG+  A    K V +T++  Y+ + V+    ++     +IL  K GL+VK   R
Sbjct: 478 PRNCIGQKFAILEEKAVISTVLRKYKIEAVD-RREDLTLLGELILRPKDGLRVKITPR 534



>gb:AP004617_1842154 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0479C08.
          Length = 534

 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 42/149 (28%), Positives = 72/149 (48%), Gaps = 2/149 (1%)
 Frame = -1

Query: 794 KLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPN-TKIIMPFYSMGRMDTVWG 618
           KL  L     E+L L+PP  L  +   E   L  G +  P+   + +P  ++   +  WG
Sbjct: 385 KLAVLQMVINETLRLYPPATLLPRMAFEDIELGGGALRVPSGASVWIPVLAIHHDEGAWG 444

Query: 617 EDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQ 438
            D  EF+P+R+     G  R P+  F  F AGPR C+G+  A    K+  A ++  ++F 
Sbjct: 445 RDAHEFRPDRFAP---GRPRPPAGAFLPFAAGPRNCVGQAYAMVEAKVALAMLLSSFRFA 501

Query: 437 LV-EFHHLEILFTDSMILEKKHGLKVKFI 354
           +  E+ H  +   + + L  +HG+ V+ +
Sbjct: 502 ISDEYRHAPV---NVLTLRPRHGVPVRLL 527



>gb:AP004264_1839405 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0025D09.
          Length = 519

 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 49/165 (29%), Positives = 84/165 (50%), Gaps = 3/165 (1%)
 Frame = -1

Query: 854 LHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTP 675
           L + + ++   KV   +   KL  ++    E+L L+ PV L  +  ++ DI   G  +  
Sbjct: 353 LREEIAMECGDKVPTGDMLNKLKMVNMFLLETLRLYSPVSLIRRK-VDTDIELGGIKMPE 411

Query: 674 NTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSV--FNAGPRTCIGR 501
              + +P  ++ R   VWGED  EF+PER+   + G+ R   +  ++  F++GPR+CIG+
Sbjct: 412 GALLTIPIATIHRDKEVWGEDADEFRPERF---ENGVTRAAKHPNALLSFSSGPRSCIGQ 468

Query: 500 DMAFTVVKMVAATIICHYQFQL-VEFHHLEILFTDSMILEKKHGL 369
           + A    K V A I+  + F L  ++ H     TD + L  K+GL
Sbjct: 469 NFAMIEAKAVIAMILQRFSFTLSPKYVHAP---TDVITLRPKYGL 510



>gb:AY230498_1591457 Candida tropicalis CYP52A12 (CYP52A12) gene,
           complete cds.
          Length = 523

 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 40/148 (27%), Positives = 70/148 (47%), Gaps = 13/148 (8%)
 Frame = -1

Query: 875 PQVEAKILHDI---LQLKQDKKVFKV--EECQKLTYLHAAFCESLGLFPPVPLNHKNPME 711
           P++ +K+  +I     + +D +V ++  E  ++  YL A   E+L ++P VP+N +    
Sbjct: 340 PEMWSKLREEIEVNFGVGEDSRVEEITFEALKRCEYLKAILNETLRMYPSVPVNFRTATR 399

Query: 710 KDILPSGHVVTPNTKIIMP--------FYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQ 555
              LP G        I +P         Y   R++  +G+D  +F+PERW  P     ++
Sbjct: 400 DTTLPRGGGANGTDPIYIPKGSTVAYVVYKTHRLEEYYGKDANDFRPERWFEPS---TKK 456

Query: 554 PSYKFSVFNAGPRTCIGRDMAFTVVKMV 471
             + +  FN GPR C+G+  A T    V
Sbjct: 457 LGWAYVPFNGGPRVCLGQQFALTEASYV 484



>gb:AB052131_1521171 Asparagus officinalis Asp-3 mRNA for cytochrome
           P450, complete cds.
          Length = 498

 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 43/147 (29%), Positives = 71/147 (48%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P    K+  ++  +   + V + E+  K+ YL A   E L L PPVPL            
Sbjct: 317 PGTMKKLKDEVRSVAGSETVVREEDISKMFYLKAVIKEILRLHPPVPLLIPRESMDHCNV 376

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
             + V   T++++  +SMGR   VW ED  EF+PER++  D   + Q  ++F  F AG R
Sbjct: 377 QQYEVPSKTRVLINAWSMGRDPKVW-EDPEEFRPERFLDSDIDFRGQ-CFEFVPFGAGRR 434

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQL 435
            C G   A   +++  A ++  + ++L
Sbjct: 435 ICPGMHFAAANLELALANLMYRFDWEL 461



>gb:DMU89746_1381108 Drosophila mettleri cytochrome P450
           monooxygenase CYP28A1 mRNA, complete cds.
          Length = 506

 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 42/136 (30%), Positives = 64/136 (47%), Gaps = 4/136 (2%)
 Frame = -1

Query: 872 QVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPS 693
           + + K+  ++     DK +   E+  +L +L A   ESL +FPP  +++K   E   LP+
Sbjct: 327 EAQQKLREELEAHLDDKGIIDFEKLNELPFLDACVQESLRIFPPAFMSNKLCTEPIELPN 386

Query: 692 ----GHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNA 525
                  V   T +++P Y    MD  +  D   FKPER++ PD     +    F  F  
Sbjct: 387 KTGENFTVERGTTVVVPHYCF-MMDEEFFPDPQAFKPERFMQPDAAKMYREQGVFMAFGD 445

Query: 524 GPRTCIGRDMAFTVVK 477
           GPR CIG   A T +K
Sbjct: 446 GPRVCIGMRFALTQIK 461



>gb:AY309972_1318073 Culex pipiens pallens cytochrome P450 mRNA,
           partial cds.
          Length = 302

 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 52/178 (29%), Positives = 84/178 (47%), Gaps = 2/178 (1%)
 Frame = -1

Query: 875 PQVEAKILHDILQL--KQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDI 702
           P+++ K+  ++ ++  K           Q + YL     ESL L+PPVP+  +   EK  
Sbjct: 128 PEIQEKVYQEVTEIIGKDLNAPTTYRNLQDMKYLELVIKESLRLYPPVPIIGRKFTEKTE 187

Query: 701 LPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAG 522
           +  G VV  ++   +    M R  T + ED   F PER+ SP+   +    Y +  F+AG
Sbjct: 188 I-DGKVVPEDSNFNVGIILMHRDPTQF-EDPERFDPERF-SPERTTELSSPYAYIPFSAG 244

Query: 521 PRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           PR CIG+  A   +K   + II +Y+          I+    + L+ K GLK+ F+ R
Sbjct: 245 PRNCIGQKFATLELKSTLSKIIRNYRLTETGPEPKLII---QLTLKPKDGLKIAFVPR 299



>pir|H96672|H96672 probable cytochrome P450 F13O11.24 [imported] -
           Arabidopsis thaliana>gb:AE005173_894146 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC006193_1533541 Arabidopsis thaliana
           chromosome I BAC F13O11 genomic sequence, complete
           sequence.
          Length = 511

 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 45/178 (25%), Positives = 82/178 (46%), Gaps = 1/178 (0%)
 Frame = -1

Query: 875 PQVEAKILHDILQLK-QDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDIL 699
           P+++ ++  +I  +  ++ K  + ++ QK+ YL A   E L   PP      + + +D +
Sbjct: 333 PEIQRRLYEEIKSIVGEEAKEVEEQDAQKMPYLKAVVMEGLRRHPPGHFVLPHSVTEDTV 392

Query: 698 PSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGP 519
             G+ V     I      +GR   VW E+ M FKPER++     I      K   F AG 
Sbjct: 393 LGGYKVPKKGTINFMVAEIGRDPKVW-EEPMAFKPERFMEEAVDITGSRGIKMMPFGAGR 451

Query: 518 RTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKRK 345
           R C G  +A   ++   A ++  +++Q V+ H +++       +  KH LK   + R+
Sbjct: 452 RICPGIGLAMLHLEYYVANMVREFEWQEVQGHEVDLTEKLEFTVVMKHPLKALAVPRR 509



>sp|Q27518|YRV7_CAEEL Putative cytochrome P450 CYP13A2 (EC
           1.14.-.-).>pir|T24781|T24781 hypothetical protein
           T10B9.7 - Caenorhabditis elegans>gb:CET10B9_1367558
           Caenorhabditis elegans cosmid T10B9, complete sequence.
          Length = 515

 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 40/146 (27%), Positives = 74/146 (50%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+++ K++ +I +     +V + E+  +L Y+     E+L L+P   +++     K    
Sbjct: 343 PKIQEKVIEEIAREFGTSEV-EFEKLGRLKYMDCVIKEALRLYPLASISNSRKCMKTTTV 401

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
           +G  +     + M  +S+     +WGED  EFKPERW S D  ++ + +Y    F  GPR
Sbjct: 402 NGVKIEAGVYVQMDTWSLHYDPELWGEDVKEFKPERW-STDEPLEHKGAY--LPFGLGPR 458

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQ 438
            CIG  +A    K++   ++ +Y F+
Sbjct: 459 QCIGMRLAIMEQKILLTHLLKNYTFE 484



>sp|Q64462|CP4B_MOUSE Cytochrome P450 4B1 (EC 1.14.14.1)
           (CYPIVB1).>pir|S66472|S66472 cytochrome P450 4B1 -
           mouse>gb:BC008996_2090763 Mus musculus cytochrome P450,
           family 4, subfamily b, polypeptide 1, mRNA (cDNA clone
           MGC:11502 IMAGE:3967680), complete
           cds.>gb:MUSCYP4B1_2125635 Mouse mRNA for CYP4B1 (renal
           cytochrome P450), complete cds.
          Length = 511

 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 40/145 (27%), Positives = 71/145 (48%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P  + +   ++ ++  D+  F+ ++  ++TYL     E   L+PPVP  ++   +     
Sbjct: 335 PMHQQRCREEVREILGDRDSFQWDDLAQMTYLTMCMKECFRLYPPVPQVYRQLSKPVTFV 394

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G  +   + I +  Y++ R   VW  D   F P R+ SP+    R P + F  F+AGPR
Sbjct: 395 DGRSLPAGSLISLHIYALHRNSAVW-PDPEVFDPLRF-SPENMTGRHP-FAFMPFSAGPR 451

Query: 515 TCIGRDMAFTVVKMVAATIICHYQF 441
            CIG+  A   +K+V A  +  ++F
Sbjct: 452 NCIGQQFAMNEMKVVTALCLLRFEF 476



>sp|O64637|C7C2_ARATH Cytochrome P450 76C2 (EC
           1.14.-.-).>pir|T00870|T00870 probable cytochrome P450
           At2g45570 [imported] - Arabidopsis
           thaliana>gb:AC003680_1531189 Arabidopsis thaliana
           chromosome 2 BAC F17K2 genomic sequence, complete
           sequence.>gb:AY062600_1565256 Arabidopsis thaliana
           putative cytochrome P450 (At2g45570; F17K2.10) mRNA,
           complete cds.>gb:AY114660_1578702 Arabidopsis thaliana
           putative cytochrome P450 (At2g45570) mRNA, complete cds.
          Length = 512

 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 49/180 (27%), Positives = 86/180 (47%), Gaps = 3/180 (1%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+   K   +I  +   K V +  +   L YL A   E+  L P  PL      E D+  
Sbjct: 332 PETMVKAQAEIDCVIGQKGVVEESDISALPYLQAVVKETFRLHPAAPLLVPRKAESDVEV 391

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G +V  +T++ +  +++GR   VW E+   FKPER++  D  + R   Y+ + F AG R
Sbjct: 392 LGFMVPKDTQVFVNVWAIGRDPNVW-ENSSRFKPERFLGKDIDL-RGRDYELTPFGAGRR 449

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQL---VEFHHLEILFTDSMILEKKHGLKVKFIKRK 345
            C G  +A   V ++ A+++  + ++L   V    L++  T  + L K + L    +K++
Sbjct: 450 ICPGLPLAVKTVPLMLASLLYSFDWKLPNGVGSEDLDMDETFGLTLHKTNPLHAVPVKKR 509



>gb:GGA250337_2572715 Gallus gallus mRNA for Cytochrome P450 protein
           (cyp3A37 gene).
          Length = 508

 Score = 66.2 bits (160), Expect = 8e-10
 Identities = 43/147 (29%), Positives = 74/147 (50%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P V+ K++++I  +  +K     E   +L YL  A  E+L L+P +    +   ++D+  
Sbjct: 331 PDVQQKVVNEIDTILPNKAPLTYEAIMQLEYLDMAVNETLRLYP-LGGRLERTCKRDVEI 389

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
           +G  +   T +I+P Y++ R    W     EF+PER+ S +      P Y +  F AGPR
Sbjct: 390 NGVTIPKGTIVIIPPYTLHRSPEYWPNP-EEFRPERF-SKENKDNIDP-YTYLPFGAGPR 446

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQL 435
            CIG   A   +K+    ++ H+ FQ+
Sbjct: 447 NCIGMRFALLTLKVAITAVLQHFTFQV 473



>gb:AX034665_1457599 Sequence 2 from Patent EP1035206.
          Length = 557

 Score = 66.2 bits (160), Expect = 8e-10
 Identities = 50/192 (26%), Positives = 90/192 (46%), Gaps = 22/192 (11%)
 Frame = -1

Query: 869 VEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPM-EKDILP- 696
           V+ K+  +I Q+  D     ++E   L YL A   ESL L PP P  ++  + ++D +P 
Sbjct: 361 VQDKLREEICQIDTDMPT--LDELNALPYLEAFVKESLRLDPPSPYANRECLKDEDFIPL 418

Query: 695 -------SGHVV-----TPNTKIIMPFYSMGRMDTVWGEDCMEFKPERW---ISPDGGIK 561
                   G V+     T  T +++P +++ R   ++GED  EF+PERW   ++      
Sbjct: 419 AEPVIGRDGSVINEVRITKGTMVMLPLFNINRSKFIYGEDAEEFRPERWLEDVTDSLNSI 478

Query: 560 RQPSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLV----EFHHLEILFTDSM 393
             P    + F +GPR C G   A   +K      +   QF+ +    E+ H+ ++ +   
Sbjct: 479 EAPYGHQASFISGPRACFGWRFAVAEMKAFLFVTLRRVQFEPIISHPEYEHITLIISRPR 538

Query: 392 IL-EKKHGLKVK 360
           I+  +K G +++
Sbjct: 539 IVGREKEGYQMR 550



>gb:AY094906_1298080 Drosophila melanogaster RH12404 full insert
           cDNA.
          Length = 383

 Score = 66.2 bits (160), Expect = 8e-10
 Identities = 41/176 (23%), Positives = 81/176 (46%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+ + ++  ++  +  D+    ++    L YL A   E L L+  VP   +   +   + 
Sbjct: 213 PETQTRLRKELQDVALDETT-DLDALNGLPYLEALIKEVLRLYTIVPTTGRQTTQSTEI- 270

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G        + +  Y +   D  +  D   FKPERW+  DG +   P++ +  F+ GP 
Sbjct: 271 GGRTYCAGVTLWINMYGLAH-DKEYYPDPYAFKPERWLPEDGAVA-PPAFSYIPFSGGPH 328

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
            CIGR  +  ++K++ A ++  +Q +L       +     M+L+ + G+ V F+K+
Sbjct: 329 VCIGRRYSLLLMKLLTARLVREFQMELSP-EQAPLRLEAQMVLKAQQGINVSFLKQ 383



>gb:AC006720_1203859 Caenorhabditis elegans cosmid Y17G9B, complete
           sequence.
          Length = 511

 Score = 66.2 bits (160), Expect = 8e-10
 Identities = 42/152 (27%), Positives = 79/152 (51%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+V+ K+  ++ ++  D +   +E   ++ YL  A  E+L LFP VP+  +  +  D + 
Sbjct: 335 PEVQRKVQAELDEVMGDDEDVTIEHLSRMKYLECALKEALRLFPSVPIITRE-LSDDQVI 393

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G  +      ++  Y + R  + W +D   F P+R++ P+  I R+ S+ F  F+AG R
Sbjct: 394 GGVNIPKGVTFLLNLYLVHRDPSQW-KDPDVFDPDRFL-PENSIARK-SFAFIPFSAGSR 450

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVEFHH 420
            CIG+  A    K++ A ++ ++  + VE  H
Sbjct: 451 NCIGQRFALMEEKVIMAHLLRNFNVKAVELMH 482



>gb:AE014298_1125353 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003488_1212362 Drosophila melanogaster
           chromosome X, section 40 of 74 of the complete sequence.
          Length = 383

 Score = 66.2 bits (160), Expect = 8e-10
 Identities = 41/176 (23%), Positives = 81/176 (46%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+ + ++  ++  +  D+    ++    L YL A   E L L+  VP   +   +   + 
Sbjct: 213 PETQTRLRKELQDVALDETT-DLDALNGLPYLEALIKEVLRLYTIVPTTGRQTTQSTEI- 270

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G        + +  Y +   D  +  D   FKPERW+  DG +   P++ +  F+ GP 
Sbjct: 271 GGRTYCAGVTLWINMYGLAH-DKEYYPDPYAFKPERWLPEDGAVA-PPAFSYIPFSGGPH 328

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
            CIGR  +  ++K++ A ++  +Q +L       +     M+L+ + G+ V F+K+
Sbjct: 329 VCIGRRYSLLLMKLLTARLVREFQMELSP-EQAPLRLEAQMVLKAQQGINVSFLKQ 383



>pir|T52168|T52168 cytochrome P450 monooxygenase [imported] -
           Arabidopsis thaliana>gb:D78600_1674782 Arabidopsis
           thaliana mRNA for cytochrome P450 monooxygenase,
           complete cds, clone P450-4.
          Length = 495

 Score = 66.2 bits (160), Expect = 8e-10
 Identities = 41/147 (27%), Positives = 76/147 (51%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+  AK   +I  +     + +  +  KL YL A   E+  L  PVPL      E D   
Sbjct: 331 PKTMAKAQAEIDCVIGQNGIVEESDISKLPYLQAVVKETFRLHTPVPLLIPRKAESDAEI 390

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G +V  +T++++  +++GR  +VW ++  +F+PER++  D  + R   Y+ + F AG R
Sbjct: 391 LGFMVLKDTQVLVNVWAIGRDPSVW-DNPSQFEPERFLGKDMDV-RGRDYELTPFGAGRR 448

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQL 435
            C G  +A   V ++ A+++  + ++L
Sbjct: 449 ICPGMPLAMKTVSLMLASLLYSFDWKL 475



>sp|P30608|CP5F_CANTR Cytochrome P450 52A6 (EC 1.14.14.-) (CYPLIIA6)
           (Alkane-inducible P450- ALK3).>pir|S22972|S22972
           cytochrome P450 52A6 - yeast (Candida
           tropicalis)>gb:CTCYP52A6_1674190 C.tropicalis CYP52A6
           gene encoding cytochrome P450alk3.
          Length = 524

 Score = 66.2 bits (160), Expect = 8e-10
 Identities = 39/153 (25%), Positives = 72/153 (47%), Gaps = 13/153 (8%)
 Frame = -1

Query: 875 PQVEAKILHDI---LQLKQDKKVFKV--EECQKLTYLHAAFCESLGLFPPVPLNHKNPME 711
           P++ +K+  +I     + ++ +V ++  E  ++  YL A   E+L ++P VP+N +    
Sbjct: 341 PEIWSKLREEIEVNFGVGEESRVEEITFESLKRCEYLKAILNETLRMYPSVPVNSRTATR 400

Query: 710 KDILPSGHVVTPNTKIIMP--------FYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQ 555
              LP G        I +P         Y   R++  +G+D  +F+PERW  P     ++
Sbjct: 401 DTTLPRGGGPNGTDPIFIPKGSTVAYIVYKTHRLEEYYGKDADDFRPERWFEPS---TKK 457

Query: 554 PSYKFSVFNAGPRTCIGRDMAFTVVKMVAATII 456
             + +  FN GPR C+G+  A T    V   ++
Sbjct: 458 LGWAYVPFNGGPRICLGQQFALTEASYVITRLV 490



>sp|Q64441|CP24_MOUSE Cytochrome P450 24A1, mitochondrial precursor
           (EC 1.14.-.-) (P450- CC24) (Vitamin D(3) 24-hydroxylase)
           (1,25-dihydroxyvitamin D(3) 24- hydroxylase)
           (24-OHase).>pir|S60033|S60033 25-hydroxyvitamin D3
           24-hydroxylase precursor - mouse>gb:D89669_2112704 Mus
           musculus mRNA for vitamin D-24-hydroxylase, complete
           cds.>gb:MUS25HD32H_2124907 Mus musculus mRNA for
           25-hydroxyvitamin D3 24-hydroxylase, complete cds.
          Length = 514

 Score = 66.2 bits (160), Expect = 8e-10
 Identities = 50/166 (30%), Positives = 80/166 (48%), Gaps = 10/166 (6%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVP-----LNHKNPME 711
           PQV+ ++L +I  +  D +  + E+ + + YL A   ES+ L P VP     L+    + 
Sbjct: 346 PQVQQRLLREIQSVLPDNQTPRAEDVRNMPYLKACLKESMRLTPSVPFTTRTLDKPTVLG 405

Query: 710 KDILPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVF 531
           +  LP G V+T NT+++      G  +  + ED  +F+PERW+  +   K+   +    F
Sbjct: 406 EYTLPKGTVLTLNTQVL------GSSEDNF-EDADKFRPERWLEKE---KKINPFAHLPF 455

Query: 530 NAGPRTCIGRDMAFTVVKMVAATIICHYQF-----QLVEFHHLEIL 408
             G R CIGR +A   + +    II  Y       + VE  HL IL
Sbjct: 456 GVGKRMCIGRRLAELQLHLALCWIIQKYNIVATDSEPVEMLHLGIL 501



>sp|Q9FH66|C71G_ARATH Cytochrome P450 71A16 (EC
           1.14.-.-).>gb:AB022210_1514974 Arabidopsis thaliana
           genomic DNA, chromosome 5, TAC clone:K16E1.
          Length = 497

 Score = 66.2 bits (160), Expect = 8e-10
 Identities = 36/147 (24%), Positives = 70/147 (47%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+   K+  +I  + +       +E + + YL A   E L L PP+PL     + +D+  
Sbjct: 319 PECLKKLQDEIRSVSKMNSYVSGKEVENMNYLKAVIKEVLRLHPPLPLLVPRLLSEDVKL 378

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G+ +T  T++I+  +++ R    WG D  EF+PER          + ++K+  F AG R
Sbjct: 379 KGYDITAGTQVIINAWAIQRDTATWGSDAQEFRPERHFDSTWDFVGR-NFKYIPFGAGRR 437

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQL 435
            C G  +   +  +  A ++  + +++
Sbjct: 438 LCPGIGLGSVMASVTLANLVKRFDWRV 464



>sp|O18596|C4DA_DROMT Cytochrome P450 4d10 (EC 1.14.-.-)
           (CYPIVD10).>gb:DMU91634_1381119 Drosophila mettleri
           cytochrome P450 monooxygenase CYP4D10 mRNA, complete
           cds.
          Length = 513

 Score = 66.2 bits (160), Expect = 8e-10
 Identities = 47/178 (26%), Positives = 84/178 (47%), Gaps = 2/178 (1%)
 Frame = -1

Query: 875 PQVEAKILHDILQL--KQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDI 702
           P+ + K + +I+ +  K  +     +    L Y+     E+L ++P VPL  +  +++  
Sbjct: 337 PECQRKCVEEIVSVLGKDTETPVTYDLLNNLNYMDLCIKETLRMYPSVPLLGRKVLQECE 396

Query: 701 LPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAG 522
           + +G ++   T I +    +GR + +  E    FKPER+       K  P + +  F+AG
Sbjct: 397 I-NGKIIPAGTNIGISPLFLGRSEDISSEP-NTFKPERFDVVTSAEKLNP-HAYIPFSAG 453

Query: 521 PRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           PR CIG+  A   +K +AA ++ HY+ + V       +    +IL  K  L  K  KR
Sbjct: 454 PRNCIGQKFAMLEIKAIAANVLRHYEIEFVGNAEESPVLIAELILRTKDPLMFKLKKR 511



>sp|Q9VYQ7|C311_DROME Probable cytochrome P450 311a1 (EC 1.14.-.-)
           (CYPCCCXIA1).>gb:AE014298_1125352 Drosophila
           melanogaster chromosome X, complete
           sequence.>gb:AE003488_1212361 Drosophila melanogaster
           chromosome X, section 40 of 74 of the complete sequence.
          Length = 483

 Score = 66.2 bits (160), Expect = 8e-10
 Identities = 41/176 (23%), Positives = 81/176 (46%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+ + ++  ++  +  D+    ++    L YL A   E L L+  VP   +   +   + 
Sbjct: 313 PETQTRLRKELQDVALDETT-DLDALNGLPYLEALIKEVLRLYTIVPTTGRQTTQSTEI- 370

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G        + +  Y +   D  +  D   FKPERW+  DG +   P++ +  F+ GP 
Sbjct: 371 GGRTYCAGVTLWINMYGLAH-DKEYYPDPYAFKPERWLPEDGAVA-PPAFSYIPFSGGPH 428

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
            CIGR  +  ++K++ A ++  +Q +L       +     M+L+ + G+ V F+K+
Sbjct: 429 VCIGRRYSLLLMKLLTARLVREFQMELSP-EQAPLRLEAQMVLKAQQGINVSFLKQ 483



>gb:BC081244_2562140 Xenopus laevis MGC86179 protein, mRNA (cDNA
           clone MGC:86179 IMAGE:6955669), complete cds.
          Length = 476

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 49/187 (26%), Positives = 91/187 (48%), Gaps = 11/187 (5%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P ++  +   I+Q  +  +V   E+  K+  + A   E+L LFP +P N +   + D++ 
Sbjct: 304 PSIQESVYQQIVQNLEKDQVPTAEDVPKIPLVRAVVKETLRLFPVLPGNGRVTQD-DLVL 362

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCM----EFKPERWISPDGGIKRQPSYKFSVFN 528
            G+++   T++ +  YS     T + + C     EFKPERWI   G ++R+ ++    F 
Sbjct: 363 DGYLIPKGTQLALCHYS-----TSFDDKCFPAAEEFKPERWIR-SGNLERKENFGSIPFG 416

Query: 527 AGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGL------- 369
            G R+CIGR +A   + ++          QL++   +++    + +L K HGL       
Sbjct: 417 YGIRSCIGRRIAELELHLLL--------IQLLQNFEIKVSPKTTTVLPKTHGLLCPGEKI 468

Query: 368 KVKFIKR 348
            V+F+ R
Sbjct: 469 NVRFVDR 475



>gb:AP003434_1829313 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0452F10.
          Length = 551

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 38/152 (25%), Positives = 73/152 (48%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+   K  ++I  +  +      +   KL YL A F E+L L PP+PL        D   
Sbjct: 364 PRAMRKAQNEIWAVVGNTSHVTKDHVDKLPYLKAVFKETLRLHPPLPLLIPREPPADTQI 423

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G+ +  +T++++  +++GR    WG+   EF PE++++     K Q  ++   F AG R
Sbjct: 424 LGYTIPAHTRVVINAWAIGRDAAAWGQQPDEFSPEKFLNSTIDYKGQ-DFELLPFGAGRR 482

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVEFHH 420
            C G     + +++  A+++ H+ ++     H
Sbjct: 483 GCPGIVFGVSAMEIALASLLYHFDWEAAATDH 514



>gb:AF005475_1760795 Phanerochaete chrysosporium cytochrome P450
           (CYP63-1A) gene, partial cds.
          Length = 208

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 41/147 (27%), Positives = 72/147 (48%), Gaps = 12/147 (8%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P V  ++  +IL +     +   ++ +++ YL A   E+L L+PPVP N +  ++  ILP
Sbjct: 22  PNVLQRLRQEILDVVGPSNLPTYDDIKQMKYLRAVLNETLRLYPPVPWNMRYAVKDGILP 81

Query: 695 SGH------VVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPS-YKFS 537
           +         +     +    + M R    WG D  EF P+R++         P+ + F 
Sbjct: 82  NSEPDGKPWFIPAGASVSYSVHCMHRRKDYWGPDAEEFDPDRFLDERLHKYLTPNPFIFL 141

Query: 536 VFNAGPRTCIGR-----DMAFTVVKMV 471
            FNAGPR C+G+     +M+F +VK++
Sbjct: 142 PFNAGPRICLGQQFAYNEMSFFLVKLL 168



>gb:CRO251269_1673471 Catharanthus roseus mRNA for geraniol
           10-hydroxylase (g10h gene).
          Length = 493

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 38/147 (25%), Positives = 75/147 (51%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P    K   ++ Q+    K  +  +  +L YL     E+L + PPVP      +E+ +  
Sbjct: 317 PDKMKKTQDELAQVIGRGKTIEESDINRLPYLRCVMKETLRIHPPVPFLIPRKVEQSVEV 376

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G+ V   +++++  +++GR +TVW +D + FKPER++  +  I R   ++   F AG R
Sbjct: 377 CGYNVPKGSQVLVNAWAIGRDETVW-DDALAFKPERFMESELDI-RGRDFELIPFGAGRR 434

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQL 435
            C G  +A   V ++  +++  + ++L
Sbjct: 435 ICPGLPLALRTVPLMLGSLLNSFNWKL 461



>gb:AB045593_1520404 Perilla frutescens SHT12 mRNA for flavonoid
           3'-hydroxylase, complete cds.
          Length = 523

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 39/152 (25%), Positives = 80/152 (52%), Gaps = 5/152 (3%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P + A++  ++  +    K+ K  +  +LTYL A   E+  L P  PL+     ++    
Sbjct: 333 PNILARVRKELDLIVGKDKLVKESDLGQLTYLQAVIKENFRLHPSTPLSLPRVAQESCEI 392

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIK-----RQPSYKFSVF 531
           +G+ +  ++ +++  +++GR   VW  D +EF+PER++   GG K     R   ++   F
Sbjct: 393 NGYYIPKDSTLLVNVWAIGRDPNVW-PDPLEFRPERFLM--GGEKPNVDVRGNDFELIPF 449

Query: 530 NAGPRTCIGRDMAFTVVKMVAATIICHYQFQL 435
            +G R C G ++   +V+++ AT++  + F+L
Sbjct: 450 GSGRRICAGMNLGIRMVQLLIATMVHAFDFEL 481



>gb:CEF22B3_1362801 Caenorhabditis elegans cosmid F22B3, complete
           sequence.>gb:CEH02I12_1364945 Caenorhabditis elegans
           fosmid H02I12, complete sequence.
          Length = 495

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 42/152 (27%), Positives = 78/152 (51%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+V+ K+  ++ ++  D +   +E   ++ YL  A  E+L LFP VP+  +  +  D + 
Sbjct: 319 PEVQRKVQAELDEVMGDDEDVTIEHLSRMKYLECALKEALRLFPSVPIITRE-LSDDQVI 377

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G  +      ++  Y + R    W +D   F P+R++ P+  I R+ S+ F  F+AG R
Sbjct: 378 GGVNIPKGVTFLLNLYLVHRDPAQW-KDPDVFDPDRFL-PENSIGRK-SFAFIPFSAGSR 434

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVEFHH 420
            CIG+  A    K++ A ++ ++  + VE  H
Sbjct: 435 NCIGQRFALMEEKVIMAHLLRNFNIKAVELMH 466



>gb:AY571901_1338101 Helicoverpa armigera cytochrome P450 CYP4 mRNA,
           partial cds.
          Length = 196

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 44/153 (28%), Positives = 79/153 (51%)
 Frame = -1

Query: 803 ECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTV 624
           E  ++ YL     ES+ LFPPVPL  +  + +D    G  +   T +++  Y + R   +
Sbjct: 54  ELNQMKYLELVIKESMRLFPPVPLIERKIL-RDCEIGGLTLVKGTSVLINIYQIQRQPEL 112

Query: 623 WGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQ 444
           + E+ +EF+PER+ +P      +  + +  F+AGPR CIG+  A   +K+  + +I    
Sbjct: 113 Y-ENPLEFRPERFEAP-----LKNPFSWLAFSAGPRNCIGQKFAMMELKITISEMI--KN 164

Query: 443 FQLVEFHHLEILFTDSMILEKKHGLKVKFIKRK 345
           F ++       L  D ++L  K+G+ +K + RK
Sbjct: 165 FYILPAPQEPELSAD-LVLRSKNGVHIKLMPRK 196



>gb:AF243506_1254903 Diabrotica virgifera virgifera insecticide
           resistance-associated cytochrome P450 mRNA, complete
           cds.
          Length = 501

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 46/176 (26%), Positives = 91/176 (51%), Gaps = 1/176 (0%)
 Frame = -1

Query: 872 QVEAKILHDILQLKQD-KKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           + + +I  +I+ +  D +K   + +  +L  +     E+L LFPPVP   +  +++DI  
Sbjct: 329 EYQDQIYEEIITVLGDAQKQPDLNDLNELKVMERFIKETLRLFPPVPYIART-LDEDIEL 387

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
           +G+++     I +  Y + R    W E   +F P+R++ P+  + R P + +  F+AGPR
Sbjct: 388 NGYLIPKEASIDIWIYDIHRNPKHWPEP-EKFDPDRFL-PENCVNRHP-FAYVPFSAGPR 444

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
            CIG+  A   +K +   I+ ++  +L + +    + TD ++L   H + + FI R
Sbjct: 445 NCIGQRFAMYEMKAIICGIMQNFSVKLADKNEKVEIMTD-LVLRSAHEINLNFIPR 499



>gb:AF016998_1232868 Drosophila melanogaster cytochrome P450
           (CYP4D1) gene, complete cds.>gb:AF016999_1232869
           Drosophila melanogaster cytochrome P450 (CYP4D1) gene,
           complete cds.>gb:AF017000_1232870 Drosophila
           melanogaster cytochrome P450 (CYP4D1) gene, complete
           cds.>gb:AF017001_1232871 Drosophila melanogaster
           cytochrome P450 (CYP4D1) gene, complete cds.
          Length = 512

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 53/179 (29%), Positives = 84/179 (46%), Gaps = 3/179 (1%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKV--EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDI 702
           P+ + K   +I  +  + K   V  E   +L Y+     E+L ++P VPL  +  +E D 
Sbjct: 336 PEAQKKCFEEIRSVVGNDKSTPVSYELLNQLHYVDLCVKETLRMYPSVPLLGRKVLE-DC 394

Query: 701 LPSGHVVTPNTKI-IMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNA 525
             +G ++   T I I P Y +GR + ++ E    FKPER+       K  P Y +  F+A
Sbjct: 395 EINGKLIPAGTNIGISPLY-LGRREELFSEP-NSFKPERFDVVTTAEKLNP-YAYIPFSA 451

Query: 524 GPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           GPR CIG+  A   +K + A ++ HY+   V       +    +IL  K  L  K  +R
Sbjct: 452 GPRNCIGQKFAMLEIKAIVANVLRHYEVDFVGDSSEPPVLIAELILRTKEPLMFKVRER 510



>gb:AE014298_1124004 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003423_1209186 Drosophila melanogaster
           chromosome X, section 7 of 74 of the complete
           sequence.>gb:AF017002_1232872 Drosophila melanogaster
           cytochrome P450 (CYP4D1) gene, complete
           cds.>gb:AF017003_1232873 Drosophila melanogaster
           cytochrome P450 (CYP4D1) gene, complete
           cds.>gb:AF017004_1232874 Drosophila melanogaster
           cytochrome P450 (CYP4D1) gene, complete cds.
          Length = 512

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 53/179 (29%), Positives = 85/179 (47%), Gaps = 3/179 (1%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKV--EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDI 702
           P+ + K   +I  +  + K   V  E   +L Y+     E+L ++P VPL  +  +E D 
Sbjct: 336 PEAQKKCFEEIRSVVGNDKSTPVSYELLNQLHYVDLCVKETLRMYPSVPLLGRKVLE-DC 394

Query: 701 LPSGHVVTPNTKI-IMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNA 525
             +G ++   T I I P Y +GR + ++ E  + FKPER+       K  P Y +  F+A
Sbjct: 395 EINGKLIPAGTNIGISPLY-LGRREELFSEPNI-FKPERFDVVTTAEKLNP-YAYIPFSA 451

Query: 524 GPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           GPR CIG+  A   +K + A ++ HY+   V       +    +IL  K  L  K  +R
Sbjct: 452 GPRNCIGQKFAMLEIKAIVANVLRHYEVDFVGDSSEPPVLIAELILRTKEPLMFKVRER 510



>gb:AE014298_1124003 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003423_1209185 Drosophila melanogaster
           chromosome X, section 7 of 74 of the complete
           sequence.>gb:AY119039_1300761 Drosophila melanogaster
           LP06368 full insert cDNA.
          Length = 503

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 53/179 (29%), Positives = 85/179 (47%), Gaps = 3/179 (1%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKV--EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDI 702
           P+ + K   +I  +  + K   V  E   +L Y+     E+L ++P VPL  +  +E D 
Sbjct: 327 PEAQKKCFEEIRSVVGNDKSTPVSYELLNQLHYVDLCVKETLRMYPSVPLLGRKVLE-DC 385

Query: 701 LPSGHVVTPNTKI-IMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNA 525
             +G ++   T I I P Y +GR + ++ E  + FKPER+       K  P Y +  F+A
Sbjct: 386 EINGKLIPAGTNIGISPLY-LGRREELFSEPNI-FKPERFDVVTTAEKLNP-YAYIPFSA 442

Query: 524 GPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           GPR CIG+  A   +K + A ++ HY+   V       +    +IL  K  L  K  +R
Sbjct: 443 GPRNCIGQKFAMLEIKAIVANVLRHYEVDFVGDSSEPPVLIAELILRTKEPLMFKVRER 501



>pir|T20908|T20908 hypothetical protein F14F7.3 - Caenorhabditis
           elegans>gb:CEF14F7_1362441 Caenorhabditis elegans cosmid
           F14F7, complete sequence.
          Length = 518

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 40/147 (27%), Positives = 72/147 (48%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+V+ K+  +I +   D +V   ++  KL Y+     E+L ++P   L +     +    
Sbjct: 344 PKVQKKLQEEIDRECADPEV-TFDQLSKLKYMECVIKETLRMYPLGALANSRCCMRATKI 402

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
             + +   T I+   +++    ++WGED  EFKPERW S D    ++  Y    F  GPR
Sbjct: 403 GNYEIDEGTNILCDTWTLHSDKSIWGEDAEEFKPERWESGDEHFYQKGGY--IPFGLGPR 460

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQL 435
            CIG  +A+   K++ + I+  Y  ++
Sbjct: 461 QCIGMRLAYMEEKLLLSHILRKYTLEV 487



>pir|T21236|T21236 hypothetical protein H02I12.8 - Caenorhabditis
           elegans
          Length = 467

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 42/152 (27%), Positives = 78/152 (51%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+V+ K+  ++ ++  D +   +E   ++ YL  A  E+L LFP VP+  +  +  D + 
Sbjct: 311 PEVQRKVQAELDEVMGDDEDVTIEHLSRMKYLECALKEALRLFPSVPIITRE-LSDDQVI 369

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G  +      ++  Y + R    W +D   F P+R++ P+  I R+ S+ F  F+AG R
Sbjct: 370 GGVNIPKGVTFLLNLYLVHRDPAQW-KDPDVFDPDRFL-PENSIGRK-SFAFIPFSAGSR 426

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVEFHH 420
            CIG+  A    K++ A ++ ++  + VE  H
Sbjct: 427 NCIGQRFALMEEKVIMAHLLRNFNIKAVELMH 458



>sp|Q27516|YRV4_CAEEL Putative cytochrome P450 CYP13A8 (EC
           1.14.-.-).>pir|T24785|T24785 hypothetical protein
           T10B9.4 - Caenorhabditis elegans>gb:CET10B9_1367564
           Caenorhabditis elegans cosmid T10B9, complete
           sequence.>gb:CEY53C12C_1370481 Caenorhabditis elegans
           YAC Y53C12C, complete sequence.
          Length = 509

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 40/147 (27%), Positives = 69/147 (46%), Gaps = 1/147 (0%)
 Frame = -1

Query: 875 PQVEAKILHDI-LQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDIL 699
           P++++K+  ++  +   D+  F  ++  KL Y+     ESL LFP     +     ++ +
Sbjct: 340 PKIQSKLQDEVDKECPNDEITF--DQLSKLKYMDNVIKESLRLFPFASFANSRRCMRNTV 397

Query: 698 PSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGP 519
               +V     +++  +++     VWG D  EFKPERW SP       P   +  F AGP
Sbjct: 398 IGEQIVEAGVDVMIDTWTLHHDKNVWGNDVEEFKPERWDSP-----LTPQQAYLSFGAGP 452

Query: 518 RTCIGRDMAFTVVKMVAATIICHYQFQ 438
           R C+G   A    K + + I+  Y F+
Sbjct: 453 RVCLGMRFALLEQKGLLSHILKKYTFE 479



>sp|P43083|CP5V_CANAP Cytochrome P450 52E1 (EC 1.14.14.-)
           (CYPLIIE1).>pir|S69988|S69988 unspecific monooxygenase
           (EC 1.14.14.1) cytochrome P450 52E1 - Candida apicola
           (ATCC 96134)>gb:CACYP450_1644880 C. apicola cytochrome
           CYP52E1 gene.
          Length = 519

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 49/180 (27%), Positives = 77/180 (42%), Gaps = 10/180 (5%)
 Frame = -1

Query: 875 PQVEAKILHDILQL--KQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDI 702
           P+V A++   +L      D +    E+ ++   L     E L L P VPLN +  +    
Sbjct: 332 PEVYAELREAVLSEFGSTDVETPTFEQLKQCKVLQNVIREVLRLHPNVPLNFRQAIVDTK 391

Query: 701 LPSGHVVTPNTKIIMP--------FYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSY 546
           LP+G     +  + +P         YSM R   +WG D   F+P+RW  P   +     +
Sbjct: 392 LPTGGGPNGDQPVFVPKGQNVFYSTYSMQRRTDIWGPDATTFRPDRWNEPREAL--ASGW 449

Query: 545 KFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLK 366
            +  FN GPR C+G+  A T         IC       EF  +E+L  D  ++  K+ +K
Sbjct: 450 DYIPFNGGPRICLGQQFALTEASYTIVR-ICQ------EFSRIEVLHPD--VITSKNSMK 500



>sp|P33269|C4D1_DROME Cytochrome P450 4d1 (EC 1.14.-.-)
           (CYPIVD1).>pir|T13611|T13611 hypothetical protein 87B1.1
           - fruit fly (Drosophila
           melanogaster)>gb:AF016992_1232862 Drosophila
           melanogaster cytochrome P450 (CYP4D1) gene, complete
           cds.>gb:AF016993_1232863 Drosophila melanogaster
           cytochrome P450 (CYP4D1) gene, complete
           cds.>gb:AF016994_1232864 Drosophila melanogaster
           cytochrome P450 (CYP4D1) gene, complete
           cds.>gb:AF016995_1232865 Drosophila melanogaster
           cytochrome P450 (CYP4D1) gene, complete
           cds.>gb:AF016996_1232866 Drosophila melanogaster
           cytochrome P450 (CYP4D1) gene, complete
           cds.>gb:AF016997_1232867 Drosophila melanogaster
           cytochrome P450 (CYP4D1) gene, complete
           cds.>gb:DMC87B1_1378460 Drosophila melanogaster cosmid
           clone 87B1.
          Length = 512

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 53/179 (29%), Positives = 84/179 (46%), Gaps = 3/179 (1%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKV--EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDI 702
           P+ + K   +I  +  + K   V  E   +L Y+     E+L ++P VPL  +  +E D 
Sbjct: 336 PEAQKKCFEEIRSVVGNDKSTPVSYELLNQLHYVDLCVKETLRMYPSVPLLGRKVLE-DC 394

Query: 701 LPSGHVVTPNTKI-IMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNA 525
             +G ++   T I I P Y +GR + ++ E    FKPER+       K  P Y +  F+A
Sbjct: 395 EINGKLIPAGTNIGISPLY-LGRREELFSEP-NSFKPERFDVVTTAEKLNP-YAYIPFSA 451

Query: 524 GPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           GPR CIG+  A   +K + A ++ HY+   V       +    +IL  K  L  K  +R
Sbjct: 452 GPRNCIGQKFAMLEIKAIVANVLRHYEVDFVGDSSEPPVLIAELILRTKEPLMFKVRER 510



>gb:BC089709_2566256 Xenopus tropicalis cDNA clone MGC:108307
           IMAGE:7021744, complete cds.
          Length = 528

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 53/184 (28%), Positives = 86/184 (46%), Gaps = 8/184 (4%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVE--ECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDI 702
           P+ + K   +I +L + K +  +E  E  KL +      ESL L PPV    +   E   
Sbjct: 354 PEYQEKCRKEITELLEGKDIKHLEWDELSKLPFTTMCIKESLRLHPPVVAVIRRCTEDIK 413

Query: 701 LPSGHVVTPNTKIIMPFYSMGRMDTVWGE----DCMEFKPERWISPDGGIKRQPSYKFSV 534
           LP G ++      I+  + +     VW      D   F PE        ++ + SY F  
Sbjct: 414 LPKGDILPKGNCCIINIFGIHHNPDVWPNPQVYDPYRFDPEN-------LQERSSYAFVP 466

Query: 533 FNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHG--LKVK 360
           F+AGPR CIG++ A   +K+V A I+ ++Q +L E     +     +IL  ++G  L+V+
Sbjct: 467 FSAGPRNCIGQNFAMAEMKIVLALILYNFQVRLDETK--TVRRKPELILRAENGLWLQVE 524

Query: 359 FIKR 348
            +KR
Sbjct: 525 ELKR 528



>gb:AP003434_1829310 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0452F10.
          Length = 561

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 42/151 (27%), Positives = 70/151 (46%), Gaps = 6/151 (3%)
 Frame = -1

Query: 794 KLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDTVWGE 615
           +L +L A   E L L  P PL       +D    G+ +   T++I+  +++GR    WG+
Sbjct: 394 ELPFLRAVIKEMLRLHAPGPLLLPRETVEDTELLGYRIPARTRVIINVWAIGRDAAAWGD 453

Query: 614 DCMEFKPERWISPDGG------IKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIIC 453
              EF PERW+   GG       +     +F  F AG R C G   A   V++  A ++ 
Sbjct: 454 SAEEFVPERWLDGGGGGGVEYAQQLGKDSRFVPFGAGRRGCPGAGFAALSVELALANLLY 513

Query: 452 HYQFQLVEFHHLEILFTDSMILEKKHGLKVK 360
           H+ ++L       I+ T  + +++  GL V+
Sbjct: 514 HFDWELPPPAASGIMATTRLDMDELFGLSVR 544



>gb:AC134348_1741777 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0530H10, complete
           sequence.>gb:AC135929_1742923 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone P0692D12, complete
           sequence.
          Length = 535

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 40/129 (31%), Positives = 62/129 (48%), Gaps = 6/129 (4%)
 Frame = -1

Query: 806 EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDT 627
           +   KL YL AA  E+L L  P+PL        D    G+ V   T++++  +++GR   
Sbjct: 366 DHVDKLPYLRAALKEALRLHAPLPLLVARETVADTEIMGYHVAARTRVVINGWAIGRDTA 425

Query: 626 VWGEDCMEFKPERWIS-PDGGIKRQPSYKFS-----VFNAGPRTCIGRDMAFTVVKMVAA 465
           VWGE   EF PER+++  +GG      YK        F  G R C G       V+M  A
Sbjct: 426 VWGETAEEFMPERFLAGGNGGGAAAADYKVQGFEMLPFGGGRRGCPGVTFGMATVEMAVA 485

Query: 464 TIICHYQFQ 438
           +++ H+ ++
Sbjct: 486 SLLYHFDWE 494



>gb:YSAP450ALK_1728134 Candida tropicalis cytochrome P-450-alk2
           (CYP52A2) and cytochrome P-450-alk1 (CYP52A1) genes,
           complete cds.
          Length = 543

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 42/153 (27%), Positives = 69/153 (45%), Gaps = 13/153 (8%)
 Frame = -1

Query: 875 PQVEAKILHDI---LQLKQDKKVFKV--EECQKLTYLHAAFCESLGLFPPVPLNHKNPME 711
           P++ AK+  +I     L QD +V ++  E  +   YL A   E+L ++P VP N +    
Sbjct: 356 PEIFAKLREEIENKFGLGQDARVEEISFETLKSCEYLKAVINETLRIYPSVPHNFRVATR 415

Query: 710 KDILPSGH--------VVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQ 555
              LP G          +     ++    +  R   ++GED   F+PERW  P+    R+
Sbjct: 416 NTTLPRGGGEGGLSPIAIKKGQVVMYTILATHRDKDIYGEDAYVFRPERWFEPE---TRK 472

Query: 554 PSYKFSVFNAGPRTCIGRDMAFTVVKMVAATII 456
             + +  FN GPR C+G+  A T    V   ++
Sbjct: 473 LGWAYVPFNGGPRICLGQQFALTEASYVTVRLL 505



>gb:AY052668_1562828 Arabidopsis thaliana At1g64950/F13O11_25 mRNA,
           complete cds.
          Length = 510

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 45/178 (25%), Positives = 80/178 (44%), Gaps = 1/178 (0%)
 Frame = -1

Query: 875 PQVEAKILHDILQLK-QDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDIL 699
           P ++ ++  +I  +  ++    + E+ QK+ YL A   E L   PP      + + +D +
Sbjct: 332 PDIQKRLYEEIKSVVGEEANEVEEEDAQKMPYLEAVVMEGLRRHPPGHFVLPHSVTEDTV 391

Query: 698 PSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGP 519
             G+ V  N  I      +GR   VW E+ M FKPER++     I      K   F AG 
Sbjct: 392 LGGYKVPKNGTINFMVAEIGRDPKVW-EEPMAFKPERFMEEAVDITGSRGIKMMPFGAGK 450

Query: 518 RTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKRK 345
           R C G  +A   ++   A ++  + ++ V+ H +++       +  KH LK   + R+
Sbjct: 451 RICPGIGLAMLHLEYYVANMVREFDWKEVQGHEVDLTEKLEFTVVMKHPLKALAVPRR 508



>gb:AE016959_1021094 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC078944_1541633
           Genomic Sequence for Oryza sativa, Nipponbare strain,
           clone OSJNBa0089D15, from Chromosome 10, complete
           sequence.>gb:AE017061_1750913 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 15 of 77 of the
           complete sequence.
          Length = 501

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 43/143 (30%), Positives = 75/143 (52%), Gaps = 1/143 (0%)
 Frame = -1

Query: 860 KILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPL-NHKNPMEKDILPSGHV 684
           K   ++ Q+   ++  +  E  +L YL A   E+L L PPVPL  H+  M   I+  G+ 
Sbjct: 331 KACDELAQVVGSRRRIEESEIGQLPYLQAVIKETLRLHPPVPLLPHRAKMAMQIM--GYT 388

Query: 683 VTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIG 504
           +   TKI++  +++GR   +W E   +F PER++       R    +   F AG R C G
Sbjct: 389 IPNGTKILINVWAIGRDKNIWTEP-EKFMPERFLDRTIDF-RGGDLELIPFGAGRRICPG 446

Query: 503 RDMAFTVVKMVAATIICHYQFQL 435
             +A  +V +V A+++ H++++L
Sbjct: 447 MPLAIWMVHVVLASLLIHFKWRL 469



>pir|JS0203|JS0203 cytochrome P450 52A1, alkane-inducible - yeast
           (Candida tropicalis)
          Length = 543

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 42/153 (27%), Positives = 69/153 (45%), Gaps = 13/153 (8%)
 Frame = -1

Query: 875 PQVEAKILHDI---LQLKQDKKVFKV--EECQKLTYLHAAFCESLGLFPPVPLNHKNPME 711
           P++ AK+  +I     L QD +V ++  E  +   YL A   E+L ++P VP N +    
Sbjct: 356 PEIFAKLREEIENKFGLGQDARVEEISFETLKSCEYLKAVINETLRIYPSVPHNFRVATR 415

Query: 710 KDILPSGH--------VVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQ 555
              LP G          +     ++    +  R   ++GED   F+PERW  P+    R+
Sbjct: 416 NTTLPRGGGEGGLSPIAIKKGQVVMYTILATHRDKDIYGEDAYVFRPERWFEPE---TRK 472

Query: 554 PSYKFSVFNAGPRTCIGRDMAFTVVKMVAATII 456
             + +  FN GPR C+G+  A T    V   ++
Sbjct: 473 LGWAYVPFNGGPRICLGQQFALTEASYVTVRLL 505



>sp|Q27514|YRV2_CAEEL Putative cytochrome P450 CYP13A5 (EC
           1.14.-.-).>pir|T24778|T24778 hypothetical protein
           T10B9.2 - Caenorhabditis elegans>gb:CET10B9_1367561
           Caenorhabditis elegans cosmid T10B9, complete sequence.
          Length = 520

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 40/146 (27%), Positives = 69/146 (47%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+++ K+  ++ +   + +V   ++  KL Y+     E+L ++P   + H     K+   
Sbjct: 346 PEIQKKLQEEVDRECPNPEV-TFDQISKLKYMECVVKEALRMYPLASIVHNRKCMKETNV 404

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
            G  +   T + +  +++     VWGED  EF+PERW S D     +  Y    F  GPR
Sbjct: 405 LGVQIEKGTNVQVDTWTLHYDPKVWGEDANEFRPERWESGDELFYAKGGY--LPFGMGPR 462

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQ 438
            CIG  +A    KM+   I+  Y F+
Sbjct: 463 ICIGMRLAMMEKKMLLTHILKKYTFE 488



>sp|Q05047|CP72_CATRO Cytochrome P450 72A1 (EC 1.3.3.9) (CYPLXXII)
           (Secologanin synthase) (SLS).>pir|T09944|T09944 probable
           cytochrome P450 protein - Madagascar
           periwinkle>gb:CTRCTP450P_1674242 Catharanthus roseus
           cytochrome P-450 protein (CYP72) mRNA, complete cds.
          Length = 524

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 38/147 (25%), Positives = 72/147 (48%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+ + +   ++LQ     K  + E    L Y+     E L L+PPV ++    + KD   
Sbjct: 352 PEWQERAREEVLQAFGKNKP-EFERLNHLKYVSMILYEVLRLYPPV-IDLTKIVHKDTKL 409

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
             + +   T++++P   + R  ++WGED MEF P R++       +  +  +  F+ GPR
Sbjct: 410 GSYTIPAGTQVMLPTVMLHREKSIWGEDAMEFNPMRFVDGVANATKN-NVTYLPFSWGPR 468

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQL 435
            C+G++ A    K+  A I+  ++F +
Sbjct: 469 VCLGQNFALLQAKLGLAMILQRFKFDV 495



>sp|Q9Y757|CP5L_DEBHA Cytochrome P450 52A12 (EC 1.14.14.-) (Alkane
           hydroxylase 1) (Alkane- inducible p450alk 1)
           (DH-ALK2).>gb:AF103948_1768235 Debaryomyces hansenii
           cytochrome P450 alkane hydroxylase (ALK1) gene, complete
           cds.
          Length = 519

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 39/124 (31%), Positives = 56/124 (45%), Gaps = 8/124 (6%)
 Frame = -1

Query: 806 EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGH--------VVTPNTKIIMPF 651
           E  +K  YL A   E L L+P VP N +   +   LP G          +     +    
Sbjct: 364 ESLKKCEYLKALLNEVLRLYPSVPQNFRVAQKDTSLPRGGGPNRDQPIFIAKGQTVTYTV 423

Query: 650 YSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMV 471
           Y+M R +  +G+D   F+PERW  P+    R+  + F  FN GPR C+G+  A T    V
Sbjct: 424 YAMHRDEQFYGKDSEVFRPERWFEPE---TRKLGWAFLPFNGGPRICLGQQFALTEASYV 480

Query: 470 AATI 459
            A +
Sbjct: 481 IARL 484



>sp|P10615|CP5A_CANTR Cytochrome P450 52A1 (EC 1.14.14.-) (CYPLIIA1)
           (Alkane-inducible P450- ALK1).>gb:YSACYP45AL_1728103
           Candida tropicalis alkane-inducible cytochrome P450
           gene, complete cds.
          Length = 543

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 42/153 (27%), Positives = 69/153 (45%), Gaps = 13/153 (8%)
 Frame = -1

Query: 875 PQVEAKILHDI---LQLKQDKKVFKV--EECQKLTYLHAAFCESLGLFPPVPLNHKNPME 711
           P++ AK+  +I     L QD +V ++  E  +   YL A   E+L ++P VP N +    
Sbjct: 356 PEIFAKLREEIENKFGLGQDARVEEISFETLKSCEYLKAVINETLRIYPSVPHNFRVATR 415

Query: 710 KDILPSGH--------VVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQ 555
              LP G          +     ++    +  R   ++GED   F+PERW  P+    R+
Sbjct: 416 NTTLPRGGGEGGLSPIAIKKGQVVMYTILATHRDKDIYGEDAYVFRPERWFEPE---TRK 472

Query: 554 PSYKFSVFNAGPRTCIGRDMAFTVVKMVAATII 456
             + +  FN GPR C+G+  A T    V   ++
Sbjct: 473 LGWAYVPFNGGPRICLGQQFALTEASYVTVRLL 505



>sp|Q43068|C821_PEA Cytochrome P450 82A1 (EC 1.14.-.-) (CYPLXXXII)
           (Fragment).>gb:PSU29333_1702483 Pisum sativum novel
           wound-inducible cytochrome P450 monooxygenase (CYP82)
           mRNA, partial cds.
          Length = 544

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 37/145 (25%), Positives = 69/145 (47%), Gaps = 1/145 (0%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P V  K+  ++      ++     +  KL YLHA   E+L L+PP P +      +D   
Sbjct: 360 PHVLEKLKEELNTYIGKERCVNESDINKLVYLHAIIKETLRLYPPAPFSSPREFTEDCTI 419

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIK-RQPSYKFSVFNAGP 519
            G+ +   T+++   + + R  +VW  D +EFKPER++S    +  R  +++   F +G 
Sbjct: 420 GGYHIKKGTRLMPNLWKIHRDPSVW-PDPLEFKPERFLSTHKDVDVRGQNFELLPFGSGR 478

Query: 518 RTCIGRDMAFTVVKMVAATIICHYQ 444
           R C G  +   +V  + A  +  ++
Sbjct: 479 RMCAGMSLGLHMVHYILANFLHSFE 503



>sp|O16805|C4D1_DROSI Cytochrome P450 4d1 (EC 1.14.-.-)
           (CYPIVD1).>gb:AF017005_1232875 Drosophila simulans
           cytochrome P450 (CYP4D1) gene, complete cds.
          Length = 512

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 53/179 (29%), Positives = 84/179 (46%), Gaps = 3/179 (1%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKV--EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDI 702
           P+ + K   +I  +  + K   V  E   +L Y+     E+L ++P VPL  +  +E D 
Sbjct: 336 PEAQKKCFEEIRSVVGNDKSTPVSYELLNQLHYVDLCVKETLRMYPSVPLLGRKVLE-DC 394

Query: 701 LPSGHVVTPNTKI-IMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNA 525
             +G ++   T I I P Y +GR + ++ E    FKPER+       K  P Y +  F+A
Sbjct: 395 EINGKLIPAGTNIGISPLY-LGRREELFSEP-NSFKPERFDVVTTAEKLNP-YAYIPFSA 451

Query: 524 GPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
           GPR CIG+  A   +K + A ++ HY+   V       +    +IL  K  L  K  +R
Sbjct: 452 GPRNCIGQKFAMLEIKAIVANVLRHYEVDFVGDSSEPPVLIAELILRTKDPLMFKVRER 510



>gb:AF097664_1767890 Mesembryanthemum crystallinum cinnamate
           4-hydroxylase mRNA, complete cds.
          Length = 546

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 40/153 (26%), Positives = 78/153 (50%), Gaps = 7/153 (4%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPL--NHKNPMEKDI 702
           P+++ KI H+I    + K V +    ++L YL A   E+L L  P+PL   H N  E  +
Sbjct: 363 PEIQKKIRHEIAMKLEGKPVTE-SNLEQLPYLQAVVKETLRLHTPIPLLVPHSNLEEAKL 421

Query: 701 LPSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKR-----QPSYKFS 537
              G+ +  N+K+++  + +   +  W  D  EF+PER++  + G        +  ++F 
Sbjct: 422 --GGYTIPKNSKVVVNAWWLAN-NPEWWRDAEEFRPERFLEEEAGADAAVGGGKVDFRFV 478

Query: 536 VFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQ 438
            F  G R+C G  +A  ++ +V A ++ +++ +
Sbjct: 479 PFGVGRRSCPGIILALPILGLVIAKLVSNFEMK 511



>gb:AB010393_1511073 Yarrowia lipolytica gene for ALK6, complete
           cds.>gb:CR382128_1660417 Yarrowia lipolytica chromosome
           B of strain CLIB99 of Yarrowia lipolytica.
          Length = 526

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 39/129 (30%), Positives = 57/129 (44%), Gaps = 8/129 (6%)
 Frame = -1

Query: 806 EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMP--------F 651
           E  ++  YL     E L L+P VP+N +       LP G     +  I +P         
Sbjct: 368 ESLKRCEYLRYVLNEGLRLYPSVPMNFRVATRDTTLPKGGGPDLDQPIFIPKGGIVVYSV 427

Query: 650 YSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMV 471
           Y   R +  WG+D  EF PERW  P  G +    +++  FN GPR C+G+  A T    V
Sbjct: 428 YHTHRAEEYWGKDTEEFIPERW-DPAEGYQIARGWEYLPFNGGPRICLGQQFALTEAGYV 486

Query: 470 AATIICHYQ 444
            A +   ++
Sbjct: 487 LARLAQEFE 495



>pir|A96673|A96673 probable cytochrome P450 F13O11.25 [imported] -
           Arabidopsis thaliana>gb:AE005173_894147 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC006193_1533542 Arabidopsis thaliana
           chromosome I BAC F13O11 genomic sequence, complete
           sequence.>gb:AY035078_1559850 Arabidopsis thaliana
           putative cytochrome p450 protein (At1g64950) mRNA,
           complete cds.>gb:AY051032_1562508 Arabidopsis thaliana
           putative cytochrome p450 protein (At1g64950) mRNA,
           complete cds.
          Length = 510

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 45/178 (25%), Positives = 80/178 (44%), Gaps = 1/178 (0%)
 Frame = -1

Query: 875 PQVEAKILHDILQLK-QDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDIL 699
           P ++ ++  +I  +  ++    + E+ QK+ YL A   E L   PP      + + +D +
Sbjct: 332 PDIQKRLYEEIKSVVGEEANEVEEEDAQKMPYLEAVVMEGLRRHPPGHFVLPHSVTEDTV 391

Query: 698 PSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGP 519
             G+ V  N  I      +GR   VW E+ M FKPER++     I      K   F AG 
Sbjct: 392 LGGYKVPKNGTINFMVAEIGRDPKVW-EEPMAFKPERFMEEAVDITGSRGIKMMPFGAGR 450

Query: 518 RTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKRK 345
           R C G  +A   ++   A ++  + ++ V+ H +++       +  KH LK   + R+
Sbjct: 451 RICPGIGLAMLHLEYYVANMVREFDWKEVQGHEVDLTEKLEFTVVMKHPLKALAVPRR 508



>pir|S08668|O4CKA4 cytochrome P450 52A4 - yeast (Candida
           maltosa)>gb:CMP450CM2_1648040 Candida maltosa mRNA for
           cytochrome P450cm2.
          Length = 538

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 43/156 (27%), Positives = 69/156 (44%), Gaps = 10/156 (6%)
 Frame = -1

Query: 854 LHDILQLKQDKKVFKV--EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGH-- 687
           +H+    K+D +V ++  E  +   YL A   E+L ++P VP N +       LP G   
Sbjct: 364 IHNRFGAKEDARVEEITFESLKLCEYLKACVNEALRVYPSVPHNFRVATRNTTLPRGGGK 423

Query: 686 ------VVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNA 525
                  +     ++    +  R  +++GED   F+PERW  P+    R+  + +  FN 
Sbjct: 424 DGMSPIAIKKGQNVMYTISATHRDPSIYGEDANVFRPERWFEPE---TRKLGWAYVPFNG 480

Query: 524 GPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHL 417
           GPR C+G+  A T    V   +       L EFH L
Sbjct: 481 GPRICLGQQFALTEASYVTVRL-------LQEFHTL 509



>pir|B40576|B40576 cytochrome P450 ALK3-A - yeast (Candida
           maltosa)>gb:CMALK_1647981 C.maltosa ALK2-A and ALK3-A
           genes for n-alkane inducible cytochrome P-450.
          Length = 538

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 43/156 (27%), Positives = 68/156 (43%), Gaps = 10/156 (6%)
 Frame = -1

Query: 854 LHDILQLKQDKKVFKV--EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGH-- 687
           +H+    K+D +V ++  E  +   YL A   E+L ++P VP N +       LP G   
Sbjct: 364 IHNRFGAKEDARVEEITFESLKLCEYLKACVNEALRVYPSVPHNFRVATRNTTLPRGGGK 423

Query: 686 ------VVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNA 525
                  +     ++    +  R   ++GED   F+PERW  P+    R+  + +  FN 
Sbjct: 424 DGMSPIAIKKGQNVMYTILATHRDPNIYGEDANVFRPERWFEPE---TRKLGWAYVPFNG 480

Query: 524 GPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHL 417
           GPR C+G+  A T    V   +       L EFH L
Sbjct: 481 GPRICLGQQFALTEASYVTVRL-------LQEFHTL 509



>sp|P16141|CP5D_CANMA Cytochrome P450 52A4 (EC 1.14.14.-) (CYPLIIA4)
           (Alkane-inducible P450- ALK3-A) (P450-CM2).
          Length = 537

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 43/156 (27%), Positives = 69/156 (44%), Gaps = 10/156 (6%)
 Frame = -1

Query: 854 LHDILQLKQDKKVFKV--EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGH-- 687
           +H+    K+D +V ++  E  +   YL A   E+L ++P VP N +       LP G   
Sbjct: 363 IHNRFGAKEDARVEEITFESLKLCEYLKACVNEALRVYPSVPHNFRVATRNTTLPRGGGK 422

Query: 686 ------VVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNA 525
                  +     ++    +  R  +++GED   F+PERW  P+    R+  + +  FN 
Sbjct: 423 DGMSPIAIKKGQNVMYTISATHRDPSIYGEDANVFRPERWFEPE---TRKLGWAYVPFNG 479

Query: 524 GPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHL 417
           GPR C+G+  A T    V   +       L EFH L
Sbjct: 480 GPRICLGQQFALTEASYVTVRL-------LQEFHTL 508



>sp|O81972|C822_SOYBN Cytochrome P450 82A2 (EC 1.14.-.-) (P450
           CP4).>pir|T07118|T07118 probable cytochrome P450 CP4 -
           soybean>gb:GMC450CP4_1680415 G.max mRNA for putative
           cytochrome P450, clone CP4.
          Length = 522

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 40/146 (27%), Positives = 74/146 (50%), Gaps = 2/146 (1%)
 Frame = -1

Query: 875 PQVEAKILHDI-LQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDIL 699
           P V  K+  ++ +Q+ +++ + +  +  KLTYL A   E+L L+PP PL+     E+D  
Sbjct: 338 PSVLEKLKAELDIQVGKERYICE-SDLSKLTYLQAVVKETLRLYPPAPLSRPREFEEDCT 396

Query: 698 PSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGI-KRQPSYKFSVFNAG 522
             G+ V   T++I     +     VW    +EFKPER+++ D  I  +   ++   F  G
Sbjct: 397 IGGYTVKKGTRLITNLSKIHTDHNVWSNP-LEFKPERFLTTDKDIDMKGQHFQLLPFGGG 455

Query: 521 PRTCIGRDMAFTVVKMVAATIICHYQ 444
            R C G ++    V++  A+ +  ++
Sbjct: 456 RRICPGINLGLQTVRLTLASFLHSFE 481



>gb:AP005732_1856806 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC
           clone:OSJNBb0014M19.>gb:AP005753_1857215 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OSJNBa0084L05.
          Length = 535

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 42/149 (28%), Positives = 71/149 (47%), Gaps = 1/149 (0%)
 Frame = -1

Query: 806 EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGHVVTPNTKIIMPFYSMGRMDT 627
           +   KLT L     E+L L+PP  L  +   E DI   G  +     + +P  ++   ++
Sbjct: 384 DHLSKLTVLQMIIQETLRLYPPATLLPRMAFE-DIQLGGLRLPRGLSVWIPVLAIHHDES 442

Query: 626 VWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHY 447
           +WG D  EF+PER+           + +F  F AGPR C+G+  A    K+V A ++  +
Sbjct: 443 IWGPDAHEFRPERFAPGARRPSAAGAARFLPFAAGPRNCVGQAYALVEAKVVLAMLLSAF 502

Query: 446 QFQLVE-FHHLEILFTDSMILEKKHGLKV 363
           +F + + + H      + + L  KHG+ V
Sbjct: 503 RFAISDNYRHAP---ENVLTLRPKHGVPV 528



>gb:CR382137_1670370 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 529

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 38/135 (28%), Positives = 61/135 (45%), Gaps = 10/135 (7%)
 Frame = -1

Query: 830 QDKKVFKV--EECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSGH--------VV 681
           +D +V ++  E  +K  +L     E L ++P VP N +  +    LP G          V
Sbjct: 364 EDSRVDEITFESLKKCEFLKCVLNEILRMYPSVPQNFRFAIRNTTLPKGGGPDGKSPIFV 423

Query: 680 TPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGR 501
           +    +    YS  R    +G+D  EF+P RW+ P+    R+  + F  FN GPR C+G+
Sbjct: 424 SKGKNLFYSMYSAHRNPKYYGKDAEEFRPSRWLEPE---IRKVGWAFLPFNGGPRICLGQ 480

Query: 500 DMAFTVVKMVAATII 456
             A T    +   +I
Sbjct: 481 QFALTGASYIVVRLI 495



>gb:AY230501_1591460 Candida tropicalis CYP52A15 (CYP52A15) gene,
           complete cds.
          Length = 540

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 47/168 (27%), Positives = 75/168 (44%), Gaps = 13/168 (7%)
 Frame = -1

Query: 875 PQVEAKILHDI---LQLKQDKKVFKV--EECQKLTYLHAAFCESLGLFPPVPLNHKNPME 711
           P+V AK+  ++     L ++ +V ++  E  +   YL A   E+L L+P VP N +    
Sbjct: 356 PEVFAKLREEVENRFGLGEEARVEEISFESLKSCEYLKAVINETLRLYPSVPHNFRVATR 415

Query: 710 KDILPSGH--------VVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQ 555
              LP G         VV     ++    +  R  +++G D   F+PERW  P+    R+
Sbjct: 416 NTTLPRGGGEDGYSPIVVKKGQVVMYTVIATHRDPSIYGADADVFRPERWFEPE---TRK 472

Query: 554 PSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQLVEFHHLEI 411
             + +  FN GPR C+G+  A T    V   +       L EF HL +
Sbjct: 473 LGWAYVPFNGGPRICLGQQFALTEASYVTVRL-------LQEFAHLSM 513



>gb:AF355145_1264968 Musca domestica cytochrome P450 CYP4G13v2 mRNA,
           complete cds.
          Length = 552

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 43/150 (28%), Positives = 76/150 (50%), Gaps = 1/150 (0%)
 Frame = -1

Query: 794 KLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSG-HVVTPNTKIIMPFYSMGRMDTVWG 618
           +++YL    CE+  LFPPVPL  +   E   L SG + +   T +++  Y + R   ++ 
Sbjct: 402 QMSYLERVICETQRLFPPVPLIARKAEEDVNLKSGPYTIAKGTTVVLLQYFVHRRADIY- 460

Query: 617 EDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTCIGRDMAFTVVKMVAATIICHYQFQ 438
            D  +F P+ ++ P+    R   Y +  F+AGPR+C+GR  A   +K++ +TII +Y+  
Sbjct: 461 PDPEKFNPDNFL-PERTANRH-YYAYIPFSAGPRSCVGRKFAMLQLKVLLSTIIRNYRVS 518

Query: 437 LVEFHHLEILFTDSMILEKKHGLKVKFIKR 348
                  +      +IL+  +G  +   KR
Sbjct: 519 STRTQK-DFQLQGDIILKMANGFNITLEKR 547



>pir|E86249|E86249 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_890171 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F25C20_1678068 Arabidopsis thaliana
           chromosome 1 BAC F25C20 sequence, complete sequence.
          Length = 477

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 37/148 (25%), Positives = 73/148 (49%), Gaps = 1/148 (0%)
 Frame = -1

Query: 875 PQVEAKILHDILQ-LKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDIL 699
           P+   K+ ++I   ++      K +E + + YL A   E   + PP+PL     + +D+ 
Sbjct: 298 PECMKKLQNEIRSTIRPHGSYIKEKEVENMRYLKAVIKEVFRVHPPLPLILPRLLTEDVK 357

Query: 698 PSGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGP 519
             G+ +   T++++  +S+ R   +WG D  EFKPER +        Q   K+  F +G 
Sbjct: 358 VKGYDIAAGTEVLINAWSIHRDPAIWGPDAEEFKPERHLDSTLDYHGQ-DLKYIPFGSGR 416

Query: 518 RTCIGRDMAFTVVKMVAATIICHYQFQL 435
           R C G ++A  +V++  A ++  + + +
Sbjct: 417 RICPGINLAMGLVEVTLANLVGRFDWSV 444



>sp|O42563|CP3R_ONCMY Cytochrome P450 3A27 (EC 1.14.14.1)
           (CYPIIIA27).>gb:OMU96077_2576976 Oncorhynchus mykiss
           cytochrome P450 3A27 (CYP3A27) mRNA, complete cds.
          Length = 518

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 45/175 (25%), Positives = 84/175 (48%)
 Frame = -1

Query: 869 VEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILPSG 690
           V  K+  +I  +  +K   + E   ++ YL     ESL L+P  P   +   +K +  +G
Sbjct: 332 VMTKLQEEIDTVFPNKAPIQYEALMQMDYLDCVLNESLRLYPIAP-RLERVAKKTVEING 390

Query: 689 HVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPRTC 510
            V+  +  +++P +++ R   +W  D  EFKPER+ S +      P Y +  F AGPR C
Sbjct: 391 IVIPKDCIVLVPTWTLHRDPEIWS-DPEEFKPERF-SKENKESIDP-YTYMPFGAGPRNC 447

Query: 509 IGRDMAFTVVKMVAATIICHYQFQLVEFHHLEILFTDSMILEKKHGLKVKFIKRK 345
           IG   A  ++K+    I+  + F + +   + +   +  +L  K  +K++   R+
Sbjct: 448 IGMRFALIMIKLAMVEILQSFTFSVCDETEIPLEMDNQGLLMPKRPIKLRLEARR 502



>sp|Q9STK8|C71P_ARATH Cytochrome P450 71A25 (EC
           1.14.-.-).>pir|T06714|T06714 probable cytochrome P450
           T29H11.200 - Arabidopsis thaliana>gb:ATT29H11_1555640
           Arabidopsis thaliana DNA chromosome 3, BAC clone T29H11.
          Length = 490

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 37/149 (24%), Positives = 73/149 (48%)
 Frame = -1

Query: 875 PQVEAKILHDILQLKQDKKVFKVEECQKLTYLHAAFCESLGLFPPVPLNHKNPMEKDILP 696
           P+   ++  ++  + + K     ++ Q + YL A   E+L L PP P+   +   +D+  
Sbjct: 311 PKSLNRLQEEVRTICKGKSRVSEDDIQGMKYLKAVIKEALRLHPPFPMMAPHESTEDVKL 370

Query: 695 SGHVVTPNTKIIMPFYSMGRMDTVWGEDCMEFKPERWISPDGGIKRQPSYKFSVFNAGPR 516
             + +   T+++M  +++GR    WG D  EFKPER +      + Q +++   F AG R
Sbjct: 371 RDYHIPAGTQVMMNAWAIGREVATWGPDAEEFKPERHLDTSVDFRGQ-NFELLPFGAGRR 429

Query: 515 TCIGRDMAFTVVKMVAATIICHYQFQLVE 429
            C     A  + ++V A ++  + ++L E
Sbjct: 430 ICPAVSFAVVLNEVVLANLVHGFDWKLPE 458


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 903,980,205
Number of Sequences: 1806583
Number of extensions: 19771841
Number of successful extensions: 46620
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 44181
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 45615
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 60430988688
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)