BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10387
         (938 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB026639_1517092 Arabidopsis thaliana genomic DNA, chromosome...    94   4e-18   
gb:AC096688_1736254 Oryza sativa chromosome 3 BAC OSJNBa0015N08 ...    74   3e-12   
gb:AE017317_440737 Desulfovibrio vulgaris subsp. vulgaris str. H...    34   3.6     


>gb:AB026639_1517092 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K21L13.>gb:AY086493_1571541 Arabidopsis
           thaliana clone 25419 mRNA, complete
           sequence.>gb:BT006394_1639281 Arabidopsis thaliana
           At5g65660 gene, complete cds.
          Length = 136

 Score = 94.0 bits (232), Expect = 4e-18
 Identities = 41/47 (87%), Positives = 46/47 (97%)
 Frame = -3

Query: 780 APPHVDASRPSLGFPLGTALLLIVIFTLSGVFSCCYHWDKLRSLRRS 640
           +PPH+DASRPSLGFPLGTALLLI+IF+LSG+FSCCYHWDK RSLRRS
Sbjct: 8   SPPHMDASRPSLGFPLGTALLLIIIFSLSGIFSCCYHWDKHRSLRRS 54



 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 22/42 (52%), Positives = 36/42 (85%)
 Frame = -1

Query: 479 DLKQNQSLTLPVVMPGEHVPRFLALPCPCQPRREERIVVEVQ 354
           ++K+ Q+L++PV+MPG++ P+F+ALPCPC P R E++ V+VQ
Sbjct: 77  EMKKPQNLSVPVLMPGDNTPKFIALPCPCAPPRPEKLTVDVQ 118



>gb:AC096688_1736254 Oryza sativa chromosome 3 BAC OSJNBa0015N08
           genomic sequence, complete sequence.
          Length = 740

 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 31/41 (75%), Positives = 37/41 (90%)
 Frame = -3

Query: 774 PHVDASRPSLGFPLGTALLLIVIFTLSGVFSCCYHWDKLRS 652
           P   +SRP+LGFPLGTALL+ VIF+LSG+FSCCYHWDKLR+
Sbjct: 4   PMAHSSRPTLGFPLGTALLIFVIFSLSGIFSCCYHWDKLRA 44



 Score = 39.7 bits (91), Expect = 0.086
 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 3/36 (8%)
 Frame = -1

Query: 473 KQNQSLTLPVVMPGEHVPRFLALPCP---CQPRREE 375
           K  +   LPV+MPG+ +P+F A PCP   C P  EE
Sbjct: 79  KAEKECGLPVIMPGDRIPKFFARPCPHEKCLPAAEE 114



>gb:AE017317_440737 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 9 of 12 of the complete
           genome.>gb:AE017285_1073898 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 462

 Score = 34.3 bits (77), Expect = 3.6
 Identities = 18/50 (36%), Positives = 25/50 (50%)
 Frame = +1

Query: 553 LYRRGNCYRLCEYRLAGPIITVGGRAVGERPTEGSELVPVVTAGEYAAQG 702
           L R+G C +LC   LA  ++   GR +G R   G  L  V+T  +Y   G
Sbjct: 225 LLRKGFCGQLCPVGLASSLLEKAGRRLGIRRQPGPRLARVLTLPKYIVLG 274


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 875,540,665
Number of Sequences: 1806583
Number of extensions: 16862328
Number of successful extensions: 45541
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 43565
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 45530
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 67285516404
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)