BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10323
         (1023 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:ATAC009853_1543048 Arabidopsis thaliana chromosome III BAC F2...   246   4e-76   
gb:LJRAB11G_1685017 L.japonicus mRNA for small GTP-binding prote...   243   4e-75   
pir|T06443|T06443 GTP-binding protein - garden pea>gb:PEAGTPBP01...   239   4e-75   Pisum sativum [garden pea]
gb:GMGMR2_1680464 G.max gmr2 gene.                                    239   4e-74   
gb:TOBNTRAE_1725465 Nicotiana tabacum SR1 Nt-rab11e mRNA, 3' end.     238   5e-74   
pir|T03626|T03626 GTP-binding protein Rab11e - common tobacco (f...   238   5e-74   Nicotiana tabacum [American tobacco]
pir|S52646|S52646 GTP-binding protein gmr2 - soybean                  234   7e-73   Glycine max [soybeans]
sp|P28187|ARA4_ARATH|ARA4_ARATH Ras-related protein ARA-4.>pir|JS0641|JS064...   243   2e-72   Arabidopsis thaliana [mouse-ear cress]
gb:BT006190_1639082 Arabidopsis thaliana clone C00163 (i) putati...   243   2e-71   
sp|P19892|ARA1_ARATH|ARA1_ARATH Ras-related protein ARA-1.>pir|JS0163|JS016...   243   2e-71   Arabidopsis thaliana [mouse-ear cress]
gb:AY063847_1565795 Arabidopsis thaliana putative RAS-related pr...   241   4e-71   
gb:AP003888_1834876 Oryza sativa (japonica cultivar-group) genom...   235   5e-71   
pir|G84723|G84723 probable RAS type GTP-binding protein [importe...   240   3e-70   Arabidopsis thaliana [mouse-ear cress]
gb:AY085494_1570563 Arabidopsis thaliana clone 15416 mRNA, compl...   233   3e-68   
pir|S52024|S52024 GTP-binding protein bra - rape>gb:BNANAPZ_1633...   234   3e-66   Brassica napus [oilseed rape]
gb:AB025628_1516508 Arabidopsis thaliana genomic DNA, chromosome...   214   3e-55   
gb:LJRAB11J_1685020 L.japonicus mRNA for small GTP-binding prote...   214   2e-54   
gb:VFGNRPR4_1727141 V.faba mRNA for guanine nucleotide regulator...   213   4e-54   
gb:AF165095_1773721 Gossypium hirsutum Rab GTP-binding protein R...   211   1e-53   
pir|S41432|S41432 GTP-binding protein, ras-like (clone vfa-yptx)...   211   2e-53   Vicia faba [broad bean]
gb:AP004334_1840388 Oryza sativa (japonica cultivar-group) genom...   209   4e-53   
gb:MCU87143_1685893 Mesembryanthemum crystallinum Nt-rab11e homo...   169   2e-52   
pir|T12580|T12580 GTP-binding protein Rab11e - common ice plant ...   169   2e-52   Mesembryanthemum crystallinum
gb:AC092852_1735758 Oryza sativa chromosome 3 BAC OSJNBa0032G11 ...   206   6e-52   
sp|Q39572|YPT6_CHLRE|YPT6_CHLRE Ras-related protein YPTC6.>pir|JC4108|JC410...   206   8e-52   Chlamydomonas reinhardtii
gb:AF165096_1773722 Gossypium hirsutum Rab GTP-binding protein R...   205   1e-51   
gb:AP005811_1858284 Oryza sativa (japonica cultivar-group) genom...   203   4e-51   
gb:GMU58853_1680707 Glycine max small GTP-binding protein (sra1)...   203   4e-51   
gb:AE014297_1140590 Drosophila melanogaster chromosome 3R, compl...   203   4e-51   
pir|T07059|T07059 GTP-binding protein sra1 - soybean (fragment)       203   4e-51   Glycine max [soybeans]
gb:BC085585_2564483 Danio rerio zgc:103679, mRNA (cDNA clone MGC...   202   7e-51   
gb:AY690483_1622462 Triticum aestivum rab GTP-binding protein mR...   201   1e-50   
gb:BT001785_1356558 Drosophila melanogaster RH21315 full insert ...   201   1e-50   
gb:AY588075_1339434 Homalodisca coagulata putative rab11 mRNA, c...   201   1e-50   
gb:AJ720402_2502589 Gallus gallus mRNA for hypothetical protein,...   201   2e-50   
gb:BT007615_2150547 Synthetic construct Homo sapiens RAB11A, mem...   201   2e-50   
gb:AF127669_2055549 Mus musculus small GTPase (Rab11a) gene, com...   201   2e-50   
gb:CR541691_1993921 Homo sapiens full open reading frame cDNA cl...   201   2e-50   
gb:ATU46926_1557029 Arabidopsis thaliana GTP-binding protein ATG...   201   2e-50   
gb:AX885919_1481372 Sequence 1782 from Patent EP1033401.              201   2e-50   
sp|P46638|R11B_MOUSE|R11B_MOUSE Ras-related protein Rab-11B.>pir|A55005|A55...   201   2e-50   Mus musculus [mouse]
sp|Q15907|R11B_HUMAN|R11B_HUMAN Ras-related protein Rab-11B (GTP-binding pr...   201   2e-50   Homo sapiens [man]
sp|P24410|R11A_HUMAN|R11A_HUMAN Ras-related protein Rab-11A (Rab-11) (24KG)...   201   2e-50   Homo sapiens [man]
gb:BC082421_2562657 Xenopus laevis hypothetical LOC494642, mRNA ...   201   3e-50   
gb:BT019535_1991117 Homo sapiens RAB11B, member RAS oncogene fam...   201   3e-50   
gb:VFGNRPR2_1727139 V.faba mRNA for guanine nucleotide regulator...   201   3e-50   
gb:AY220456_1310447 Limulus polyphemus rab11-2 mRNA, complete cds.    201   3e-50   
pir|T12097|T12097 GTP-binding protein, ras-like (clone vfa-ypt3a...   201   3e-50   Vicia faba [broad bean]
pir|T06447|T06447 GTP-binding protein - garden pea>gb:PEAGTPBP05...   201   3e-50   Pisum sativum [garden pea]
sp|Q40521|R11B_TOBAC|R11B_TOBAC Ras-related protein Rab11B.>pir|T03620|T036...   201   3e-50   Nicotiana tabacum [American tobacco]
sp|P22129|R11B_DISOM|R11B_DISOM Ras-related protein Rab-11B (ORA3).>pir|C38...   201   3e-50   
gb:BC081187_2562088 Xenopus laevis MGC84419 protein, mRNA (cDNA ...   200   3e-50   
gb:AC124143_1740431 Oryza sativa (japonica cultivar-group) chrom...   200   3e-50   
gb:AC010155_1536914 Genomic sequence for Arabidopsis thaliana BA...   200   3e-50   
gb:AY220749_1310454 Limulus polyphemus Rab11-1a mRNA, complete c...   200   3e-50   
gb:AY220748_1310453 Limulus polyphemus Rab11-1c mRNA, complete cds.   200   3e-50   
sp|Q40191|R11A_LOTJA|R11A_LOTJA Ras-related protein Rab11A.>gb:LJRAB11A_168...   200   3e-50   Lotus japonicus
gb:CR536494_1993789 Homo sapiens full open reading frame cDNA cl...   200   4e-50   
gb:GMGMR1_1680463 G.max gmr1 gene.                                    158   5e-50   
gb:BC087498_2565337 Xenopus laevis hypothetical LOC496163, mRNA ...   199   6e-50   
gb:BC075268_2558374 Xenopus tropicalis MGC88884 protein, mRNA (c...   199   6e-50   
gb:BC048889_2550064 Danio rerio zgc:55760, mRNA (cDNA clone MGC:...   199   6e-50   
gb:AF327517_1786804 Oryza sativa GTP-binding protein mRNA, compl...   199   6e-50   
sp|P40393|RIC2_ORYSA|RIC2_ORYSA Ras-related protein RIC2.>pir|S38741|S38741...   199   6e-50   Oryza sativa [red rice]
sp|O35509|R11B_RAT|R11B_RAT Ras-related protein Rab-11B.>gb:D01046_211211...   199   6e-50   Rattus norvegicus [brown rat]
gb:BC076247_2559115 Danio rerio zgc:92772, mRNA (cDNA clone MGC:...   199   7e-50   
gb:BC041250_2547885 Xenopus laevis RAB11B, member RAS oncogene f...   199   7e-50   
gb:AB015472_1512535 Arabidopsis thaliana genomic DNA, chromosome...   199   7e-50   
pir|JC2487|JC2487 GTP-binding protein H-YPT3 - human>gb:HSYPT31_...   199   7e-50   Homo sapiens [man]
gb:AC069472_1540865 Arabidopsis thaliana chromosome 3 BAC F28J15...   199   1e-49   
pir|T04539|T04539 GTP-binding protein F28J12.90 - Arabidopsis th...   199   1e-49   Arabidopsis thaliana [mouse-ear cress]
gb:AC130603_1740794 Oryza sativa (japonica cultivar-group) chrom...   198   1e-49   
gb:AY632359_1618689 Gossypium hirsutum BAC 155C17, complete sequ...   198   2e-49   
pir|T29035|T29035 hypothetical protein F53G12.1 - Caenorhabditis...   198   2e-49   Caenorhabditis elegans [roundworm]
gb:AF532625_1809427 Glycine max GTP-binding protein mRNA, comple...   197   2e-49   
gb:AY327044_1599685 Oryza sativa (japonica cultivar-group) GTP-b...   197   2e-49   
gb:AP003760_1833061 Oryza sativa (japonica cultivar-group) genom...   197   3e-49   
gb:AY632360_1618702 Gossypium hirsutum BAC 106I22, complete sequ...   197   3e-49   
gb:AY088624_1573640 Arabidopsis thaliana clone 8545 mRNA, comple...   197   3e-49   
pir|T06105|T06105 GTP-binding protein GB3 - Arabidopsis thaliana...   197   3e-49   Arabidopsis thaliana [mouse-ear cress]
gb:AP006727_1862708 Oryza sativa (japonica cultivar-group) genom...   197   4e-49   
pir|S41431|S41431 GTP-binding protein, ras-like - fava bean>gb:P...   197   4e-49   Pisum sativum [garden pea]
sp|P28185|ARA2_ARATH|ARA2_ARATH Ras-related protein ARA-2.>pir|JS0639|JS063...   196   5e-49   Arabidopsis thaliana [mouse-ear cress]
gb:NCB9G16_1690434 Neurospora crassa DNA linkage group II BAC cl...   196   6e-49   
gb:AY297922_1317124 Toxoplasma gondii Rab11 (rab11) mRNA, comple...   196   6e-49   
pir|T06445|T06445 GTP-binding protein - garden pea>gb:PEAGTPBP03...   196   6e-49   Pisum sativum [garden pea]
sp|O04486|RB1C_ARATH|RB1C_ARATH Ras-related protein Rab11C.>pir|A86230|A862...   196   6e-49   Arabidopsis thaliana [mouse-ear cress]
sp|Q39222|RB1B_ARATH|RB1B_ARATH Ras-related protein Rab11.>pir|S59942|S5994...   196   6e-49   Arabidopsis thaliana [mouse-ear cress]
gb:LJRAB11H_1685018 L.japonicus mRNA for small GTP-binding prote...   196   8e-49   
pir|S52647|S52647 GTP-binding protein gmr1 - soybean (fragment)       154   9e-49   Glycine max [soybeans]
gb:BC055141_2551229 Danio rerio zgc:63565, mRNA (cDNA clone MGC:...   195   1e-48   
gb:AY086881_1571922 Arabidopsis thaliana clone 2904 mRNA, comple...   195   1e-48   
gb:AB024025_1515706 Arabidopsis thaliana genomic DNA, chromosome...   195   1e-48   
gb:BT005565_1638505 Arabidopsis thaliana clone U51331 putative R...   195   1e-48   
gb:AC084818_1733864 Oryza sativa (japonica cultivar-group) chrom...   194   2e-48   
sp|Q40195|R11E_LOTJA|R11E_LOTJA Ras-related protein Rab11E.>gb:LJRAB11E_168...   194   2e-48   Lotus japonicus
gb:AB013395_1512175 Arabidopsis thaliana genomic DNA, chromosome...   194   2e-48   
sp|Q40522|R11D_TOBAC|R11D_TOBAC Ras-related protein Rab11D.>pir|T03622|T036...   194   2e-48   Nicotiana tabacum [American tobacco]
sp|Q40193|R11C_LOTJA|R11C_LOTJA Ras-related protein Rab11C.>gb:LJRAB11C_168...   194   2e-48   Lotus japonicus
pir|F84750|F84750 probable GTP-binding protein [imported] - Arab...   193   4e-48   Arabidopsis thaliana [mouse-ear cress]
pir|T04872|T04872 GTP-binding protein F28A21.210 - Arabidopsis t...   193   4e-48   Arabidopsis thaliana [mouse-ear cress]
gb:AC093018_1735827 Oryza sativa chromosome 3 BAC OSJNBb0081B07 ...   193   5e-48   
gb:AB016890_1513205 Arabidopsis thaliana genomic DNA, chromosome...   193   5e-48   
gb:MIRABX_1686474 M.indica mRNA for small GTPase.                     192   7e-48   
gb:LES245570_1684504 Lycopersicon esculentum mRNA for Rab11 GTPa...   192   7e-48   
gb:AY585939_1616346 Paxillus involutus strain ATCC 200175 GTPase...   192   7e-48   
sp|Q39434|RAB2_BETVU|RAB2_BETVU Ras-related protein Rab2BV.>pir|T14566|T145...   192   7e-48   Beta vulgaris [beet]
sp|Q96283|RB1A_ARATH|RB1A_ARATH Ras-related protein Rab11A.>pir|T12965|T129...   192   9e-48   Arabidopsis thaliana [mouse-ear cress]
gb:AB012245_1511777 Arabidopsis thaliana genomic DNA, chromosome...   192   1e-47   
sp|P17610|YPT3_SCHPO|YPT3_SCHPO Ras-related protein ypt3 (RAB).>pir|S10026|...   192   1e-47   Schizosaccharomyces pombe
sp|Q40194|R11D_LOTJA|R11D_LOTJA Ras-related protein Rab11D.>gb:LJRAB11D_168...   192   1e-47   Lotus japonicus
gb:AF532626_1809428 Glycine max small GTP-binding protein mRNA, ...   191   2e-47   
pir|T06448|T06448 GTP-binding protein - garden pea>gb:PEAGTPBP07...   191   2e-47   Pisum sativum [garden pea]
sp|Q01111|YPT3_NICPL|YPT3_NICPL Ras-related protein YPT3.>pir|S23523|S23523...   191   2e-47   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb:AC069473_1540884 Arabidopsis thaliana chromosome 3 BAC T21B14...   191   3e-47   
gb:AY099331_1298683 Periplaneta americana Rab11 mRNA, partial cds.    190   3e-47   
gb:AB197058_1203137 Entamoeba histolytica gene for small GTPase ...   190   3e-47   
gb:AC130609_1740863 Oryza sativa (japonica cultivar-group) chrom...   190   4e-47   
pir|T06446|T06446 GTP-binding protein - garden pea>gb:PEAGTPBP04...   190   4e-47   Pisum sativum [garden pea]
gb:AP004127_1838035 Oryza sativa (japonica cultivar-group) genom...   189   6e-47   
gb:AE016818_1748577 Ashbya gossypii (= Eremothecium gossypii) AT...   189   6e-47   
sp|Q40520|R11C_TOBAC|R11C_TOBAC Ras-related protein Rab11C.>pir|T03613|T036...   189   8e-47   Nicotiana tabacum [American tobacco]
sp|Q40723|RGP2_ORYSA|RGP2_ORYSA Ras-related protein RGP2 (GTP-binding regul...   189   1e-46   Oryza sativa [red rice]
sp|P36412|RB11_DICDI|RB11_DICDI Ras-related protein Rab11.>gb:DDU02925_1377...   189   1e-46   Dictyostelium discoideum
gb:AY585953_1616360 Paxillus involutus strain Maj GTPase (rab) g...   188   2e-46   
sp|Q40523|R11A_TOBAC|R11A_TOBAC Ras-related protein Rab11A.>pir|T03625|T036...   188   2e-46   Nicotiana tabacum [American tobacco]
gb:BC086715_2564932 Danio rerio zgc:101648, mRNA (cDNA clone MGC...   187   2e-46   
gb:PEAGTPBP02_1699684 Pisum sativum mRNA for GTP-binding protein...   187   2e-46   
gb:CR382130_1662909 Yarrowia lipolytica chromosome D of strain C...   187   2e-46   
gb:AY084274_1569366 Arabidopsis thaliana clone 102017 mRNA, comp...   187   2e-46   
gb:AB007911_1510331 Pisum sativum gene for PRA2, complete cds.        187   2e-46   
gb:AB054587_1196630 Entamoeba histolytica EhRab11B mRNA for smal...   187   2e-46   
pir|T06444|T06444 GTP-binding protein - garden pea (fragment)         187   2e-46   Pisum sativum [garden pea]
gb:CR382134_1667106 Debaryomyces hansenii chromosome B of strain...   187   3e-46   
gb:CR380957_1652917 Candida glabrata strain CBS138 chromosome K ...   187   3e-46   
gb:PFMAL13_1191281 Plasmodium falciparum 3D7 chromosome 13, *** ...   187   3e-46   
sp|P25766|RGP1_ORYSA|RGP1_ORYSA Ras-related protein RGP1 (GTP-binding regul...   186   5e-46   Oryza sativa [red rice]
gb:CR380949_1649515 Candida glabrata strain CBS138 chromosome C ...   186   6e-46   
gb:LJRAB11B_1685012 L.japonicus mRNA for small GTP-binding prote...   186   8e-46   
gb:AY585950_1616357 Paxillus involutus strain ATCC 200175 GTPase...   186   8e-46   
sp|P51996|YP32_YEAST|YP32_YEAST GTP-binding protein YPT32/YPT11.>pir|S58514...   186   8e-46   Saccharomyces cerevisiae [brewer's yeast]
gb:BC080339_2561656 Xenopus tropicalis rab25-prov protein, mRNA ...   185   1e-45   
gb:AF030183_1234434 Entamoeba histolytica GTP-binding protein (R...   185   1e-45   
gb:AB186370_1202818 Entamoeba histolytica EhRAB11A gene for EhRa...   185   1e-45   
gb:AE005172_891741 Arabidopsis thaliana chromosome 1, top arm co...   184   2e-45   
sp|P38555|YP31_YEAST|YP31_YEAST GTP-binding protein YPT31/YPT8.>pir|S42679|...   184   2e-45   Saccharomyces cerevisiae [brewer's yeast]
gb:AP003614_1831397 Oryza sativa (japonica cultivar-group) genom...   183   4e-45   
gb:FSGTP1_1679276 F.sylvatica mRNA for GTP1 protein.                  183   5e-45   
pir|T03636|T03636 GTP-binding protein mgp1 - maize>gb:MZEMGP1_16...   183   5e-45   Zea mays [maize]
pir|D96763|D96763 hypothetical protein F25P22.5 [imported] - Ara...   182   7e-45   Arabidopsis thaliana [mouse-ear cress]
gb:BC074344_2557855 Xenopus laevis MGC84182 protein, mRNA (cDNA ...   181   2e-44   
pir|A86209|A86209 protein F22G5.24 [imported] - Arabidopsis thal...   181   3e-44   Arabidopsis thaliana [mouse-ear cress]
gb:AF119675_2055308 Mus musculus small GTP-binding protein RAB25...   180   5e-44   
gb:AF274025_1894209 Homo sapiens GTP-binding protein Rab25 mRNA,...   180   5e-44   
gb:AF083124_1881603 Homo sapiens CATX-8 mRNA, complete cds.           180   5e-44   
gb:AP005681_1855910 Oryza sativa (japonica cultivar-group) genom...   180   5e-44   
sp|P46629|RB25_RABIT|RB25_RABIT Ras-related protein Rab-25.>pir|A48500|A485...   180   5e-44   Oryctolagus cuniculus [domestic rabbit]
sp|Q9WTL2|RB25_MOUSE|RB25_MOUSE Ras-related protein Rab-25.>gb:AK003260_115...   180   5e-44   Mus musculus [mouse]
sp|P57735|RB25_HUMAN|RB25_HUMAN Ras-related protein Rab-25 (CATX-8).>gb:AL3...   180   5e-44   Homo sapiens [man]
pir|B86142|B86142 protein probable GTP-binding protein [imported...   178   1e-43   Arabidopsis thaliana [mouse-ear cress]
gb:T10F20_1723324 Sequence of BAC T10F20 from Arabidopsis thalia...   177   3e-43   
gb:CEU68258_1368630 Caenorhabditis elegans rab11-like mRNA, part...   175   1e-42   
gb:AB054588_1196631 Entamoeba histolytica EhRab11C mRNA for smal...   175   1e-42   
gb:AC117075_1207790 Dictyostelium discoideum chromosome 2 map 52...   174   3e-42   
gb:AE017345_1756792 Cryptococcus neoformans var. neoformans JEC2...   172   7e-42   
gb:AJ697970_1813433 Medicago sativa rab11f gene for small GTPase.     171   2e-41   
pir|S45023|S45023 GTP-binding protein Rab - alfalfa>gb:MSRAB_168...   171   2e-41   Medicago sativa [alfalfa]
pir|T03637|T03637 GTP-binding protein mgp2 - maize>gb:MZEMGP2_16...   171   2e-41   Zea mays [maize]
gb:AF152531_1245603 Trypanosoma brucei small GTPase Rab11 (Rab11...   168   1e-40   
gb:SCRASX_1709324 Yeast YP2 gene The YP2 protein shows homology ...   167   3e-40   
gb:CR857602_1181826 Pongo pygmaeus mRNA; cDNA DKFZp469D1215 (fro...   167   3e-40   
sp|P01123|YPT1_YEAST|YPT1_YEAST GTP-binding protein YPT1 (Protein YP2).>pir...   167   3e-40   Saccharomyces cerevisiae [brewer's yeast]
sp|P61028|RB8B_MOUSE|RB8B_MOUSE Ras-related protein Rab-8B.>sp|P70550|RB8B_...   167   3e-40   Mus musculus [mouse]
gb:AJ634908_1813314 Cucumis sativus partial mRNA for putative Ra...   167   4e-40   
gb:AB112929_1200243 Caenorhabditis elegans rab8 mRNA for Rab8, c...   167   4e-40   
pir|T33855|T33855 hypothetical protein D1037.4 - Caenorhabditis ...   167   4e-40   Caenorhabditis elegans [roundworm]
gb:GMU58854_1680708 Glycine max small GTP-binding protein (sra2)...   166   5e-40   
gb:AY223134_1176598 Schistosoma japonicum clone ZZD1452 mRNA seq...   166   5e-40   
pir|T33781|T33781 hypothetical protein C39F7.4 - Caenorhabditis ...   166   5e-40   Caenorhabditis elegans [roundworm]
sp|P16976|YPT1_MAIZE|YPT1_MAIZE GTP-binding protein YPTM1.>pir|A38202|A3820...   166   5e-40   Zea mays [maize]
gb:KLA249367_1683512 Kluyveromyces lactis ypt1 gene.                  166   9e-40   
gb:AF461435_1273271 Babesia gibsoni small GTP binding protein ra...   166   9e-40   
gb:CR380957_1653056 Candida glabrata strain CBS138 chromosome K ...   165   1e-39   
pir|S41430|S41430 GTP-binding protein, ras-like (clone vfa-ypt1)...   165   1e-39   Pisum sativum [garden pea]
sp|Q92930|RB8B_HUMAN|RB8B_HUMAN Ras-related protein Rab-8B.>gb:HSM804678_11...   165   1e-39   Homo sapiens [man]
gb:BC078493_2561034 Xenopus laevis MGC85265 protein, mRNA (cDNA ...   164   2e-39   
gb:BC078133_2560769 Xenopus laevis RAB8B, member RAS oncogene fa...   164   2e-39   
gb:AP003443_1829474 Oryza sativa (japonica cultivar-group) genom...   164   2e-39   
gb:PEAGTPBP08_1699690 Pisum sativum mRNA for GTP-binding protein...   164   2e-39   
gb:NP43GTP_1691039 N.plumbaginifolia mRNA for small GTP-binding ...   164   3e-39   
gb:SLU38464_1715387 Solanum lycopersicum small GTP-binding prote...   164   3e-39   
gb:LJRAB11F_1685016 L.japonicus mRNA for small GTP-binding prote...   164   3e-39   
sp|P40392|RIC1_ORYSA|RIC1_ORYSA Ras-related protein RIC1.>pir|S38740|S38740...   164   3e-39   Oryza sativa [red rice]
gb:BC047816_2549902 Danio rerio zgc:56049, mRNA (cDNA clone MGC:...   163   4e-39   
pir|S72515|S72515 GTP-binding protein RAB1 - garden petunia>gb:P...   163   4e-39   Petunia x hybrida [garden petunia]
sp|P22128|RAB8_DISOM|RAB8_DISOM Ras-related protein Rab-8 (ORA2).>gb:DYGORA...   163   4e-39   
gb:AL772154_2504473 Zebrafish DNA sequence from clone CH211-101N...   163   6e-39   
gb:LJRAB1E_1685025 L.japonicus mRNA for small GTP-binding protei...   163   6e-39   
gb:BC045014_2548971 Xenopus laevis RAB1, member RAS oncogene fam...   162   8e-39   
gb:LJRAB1D_1685024 L.japonicus mRNA for small GTP-binding protei...   162   8e-39   
gb:AY060495_1564804 Arabidopsis thaliana AT4g17530/dl4800c mRNA,...   162   8e-39   
gb:ATCHRIV46_1545555 Arabidopsis thaliana DNA chromosome 4, cont...   162   8e-39   
pir|H71444|H71444 GTP-binding protein - Arabidopsis thaliana>gb:...   162   8e-39   Arabidopsis thaliana [mouse-ear cress]
sp|Q05974|RAB1_LYMST|RAB1_LYMST Ras-related protein Rab-1A.>pir|S38339|S383...   162   8e-39   Lymnaea stagnalis
sp|P22125|RAB1_DISOM|RAB1_DISOM Ras-related protein ORAB-1.>gb:DYGORAB1_257...   162   8e-39   
gb:AF346820_1789995 Pichia angusta GTP-binding protein (YPT1) ge...   162   1e-38   
gb:AF037357_1235071 Dictyostelium discoideum GTPase rab11b (RAB1...   162   1e-38   
pir|S39565|S39565 GTP-binding protein rab1 - soybean>gb:SOYRAB1P...   162   1e-38   Glycine max [soybeans]
sp|Q39571|YPT1_CHLRE|YPT1_CHLRE GTP-binding protein YPTC1.>pir|JC4105|JC410...   162   1e-38   Chlamydomonas reinhardtii
gb:AC104285_1737519 Oryza sativa (japonica cultivar-group) chrom...   162   1e-38   
gb:SLU38465_1715388 Solanum lycopersicum small GTP-binding prote...   162   1e-38   
gb:BT019527_2151403 Synthetic construct Homo sapiens RAB1A, memb...   161   2e-38   
gb:AL606522_2071425 Mouse DNA sequence from clone RP23-19L22 on ...   161   2e-38   
gb:PEAGTPBP10_1699692 Pisum sativum mRNA for GTP-binding protein...   161   2e-38   
gb:AB054578_1196621 Entamoeba histolytica EhRab1A mRNA for small...   161   2e-38   
gb:AE016959_1022248 Oryza sativa (japonica cultivar-group) chrom...   161   2e-38   
gb:AE005172_890785 Arabidopsis thaliana chromosome 1, top arm co...   161   2e-38   
pir|JE0318|JE0318 GTP-binding protein rabB - silkworm>gb:AF01357...   161   2e-38   Bombyx mori [silk moth]
sp|P11476|RB1A_HUMAN|RB1A_HUMAN Ras-related protein Rab-1A (YPT1-related pr...   161   2e-38   Homo sapiens [man]
gb:CR382134_1667256 Debaryomyces hansenii chromosome B of strain...   161   2e-38   
sp|P31584|YPT1_VOLCA|YPT1_VOLCA GTP-binding protein yptV1.>pir|JC1247|JC124...   161   2e-38   Volvox carteri
sp|Q01890|YPT1_PHYIN|YPT1_PHYIN Ras-like GTP-binding protein YPT1.>pir|JC53...   161   2e-38   Phytophthora infestans [potato late blight]
gb:BC053195_2550587 Danio rerio RAB13, member RAS oncogene famil...   160   3e-38   
gb:AF330211_1787105 Candida albicans small GTP-binding protein Y...   160   3e-38   
gb:LJRAB1C_1685023 L.japonicus mRNA for small GTP-binding protei...   160   4e-38   
gb:AB024994_1516075 Cicer arietinum mRNA for rab-type small GTP-...   160   4e-38   
sp|Q9DD03|RB13_MOUSE|RB13_MOUSE Ras-related protein Rab-13.>gb:AK002303_115...   160   4e-38   Mus musculus [mouse]
gb:CR382124_1656560 Kluyveromyces lactis strain NRRL Y-1140 chro...   160   5e-38   
pir|T14391|T14391 GTP-binding protein homolog - turnip>gb:BNAYPT...   160   5e-38   Brassica rapa
gb:AB158369_2048971 Mesocricetus auratus mRNA for Rab13, complet...   159   6e-38   
gb:LJRAB1A_1685021 L.japonicus mRNA for small GTP-binding protei...   159   6e-38   
gb:AK129477_2069708 Mus musculus mRNA for mKIAA3012 protein.          159   8e-38   
gb:CR533462_1993667 Homo sapiens full open reading frame cDNA cl...   159   8e-38   
gb:AJ810707_1814165 Poa pratensis mRNA for RAB1-like (rab1-1 gene).   159   8e-38   
pir|S06147|S06147 GTP-binding protein rab1B - rat                     159   8e-38   Rattus norvegicus [brown rat]
pir|S34253|S34253 GTP-binding protein, ras-related - common toba...   159   8e-38   Nicotiana tabacum [American tobacco]
sp|P34139|RB1A_DICDI|RB1A_DICDI Ras-related protein Rab1A.>gb:DDIRAB1A_1377...   159   8e-38   Dictyostelium discoideum
sp|P35286|RB13_RAT|RB13_RAT Ras-related protein Rab-13.>gb:AF525280_20675...   159   8e-38   Rattus norvegicus [brown rat]
gb:BT008275_2151207 Synthetic construct Homo sapiens mel transfo...   159   1e-37   
gb:BC071176_2106411 Rattus norvegicus cDNA clone IMAGE:7098881, ...   159   1e-37   
gb:S53268_2040415 Homo sapiens RAS-related protein MEL (MEL) gen...   159   1e-37   
gb:AE016815_1746457 Ashbya gossypii (= Eremothecium gossypii) AT...   159   1e-37   
gb:OSA307662_1692475 Oryza sativa genomic DNA fragment, chromoso...   159   1e-37   
gb:AK076048_1171195 Mus musculus 11 days embryo whole body cDNA,...   159   1e-37   
pir|D38625|D38625 GTP-binding protein o-rab1 - electric ray (Dis...   159   1e-37   
sp|Q05737|YPT2_MAIZE|YPT2_MAIZE GTP-binding protein YPTM2.>pir|B38202|B3820...   159   1e-37   Zea mays [maize]
sp|P55258|RB8A_MOUSE|RB8A_MOUSE Ras-related protein Rab-8A (Oncogene c-mel)...   159   1e-37   Mus musculus [mouse]
sp|P61007|RB8A_CANFA|RB8A_CANFA Ras-related protein Rab-8A (Oncogene c-mel)...   159   1e-37   Canis lupus familiaris [dogs]
sp|P05711|RB1A_RAT|RB1A_RAT Ras-related protein Rab-1A.>pir|A39963|TVRTYP...   159   1e-37   Rattus norvegicus [brown rat]
gb:BT019699_2151495 Synthetic construct Homo sapiens RAB13, memb...   158   1e-37   
gb:BC073168_1989056 Homo sapiens RAB13, member RAS oncogene fami...   158   1e-37   
gb:AY080753_1568466 Arabidopsis thaliana putative ras-related sm...   158   1e-37   
gb:AY052333_1562706 Arabidopsis thaliana At1g02130/T7I23_6 mRNA,...   158   1e-37   
sp|P51153|RB13_HUMAN|RB13_HUMAN Ras-related protein Rab-13.>pir|A49647|A496...   158   1e-37   Homo sapiens [man]
sp|P28188|ARA5_ARATH|ARA5_ARATH Ras-related protein ARA-5.>pir|B86153|B8615...   158   1e-37   Arabidopsis thaliana [mouse-ear cress]
gb:AE014297_1140623 Drosophila melanogaster chromosome 3R, compl...   158   2e-37   
pir|T26168|T26168 hypothetical protein W04G5.2 - Caenorhabditis ...   158   2e-37   Caenorhabditis elegans [roundworm]
pir|B38625|B38625 GTP-binding protein ora2 - electric ray (Disco...   158   2e-37   
gb:AE014296_1137067 Drosophila melanogaster chromosome 3L, compl...   157   2e-37   
sp|P10536|RB1B_RAT|RB1B_RAT Ras-related protein Rab-1B.>gb:RNRAB1B_213628...   157   2e-37   Rattus norvegicus [brown rat]
gb:BC085118_2109070 Rattus norvegicus similar to Ras-related pro...   157   3e-37   
gb:AJ810708_1814166 Poa pratensis mRNA for RAB1-like (rab1-2 gene).   157   3e-37   
gb:ATAC016795_1543586 Arabidopsis thaliana chromosome III BAC F2...   157   3e-37   
pir|S04590|S04590 GTP-binding protein ypt1 - fission yeast  (Sch...   157   3e-37   Schizosaccharomyces pombe
sp|P11620|YPT1_SCHPO|YPT1_SCHPO Ras-related protein ypt1.>pir|T50323|T50323...   157   3e-37   Schizosaccharomyces pombe
sp|Q9D1G1|RB1B_MOUSE|RB1B_MOUSE Ras-related protein Rab-1B.>gb:AK003609_115...   157   3e-37   Mus musculus [mouse]
sp|Q9H0U4|RB1B_HUMAN|RB1B_HUMAN Ras-related protein Rab-1B.>gb:CR857726_118...   157   3e-37   Homo sapiens [man]
gb:BC071068_2555932 Xenopus laevis MGC78967 protein, mRNA (cDNA ...   157   4e-37   
gb:BC054719_2101764 Mus musculus cDNA clone MGC:64765 IMAGE:5686...   157   4e-37   
gb:AF468652_1904050 Homo sapiens RAB2B mRNA, complete cds.            157   4e-37   
gb:ANI278659_1819457 Aspergillus niger srgB gene for a secretion...   157   4e-37   
gb:AF108883_1768640 Capsicum annuum small GTP-binding protein mR...   157   4e-37   
gb:TRE277108_1725805 Trichoderma reesei ypt1 gene for small GTP-...   157   4e-37   
gb:SLU38466_1715389 Solanum lycopersicum small GTP-binding prote...   157   4e-37   
gb:AY370773_1323831 Trypanosoma brucei strain Lister 427 Rab1 mR...   157   4e-37   
gb:HSM807747_1187893 Homo sapiens mRNA; cDNA DKFZp313C1541 (from...   157   4e-37   
gb:AK005230_1152895 Mus musculus adult male cerebellum cDNA, RIK...   157   4e-37   
sp|P17609|YPT2_SCHPO|YPT2_SCHPO Ras-related protein ypt2.>pir|S12790|S12790...   157   4e-37   Schizosaccharomyces pombe
sp|P59279|RB2B_MOUSE|RB2B_MOUSE Ras-related protein Rab-2B.>gb:AK038393_116...   157   4e-37   Mus musculus [mouse]
sp|Q8WUD1|RB2B_HUMAN|RB2B_HUMAN Ras-related protein Rab-2B.>gb:BC020839_197...   157   4e-37   
gb:AE017352_1759798 Cryptococcus neoformans var. neoformans JEC2...   156   5e-37   
gb:BC044459_2548765 Danio rerio RAB2, member RAS oncogene family...   156   7e-37   
gb:BC058382_2103189 Mus musculus RAB2, member RAS oncogene famil...   156   7e-37   
gb:BC009227_1971840 Homo sapiens RAB13, member RAS oncogene fami...   156   7e-37   
gb:AX407295_1468040 Sequence 66 from Patent WO0226984.                156   7e-37   
gb:AK042862_1166431 Mus musculus 7 days neonate cerebellum cDNA,...   156   7e-37   
pir|B34323|B34323 GTP-binding protein Rab2 - human>gb:HUMRAB2A_2...   156   7e-37   
pir|S52325|S52325 GTP-binding protein RAB2 - chicken>gb:GGRAB2_2...   156   7e-37   
sp|Q01971|RB2A_RABIT|RB2A_RABIT Ras-related protein Rab-2A.>pir|S23979|S239...   156   7e-37   
sp|P53994|RB2A_MOUSE|RB2A_MOUSE Ras-related protein Rab-2A.>gb:AK079071_117...   156   7e-37   
sp|P61105|RB2A_CANFA|RB2A_CANFA Ras-related protein Rab-2A.>sp|P61019|RB2A_...   156   7e-37   
gb:BC074632_2558127 Xenopus tropicalis RAB2B, member RAS oncogen...   155   9e-37   
gb:AF244545_1780371 Aspergillus awamori YptA (yptA) gene, comple...   155   9e-37   
gb:LJRAB1B_1685022 L.japonicus mRNA for small GTP-binding protein,.   155   9e-37   
gb:BX538352_1358968 Cryptosporidium parvum chromosome 6, complet...   155   9e-37   
gb:AK051218_1169610 Mus musculus 12 days embryo spinal ganglion ...   155   9e-37   
sp|P33723|YPT1_NEUCR|YPT1_NEUCR GTP-binding protein ypt1.>pir|S30096|S30096...   155   9e-37   
gb:AE014134_1129176 Drosophila melanogaster chromosome 2L, compl...   155   1e-36   
gb:AE014134_1129175 Drosophila melanogaster chromosome 2L, compl...   155   1e-36   
gb:AE014134_1129174 Drosophila melanogaster chromosome 2L, compl...   155   1e-36   
gb:BT019693_2151491 Synthetic construct Homo sapiens RAB2, membe...   155   2e-36   
sp|P20790|SAS1_DICDI|SAS1_DICDI GTP-binding protein SAS1.>pir|A34716|A34716...   155   2e-36   
sp|P05712|RB2A_RAT|RB2A_RAT Ras-related protein Rab-2A.>pir|B39963|B39963...   155   2e-36   
gb:BC033312_2097436 Mus musculus RAB2B, member RAS oncogene fami...   154   2e-36   
gb:AP003848_1834225 Oryza sativa (japonica cultivar-group) genom...   154   2e-36   
gb:PEAGTPBP09_1699691 Pisum sativum mRNA for GTP-binding protein...   154   2e-36   
gb:PFA308736_1392266 Plasmodium falciparum mRNA for putative Rab...   154   2e-36   
gb:AF183937_1248530 Giardia intestinalis guanine nucleotide-bind...   154   2e-36   
pir|T07609|T07609 GTP-binding protein SYPT - soybean>gb:SOYGTPBI...   154   2e-36   
pir|PS0279|PS0279 GTP-binding protein ara-5 - Arabidopsis thalia...   154   2e-36   
sp|Q05975|RAB2_LYMST|RAB2_LYMST Ras-related protein Rab-2.>pir|S38341|S3834...   154   2e-36   
gb:ATHARA5_1553009 Arabidopsis thaliana mRNA for small GTP-bindi...   154   3e-36   
gb:AB035352_1195211 Drosophila melanogaster mRNA for Drab2, comp...   154   3e-36   
gb:CR861352_1185352 Pongo pygmaeus mRNA; cDNA DKFZp459A1411 (fro...   154   3e-36   
gb:AE013599_1130269 Drosophila melanogaster chromosome 2R, compl...   154   3e-36   
gb:AE014188_968107 Plasmodium falciparum 3D7 chromosome 12, comp...   154   3e-36   
pir|T25796|T25796 hypothetical protein F53F10.4 - Caenorhabditis...   154   3e-36   
sp|P36863|YPT4_VOLCA|YPT4_VOLCA GTP-binding protein yptV4 (RAB2 homolog).>p...   154   3e-36   
sp|Q39570|YPT4_CHLRE|YPT4_CHLRE GTP-binding protein YPTC4.>pir|JC4106|JC410...   154   3e-36   
gb:BT019694_2151492 Synthetic construct Homo sapiens RAB2, membe...   154   4e-36   
gb:AY324135_1319618 Babesia bovis Rab1b mRNA, complete cds.           154   4e-36   
gb:AC116921_1206426 Dictyostelium discoideum chromosome 2 map 46...   154   4e-36   
gb:CR382130_1662640 Yarrowia lipolytica chromosome D of strain C...   153   5e-36   
gb:AY069563_1294293 Drosophila melanogaster LD29476 full length ...   153   5e-36   
gb:AB076904_1197652 Ciona intestinalis Ci-rab2 mRNA for GTP-bind...   153   6e-36   
sp|P36410|RAB4_DICDI|RAB4_DICDI Ras-related protein Rab4.>gb:DDU02927_13772...   153   6e-36   
gb:BC060015_2552795 Xenopus laevis hypothetical protein MGC68629...   152   8e-36   
gb:LEIGTPHOM_1387385 Leishmania major V121 GTP-binding protein h...   152   8e-36   
gb:BC076234_2559102 Danio rerio zgc:92757, mRNA (cDNA clone MGC:...   152   1e-35   
pir|T31551|T31551 hypothetical protein Y47D3A.25 - Caenorhabditi...   152   1e-35   
gb:AE017343_1755676 Cryptococcus neoformans var. neoformans JEC2...   152   1e-35   
sp|P22127|RB10_DISOM|RB10_DISOM Ras-related protein Rab-10 (ORA1).>pir|A386...   152   1e-35   
pir|S71585|S71585 GTP-binding protein GB2 - Arabidopsis thaliana...   151   2e-35   
gb:BC045374_2549216 Danio rerio RAB14, member RAS oncogene famil...   151   2e-35   
gb:ANI278658_1819456 Aspergillus niger srgA gene for a secretion...   151   2e-35   
gb:LJRAB2A_1685028 L.japonicus mRNA for small GTP-binding protei...   151   2e-35   
pir|E71440|E71440 GTP-binding protein RAB2A - Arabidopsis thaliana    151   2e-35   
pir|H85191|H85191 GTP-binding RAB2A like protein [imported] - Ar...   151   2e-35   
pir|T23530|T23530 hypothetical protein K09A9.2 - Caenorhabditis ...   151   2e-35   
pir|E42148|E42148 GTP-binding protein rab14 - rat                     151   2e-35   
gb:AL137068_1919426 Human DNA sequence from clone RP11-165P4 on ...   150   3e-35   
gb:ATAC015985_1543570 Arabidopsis thaliana chromosome III BAC F8...   150   3e-35   
pir|T03767|T03767 GTP-binding protein rab2 - rice>gb:RICGTPBP_17...   150   3e-35   
sp|P49103|RB2A_MAIZE|RB2A_MAIZE Ras-related protein Rab-2-A.>pir|T02242|T02...   150   3e-35   
sp|Q91V41|RB14_MOUSE|RB14_MOUSE Ras-related protein Rab-14.>pir|T47160|T471...   150   3e-35   
sp|P61106|RB14_HUMAN|RB14_HUMAN Ras-related protein Rab-14.>sp|P61107|RB14_...   150   3e-35   
gb:AY370774_1323832 Trypanosoma brucei strain Lister 427 Rab2B m...   150   4e-35   
gb:HSM801620_1186309 Homo sapiens mRNA; cDNA DKFZp564L1962 (from...   150   4e-35   
gb:CR859178_1183312 Pongo pygmaeus mRNA; cDNA DKFZp459K2229 (fro...   150   4e-35   
gb:AK008725_1154756 Mus musculus adult male stomach cDNA, RIKEN ...   150   4e-35   
pir|S71559|S71559 GTP-binding protein rab2 - soybean>gb:GMU32185...   150   4e-35   
pir|T48378|T48378 GTP-binding protein-like - Arabidopsis thalian...   150   4e-35   
sp|P49104|RB2B_MAIZE|RB2B_MAIZE Ras-related protein Rab-2-B.>pir|T02248|T02...   150   4e-35   
sp|P34140|RB1B_DICDI|RB1B_DICDI Ras-related protein Rab1B (Fragment).>gb:DD...   150   4e-35   
sp|P61026|RB10_HUMAN|RB10_HUMAN Ras-related protein Rab-10.>sp|P61027|RB10_...   150   4e-35   
gb:BC057747_2552219 Xenopus laevis hypothetical protein MGC69101...   150   5e-35   
gb:AJ720699_2502886 Gallus gallus mRNA for hypothetical protein,...   150   5e-35   
gb:AF397451_1795842 Nicotiana tabacum small GTPase Rab2 (Rab2) m...   150   5e-35   
gb:PFA237914_1392032 Plasmodium falciparum putative rab1A gene.       150   5e-35   
gb:CEU68256_1368628 Caenorhabditis elegans rab8-like mRNA, parti...   150   5e-35   
gb:AF201953_1250618 Plasmodium falciparum isolate FCC1/HN Rab1 p...   150   5e-35   
sp|P20791|SAS2_DICDI|SAS2_DICDI GTP-binding protein SAS2.>pir|B34716|B34716...   150   5e-35   
sp|P24409|RB10_CANFA|RB10_CANFA Ras-related protein Rab-10.>pir|D36364|D363...   150   5e-35   
gb:AP005644_1855359 Oryza sativa (japonica cultivar-group) genom...   149   7e-35   
gb:AF083256_1766875 Sporobolus stapfianus small GTP binding prot...   149   7e-35   
gb:HVU518934_1682800 Hordeum vulgare subsp. vulgare mRNA for RAB...   149   7e-35   
gb:CR382125_1657757 Kluyveromyces lactis strain NRRL Y-1140 chro...   149   7e-35   
gb:PFA409198_1392394 Plasmodium falciparum mRNA for putative GTP...   149   7e-35   
pir|T04362|T04362 GTP-binding protein yptm3 - maize>gb:ZMYPTM3_1...   149   7e-35   
gb:BC058341_2552291 Danio rerio zgc:63643, mRNA (cDNA clone MGC:...   149   9e-35   
gb:CLI272025_1647837 Colletotrichum lindemuthianum pt1 gene for ...   149   9e-35   
gb:AY851657_1630837 Triticum aestivum small GTP-binding protein ...   149   9e-35   
gb:AE014298_1126574 Drosophila melanogaster chromosome X, comple...   149   9e-35   
pir|D71440|D71440 GTP-binding protein RAB2A - Arabidopsis thalia...   149   9e-35   
gb:AX888137_1483590 Sequence 4000 from Patent EP1033401.              149   1e-34   
gb:AY299636_1317208 Toxoplasma gondii Rab11b (rab11b) mRNA, comp...   149   1e-34   
pir|S57471|S57471 GTP-binding protein GTP6 - garden pea>gb:PSGTP...   149   1e-34   
sp|P07560|SEC4_YEAST|SEC4_YEAST Ras-related protein SEC4.>pir|A25959|TVBYQ4...   149   1e-34   
gb:BC077124_2559843 Danio rerio zgc:100812, mRNA (cDNA clone MGC...   148   1e-34   
gb:BC061434_2553208 Xenopus tropicalis hypothetical protein MGC7...   148   1e-34   
gb:BT020020_2151649 Synthetic construct Homo sapiens RAB35, memb...   148   1e-34   
gb:LJRAB8E_1685039 L.japonicus mRNA for small GTP-binding protei...   148   1e-34   
gb:AY087058_1572094 Arabidopsis thaliana clone 3115 mRNA, comple...   148   1e-34   
gb:PFU41269_1395081 Plasmodium falciparum Rab1 protein (PfRab1) ...   148   1e-34   
gb:AB015237_1193575 Dictyostelium discoideum Rab1C mRNA, complet...   148   1e-34   
sp|Q15286|RB35_HUMAN|RB35_HUMAN Ras-related protein Rab-35 (Rab-1C) (GTP-bi...   148   1e-34   
sp|Q39433|RAB1_BETVU|RAB1_BETVU Ras-related protein RAB1BV.>pir|T14565|T145...   148   1e-34   
gb:BC068969_2555461 Xenopus laevis similar to RAB35, member RAS ...   148   2e-34   
gb:BC041759_2548037 Xenopus laevis similar to RAB35, member RAS ...   148   2e-34   
gb:LJRAB8D_1685038 L.japonicus mRNA for small GTP-binding protei...   148   2e-34   
gb:LJRAB8A_1685035 L.japonicus mRNA for small GTP-binding protei...   148   2e-34   
gb:AF169952_1246928 Tetrahymena thermophila putative intermediat...   148   2e-34   
gb:AF542024_1809999 Griffithsia japonica GTP-binding protein mRN...   147   3e-34   
gb:AY579410_1616019 Oryza sativa (japonica cultivar-group) small...   147   3e-34   
gb:AX885835_1481288 Sequence 1698 from Patent EP1033401.              147   3e-34   
gb:CNS07EGB_1373138 chromosome IV of strain GB-M1 of Encephalito...   147   3e-34   
pir|T28971|T28971 hypothetical protein T23H2.5 - Caenorhabditis ...   147   3e-34   
gb:AP004340_1840465 Oryza sativa (japonica cultivar-group) genom...   147   3e-34   
gb:AC117265_1739405 Oryza sativa (japonica cultivar-group) chrom...   147   3e-34   
gb:CGAJ4685_1646366 Candida glabrata SEC4 homologue, complete CD...   147   3e-34   
gb:AB079022_1523849 Nicotiana tabacum mRNA for ras-related prote...   147   3e-34   
gb:AB079021_1523848 Nicotiana tabacum mRNA for ras-related prote...   147   3e-34   
gb:AB079020_1523847 Nicotiana tabacum mRNA for ras-related prote...   147   3e-34   
gb:AY324134_1319617 Babesia bovis Rab1a mRNA, complete cds.           147   3e-34   
gb:AF460175_1273154 Giardia intestinalis strain WBC6 GTPase Rab1...   147   3e-34   
gb:AE013599_1132450 Drosophila melanogaster chromosome 2R, compl...   147   3e-34   
pir|T14405|T14405 small GTP-binding protein rab-1 - turnip>gb:BC...   147   3e-34   
pir|B42148|B42148 GTP-binding protein rab10 - rat                     147   3e-34   
sp|P36861|YPT2_VOLCA|YPT2_VOLCA GTP-binding protein yptV2.>pir|S36365|S3636...   147   3e-34   
sp|P28186|ARA3_ARATH|ARA3_ARATH Ras-related protein ARA-3.>pir|JS0640|JS064...   147   3e-34   
gb:AY576526_1615966 Oryza sativa (japonica cultivar-group) ethyl...   147   4e-34   
pir|S57478|S57478 GTP-binding protein GTP13 - garden pea>gb:PSGT...   147   4e-34   
pir|S57462|S57462 GTP-binding protein GTP11 - garden pea>gb:PSGT...   147   4e-34   
pir|T45901|T45901 GTPase AtRAB8 - Arabidopsis thaliana>gb:ATF4P1...   147   4e-34   
gb:AB015475_1512574 Arabidopsis thaliana genomic DNA, chromosome...   146   6e-34   
gb:BC080219_2561607 Danio rerio zgc:101015, mRNA (cDNA clone MGC...   146   7e-34   
gb:AF408432_2065195 Mus musculus GTP-binding protein RAB4 (Rab4)...   146   7e-34   
gb:AF217985_1890596 Homo sapiens clone PP1596 unknown mRNA.           146   7e-34   
gb:AF087861_1881875 Homo sapiens rab4b mRNA, complete cds.            146   7e-34   
gb:OSJN00012_1693251 Oryza sativa genomic DNA, chromosome 4, BAC...   146   7e-34   
gb:AY439005_1606292 Fucus distichus Rab family GTPase Rab8 (Rab8...   146   7e-34   
gb:SMU35432_1397856 Schistosoma mansoni rab-related GTP-binding ...   146   7e-34   
gb:AY324136_1319619 Babesia bovis Rab2 mRNA, complete cds.            146   7e-34   
pir|S33900|S33900 GTP-binding protein ypt2 - tomato>gb:LEYPT2A_1...   146   7e-34   
sp|Q91ZR1|RB4B_MOUSE|RB4B_MOUSE Ras-related protein Rab-4B.>sp|P51146|RB4B_...   146   7e-34   
sp|P61017|RB4B_CANFA|RB4B_CANFA Ras-related protein Rab-4B.>sp|P61018|RB4B_...   146   7e-34   
gb:AE016820_1749933 Ashbya gossypii (= Eremothecium gossypii) AT...   145   1e-33   
gb:CR548612_1375261 Paramecium tetraurelia macronuclear largest ...   145   1e-33   
gb:AB197072_1203151 Entamoeba histolytica gene for small GTPase ...   145   1e-33   
gb:AE014298_1126543 Drosophila melanogaster chromosome X, comple...   145   1e-33   
pir|S57474|S57474 GTP-binding protein - garden pea>gb:PSSE354GP_...   145   1e-33   
sp|Q8BHC1|R39B_MOUSE|R39B_MOUSE Ras-related protein Rab-39B.>gb:AK039013_11...   145   1e-33   
sp|Q96DA2|R39B_HUMAN|R39B_HUMAN Ras-related protein Rab-39B.>gb:HSM805561_1...   145   1e-33   
gb:AY166852_1937506 Homo sapiens RAB41 mRNA, complete cds.>gb:BC...   145   1e-33   
gb:AY052478_1935294 Homo sapiens RAB39 mRNA, complete cds.            145   1e-33   
gb:DCJ001367_1675704 Daucus carota mRNA for Rab8-like small GTP-...   145   1e-33   
gb:AF107762_1241862 Theileria parva small GTP-binding protein ra...   145   1e-33   
gb:PFMAL13_1191468 Plasmodium falciparum 3D7 chromosome 13, *** ...   145   1e-33   
gb:AY223077_1176542 Schistosoma japonicum clone ZZD1287 mRNA seq...   145   1e-33   
gb:AE014296_1135297 Drosophila melanogaster chromosome 3L, compl...   145   1e-33   
gb:AF096249_1767805 Lycopersicon esculentum ethylene-responsive ...   145   2e-33   
gb:AB079024_1523851 Nicotiana tabacum mRNA for ras-related prote...   145   2e-33   
gb:AB197073_1203152 Entamoeba histolytica gene for small GTPase ...   145   2e-33   
gb:BX538352_1359029 Cryptosporidium parvum chromosome 6, complet...   144   2e-33   
gb:AF169951_1246927 Tetrahymena thermophila putative intermediat...   144   2e-33   
gb:AE014297_1140624 Drosophila melanogaster chromosome 3R, compl...   144   2e-33   
pir|JC7589|JC7589 Sec4p homolog - yeast (Pichia pastoris)>gb:PPA...   144   3e-33   
gb:CR382138_1671014 Debaryomyces hansenii chromosome F of strain...   144   4e-33   
pir|S51495|S51495 GTP-binding protein RYL1 - yeast (Yarrowia lip...   144   4e-33   
sp|P35281|RB10_RAT|RB10_RAT Ras-related protein Rab-10.>gb:RATRAB10X_2133...   144   4e-33   
gb:BC044974_2548933 Xenopus laevis RAB4A, member RAS oncogene fa...   143   5e-33   
gb:LJRAB8C_1685037 L.japonicus mRNA for small GTP-binding protei...   143   5e-33   
gb:AY321327_1177773 Rattus norvegicus Ac2-048 mRNA, complete cds.     143   5e-33   
sp|Q15771|RB30_HUMAN|RB30_HUMAN Ras-related protein Rab-30.>gb:AF498956_190...   143   5e-33   
sp|O14462|SEC4_CANAL|SEC4_CANAL Ras-related protein SEC4.>pir|T18242|T18242...   143   6e-33   
gb:AE017345_1756866 Cryptococcus neoformans var. neoformans JEC2...   142   8e-33   
gb:AB035919_1518995 Carica papaya pgp1 mRNA for small GTP-bindin...   142   1e-32   
sp|P41924|RYL1_YARLI|RYL1_YARLI Ras-like GTP-binding protein RYL1.>gb:CR382...   142   1e-32   
gb:AJ719773_2501960 Gallus gallus mRNA for hypothetical protein,...   142   1e-32   
gb:BC062016_2104792 Rattus norvegicus cDNA clone MGC:72520 IMAGE...   142   1e-32   
gb:AF498934_1905318 Homo sapiens small GTP binding protein RAB4A...   142   1e-32   
gb:AY542998_1334454 Bigelowiella natans RAB2 mRNA, complete cds.      142   1e-32   
pir|JC4962|JC4962 rab protein 30 - human>gb:HSU57092_2024988 Hum...   142   1e-32   
pir|T28972|T28972 hypothetical protein T23H2.6 - Caenorhabditis ...   142   1e-32   
sp|P05714|RB4A_RAT|RB4A_RAT Ras-related protein Rab-4A.>pir|S01766|S01766...   142   1e-32   
sp|P20338|RB4A_HUMAN|RB4A_HUMAN Ras-related protein Rab-4A.                      142   1e-32   
gb:MMU534465_2121973 Mus musculus mRNA for Ras-related protein R...   141   2e-32   
gb:BC085393_2564344 Danio rerio RAB22A, member RAS oncogene fami...   141   2e-32   
gb:BC056054_2551637 Xenopus laevis hypothetical protein MGC69017...   141   2e-32   
gb:AY398404_2531934 Danio rerio clone RK113A4H10 RAB22A, member ...   141   2e-32   
gb:AY357728_2529439 Rana ridibunda ras-related GTP-binding prote...   141   2e-32   
gb:BC089957_2111135 Rattus norvegicus cDNA clone MGC:109292 IMAG...   141   2e-32   
gb:TBU24677_1399445 Trypanosoma brucei rhodesiense ras-related p...   141   2e-32   
gb:AF389109_1267381 Entamoeba histolytica small GTP-binding prot...   141   2e-32   
sp|P56371|RB4A_MOUSE|RB4A_MOUSE Ras-related protein Rab-4A.>gb:D86563_21125...   141   2e-32   
sp|P35293|RB18_MOUSE|RB18_MOUSE Ras-related protein Rab-18.>pir|JN0874|JN08...   141   2e-32   
sp|Q9NP72|RB18_HUMAN|RB18_HUMAN Ras-related protein Rab-18.>gb:CR860884_118...   141   2e-32   
gb:BC077886_2560535 Xenopus laevis RAB14, member RAS oncogene fa...   140   3e-32   
gb:AB197097_1203176 Entamoeba histolytica gene for small GTPase ...   140   3e-32   
gb:AJ719816_2502003 Gallus gallus mRNA for hypothetical protein,...   140   4e-32   
gb:BC074233_2557749 Xenopus laevis similar to RAB18, member RAS ...   140   5e-32   
gb:BC043996_2548406 Xenopus laevis similar to RAB18, member RAS ...   140   5e-32   
gb:RNRAB4_2136285 Rat ras-related mRNA rab4.                          140   5e-32   
gb:AK017185_1159045 Mus musculus 11 days pregnant adult female o...   140   5e-32   
pir|E34323|E34323 GTP-binding protein Rab4 - human>gb:HUMRAB4A_2...   140   5e-32   
sp|Q8BHD0|R39A_MOUSE|R39A_MOUSE Ras-related protein Rab-39A (Rab-39).>gb:AK...   140   5e-32   
sp|P35285|R22A_MOUSE|R22A_MOUSE Ras-related protein Rab-22A (Rab-22) (Rab-1...   140   5e-32   
gb:BC061274_2553051 Xenopus tropicalis hypothetical protein MGC7...   139   7e-32   
gb:LJRAB11I_1685019 L.japonicus mRNA for small GTP-binding prote...   139   7e-32   
gb:BT007528_2150460 Synthetic construct Homo sapiens RAB22A, mem...   139   9e-32   
gb:HSA276210_2002136 Homo sapiens mRNA for GTP-binding protein R...   139   9e-32   
gb:AF125104_1885076 Homo sapiens RAB22 mRNA, complete cds.            139   9e-32   
gb:CFRAB22A_1438654 Canis familiaris mRNA for Rab22 protein.          139   9e-32   
sp|Q9UL26|R22A_HUMAN|R22A_HUMAN Ras-related protein Rab-22A (Rab-22).>gb:AF...   139   9e-32   
gb:BC076054_2558936 Danio rerio zgc:92523, mRNA (cDNA clone MGC:...   139   1e-31   
gb:BC076437_2559274 Danio rerio zgc:100889, mRNA (cDNA clone MGC...   138   2e-31   
gb:BC056535_2551809 Danio rerio RAB4a, member RAS oncogene famil...   138   2e-31   
pir|T20749|T20749 hypothetical protein F11A5.3 - Caenorhabditis ...   138   2e-31   
sp|P36409|RAB2_DICDI|RAB2_DICDI Ras-related protein Rab2 (Fragment).>gb:DDU...   138   2e-31   
gb:BC076367_2559229 Danio rerio zgc:92916, mRNA (cDNA clone MGC:...   137   3e-31   


>gb:ATAC009853_1543048 Arabidopsis thaliana chromosome III BAC F21O3
           genomic sequence, complete sequence.>gb:AY072444_1567261
           Arabidopsis thaliana putative GTP-binding protein
           (At3g07410) mRNA, complete cds.>gb:BT002173_1635776
           Arabidopsis thaliana putative GTP-binding protein
           (At3g07410) mRNA, complete cds.
          Length = 217

 Score =  246 bits (628), Expect(2) = 4e-76
 Identities = 122/158 (77%), Positives = 137/158 (86%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDSAVGKSNLLSRF+RDEFD NSKATIGVEFQTQ+VE++GKEVKAQ+WDTAG
Sbjct: 11  YLFKIVLIGDSAVGKSNLLSRFSRDEFDTNSKATIGVEFQTQLVEIEGKEVKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFRAVTSAYYRGA GALIVYDITR  TFE++KRWL+ELNTHCDT VA+MLVGNKCDLE
Sbjct: 71  QERFRAVTSAYYRGAFGALIVYDITRGDTFESVKRWLQELNTHCDTAVAQMLVGNKCDLE 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRL 405
            IR VSV           LFF+ETSALD+TNV+ A  +
Sbjct: 131 DIRAVSVEEGKALAEEEGLFFMETSALDATNVDKAFEI 168



 Score = 62.4 bits (150), Expect(2) = 4e-76
 Identities = 31/42 (73%), Positives = 36/42 (85%)
 Frame = -1

Query: 411 EIVIRDIYKNVSRKLLNSDSYKAELSVNRVSLANGADMSKQN 286
           EIVIR+I+ NVSRKLLNSD+YKAELSVNRVSL N  D S+ +
Sbjct: 167 EIVIREIFNNVSRKLLNSDAYKAELSVNRVSLVNNQDGSESS 208



>gb:LJRAB11G_1685017 L.japonicus mRNA for small GTP-binding protein,
           RAB11G.
          Length = 219

 Score =  243 bits (620), Expect(2) = 4e-75
 Identities = 119/158 (75%), Positives = 137/158 (86%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+D KEVKAQ+WDTAG
Sbjct: 12  YLFKIVIIGDSAVGKSNLLSRYARNEFNMHSKATIGVEFQTQSLEIDSKEVKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFRAVTSAYYRGAVGALIVYDITR+TTF+++ RWL+EL THCDTTVA MLVGNKCDLE
Sbjct: 72  QERFRAVTSAYYRGAVGALIVYDITRRTTFDSVSRWLDELKTHCDTTVAMMLVGNKCDLE 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRL 405
           +IR VS+           LFF+ETSALDSTNV TA  +
Sbjct: 132 NIRAVSIEEGKSLAEAQGLFFMETSALDSTNVRTAFEM 169



 Score = 62.4 bits (150), Expect(2) = 4e-75
 Identities = 33/44 (75%), Positives = 39/44 (88%), Gaps = 1/44 (2%)
 Frame = -1

Query: 411 EIVIRDIYKNVSRKLLNSDSYKAELSVNRVSLA-NGADMSKQNK 283
           E+VIR+IY NVSRK+LNSD+YKAELSV+RVSL  NGA  SKQ+K
Sbjct: 168 EMVIREIYNNVSRKVLNSDTYKAELSVDRVSLVNNGAATSKQSK 211



>pir|T06443|T06443 GTP-binding protein - garden
           pea>gb:PEAGTPBP01_1699683 Pisum sativum mRNA for
           GTP-binding protein, complete cds, clone:pra1.
          Length = 215

 Score =  239 bits (609), Expect(2) = 4e-75
 Identities = 119/158 (75%), Positives = 135/158 (85%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDSAVGKSNLLSRFAR+EFD NSKATIGVEFQTQ VE+DGKEVKAQ+WDTAG
Sbjct: 11  YLFKIVLIGDSAVGKSNLLSRFARNEFDSNSKATIGVEFQTQTVEIDGKEVKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFRAVTSAYYRGA GAL+VYDI+R+ TF++IKRWL+EL T  D+TVARMLVGNKCDLE
Sbjct: 71  QERFRAVTSAYYRGAFGALVVYDISRRGTFDSIKRWLDELTTQNDSTVARMLVGNKCDLE 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRL 405
           S+R+VS            LFF+ETSALDSTNV  A  +
Sbjct: 131 SLREVSTEEGKAFAEEEGLFFMETSALDSTNVQKAFEI 168



 Score = 66.6 bits (161), Expect(2) = 4e-75
 Identities = 33/44 (75%), Positives = 36/44 (81%)
 Frame = -1

Query: 423 QHRLEIVIRDIYKNVSRKLLNSDSYKAELSVNRVSLANGADMSK 292
           Q   EIVIR+IY N+SRK+LNSDSYKAELSVNRVSL NGA   K
Sbjct: 163 QKAFEIVIREIYNNISRKVLNSDSYKAELSVNRVSLVNGAGSKK 206



>gb:GMGMR2_1680464 G.max gmr2 gene.
          Length = 219

 Score =  239 bits (609), Expect(2) = 4e-74
 Identities = 117/158 (74%), Positives = 136/158 (86%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+D KEVKAQ+WDTAG
Sbjct: 12  YLFKIVIIGDSAVGKSNLLSRYARNEFNMHSKATIGVEFQTQCLEIDSKEVKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFRAVTSAYYRGAVGALIVYDI+R+TTF+++ RWL+EL THCDTTVA MLVGNKCDLE
Sbjct: 72  QERFRAVTSAYYRGAVGALIVYDISRRTTFDSVGRWLDELKTHCDTTVAMMLVGNKCDLE 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRL 405
           +IR VS+           LFF+ETSALDSTNV  A  +
Sbjct: 132 NIRAVSIDEGKSLAEAEGLFFMETSALDSTNVKMAFEM 169



 Score = 63.2 bits (152), Expect(2) = 4e-74
 Identities = 33/44 (75%), Positives = 39/44 (88%), Gaps = 1/44 (2%)
 Frame = -1

Query: 411 EIVIRDIYKNVSRKLLNSDSYKAELSVNRVSLA-NGADMSKQNK 283
           E+VIR+IY NVSRK+LNS++YKAELSVNRVSL  NGA  SKQN+
Sbjct: 168 EMVIREIYNNVSRKVLNSETYKAELSVNRVSLVNNGAATSKQNQ 211



>gb:TOBNTRAE_1725465 Nicotiana tabacum SR1 Nt-rab11e mRNA, 3' end.
          Length = 209

 Score =  238 bits (607), Expect(2) = 5e-74
 Identities = 116/155 (74%), Positives = 136/155 (87%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDSAVGKSNLL+R+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct: 3   YLFKIVIIGDSAVGKSNLLTRYARNEFNLHSKATIGVEFQTQTLEIDGKEVKAQIWDTAG 62

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFRAVTSAYYRGA GAL+VYDITR+TTF++I RWL+EL TH DTTVARMLVGNKCDL+
Sbjct: 63  QERFRAVTSAYYRGAFGALVVYDITRRTTFDSIPRWLDELKTHSDTTVARMLVGNKCDLD 122

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
           +IR VSV           +FF+ETSALD+TNVN A
Sbjct: 123 NIRAVSVEEGKSLAESEGMFFMETSALDATNVNKA 157



 Score = 63.5 bits (153), Expect(2) = 5e-74
 Identities = 33/44 (75%), Positives = 39/44 (88%), Gaps = 1/44 (2%)
 Frame = -1

Query: 411 EIVIRDIYKNVSRKLLNSDSYKAELSVNRVSLA-NGADMSKQNK 283
           ++VIR+IY +VSRK+LNSDSYKAELSVNRVSL  NG D SKQN+
Sbjct: 159 DMVIREIYNSVSRKVLNSDSYKAELSVNRVSLVDNGTDGSKQNQ 202



>pir|T03626|T03626 GTP-binding protein Rab11e - common tobacco
           (fragment)
          Length = 209

 Score =  238 bits (607), Expect(2) = 5e-74
 Identities = 116/155 (74%), Positives = 136/155 (87%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDSAVGKSNLL+R+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct: 3   YLFKIVIIGDSAVGKSNLLTRYARNEFNLHSKATIGVEFQTQTLEIDGKEVKAQIWDTAG 62

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFRAVTSAYYRGA GAL+VYDITR+TTF++I RWL+EL TH DTTVARMLVGNKCDL+
Sbjct: 63  QERFRAVTSAYYRGAFGALVVYDITRRTTFDSIPRWLDELKTHSDTTVARMLVGNKCDLD 122

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
           +IR VSV           +FF+ETSALD+TNVN A
Sbjct: 123 NIRAVSVEEGKSLAESEGMFFMETSALDATNVNKA 157



 Score = 63.5 bits (153), Expect(2) = 5e-74
 Identities = 33/44 (75%), Positives = 39/44 (88%), Gaps = 1/44 (2%)
 Frame = -1

Query: 411 EIVIRDIYKNVSRKLLNSDSYKAELSVNRVSLA-NGADMSKQNK 283
           ++VIR+IY +VSRK+LNSDSYKAELSVNRVSL  NG D SKQN+
Sbjct: 159 DMVIREIYNSVSRKVLNSDSYKAELSVNRVSLVDNGTDGSKQNQ 202



>pir|S52646|S52646 GTP-binding protein gmr2 - soybean
          Length = 219

 Score =  234 bits (598), Expect(2) = 7e-73
 Identities = 116/155 (74%), Positives = 134/155 (86%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+D KEVKAQ+WDTAG
Sbjct: 12  YLFKIVIIGDSAVGKSNLLSRYARNEFNMHSKATIGVEFQTQCLEIDSKEVKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFRAVTSAYYRGAVGALIVYDI+R+TTF+++ RWL+EL THCDTTVA MLVGNKCDLE
Sbjct: 72  QERFRAVTSAYYRGAVGALIVYDISRRTTFDSVGRWLDELKTHCDTTVAMMLVGNKCDLE 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
           +IR VS+           L F+ETSALDSTNV  A
Sbjct: 132 NIRAVSIDEGKSLAEAEGLQFMETSALDSTNVKMA 166



 Score = 63.2 bits (152), Expect(2) = 7e-73
 Identities = 33/44 (75%), Positives = 39/44 (88%), Gaps = 1/44 (2%)
 Frame = -1

Query: 411 EIVIRDIYKNVSRKLLNSDSYKAELSVNRVSLA-NGADMSKQNK 283
           E+VIR+IY NVSRK+LNS++YKAELSVNRVSL  NGA  SKQN+
Sbjct: 168 EMVIREIYNNVSRKVLNSETYKAELSVNRVSLVNNGAATSKQNQ 211



>sp|P28187|ARA4_ARATH Ras-related protein ARA-4.>pir|JS0641|JS0641
           GTP-binding protein ara4 - Arabidopsis
           thaliana>gb:AC004450_1531699 Arabidopsis thaliana
           chromosome 2 clone F14B2 map CIC10F02, complete
           sequence.>gb:ATHARA4_1553008 Arabidopsis thaliana mRNA
           for small GTP-binding protein (ara-4), complete cds.
          Length = 214

 Score =  243 bits (621), Expect(2) = 2e-72
 Identities = 120/158 (75%), Positives = 137/158 (86%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct: 11  YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMLIDGKEVKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFRAVTSAYYRGAVGAL+VYDITR +TFEN+ RWL+ELNTH DTTVA+ML+GNKCDLE
Sbjct: 71  QERFRAVTSAYYRGAVGALVVYDITRSSTFENVGRWLDELNTHSDTTVAKMLIGNKCDLE 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRL 405
           SIR VSV           LFF+ETSALDSTNV TA  +
Sbjct: 131 SIRAVSVEEGKSLAESEGLFFMETSALDSTNVKTAFEM 168



 Score = 52.8 bits (125), Expect(2) = 2e-72
 Identities = 25/32 (78%), Positives = 29/32 (90%)
 Frame = -1

Query: 411 EIVIRDIYKNVSRKLLNSDSYKAELSVNRVSL 316
           E+VIR+IY N+SRK LNSDSYK EL+VNRVSL
Sbjct: 167 EMVIREIYSNISRKQLNSDSYKEELTVNRVSL 198



>gb:BT006190_1639082 Arabidopsis thaliana clone C00163 (i) putative
           RAS-related protein ARA-1 (At1g05810) mRNA, complete
           cds.
          Length = 261

 Score =  243 bits (619), Expect(2) = 2e-71
 Identities = 121/158 (76%), Positives = 136/158 (86%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+VVIGDSAVGKSNLLSR+AR+EF  NSKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct: 54  YLFKIVVIGDSAVGKSNLLSRYARNEFSANSKATIGVEFQTQSMEIEGKEVKAQIWDTAG 113

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFRAVTSAYYRGAVGAL+VYDITR+TTFE++ RWL+EL  H DTTVARMLVGNKCDLE
Sbjct: 114 QERFRAVTSAYYRGAVGALVVYDITRRTTFESVGRWLDELKIHSDTTVARMLVGNKCDLE 173

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRL 405
           +IR VSV           LFF+ETSALDSTNV TA  +
Sbjct: 174 NIRAVSVEEGKALAEEEGLFFVETSALDSTNVKTAFEM 211



 Score = 50.4 bits (119), Expect(2) = 2e-71
 Identities = 25/32 (78%), Positives = 28/32 (87%)
 Frame = -1

Query: 411 EIVIRDIYKNVSRKLLNSDSYKAELSVNRVSL 316
           E+VI DIY NVSRK LNSD+YK EL+VNRVSL
Sbjct: 210 EMVILDIYNNVSRKQLNSDTYKDELTVNRVSL 241



>sp|P19892|ARA1_ARATH Ras-related protein ARA-1.>pir|JS0163|JS0163
           GTP-binding protein ara - Arabidopsis
           thaliana>gb:AE005172_889599 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:ATHRAS_1553335 Arabidopsis thaliana
           ras-related protein (ara) gene, complete
           cds.>gb:T20M3_1723732 Sequence of BAC T20M3 from
           Arabidopsis thaliana chromosome 1, complete
           sequence.>gb:AF332457_1787269 Arabidopsis thaliana clone
           C00163 putative RAS-related protein ARA-1 (At1g05810)
           mRNA, partial cds.
          Length = 218

 Score =  243 bits (619), Expect(2) = 2e-71
 Identities = 121/158 (76%), Positives = 136/158 (86%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+VVIGDSAVGKSNLLSR+AR+EF  NSKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct: 11  YLFKIVVIGDSAVGKSNLLSRYARNEFSANSKATIGVEFQTQSMEIEGKEVKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFRAVTSAYYRGAVGAL+VYDITR+TTFE++ RWL+EL  H DTTVARMLVGNKCDLE
Sbjct: 71  QERFRAVTSAYYRGAVGALVVYDITRRTTFESVGRWLDELKIHSDTTVARMLVGNKCDLE 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRL 405
           +IR VSV           LFF+ETSALDSTNV TA  +
Sbjct: 131 NIRAVSVEEGKALAEEEGLFFVETSALDSTNVKTAFEM 168



 Score = 50.4 bits (119), Expect(2) = 2e-71
 Identities = 25/32 (78%), Positives = 28/32 (87%)
 Frame = -1

Query: 411 EIVIRDIYKNVSRKLLNSDSYKAELSVNRVSL 316
           E+VI DIY NVSRK LNSD+YK EL+VNRVSL
Sbjct: 167 EMVILDIYNNVSRKQLNSDTYKDELTVNRVSL 198



>gb:AY063847_1565795 Arabidopsis thaliana putative RAS-related
           protein ARA-1 (At1g05810) mRNA, complete cds.
          Length = 218

 Score =  241 bits (616), Expect(2) = 4e-71
 Identities = 120/158 (75%), Positives = 136/158 (86%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+VVIGDSAVGKSNLLSR+AR+EF  NSKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct: 11  YLFKIVVIGDSAVGKSNLLSRYARNEFSANSKATIGVEFQTQSMEIEGKEVKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFRAVTSAYYRGAVGAL+VYDITR+TTFE++ RWL++L  H DTTVARMLVGNKCDLE
Sbjct: 71  QERFRAVTSAYYRGAVGALVVYDITRRTTFESVGRWLDQLKIHSDTTVARMLVGNKCDLE 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRL 405
           +IR VSV           LFF+ETSALDSTNV TA  +
Sbjct: 131 NIRAVSVEEGKALAEEEGLFFVETSALDSTNVKTAFEM 168



 Score = 50.4 bits (119), Expect(2) = 4e-71
 Identities = 25/32 (78%), Positives = 28/32 (87%)
 Frame = -1

Query: 411 EIVIRDIYKNVSRKLLNSDSYKAELSVNRVSL 316
           E+VI DIY NVSRK LNSD+YK EL+VNRVSL
Sbjct: 167 EMVILDIYNNVSRKQLNSDTYKDELTVNRVSL 198



>gb:AP003888_1834876 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1191_A10.
          Length = 216

 Score =  235 bits (599), Expect(2) = 5e-71
 Identities = 114/158 (72%), Positives = 138/158 (87%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ ++++GK+VKAQ+WDTAG
Sbjct: 12  YLFKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMDINGKDVKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFRAVTSAYYRGA GAL+VYDI+R++TF+N+ RWL+ELNTH DTTVA+MLVGNKCDL+
Sbjct: 72  QERFRAVTSAYYRGAFGALLVYDISRRSTFDNVGRWLQELNTHSDTTVAKMLVGNKCDLD 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRL 405
           +IR+V V           LFF+ETSALDSTNV TA  +
Sbjct: 132 NIREVPVEEGKALAEAEGLFFMETSALDSTNVRTAFEI 169



 Score = 56.6 bits (135), Expect(2) = 5e-71
 Identities = 29/43 (67%), Positives = 36/43 (83%), Gaps = 1/43 (2%)
 Frame = -1

Query: 411 EIVIRDIYKNVSRKLLNSDSYKAELSVNRVSL-ANGADMSKQN 286
           EIVI++IY NVSRK+LNSDSYKAELS+NRVS+  +  D  KQ+
Sbjct: 168 EIVIKEIYSNVSRKILNSDSYKAELSLNRVSIEGDSKDDQKQS 210



>pir|G84723|G84723 probable RAS type GTP-binding protein [imported]
           - Arabidopsis thaliana>gb:AC007071_1535196 Arabidopsis
           thaliana chromosome 2 clone T9H9 map nga361, complete
           sequence.>gb:BT009720_1640181 Arabidopsis thaliana
           At2g31680 gene, complete cds.
          Length = 219

 Score =  240 bits (613), Expect(2) = 3e-70
 Identities = 119/158 (75%), Positives = 138/158 (87%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct: 11  YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQNMEIEGKEVKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFRAVTSAYYRGAVGAL+VYDI+R++TFE++ RWL+EL TH DTTVARMLVGNKCDLE
Sbjct: 71  QERFRAVTSAYYRGAVGALVVYDISRRSTFESVGRWLDELKTHSDTTVARMLVGNKCDLE 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRL 405
           SIR VSV           LFF+ETSALDSTNV TA  +
Sbjct: 131 SIRAVSVEEGKALAETEGLFFMETSALDSTNVKTAFEM 168



 Score = 48.9 bits (115), Expect(2) = 3e-70
 Identities = 26/40 (65%), Positives = 31/40 (77%), Gaps = 1/40 (2%)
 Frame = -1

Query: 411 EIVIRDIYKNVSRKLLNSDSYKAELSV-NRVSLANGADMS 295
           E+VIRDIY N+SRK LNSD+YK ELS+ NRVSL    + S
Sbjct: 167 EMVIRDIYTNISRKQLNSDTYKTELSMKNRVSLVKDDNKS 206



>gb:AY085494_1570563 Arabidopsis thaliana clone 15416 mRNA, complete
           sequence.
          Length = 219

 Score =  233 bits (595), Expect(2) = 3e-68
 Identities = 116/158 (73%), Positives = 136/158 (86%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVE +TQ +E++GKEVKAQ+WDTA 
Sbjct: 11  YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVELETQNMEIEGKEVKAQIWDTAC 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFRAVTSAYYRGAVGAL+VYDI+R++TFE++ RWL+EL TH DTTVARMLVGNKCDLE
Sbjct: 71  QERFRAVTSAYYRGAVGALVVYDISRRSTFESVGRWLDELKTHSDTTVARMLVGNKCDLE 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRL 405
           SIR VSV           LFF+ETSALDSTNV TA  +
Sbjct: 131 SIRAVSVEEGKALAETEGLFFMETSALDSTNVKTAFEM 168



 Score = 48.9 bits (115), Expect(2) = 3e-68
 Identities = 26/40 (65%), Positives = 31/40 (77%), Gaps = 1/40 (2%)
 Frame = -1

Query: 411 EIVIRDIYKNVSRKLLNSDSYKAELSV-NRVSLANGADMS 295
           E+VIRDIY N+SRK LNSD+YK ELS+ NRVSL    + S
Sbjct: 167 EMVIRDIYTNISRKQLNSDTYKTELSMKNRVSLVKDDNKS 206



>pir|S52024|S52024 GTP-binding protein bra - rape>gb:BNANAPZ_1633473
           Brassica napus small GTP-binding protein (bra) mRNA,
           complete cds.
          Length = 219

 Score =  234 bits (598), Expect(2) = 3e-66
 Identities = 114/158 (72%), Positives = 138/158 (87%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GK+VKAQ+WDTAG
Sbjct: 11  YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQSMEIEGKDVKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFRAVTSAYYRGAVGAL+VYDI+R++TFE++ RWL+EL TH DTTVARMLVGNKCDL+
Sbjct: 71  QERFRAVTSAYYRGAVGALVVYDISRRSTFESVARWLDELKTHSDTTVARMLVGNKCDLD 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRL 405
           ++R VSV           LFF+ETSAL+STNV TA  +
Sbjct: 131 NMRAVSVEEGKALAETQGLFFMETSALNSTNVKTAFEM 168



 Score = 41.2 bits (95), Expect(2) = 3e-66
 Identities = 23/33 (69%), Positives = 25/33 (75%), Gaps = 1/33 (3%)
 Frame = -1

Query: 411 EIVIRDIYKNVSRKLLNSDSYKAELSVN-RVSL 316
           E+VIRDIY N SRK LNSD +K EL  N RVSL
Sbjct: 167 EMVIRDIYANFSRKQLNSDMHKTELKWNSRVSL 199



>gb:AB025628_1516508 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MNJ7.>gb:BT004809_1637843 Arabidopsis thaliana
           At5g47520 gene, complete cds.
          Length = 221

 Score =  214 bits (545), Expect(2) = 3e-55
 Identities = 106/155 (68%), Positives = 127/155 (81%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct: 13  YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG 72

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFRAVTSAYYRGAVGAL+VYDI+R+ TF +I RWL EL+TH D  V  +LVGNK DL+
Sbjct: 73  QERFRAVTSAYYRGAVGALLVYDISRRQTFHSIGRWLNELHTHSDMNVVTILVGNKSDLK 132

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +R+VS            LFF+ETSALDS+NV  A
Sbjct: 133 DLREVSTAEGKALAEAQGLFFMETSALDSSNVAAA 167



 Score = 24.6 bits (52), Expect(2) = 3e-55
 Identities = 12/35 (34%), Positives = 22/35 (62%)
 Frame = -1

Query: 411 EIVIRDIYKNVSRKLLNSDSYKAELSVNRVSLANG 307
           E V+++IY  +SRK+++S     +   +  SL+NG
Sbjct: 169 ETVVKEIYNILSRKVMSSQELNKQ---DPASLSNG 200



>gb:LJRAB11J_1685020 L.japonicus mRNA for small GTP-binding protein,
           RAB11J.
          Length = 223

 Score =  214 bits (545), Expect = 2e-54
 Identities = 105/157 (66%), Positives = 128/157 (81%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct: 13  YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKIDINGKEIKAQIWDTAG 72

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct: 73  QERFRAVTSAYYRGAVGALVVYDISRRQTFDSIGRWLNELHTHSDMNVVTILVGNKSDLK 132

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
             R+V+            LFF+ETSALDS+NV  A +
Sbjct: 133 DAREVTTAEGKALAEAQGLFFMETSALDSSNVAAAFQ 169



>gb:VFGNRPR4_1727141 V.faba mRNA for guanine nucleotide regulatory
           protein (1226bp).
          Length = 223

 Score =  213 bits (542), Expect(2) = 4e-54
 Identities = 107/157 (68%), Positives = 128/157 (81%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct: 13  YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMEINGKEVKAQIWDTAG 72

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct: 73  QERFRAVTSAYYRGAVGALLVYDISRRQTFDSIGRWLNELHTHSDMNVVTILVGNKSDLK 132

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
             R+V             LFF+ETSALDS+NV +A +
Sbjct: 133 DAREVPTPEGKALAEAQGLFFMETSALDSSNVVSAFQ 169



 Score = 21.9 bits (45), Expect(2) = 4e-54
 Identities = 8/24 (33%), Positives = 16/24 (66%)
 Frame = -1

Query: 411 EIVIRDIYKNVSRKLLNSDSYKAE 340
           + V+++IY  +SRK++ S   K +
Sbjct: 169 QTVVKEIYNILSRKVMMSQELKKQ 192



>gb:AF165095_1773721 Gossypium hirsutum Rab GTP-binding protein
           Rab11a mRNA, complete cds.
          Length = 224

 Score =  211 bits (538), Expect = 1e-53
 Identities = 105/157 (66%), Positives = 126/157 (80%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V++GDSAVGKSNLL+RFAR+EF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct: 13  YLFKIVLVGDSAVGKSNLLARFARNEFYPNSKSTIGVEFQTQKLDINGKEVKAQIWDTAG 72

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL TH D  V  +LVGNK DL 
Sbjct: 73  QERFRAVTSAYYRGAVGALLVYDISRRQTFDSIGRWLNELQTHSDMNVVTILVGNKSDLR 132

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
             R+VS            LFF+ETSALDS+NV  A +
Sbjct: 133 DAREVSTAEGKALAEAQGLFFMETSALDSSNVAAAFQ 169



>pir|S41432|S41432 GTP-binding protein, ras-like (clone vfa-yptx) -
           fava bean
          Length = 223

 Score =  211 bits (536), Expect(2) = 2e-53
 Identities = 105/157 (66%), Positives = 126/157 (80%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct: 13  YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMEINGKEVKAQIWDTAG 72

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFRA TSAYYRGAVGAL+VYDI+R+ TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct: 73  QERFRAETSAYYRGAVGALLVYDISRRQTFDSIGRWLNELHTHSDMNVVTILVGNKSDLK 132

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
             R+V              FF+ETSALDS+NV +A +
Sbjct: 133 DAREVPTPEGKALAEAQGFFFMETSALDSSNVVSAFQ 169



 Score = 21.9 bits (45), Expect(2) = 2e-53
 Identities = 8/24 (33%), Positives = 16/24 (66%)
 Frame = -1

Query: 411 EIVIRDIYKNVSRKLLNSDSYKAE 340
           + V+++IY  +SRK++ S   K +
Sbjct: 169 QTVVKEIYNILSRKVMMSQELKKQ 192



>gb:AP004334_1840388 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0455H11.
          Length = 220

 Score =  209 bits (533), Expect(2) = 4e-53
 Identities = 103/157 (65%), Positives = 127/157 (80%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V++GDS+VGKSNLL+RFAR+EF  NSK+TIGVEFQTQ + +DGKE+KAQ+WDTAG
Sbjct: 13  YLFKIVLLGDSSVGKSNLLARFARNEFYPNSKSTIGVEFQTQKLVIDGKEIKAQIWDTAG 72

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFRAVTSAYYRGAVGAL+VYDI+R+ TF+++ RWL EL+TH D  V  +LVGNK DL+
Sbjct: 73  QERFRAVTSAYYRGAVGALLVYDISRRQTFDSVGRWLNELHTHSDMNVVTILVGNKTDLK 132

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
             R+VS            LFF+ETSALDS+NV  A +
Sbjct: 133 HAREVSTAEGKALAESQGLFFMETSALDSSNVAEAFQ 169



 Score = 22.3 bits (46), Expect(2) = 4e-53
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = -1

Query: 411 EIVIRDIYKNVSRKLLNSDSYKAELSVNRVSLANG 307
           + V+++IY  +SRK+  S   K     +  SL+NG
Sbjct: 169 QTVVKEIYGILSRKVFQSQEQKR----SEQSLSNG 199



>gb:MCU87143_1685893 Mesembryanthemum crystallinum Nt-rab11e homolog
           mRNA, partial cds.
          Length = 167

 Score =  169 bits (428), Expect(2) = 2e-52
 Identities = 82/117 (70%), Positives = 95/117 (81%)
 Frame = -2

Query: 755 QVVEVDGKEVKAQVWDTAGQERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELN 576
           Q +++DGK+VKAQ+WDTAGQERFRAVTSAYYRGAVGAL+VYDITR+TTF++I RWL+EL 
Sbjct: 1   QSIDIDGKKVKAQIWDTAGQERFRAVTSAYYRGAVGALVVYDITRRTTFDSISRWLDELK 60

Query: 575 THCDTTVARMLVGNKCDLESIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRL 405
           TH DTTVARMLVGNKCDL+ IR VS            LFFIETSA DSTNV T+  +
Sbjct: 61  THSDTTVARMLVGNKCDLDDIRAVSTDEGKSLAEEHGLFFIETSAKDSTNVKTSFEI 117



 Score = 60.1 bits (144), Expect(2) = 2e-52
 Identities = 32/43 (74%), Positives = 37/43 (86%)
 Frame = -1

Query: 411 EIVIRDIYKNVSRKLLNSDSYKAELSVNRVSLANGADMSKQNK 283
           EIVI++IY +VSRK+LNSDSYKAELSVNRVSL N  D  KQN+
Sbjct: 116 EIVIKEIYCSVSRKVLNSDSYKAELSVNRVSLVND-DKQKQNQ 157



>pir|T12580|T12580 GTP-binding protein Rab11e - common ice plant
           (fragment)
          Length = 167

 Score =  169 bits (428), Expect(2) = 2e-52
 Identities = 82/117 (70%), Positives = 95/117 (81%)
 Frame = -2

Query: 755 QVVEVDGKEVKAQVWDTAGQERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELN 576
           Q +++DGK+VKAQ+WDTAGQERFRAVTSAYYRGAVGAL+VYDITR+TTF++I RWL+EL 
Sbjct: 1   QSIDIDGKKVKAQIWDTAGQERFRAVTSAYYRGAVGALVVYDITRRTTFDSISRWLDELK 60

Query: 575 THCDTTVARMLVGNKCDLESIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRL 405
           TH DTTVARMLVGNKCDL+ IR VS            LFFIETSA DSTNV T+  +
Sbjct: 61  THSDTTVARMLVGNKCDLDDIRAVSTDEGKSLAEEHGLFFIETSAKDSTNVKTSFEI 117



 Score = 60.1 bits (144), Expect(2) = 2e-52
 Identities = 32/43 (74%), Positives = 37/43 (86%)
 Frame = -1

Query: 411 EIVIRDIYKNVSRKLLNSDSYKAELSVNRVSLANGADMSKQNK 283
           EIVI++IY +VSRK+LNSDSYKAELSVNRVSL N  D  KQN+
Sbjct: 116 EIVIKEIYCSVSRKVLNSDSYKAELSVNRVSLVND-DKQKQNQ 157



>gb:AC092852_1735758 Oryza sativa chromosome 3 BAC OSJNBa0032G11
           genomic sequence, complete sequence.
          Length = 223

 Score =  206 bits (524), Expect = 6e-52
 Identities = 98/157 (62%), Positives = 125/157 (79%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDS VGKSNLLSRF R+ F  +SK+TIGVEF T+ ++V+GK VKAQ+WDTAG
Sbjct: 17  YLFKIVLIGDSGVGKSNLLSRFTRNSFSLDSKSTIGVEFATRTIQVEGKIVKAQIWDTAG 76

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+T+ TTFEN+KRWL+EL  H D+ +  ML+GNK DL+
Sbjct: 77  QERYRAITSAYYRGAVGALLVYDVTKATTFENVKRWLKELRDHADSNIVVMLIGNKIDLK 136

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R VS+           L F+ETSALD+TNV+ A +
Sbjct: 137 HLRSVSLEDATSFAEREGLSFVETSALDATNVDKAFQ 173



>sp|Q39572|YPT6_CHLRE Ras-related protein YPTC6.>pir|JC4108|JC4108
           GTP-binding protein yptC6 - Chlamydomonas
           reinhardtii>gb:CRU13169_1673613 Chlamydomonas
           reinhardtii YptC6 (yptC6) gene, complete cds.
          Length = 216

 Score =  206 bits (523), Expect = 8e-52
 Identities = 101/157 (64%), Positives = 122/157 (77%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF   SK+TIGVEF T+ ++VDGK +KAQ+WDTAG
Sbjct: 11  YLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIQVDGKTIKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDIT+  TFEN++RWL+EL  H D+ +  MLVGNK DL+
Sbjct: 71  QERYRAITSAYYRGAVGALLVYDITKSVTFENVERWLKELRDHADSNIVIMLVGNKSDLK 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +RDV             L FIETSAL+STNV  A +
Sbjct: 131 HLRDVQTEVAQAFCEREGLSFIETSALESTNVEKAFQ 167



>gb:AF165096_1773722 Gossypium hirsutum Rab GTP-binding protein
           Rab11b mRNA, complete cds.
          Length = 224

 Score =  205 bits (521), Expect = 1e-51
 Identities = 103/157 (65%), Positives = 124/157 (78%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+ GDSAVGKSNLL+RFAR+EF  +SK+TIGVE QTQ ++++GKEVKAQ+WDTAG
Sbjct: 13  YLFKIVLDGDSAVGKSNLLARFARNEFYPDSKSTIGVELQTQKLDINGKEVKAQIWDTAG 72

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL TH D  V  +LVGNK DL 
Sbjct: 73  QERFRAVTSAYYRGAVGALLVYDISRRQTFDSIGRWLNELQTHSDMNVVTILVGNKSDLR 132

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
             R+VS            LFF+ETSALDS+NV  A +
Sbjct: 133 DAREVSTAEGKALAEAQGLFFMETSALDSSNVAAAFQ 169



>gb:AP005811_1858284 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0706E03.
          Length = 216

 Score =  203 bits (517), Expect = 4e-51
 Identities = 100/155 (64%), Positives = 118/155 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF   SK+TIGVEF T+ + VD K VKAQ+WDTAG
Sbjct: 11  YLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR  TFEN++RWL+EL  H D  +  MLVGNK DL 
Sbjct: 71  QERYRAITSAYYRGAVGALVVYDVTRHVTFENVERWLKELRDHTDANIVIMLVGNKADLR 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +R VSV            FF+ETSAL+S NV +A
Sbjct: 131 HLRAVSVEDAKGFAERESTFFMETSALESMNVESA 165



>gb:GMU58853_1680707 Glycine max small GTP-binding protein (sra1)
           mRNA, partial cds.
          Length = 222

 Score =  203 bits (517), Expect = 4e-51
 Identities = 99/155 (63%), Positives = 123/155 (79%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           Y+FKVV+IGDSAVGKS +L+RFAR+EF  +SK+TIGVEFQT+ + +D K VKAQ+WDTAG
Sbjct: 12  YVFKVVLIGDSAVGKSQILARFARNEFSLDSKSTIGVEFQTRTLVIDHKTVKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RAVTSAYYRGAVGA++VYDIT++ TF++I RWLEEL  H D  +  +L GNKCDLE
Sbjct: 72  QERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILTGNKCDLE 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
           + RDV             LFF+ETSAL++TNV TA
Sbjct: 132 NQRDVPTEDAKEFAEKEGLFFLETSALEATNVETA 166



>gb:AE014297_1140590 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE014297_1140591 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AB035354_1195213
           Drosophila melanogaster mRNA for Drab11, complete
           cds.>gb:AE003733_1222583 Drosophila melanogaster
           chromosome 3R, section 71 of 118 of the complete
           sequence.>gb:AE003733_1222584 Drosophila melanogaster
           chromosome 3R, section 71 of 118 of the complete
           sequence.>gb:AY070528_1294673 Drosophila melanogaster
           GM06568 full length cDNA.>gb:AY113404_1299352 Drosophila
           melanogaster RE11886 full insert cDNA.>gb:D84315_1376302
           Drosophila melanogaster mRNA for rab11, complete cds.
          Length = 214

 Score =  203 bits (517), Expect = 4e-51
 Identities = 101/157 (64%), Positives = 119/157 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ +EVDGK +KAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN++RWL EL  H D  +  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L FIETSALDSTNV TA +
Sbjct: 130 HLRSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQ 166



>pir|T07059|T07059 GTP-binding protein sra1 - soybean (fragment)
          Length = 222

 Score =  203 bits (517), Expect = 4e-51
 Identities = 99/155 (63%), Positives = 123/155 (79%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           Y+FKVV+IGDSAVGKS +L+RFAR+EF  +SK+TIGVEFQT+ + +D K VKAQ+WDTAG
Sbjct: 12  YVFKVVLIGDSAVGKSQILARFARNEFSLDSKSTIGVEFQTRTLVIDHKTVKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RAVTSAYYRGAVGA++VYDIT++ TF++I RWLEEL  H D  +  +L GNKCDLE
Sbjct: 72  QERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILTGNKCDLE 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
           + RDV             LFF+ETSAL++TNV TA
Sbjct: 132 NQRDVPTEDAKEFAEKEGLFFLETSALEATNVETA 166



>gb:BC085585_2564483 Danio rerio zgc:103679, mRNA (cDNA clone
           MGC:103679 IMAGE:7261727), complete cds.
          Length = 215

 Score =  202 bits (515), Expect = 7e-51
 Identities = 100/157 (63%), Positives = 121/157 (77%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ ++VDGK VKAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTVKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN++RWL+EL  H D+ +  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L F+ETSALDSTNV TA +
Sbjct: 130 HLRAVPTDEARAFAEKNGLSFLETSALDSTNVETAFQ 166



>gb:AY690483_1622462 Triticum aestivum rab GTP-binding protein mRNA,
           complete cds.
          Length = 216

 Score =  201 bits (512), Expect = 1e-50
 Identities = 99/155 (63%), Positives = 117/155 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLL+RF R+EF   SK+TIGVEF T+ + VD K VKAQ+WDTAG
Sbjct: 11  YLFKVVLIGDSGVGKSNLLTRFTRNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR  TFEN++RWL+EL  H D  +  MLVGNK DL 
Sbjct: 71  QERYRAITSAYYRGAVGALVVYDVTRHVTFENVERWLKELKDHTDANIVIMLVGNKADLR 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +R VSV            FF+ETSAL+S NV  A
Sbjct: 131 HLRAVSVEDAKAFAEREYTFFMETSALESMNVEDA 165



>gb:BT001785_1356558 Drosophila melanogaster RH21315 full insert
           cDNA.
          Length = 214

 Score =  201 bits (512), Expect = 1e-50
 Identities = 100/157 (63%), Positives = 118/157 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF+  S +TIGVEF T+ +EVDGK +KAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESNSTIGVEFATRSIEVDGKTIKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN++RWL EL  H D  +  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L FIETSALDSTNV TA +
Sbjct: 130 HLRSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQ 166



>gb:AY588075_1339434 Homalodisca coagulata putative rab11 mRNA,
           complete cds.
          Length = 215

 Score =  201 bits (512), Expect = 1e-50
 Identities = 100/155 (64%), Positives = 118/155 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ ++VDGK +KAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN++RWL EL  H D  +  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +R V             L FIETSALDSTNV TA
Sbjct: 130 HLRAVPTDEARTFAERNGLSFIETSALDSTNVETA 164



>gb:AJ720402_2502589 Gallus gallus mRNA for hypothetical protein,
           clone 16p4.
          Length = 216

 Score =  201 bits (511), Expect = 2e-50
 Identities = 99/157 (63%), Positives = 120/157 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ ++VDGK +KAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN++RWL+EL  H D+ +  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L FIETSALDSTNV  A +
Sbjct: 130 HLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQ 166



>gb:BT007615_2150547 Synthetic construct Homo sapiens RAB11A, member
           RAS oncogene family mRNA, partial
           cds.>gb:BT020153_2151724 Synthetic construct Homo
           sapiens RAB11A, member RAS oncogene family mRNA, partial
           cds.>gb:BT020156_2151725 Synthetic construct Homo
           sapiens RAB11A, member RAS oncogene family mRNA, partial
           cds.
          Length = 217

 Score =  201 bits (511), Expect = 2e-50
 Identities = 99/157 (63%), Positives = 120/157 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ ++VDGK +KAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN++RWL+EL  H D+ +  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L FIETSALDSTNV  A +
Sbjct: 130 HLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQ 166



>gb:AF127669_2055549 Mus musculus small GTPase (Rab11a) gene,
           complete cds.
          Length = 216

 Score =  201 bits (511), Expect = 2e-50
 Identities = 99/157 (63%), Positives = 120/157 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ ++VDGK +KAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN++RWL+EL  H D+ +  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L FIETSALDSTNV  A +
Sbjct: 130 HLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQ 166



>gb:CR541691_1993921 Homo sapiens full open reading frame cDNA clone
           RZPDo834D1128D for gene RAB11B, RAB11B, member RAS
           oncogene family; complete cds, without stopcodon.
          Length = 218

 Score =  201 bits (511), Expect = 2e-50
 Identities = 99/157 (63%), Positives = 120/157 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ ++VDGK +KAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN++RWL+EL  H D+ +  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L FIETSALDSTNV  A +
Sbjct: 130 HLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFK 166



>gb:ATU46926_1557029 Arabidopsis thaliana GTP-binding protein ATGB3
           mRNA, complete cds.
          Length = 224

 Score =  201 bits (511), Expect = 2e-50
 Identities = 103/181 (56%), Positives = 131/181 (72%), Gaps = 5/181 (2%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           Y+FKVV+IGDSAVGKS LL+RFARDEF  +SKATIGVEFQT+ + ++ K +KAQ+WDTAG
Sbjct: 16  YVFKVVLIGDSAVGKSQLLARFARDEFSMDSKATIGVEFQTRTLSIEQKSIKAQIWDTAG 75

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RAVTSAYYRGAVGA++VYD+T++ TFE+I RWLEEL  H D  +  +L+GNK DLE
Sbjct: 76  QERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKSDLE 135

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNV----NTALRLSFAT-STRTLAGSCSTPT 354
             R V             LFF+ETSAL++TNV    NT +   + T + + LA  C +  
Sbjct: 136 DQRAVPTEDAKEFAEKEGLFFLETSALNATNVENSFNTLMTQIYNTVNKKNLASECDSNN 195

Query: 353 P 351
           P
Sbjct: 196 P 196



>gb:AX885919_1481372 Sequence 1782 from Patent EP1033401.
          Length = 194

 Score =  201 bits (511), Expect = 2e-50
 Identities = 98/157 (62%), Positives = 119/157 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ ++VDGK +KAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN++RWL+EL  H D+ +  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V               FIETSALDSTNV  A +
Sbjct: 130 HLRAVPTDEARAFAEKNNXSFIETSALDSTNVEEAFK 166



>sp|P46638|R11B_MOUSE Ras-related protein Rab-11B.>pir|A55005|A55005
           GTP-binding protein Rab11b - mouse>gb:AF528162_1188182
           Mus musculus strain 129/Sv chromosome 17 clone 309m19,
           *** SEQUENCING IN PROGRESS ***, 4 ordered
           pieces.>gb:BC054753_2101793 Mus musculus RAB11B, member
           RAS oncogene family, mRNA (cDNA clone MGC:65651
           IMAGE:6411651), complete cds.>gb:BC085270_2109150 Mus
           musculus RAB11B, member RAS oncogene family, mRNA (cDNA
           clone MGC:103195 IMAGE:6478784), complete
           cds.>gb:MUSRAB11B_2129807 Mus musculus Rab11b mRNA,
           complete cds.
          Length = 218

 Score =  201 bits (511), Expect = 2e-50
 Identities = 99/157 (63%), Positives = 120/157 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ ++VDGK +KAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN++RWL+EL  H D+ +  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L FIETSALDSTNV  A +
Sbjct: 130 HLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFK 166



>sp|Q15907|R11B_HUMAN Ras-related protein Rab-11B (GTP-binding
           protein YPT3).>gb:AF498947_1905331 Homo sapiens small
           GTP binding protein RAB11B (RAB11B) mRNA, complete
           cds.>gb:BT019536_1991118 Homo sapiens RAB11B, member RAS
           oncogene family mRNA, complete cds.>gb:AF286534_2061556
           Rattus norvegicus GTP-binding protein RAB11B (Rab11b)
           mRNA, complete cds.>gb:BC062041_2104816 Rattus
           norvegicus RAB11B, member RAS oncogene family, mRNA
           (cDNA clone MGC:72373 IMAGE:5598168), complete cds.
          Length = 218

 Score =  201 bits (511), Expect = 2e-50
 Identities = 99/157 (63%), Positives = 120/157 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ ++VDGK +KAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN++RWL+EL  H D+ +  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L FIETSALDSTNV  A +
Sbjct: 130 HLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFK 166



>sp|P24410|R11A_HUMAN Ras-related protein Rab-11A (Rab-11) (24KG)
           (YL8).>pir|S47169|S47169 GTP-binding protein Rab11 -
           human>pir|E36364|E36364 GTP-binding protein rab11 -
           dog>pir|JN0056|JN0056 GTP-binding protein rab11 -
           rat>gb:AK014268_1157846 Mus musculus 13 days embryo head
           cDNA, RIKEN full-length enriched library,
           clone:3110082B04 product:RAB11a, member RAS oncogene
           family, full insert sequence.>gb:CR859359_1183478 Pongo
           pygmaeus mRNA; cDNA DKFZp469L0820 (from clone
           DKFZp469L0820).>gb:CFRAB11_1438652 Canine rab11 mRNA for
           ras-related GTP-binding protein.>gb:RABTUBULO_1444172
           Rabbit tubulovesicle-associated protein Rab11 mRNA,
           complete cds.>gb:AF000231_1875697 Homo sapiens rab11a
           GTPase mRNA, complete cds.>gb:AF498946_1905330 Homo
           sapiens small GTP binding protein RAB11A (RAB11A) mRNA,
           complete cds.>gb:BC013348_1974056 Homo sapiens RAB11A,
           member RAS oncogene family, mRNA (cDNA clone MGC:1490
           IMAGE:3510339), complete cds.>gb:BT020151_1991411 Homo
           sapiens RAB11A, member RAS oncogene family mRNA,
           complete cds.>gb:BT020154_1991412 Homo sapiens RAB11A,
           member RAS oncogene family mRNA, complete
           cds.>gb:CR407669_1992523 Homo sapiens full open reading
           frame cDNA clone RZPDo834B053D for gene RAB11A, RAB11A,
           member RAS oncogene family complete cds, without
           stopcodon.>gb:CR536493_1993788 Homo sapiens full open
           reading frame cDNA clone RZPDo834F1017D for gene RAB11A,
           RAB11A, member RAS oncogene family; complete cds, incl.
           stopcodon.>gb:HSMRAB11_2018881 H.sapiens mRNA for Rab11
           gene.>gb:HSRASLP_2019907 Human YL8 mRNA for ras-like
           protein.>gb:BC010722_2091072 Mus musculus RAB11a, member
           RAS oncogene family, mRNA (cDNA clone MGC:6317
           IMAGE:2811973), complete cds.>gb:BC085727_2109299 Rattus
           norvegicus RAB11a, member RAS oncogene family, mRNA
           (cDNA clone MGC:93374 IMAGE:7189729), complete
           cds.>gb:RATRASP21_2133657 R.norvegicus ras p21-like
           small GTP-binding protein (24KG) mRNA, complete cds.
          Length = 216

 Score =  201 bits (511), Expect = 2e-50
 Identities = 99/157 (63%), Positives = 120/157 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ ++VDGK +KAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN++RWL+EL  H D+ +  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L FIETSALDSTNV  A +
Sbjct: 130 HLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQ 166



>gb:BC082421_2562657 Xenopus laevis hypothetical LOC494642, mRNA
           (cDNA clone MGC:83288 IMAGE:6863246), complete
           cds.>gb:BC084173_2563564 Xenopus tropicalis hypothetical
           LOC496458, mRNA (cDNA clone MGC:79602 IMAGE:6979289),
           complete cds.
          Length = 218

 Score =  201 bits (510), Expect = 3e-50
 Identities = 99/157 (63%), Positives = 119/157 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ ++VDGK +KAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN++RWL+EL  H D  +  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L FIETSALDSTNV  A +
Sbjct: 130 HLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFK 166



>gb:BT019535_1991117 Homo sapiens RAB11B, member RAS oncogene family
           mRNA, complete cds.
          Length = 218

 Score =  201 bits (510), Expect = 3e-50
 Identities = 99/157 (63%), Positives = 120/157 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ ++VDGK +KAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN++RWL+EL  H D+ +  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSDIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L FIETSALDSTNV  A +
Sbjct: 130 HLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFK 166



>gb:VFGNRPR2_1727139 V.faba mRNA for guanine nucleotide regulatory
           protein (744bp).
          Length = 207

 Score =  201 bits (510), Expect = 3e-50
 Identities = 98/155 (63%), Positives = 117/155 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF ++EF   SK+TIGVEF T+ + VD K VKAQ+WDTAG
Sbjct: 2   YLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAG 61

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR  TFEN++RWL+EL  H D  +  MLVGNK DL 
Sbjct: 62  QERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDANIVVMLVGNKADLR 121

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +R VS             FF+ETSAL+S NV +A
Sbjct: 122 HLRAVSTEDSTAFAERENTFFMETSALESLNVESA 156



>gb:AY220456_1310447 Limulus polyphemus rab11-2 mRNA, complete cds.
          Length = 217

 Score =  201 bits (510), Expect = 3e-50
 Identities = 99/157 (63%), Positives = 120/157 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ ++VDGK +KAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN++RWL+EL  H D  +  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADQNIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L FIETSALDSTNV +A +
Sbjct: 130 HLRAVPTDEARAFAEKNNLSFIETSALDSTNVESAFQ 166



>pir|T12097|T12097 GTP-binding protein, ras-like (clone vfa-ypt3a) -
           fava bean  (fragment)
          Length = 207

 Score =  201 bits (510), Expect = 3e-50
 Identities = 98/155 (63%), Positives = 117/155 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF ++EF   SK+TIGVEF T+ + VD K VKAQ+WDTAG
Sbjct: 2   YLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAG 61

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR  TFEN++RWL+EL  H D  +  MLVGNK DL 
Sbjct: 62  QERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDANIVVMLVGNKADLR 121

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +R VS             FF+ETSAL+S NV +A
Sbjct: 122 HLRAVSTEDSTAFAERENTFFMETSALESLNVESA 156



>pir|T06447|T06447 GTP-binding protein - garden
           pea>gb:PEAGTPBP05_1699687 Pisum sativum mRNA for
           GTP-binding protein, complete cds, clone:pra5.
          Length = 217

 Score =  201 bits (510), Expect = 3e-50
 Identities = 98/155 (63%), Positives = 117/155 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF ++EF   SK+TIGVEF T+ + VD K VKAQ+WDTAG
Sbjct: 12  YLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR  TFEN++RWL+EL  H D  +  MLVGNK DL 
Sbjct: 72  QERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDANIVVMLVGNKADLR 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +R VS             FF+ETSAL+S NV +A
Sbjct: 132 HLRAVSTEDSTSFAEREHTFFMETSALESLNVESA 166



>sp|Q40521|R11B_TOBAC Ras-related protein Rab11B.>pir|T03620|T03620
           GTP-binding protein Rab11b - common
           tobacco>gb:TOBNTRAB_1725462 Nicotiana tabacum SR1
           Nt-rab11b mRNA, complete cds.
          Length = 217

 Score =  201 bits (510), Expect = 3e-50
 Identities = 99/155 (63%), Positives = 118/155 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDS VGKSNLLSRF+R+EF+  SK+TIGVEF T+ + VD K VKAQ+WDTAG
Sbjct: 13  YLFKLVLIGDSGVGKSNLLSRFSRNEFNLESKSTIGVEFATRSIRVDDKIVKAQIWDTAG 72

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDITR  TFEN++RWL+EL  H D  +  MLVGNK DL 
Sbjct: 73  QERYRAITSAYYRGAVGALVVYDITRHVTFENVERWLKELRDHTDQNIVIMLVGNKADLR 132

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +R VS             FF+ETSAL+S NV  A
Sbjct: 133 HLRAVSTEDAKAFAERENTFFMETSALESLNVENA 167



>sp|P22129|R11B_DISOM Ras-related protein Rab-11B
           (ORA3).>pir|C38625|C38625 GTP-binding protein ora3 -
           electric ray (Discopyge ommata)>gb:DYGORA3_2571459
           Discopyge ommata GTP-binding protein (ora3) mRNA,
           complete cds.
          Length = 218

 Score =  201 bits (510), Expect = 3e-50
 Identities = 99/157 (63%), Positives = 119/157 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ ++VDGK +KAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN++RWL+EL  H D  +  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L FIETSALDSTNV  A +
Sbjct: 130 HLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFK 166



>gb:BC081187_2562088 Xenopus laevis MGC84419 protein, mRNA (cDNA
           clone MGC:84419 IMAGE:7019309), complete cds.
          Length = 216

 Score =  200 bits (509), Expect = 3e-50
 Identities = 99/157 (63%), Positives = 119/157 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ ++VDGK +KAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN++RWL+EL  H D  +  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNKIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L FIETSALDSTNV  A +
Sbjct: 130 HLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQ 166



>gb:AC124143_1740431 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0053D02, complete sequence.
          Length = 217

 Score =  200 bits (509), Expect = 3e-50
 Identities = 98/155 (63%), Positives = 115/155 (74%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF   SK+TIGVEF T+ + VD K VKAQ+WDTAG
Sbjct: 11  YLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKVVKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR  TFEN++RW+ EL  H D  +  MLVGNK DL 
Sbjct: 71  QERYRAITSAYYRGAVGALVVYDVTRHVTFENVERWMRELKDHTDANIVIMLVGNKADLR 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +R VS             FF+ETSAL+S NV  A
Sbjct: 131 HLRAVSTEDAKAFAEKENTFFMETSALESMNVENA 165



>gb:AC010155_1536914 Genomic sequence for Arabidopsis thaliana BAC
           F3M18 from chromosome I, complete sequence.
          Length = 218

 Score =  200 bits (509), Expect = 3e-50
 Identities = 95/155 (61%), Positives = 118/155 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+ GDS VGKSNLLSRF R++F H+S+ATIGVEF T+ ++ D K VKAQ+WDTAG
Sbjct: 12  YLFKVVLTGDSGVGKSNLLSRFTRNDFSHDSRATIGVEFATRSIQCDDKIVKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR  TFEN++RWL+EL  H D  +  MLVGNK DL 
Sbjct: 72  QERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDANIVIMLVGNKADLR 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +R +S             FF+ETSAL++ NV+ A
Sbjct: 132 HLRAISTEEAKAFAERENTFFMETSALEAVNVDNA 166



>gb:AY220749_1310454 Limulus polyphemus Rab11-1a mRNA, complete
           cds.>gb:AY220750_1310455 Limulus polyphemus Rab11-1b
           mRNA, complete cds.
          Length = 217

 Score =  200 bits (509), Expect = 3e-50
 Identities = 99/157 (63%), Positives = 119/157 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ ++VDGK +KAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN++RWL+EL  H D  +  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADQNIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L FIETSALDSTNV  A +
Sbjct: 130 HLRAVPTDEARAFAEKNILSFIETSALDSTNVEAAFQ 166



>gb:AY220748_1310453 Limulus polyphemus Rab11-1c mRNA, complete cds.
          Length = 217

 Score =  200 bits (509), Expect = 3e-50
 Identities = 99/157 (63%), Positives = 119/157 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ ++VDGK +KAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN++RWL+EL  H D  +  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADQNIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L FIETSALDSTNV  A +
Sbjct: 130 HLRAVPTDEARAFAEKNILSFIETSALDSTNVEVAFQ 166



>sp|Q40191|R11A_LOTJA Ras-related protein
           Rab11A.>gb:LJRAB11A_1685011 L.japonicus mRNA for small
           GTP-binding protein, RAB11A.
          Length = 226

 Score =  200 bits (509), Expect = 3e-50
 Identities = 97/155 (62%), Positives = 123/155 (79%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           Y+FKVV+IGDSAVGKS +L+RFAR+EF  +SK+TIGVEFQT+ + +D K VKAQ+WDTAG
Sbjct: 16  YVFKVVLIGDSAVGKSQILARFARNEFSLDSKSTIGVEFQTRTLVIDHKTVKAQIWDTAG 75

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RAVTSAYYRGAVGA++VYDIT++ TF++I RWLEEL  H D  +  +L+GNKCDL 
Sbjct: 76  QERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILIGNKCDLV 135

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
           + RDV             LFF+ETSAL++TNV +A
Sbjct: 136 NQRDVPTEDAKEFAEKEGLFFLETSALEATNVESA 170



>gb:CR536494_1993789 Homo sapiens full open reading frame cDNA clone
           RZPDo834G1017D for gene RAB11B, RAB11B, member RAS
           oncogene family; complete cds, incl. stopcodon.
          Length = 218

 Score =  200 bits (508), Expect = 4e-50
 Identities = 98/157 (62%), Positives = 120/157 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ ++VDGK +KAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN++RWL+EL  H D+ +  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L FIET+ALDSTNV  A +
Sbjct: 130 HLRAVPTDEARAFAEKNNLSFIETAALDSTNVEEAFK 166



>gb:GMGMR1_1680463 G.max gmr1 gene.
          Length = 155

 Score =  158 bits (399), Expect(2) = 5e-50
 Identities = 77/105 (73%), Positives = 87/105 (82%)
 Frame = -2

Query: 719 QVWDTAGQERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLV 540
           Q+WDTAGQERFRAVTSAYYRGAVGALIVYDI+R+TTF+++ RWL+EL THCDTTVA MLV
Sbjct: 1   QIWDTAGQERFRAVTSAYYRGAVGALIVYDISRRTTFDSVGRWLDELKTHCDTTVAMMLV 60

Query: 539 GNKCDLESIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRL 405
           GNKCDLE+IR VSV           LFF+ETSALDSTNV TA  +
Sbjct: 61  GNKCDLENIRAVSVDEGKSLAEAEGLFFMETSALDSTNVKTAFEM 105



 Score = 63.5 bits (153), Expect(2) = 5e-50
 Identities = 33/44 (75%), Positives = 39/44 (88%), Gaps = 1/44 (2%)
 Frame = -1

Query: 411 EIVIRDIYKNVSRKLLNSDSYKAELSVNRVSLA-NGADMSKQNK 283
           E+VIR+IY NVSRK+LNS++YKAELSVNRVSL  NGA  SKQN+
Sbjct: 104 EMVIREIYTNVSRKVLNSETYKAELSVNRVSLVNNGASTSKQNQ 147



>gb:BC087498_2565337 Xenopus laevis hypothetical LOC496163, mRNA
           (cDNA clone MGC:99345 IMAGE:7204147), complete cds.
          Length = 218

 Score =  199 bits (507), Expect = 6e-50
 Identities = 98/157 (62%), Positives = 119/157 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ ++VDGK +KAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN++RWL+EL  H D  +  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L FIETSALDSTNV  + +
Sbjct: 130 HLRAVPTDEARAFAEKNNLSFIETSALDSTNVEESFK 166



>gb:BC075268_2558374 Xenopus tropicalis MGC88884 protein, mRNA (cDNA
           clone MGC:88884 IMAGE:6998325), complete cds.
          Length = 218

 Score =  199 bits (507), Expect = 6e-50
 Identities = 98/157 (62%), Positives = 119/157 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ ++VDGK +KAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN++RWL+EL  H D  +  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L FIETSALDSTNV  + +
Sbjct: 130 HLRAVPTDEARAFAEKNNLSFIETSALDSTNVEESFK 166



>gb:BC048889_2550064 Danio rerio zgc:55760, mRNA (cDNA clone
           MGC:55760 IMAGE:3816634), complete cds.
          Length = 218

 Score =  199 bits (507), Expect = 6e-50
 Identities = 98/157 (62%), Positives = 119/157 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLF+VV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ ++VDGK +KAQ+WDTAG
Sbjct: 10  YLFRVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN++RWL+EL  H D  +  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L FIETSALDSTNV  A +
Sbjct: 130 HLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFK 166



>gb:AF327517_1786804 Oryza sativa GTP-binding protein mRNA, complete
           cds.>gb:AP003686_1832058 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0659D09.
          Length = 217

 Score =  199 bits (507), Expect = 6e-50
 Identities = 99/155 (63%), Positives = 119/155 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF   SK+TIGVEF T+ ++VDGK VKAQ+WDTAG
Sbjct: 13  YLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLQVDGKVVKAQIWDTAG 72

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR +TFEN++RWL+EL  H D  +  MLVGNK DL 
Sbjct: 73  QERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLKELRDHTDPNIVVMLVGNKSDLR 132

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +  V             L+F+ETSAL+STNV  A
Sbjct: 133 HLVAVQTDEGKAFAERESLYFMETSALESTNVENA 167



>sp|P40393|RIC2_ORYSA Ras-related protein RIC2.>pir|S38741|S38741
           GTP-binding protein ric2 - rice>gb:RICSS230_1703786
           Oryza sativa ss230 mRNA for ras-related GTP binding
           protein, complete cds.
          Length = 217

 Score =  199 bits (507), Expect = 6e-50
 Identities = 99/155 (63%), Positives = 119/155 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF   SK+TIGVEF T+ ++VDGK VKAQ+WDTAG
Sbjct: 13  YLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLQVDGKVVKAQIWDTAG 72

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR +TFEN++RWL+EL  H D  +  MLVGNK DL 
Sbjct: 73  QERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLKELRDHTDPNIVVMLVGNKSDLR 132

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +  V             L+F+ETSAL+STNV  A
Sbjct: 133 HLVAVQTDEGKAFAERESLYFMETSALESTNVENA 167



>sp|O35509|R11B_RAT Ras-related protein Rab-11B.>gb:D01046_2112117
           Rattus norvegicus mRNA for GTP binding protein, complete
           cds.
          Length = 218

 Score =  199 bits (507), Expect = 6e-50
 Identities = 98/157 (62%), Positives = 120/157 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ ++VDGK +KAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN++RWL+EL  H D+ +  +LVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVILLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L FIETSALDSTNV  A +
Sbjct: 130 HLRAVCPLTEARAFAERHLSFIETSALDSTNVEEAFK 166



>gb:BC076247_2559115 Danio rerio zgc:92772, mRNA (cDNA clone
           MGC:92772 IMAGE:7086892), complete cds.
          Length = 218

 Score =  199 bits (506), Expect = 7e-50
 Identities = 98/157 (62%), Positives = 119/157 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           +LFKVV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ ++VDGK +KAQ+WDTAG
Sbjct: 10  FLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN++RWL+EL  H D  +  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L FIETSALDSTNV  A +
Sbjct: 130 HLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFK 166



>gb:BC041250_2547885 Xenopus laevis RAB11B, member RAS oncogene
           family, mRNA (cDNA clone MGC:52793 IMAGE:4724682),
           complete cds.
          Length = 218

 Score =  199 bits (506), Expect = 7e-50
 Identities = 98/157 (62%), Positives = 118/157 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ ++VDGK +KAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRG VGAL+VYDI +  T+EN++RWL+EL  H D  +  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGVVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L FIETSALDSTNV  A +
Sbjct: 130 HLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFK 166



>gb:AB015472_1512535 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MAE1.>gb:BT005238_1638178 Arabidopsis thaliana
           At5g60860 mRNA, complete cds.>gb:AK118670_1816634
           Arabidopsis thaliana At5g60860 mRNA for putative
           GTP-binding protein, complete cds, clone: RAFL19-94-D08.
          Length = 217

 Score =  199 bits (506), Expect = 7e-50
 Identities = 98/155 (63%), Positives = 115/155 (74%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF   SK+TIGVEF T+ + VD K VKAQ+WDTAG
Sbjct: 12  YLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKIVKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR  TFEN++RWL+EL  H D  +  M VGNK DL 
Sbjct: 72  QERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDANIVIMFVGNKADLR 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +R VS             FF+ETSAL+S NV  A
Sbjct: 132 HLRAVSTEDAKAFAERENTFFMETSALESMNVENA 166



>pir|JC2487|JC2487 GTP-binding protein H-YPT3 -
           human>gb:HSYPT31_2028556 H.sapiens YPT3 mRNA.
          Length = 218

 Score =  199 bits (506), Expect = 7e-50
 Identities = 98/157 (62%), Positives = 119/157 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ ++VDGK +KAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+R +TSAYYRGAVGAL+VYDI +  T+EN++RWL+EL  H D+ +  MLVGNK DL 
Sbjct: 70  QERYRRITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L FIETSALDSTNV  A +
Sbjct: 130 HLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFK 166



>gb:AC069472_1540865 Arabidopsis thaliana chromosome 3 BAC F28J15
           genomic sequence, complete sequence.>gb:AP002063_1821827
           Arabidopsis thaliana genomic DNA, chromosome 3, BAC
           clone: T23B7.
          Length = 222

 Score =  199 bits (505), Expect = 1e-49
 Identities = 96/155 (61%), Positives = 123/155 (79%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           Y+FKVV+IGDSAVGK+ LL+RFAR+EF  +SKATIGVEFQT+ + +D K VKAQ+WDTAG
Sbjct: 14  YVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVIDNKTVKAQIWDTAG 73

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RAVTSAYYRGAVGA++VYD+T++ +F+++ +WLEEL  H D  +  ML+GNKCDL 
Sbjct: 74  QERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVIMLIGNKCDLG 133

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
           S+R V             LFF+ETSAL++TNV TA
Sbjct: 134 SLRAVPTEDAQEFAQRENLFFMETSALEATNVETA 168



>pir|T04539|T04539 GTP-binding protein F28J12.90 - Arabidopsis
           thaliana>gb:ATCHRIV48_1545644 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           48.>gb:ATF28J12_1550315 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F28J12 (ESSAII
           project).>gb:BT010933_1640879 Arabidopsis thaliana
           At4g18430 gene, complete cds.>gb:BT011645_1641167
           Arabidopsis thaliana At4g18430 mRNA, complete cds.
          Length = 217

 Score =  199 bits (505), Expect = 1e-49
 Identities = 100/155 (64%), Positives = 117/155 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDS VGKSNLLSRF R+EF   SK+TIGVEF T+ V VD K +KAQ+WDTAG
Sbjct: 12  YLFKLVLIGDSGVGKSNLLSRFTRNEFSIESKSTIGVEFATRSVHVDEKIIKAQLWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDITR  TFEN++RWL+EL  H D  V  MLVGNK DL 
Sbjct: 72  QERYRAITSAYYRGAVGALLVYDITRHITFENVERWLKELRDHTDANVVIMLVGNKADLR 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +R V             +FF+ETSALD+TNV  A
Sbjct: 132 HLRAVPTEEARSFSERENMFFMETSALDATNVEQA 166



>gb:AC130603_1740794 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone B1130G10, complete sequence.
          Length = 220

 Score =  198 bits (504), Expect = 1e-49
 Identities = 95/155 (61%), Positives = 120/155 (77%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF ++EF   SK+TIGVEF T+ ++VDGK +KAQ+WDTAG
Sbjct: 16  YLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSLQVDGKVIKAQIWDTAG 75

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR+ TF+N+ RWL EL  H D ++  ML+GNK DL 
Sbjct: 76  QERYRAITSAYYRGAVGALLVYDVTRRATFDNVGRWLRELRDHTDPSIVCMLIGNKSDLR 135

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +  VS            ++F+ETSALD+TNV+ A
Sbjct: 136 HLVAVSTEDGKEFAEAESMYFMETSALDATNVDNA 170



>gb:AY632359_1618689 Gossypium hirsutum BAC 155C17, complete
           sequence.
          Length = 218

 Score =  198 bits (503), Expect = 2e-49
 Identities = 98/155 (63%), Positives = 118/155 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF   SK+TIGVEF T+ + VDGK +KAQ+WDTAG
Sbjct: 12  YLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLNVDGKVIKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR +TFEN++RWL EL  H D  +  MLVGNK DL 
Sbjct: 72  QERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLRELRDHTDPNIVVMLVGNKSDLR 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +  VS            L+F+ETSAL++TNV  A
Sbjct: 132 HLVAVSTEDGKSFAEKESLYFMETSALEATNVEIA 166



>pir|T29035|T29035 hypothetical protein F53G12.1 - Caenorhabditis
           elegans>gb:AF003139_1230814 Caenorhabditis elegans
           cosmid F53G12, complete sequence.
          Length = 211

 Score =  198 bits (503), Expect = 2e-49
 Identities = 99/155 (63%), Positives = 117/155 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ + V+GK VKAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSISVEGKTVKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN++RWL+EL  H D  +  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHVTYENVERWLKELRDHADQNIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +R V             L FIETSALDSTNV  A
Sbjct: 130 HLRAVPTDEAKIYAERNQLSFIETSALDSTNVEAA 164



>gb:AF532625_1809427 Glycine max GTP-binding protein mRNA, complete
           cds.
          Length = 217

 Score =  197 bits (502), Expect = 2e-49
 Identities = 96/155 (61%), Positives = 119/155 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF ++EF+  SK+TIGVEF T+ ++VD K +KAQ+WDTAG
Sbjct: 12  YLFKVVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATRTLDVDSKVIKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR+ TFEN+ RWL+EL  H D  +  MLVGNK DL 
Sbjct: 72  QERYRAITSAYYRGAVGALLVYDVTRQATFENVDRWLKELRNHTDANIVVMLVGNKSDLR 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +  VS            L+F+ETSAL++TNV  A
Sbjct: 132 HLVAVSTEDGKSYAEKESLYFMETSALEATNVENA 166



>gb:AY327044_1599685 Oryza sativa (japonica cultivar-group)
           GTP-binding protein GTP1 mRNA, complete
           cds.>gb:AP003076_1824663 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0481E12.
          Length = 221

 Score =  197 bits (502), Expect = 2e-49
 Identities = 97/155 (62%), Positives = 119/155 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK V+IGDS VGKSNLLSRF ++EF   SK+TIGVEF T+ ++VDGK VKAQ+WDTAG
Sbjct: 17  YLFKTVLIGDSGVGKSNLLSRFTKNEFCLESKSTIGVEFATRSIQVDGKVVKAQIWDTAG 76

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR+ TF+N+ RWL+EL  H D ++  MLVGNK DL 
Sbjct: 77  QERYRAITSAYYRGAVGALLVYDVTRRATFDNVARWLKELRDHTDPSIVVMLVGNKSDLR 136

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +  VS            L+F+ETSALD+TNV  A
Sbjct: 137 HLVAVSTEDGKEYAEAESLYFMETSALDATNVENA 171



>gb:AP003760_1833061 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBb0063G05.
          Length = 224

 Score =  197 bits (501), Expect = 3e-49
 Identities = 97/155 (62%), Positives = 116/155 (74%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRFARDEF   +++TIGVEF T+ V VD + VKAQ+WDTAG
Sbjct: 18  YLFKVVLIGDSGVGKSNLLSRFARDEFSLETRSTIGVEFATKTVRVDDRLVKAQIWDTAG 77

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR+ TFEN +RWL+EL  H D  +  MLVGNK DL 
Sbjct: 78  QERYRAITSAYYRGAVGALVVYDVTRRITFENAERWLKELRDHTDANIVVMLVGNKADLR 137

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +R V              F +ETSAL++TNV  A
Sbjct: 138 HLRAVPAEDARAFAEAHGTFSMETSALEATNVEGA 172



>gb:AY632360_1618702 Gossypium hirsutum BAC 106I22, complete
           sequence.
          Length = 218

 Score =  197 bits (501), Expect = 3e-49
 Identities = 100/161 (62%), Positives = 121/161 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF   SK+TIGVEF T+ + VDGK +KAQ+WDTAG
Sbjct: 12  YLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLNVDGKVIKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR +TFEN++RWL EL  H D  +  MLVGNK DL 
Sbjct: 72  QERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLRELRDHTDPNIVVMLVGNKSDLR 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFA 396
            +  VS            L+F+ETSAL++TNV     +SFA
Sbjct: 132 HLVAVSTEDGKSFAEKESLYFMETSALEATNV----EISFA 168



>gb:AY088624_1573640 Arabidopsis thaliana clone 8545 mRNA, complete
           sequence.
          Length = 224

 Score =  197 bits (501), Expect = 3e-49
 Identities = 96/155 (61%), Positives = 120/155 (77%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           Y+FKVV+IGDSAVGKS LL+RFARDEF  +SKATIGVEFQT+ + ++ K +KAQ+WDTAG
Sbjct: 16  YVFKVVLIGDSAVGKSQLLARFARDEFSMDSKATIGVEFQTRTLSIEQKSIKAQIWDTAG 75

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RAVTSAYYRGAVGA++VYD+T++ TFE+I RWLEEL  H D  +  +L+GNK DLE
Sbjct: 76  QERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKSDLE 135

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             R V             LFF+ETSAL++TNV  +
Sbjct: 136 DQRAVPTEDAKEFAEKEGLFFLETSALNATNVENS 170



>pir|T06105|T06105 GTP-binding protein GB3 - Arabidopsis
           thaliana>gb:ATCHRIV92_1547983 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 92.>gb:ATT5J17_1556162
           Arabidopsis thaliana DNA chromosome 4, BAC clone T5J17
           (ESSA project).>gb:AY072448_1567265 Arabidopsis thaliana
           GTP-binding protein GB3 (At4g39990) mRNA, complete
           cds.>gb:AY128914_1580994 Arabidopsis thaliana
           GTP-binding protein GB3 (At4g39990) mRNA, complete cds.
          Length = 224

 Score =  197 bits (501), Expect = 3e-49
 Identities = 96/155 (61%), Positives = 120/155 (77%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           Y+FKVV+IGDSAVGKS LL+RFARDEF  +SKATIGVEFQT+ + ++ K +KAQ+WDTAG
Sbjct: 16  YVFKVVLIGDSAVGKSQLLARFARDEFSMDSKATIGVEFQTRTLSIEQKSIKAQIWDTAG 75

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RAVTSAYYRGAVGA++VYD+T++ TFE+I RWLEEL  H D  +  +L+GNK DLE
Sbjct: 76  QERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKSDLE 135

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             R V             LFF+ETSAL++TNV  +
Sbjct: 136 DQRAVPTEDAKEFAEKEGLFFLETSALNATNVENS 170



>gb:AP006727_1862708 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0645D04.
          Length = 226

 Score =  197 bits (500), Expect = 4e-49
 Identities = 96/155 (61%), Positives = 122/155 (78%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           Y+FKVV+IGDSAVGKS LL+RFAR+EF+ +SKATIGVEFQT+ + +D + VKAQ+WDTAG
Sbjct: 17  YVFKVVLIGDSAVGKSQLLARFARNEFNLDSKATIGVEFQTRTLHIDARTVKAQIWDTAG 76

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RAVTSAYYRGAVGA++VYDIT++ +F+++ RWLEEL  H D  +  ML+GNK DL 
Sbjct: 77  QERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLIGNKSDLG 136

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
           ++R V             LFF+ETSAL+STNV  A
Sbjct: 137 TLRVVPTEDAKEFAERENLFFMETSALESTNVENA 171



>pir|S41431|S41431 GTP-binding protein, ras-like - fava
           bean>gb:PEAGTPBP06_1699688 Pisum sativum mRNA for
           GTP-binding protein, complete cds,
           clone:pra6.>gb:VFGNRPR3_1727140 V.faba mRNA for guanine
           nucleotide regulatory protein (807bp).
          Length = 217

 Score =  197 bits (500), Expect = 4e-49
 Identities = 96/155 (61%), Positives = 118/155 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF ++EF+  SK+TIGVEF T+ + VD K +KAQ+WDTAG
Sbjct: 12  YLFKVVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATRTLNVDSKVIKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR  TFEN+ RWL+EL  H D+ +  MLVGNK DL 
Sbjct: 72  QERYRAITSAYYRGAVGALLVYDVTRHATFENVDRWLKELRNHTDSNIVVMLVGNKADLR 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +  VS            L+F+ETSAL++TNV  A
Sbjct: 132 HLVAVSTEDGKSYAEKESLYFMETSALEATNVENA 166



>sp|P28185|ARA2_ARATH Ras-related protein ARA-2.>pir|JS0639|JS0639
           GTP-binding protein ara2 - Arabidopsis
           thaliana>gb:AE005172_889656 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:ATHARA2_1553006 Arabidopsis thaliana mRNA
           for small GTP-binding protein (ara-2), complete
           cds.>gb:AY065306_1566453 Arabidopsis thaliana putative
           GTP-binding protein RAB11D (At1g06400) mRNA, complete
           cds.>gb:AY096439_1575983 Arabidopsis thaliana putative
           GTP-binding protein (At1g06400) mRNA, complete
           cds.>gb:T2D23_1723944 Sequence of BAC T2D23 from
           Arabidopsis thaliana chromosome 1, complete
           sequence.>gb:AF332428_1787240 Arabidopsis thaliana
           putative GTP-binding protein RAB11D (At1g06400) mRNA,
           complete cds.
          Length = 216

 Score =  196 bits (499), Expect = 5e-49
 Identities = 95/155 (61%), Positives = 116/155 (74%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDS VGKSNLLSRF ++EF+  SK+TIGVEF T+  +V+GK VKAQ+WDTAG
Sbjct: 12  YLFKLVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATKTTKVEGKVVKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL++YD+TR  TFEN  RWL EL  H D  +  ML+GNKCDL 
Sbjct: 72  QERYRAITSAYYRGAVGALLIYDVTRHATFENAARWLRELRGHTDPNIVVMLIGNKCDLR 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +  V             L+F+ETSALD+TNV  A
Sbjct: 132 HLVAVKTEEAKAFAERESLYFMETSALDATNVENA 166



>gb:NCB9G16_1690434 Neurospora crassa DNA linkage group II BAC clone
           B9G16.
          Length = 214

 Score =  196 bits (498), Expect = 6e-49
 Identities = 97/157 (61%), Positives = 119/157 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           +LFKVV+IGDS VGKSNLLSRF R+EF+ +SK+TIGVEF T+ ++VD K +KAQ+WDTAG
Sbjct: 8   FLFKVVLIGDSGVGKSNLLSRFTRNEFNLDSKSTIGVEFATRSIQVDSKTIKAQIWDTAG 67

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI++  TFEN+ RWL+EL  H D  +  MLVGNK DL 
Sbjct: 68  QERYRAITSAYYRGAVGALLVYDISKGVTFENVNRWLKELRDHADQNIVIMLVGNKSDLR 127

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L FIETSALD+TNV  A +
Sbjct: 128 HLRAVPTEDAKKFAEENHLSFIETSALDATNVELAFQ 164



>gb:AY297922_1317124 Toxoplasma gondii Rab11 (rab11) mRNA, complete
           cds.
          Length = 219

 Score =  196 bits (498), Expect = 6e-49
 Identities = 98/156 (62%), Positives = 122/156 (78%), Gaps = 1/156 (0%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVD-GKEVKAQVWDTA 702
           YL+K+V+IGDS VGKSN+LSRF RDEF+  SK+TIGVEF T+ V +D GK +KAQ+WDTA
Sbjct: 10  YLYKIVLIGDSGVGKSNMLSRFTRDEFNLESKSTIGVEFATKSVYLDEGKVIKAQIWDTA 69

Query: 701 GQERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDL 522
           GQER+RA+TSAYYRGAVGAL+VYDIT++ +FEN++RWL+EL  H D  +  +LVGNK DL
Sbjct: 70  GQERYRAITSAYYRGAVGALLVYDITKRQSFENVERWLKELRDHADPNIVILLVGNKSDL 129

Query: 521 ESIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
           + +R VSV           L FIETSALD+TNV  A
Sbjct: 130 KHLRAVSVEEATKFANREHLAFIETSALDATNVEQA 165



>pir|T06445|T06445 GTP-binding protein - garden
           pea>gb:PEAGTPBP03_1699685 Pisum sativum mRNA for
           GTP-binding protein, complete cds, clone:pra3.
          Length = 225

 Score =  196 bits (498), Expect = 6e-49
 Identities = 96/155 (61%), Positives = 121/155 (78%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           Y+FKVV+IGDSAVGKS +L+RF+R+EF  +SK+TIGVEFQT+ + +D K VKAQ+WDTAG
Sbjct: 16  YVFKVVLIGDSAVGKSQILARFSRNEFSLDSKSTIGVEFQTRTLVIDHKTVKAQIWDTAG 75

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RAVTSAYYRGAVGA++VYDIT++ TF++I RWLEEL  H D  +  +LVGNK DLE
Sbjct: 76  QERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILVGNKSDLE 135

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
           + RDV             LFF+ETSAL +TNV  +
Sbjct: 136 NQRDVPTEDAKEFAEKEGLFFLETSALQATNVEAS 170



>sp|O04486|RB1C_ARATH Ras-related protein Rab11C.>pir|A86230|A86230
           hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_889968 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:ATU74669_1557228 Arabidopsis thaliana
           ras-related small GTPase (AtRAB11c) mRNA, complete
           cds.>gb:AY045620_1561211 Arabidopsis thaliana
           At1g09630/F21M12_2 mRNA, complete
           cds.>gb:AY085684_1570751 Arabidopsis thaliana clone
           17081 mRNA, complete sequence.>gb:AY133657_1581480
           Arabidopsis thaliana At1g09630/F21M12_2 mRNA, complete
           cds.>gb:F21M12_1677841 Sequence of BAC F21M12 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 217

 Score =  196 bits (498), Expect = 6e-49
 Identities = 95/157 (60%), Positives = 121/157 (77%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF   SK+TIGVEF T+ ++V+G+ VKAQ+WDTAG
Sbjct: 11  YLFKVVLIGDSGVGKSNLLSRFTRNEFCLESKSTIGVEFATRTLQVEGRTVKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGA+GAL+VYD+T+ TTFEN+ RWL+EL  H D+ +  ML+GNK DL+
Sbjct: 71  QERYRAITSAYYRGALGALLVYDVTKPTTFENVSRWLKELRDHADSNIVIMLIGNKTDLK 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V+            L FIETSAL++ NV  A +
Sbjct: 131 HLRAVATEDAQSYAEKEGLSFIETSALEALNVEKAFQ 167



>sp|Q39222|RB1B_ARATH Ras-related protein Rab11.>pir|S59942|S59942
           GTP-binding protein Rab11 - Arabidopsis
           thaliana>gb:AE005172_890668 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC051629_1540075 Arabidopsis thaliana
           chromosome I BAC F6I1 genomic sequence, complete
           sequence.>gb:ATHSGBP_1553391 Arabidopsis thaliana small
           GTP-binding protein (Rab11) mRNA, complete
           cds.>gb:BT006406_1639293 Arabidopsis thaliana At1g16920
           gene, complete cds.
          Length = 216

 Score =  196 bits (498), Expect = 6e-49
 Identities = 97/155 (62%), Positives = 118/155 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF ++EF+  SK+TIGVEF T+ ++VDGK VKAQ+WDTAG
Sbjct: 12  YLFKVVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATRTLKVDGKVVKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR+ TFEN+ RWL+EL  H D  +  MLVGNK DL 
Sbjct: 72  QERYRAITSAYYRGAVGALLVYDVTRRATFENVDRWLKELKNHTDPNIVVMLVGNKSDLR 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +  V             L F+ETSAL++TNV  A
Sbjct: 132 HLLAVPTEDGKSYAEQESLCFMETSALEATNVEDA 166



>gb:LJRAB11H_1685018 L.japonicus mRNA for small GTP-binding protein,
           RAB11H.
          Length = 218

 Score =  196 bits (497), Expect = 8e-49
 Identities = 99/156 (63%), Positives = 117/156 (75%), Gaps = 1/156 (0%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF ++EF   SK+TIGVEF T+ + VD K VKAQVWDTAG
Sbjct: 12  YLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSIRVDDKVVKAQVWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD++R  TFEN++RWL+EL  H DT +  MLVGNK DL 
Sbjct: 72  QERYRAITSAYYRGAVGALLVYDVSRHVTFENVERWLKELRDHTDTNIVVMLVGNKADLR 131

Query: 518 SIRDVSV-XXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +R VS              FF+ETSAL+S NV  A
Sbjct: 132 HLRAVSTEDSSGFLLNERTHFFMETSALESLNVENA 167



>pir|S52647|S52647 GTP-binding protein gmr1 - soybean (fragment)
          Length = 155

 Score =  154 bits (388), Expect(2) = 9e-49
 Identities = 76/102 (74%), Positives = 85/102 (83%)
 Frame = -2

Query: 719 QVWDTAGQERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLV 540
           Q+WDTAGQERFRAVTSAYYRGAVGALIVYDI+R+TTF+++ RWL+EL THCDTTVA MLV
Sbjct: 1   QIWDTAGQERFRAVTSAYYRGAVGALIVYDISRRTTFDSVGRWLDELKTHCDTTVAMMLV 60

Query: 539 GNKCDLESIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
           GNKCDLE+IR VSV           L F+ETSALDSTNV TA
Sbjct: 61  GNKCDLENIRAVSVDEGKSLAEAEGLQFMETSALDSTNVKTA 102



 Score = 63.5 bits (153), Expect(2) = 9e-49
 Identities = 33/44 (75%), Positives = 39/44 (88%), Gaps = 1/44 (2%)
 Frame = -1

Query: 411 EIVIRDIYKNVSRKLLNSDSYKAELSVNRVSLA-NGADMSKQNK 283
           E+VIR+IY NVSRK+LNS++YKAELSVNRVSL  NGA  SKQN+
Sbjct: 104 EMVIREIYTNVSRKVLNSETYKAELSVNRVSLVNNGASTSKQNQ 147



>gb:BC055141_2551229 Danio rerio zgc:63565, mRNA (cDNA clone
           MGC:63565 IMAGE:3818937), complete cds.
          Length = 216

 Score =  195 bits (496), Expect = 1e-48
 Identities = 97/157 (61%), Positives = 119/157 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ + V+GK VKAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIHVEGKTVKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN +RWL+EL  H D+ +  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHLTYENAERWLKELQDHADSNIVIMLVGNKSDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V +           L F+ETSALDS+NV  A +
Sbjct: 130 HLRAVPMDEAKAFAEKHGLSFLETSALDSSNVELAFQ 166



>gb:AY086881_1571922 Arabidopsis thaliana clone 2904 mRNA, complete
           sequence.
          Length = 216

 Score =  195 bits (496), Expect = 1e-48
 Identities = 97/155 (62%), Positives = 117/155 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF ++EF+  SK+TIGVEF T+  +VDGK VKAQ+WDTAG
Sbjct: 12  YLFKVVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATRTFKVDGKVVKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR+ TFEN+ RWL+EL  H D  +  MLVGNK DL 
Sbjct: 72  QERYRAITSAYYRGAVGALLVYDVTRRATFENVDRWLKELKNHTDPNIVVMLVGNKSDLR 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +  V             L F+ETSAL++TNV  A
Sbjct: 132 HLLAVPTEDGKSYAEQESLCFMETSALEATNVEDA 166



>gb:AB024025_1515706 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K16F13.>gb:AF218121_1778148 Arabidopsis
           thaliana small molecular weight g-protein (smg1) mRNA,
           complete cds.
          Length = 223

 Score =  195 bits (496), Expect = 1e-48
 Identities = 95/152 (62%), Positives = 119/152 (78%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           Y+FKVV+IGDSAVGKS LL+RF+R+EF   SKATIGVEFQT+ +E+D K +KAQ+WDTAG
Sbjct: 14  YVFKVVLIGDSAVGKSQLLARFSRNEFSIESKATIGVEFQTRTLEIDRKTIKAQIWDTAG 73

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RAVTSAYYRGAVGA++VYDIT++ +F+++ RWLEEL  H D  +  ML+GNK DL 
Sbjct: 74  QERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLIGNKTDLG 133

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNV 423
           ++R V             LFF+ETSALDS NV
Sbjct: 134 TLRAVPTEDAKEFAQRENLFFMETSALDSNNV 165



>gb:BT005565_1638505 Arabidopsis thaliana clone U51331 putative Ras
           family GTP-binding protein (At3g15060) mRNA, complete
           cds.>gb:AK118727_1816690 Arabidopsis thaliana At3g15060
           mRNA for putative ras-related GTP-binding protein,
           complete cds, clone: RAFL21-06-O17.>gb:AP000370_1819771
           Arabidopsis thaliana genomic DNA, chromosome 3, TAC
           clone:K15M2.
          Length = 217

 Score =  195 bits (495), Expect = 1e-48
 Identities = 95/155 (61%), Positives = 116/155 (74%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           +L+KVV+IGDS VGKSNLLSRF R+EF   SK+TIGVEF T+ + VD K VKAQ+WDTAG
Sbjct: 12  FLYKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDEKIVKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR  TFEN++RWL+EL  H +  +  MLVGNK DL 
Sbjct: 72  QERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTEANIVIMLVGNKADLR 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +R VS             FF+ETSAL++ NV  A
Sbjct: 132 HLRAVSTEDAKAFAERENTFFMETSALEALNVENA 166



>gb:AC084818_1733864 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0668H12, complete
           sequence.>gb:AC104285_1737518 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBb0035J08,
           complete sequence.
          Length = 220

 Score =  194 bits (494), Expect = 2e-48
 Identities = 96/168 (57%), Positives = 124/168 (73%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF   SK+TIGVEF T+ + V+GK +KAQ+WDTAG
Sbjct: 13  YLFKVVLIGDSGVGKSNLLSRFTRNEFCLESKSTIGVEFATRTLHVEGKIIKAQIWDTAG 72

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGA+GA++VYD+++ TTF+NI RWL+EL  H D  +  MLVGNK DL+
Sbjct: 73  QERYRAITSAYYRGALGAVLVYDVSKPTTFDNISRWLKELRDHADANIRIMLVGNKTDLK 132

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLA 375
            +R V+            L +IETSAL++TNV  A +L      R ++
Sbjct: 133 HLRAVATDDAHKFAEAEGLSYIETSALEATNVEEAFQLILGDIYRAIS 180



>sp|Q40195|R11E_LOTJA Ras-related protein
           Rab11E.>gb:LJRAB11E_1685015 L.japonicus mRNA for small
           GTP-binding protein, RAB11E.
          Length = 218

 Score =  194 bits (494), Expect = 2e-48
 Identities = 95/155 (61%), Positives = 117/155 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ + +DGK +KAQ+WDTAG
Sbjct: 12  YLFKLVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATKSLNIDGKVIKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR TTFE   RWL+EL  H D  +  ML+GNK DL 
Sbjct: 72  QERYRAITSAYYRGAVGALLVYDVTRSTTFETAGRWLKELRDHTDPNIVVMLIGNKSDLR 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +  VS            L+F+ETSAL++TNV  A
Sbjct: 132 HLVTVSTEDGKAFAEKESLYFMETSALEATNVENA 166



>gb:AB013395_1512175 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MQN23.>gb:AY045947_1561444 Arabidopsis thaliana
           putative GTP-binding protein (At5g65270) mRNA, complete
           cds.>gb:AY079309_1568199 Arabidopsis thaliana putative
           GTP-binding protein (At5g65270) mRNA, complete
           cds.>gb:AY087004_1572040 Arabidopsis thaliana clone
           30437 mRNA, complete sequence.
          Length = 226

 Score =  194 bits (493), Expect = 2e-48
 Identities = 95/155 (61%), Positives = 119/155 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           Y+FKVV+IGDSAVGKS +L+R+ARDEF  +SKATIGVEFQT+ + +D K VKAQ+WDTAG
Sbjct: 16  YVFKVVLIGDSAVGKSQILARYARDEFSLDSKATIGVEFQTRTLVIDHKSVKAQIWDTAG 75

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RAVTSAYYRGAVGA++VYDITR+ TF++I RWLEEL  H D  +  +L+GNK DL 
Sbjct: 76  QERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHADKNIVIILIGNKSDLV 135

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             R +             LFF+ETSA ++TNV +A
Sbjct: 136 DQRAIPTEDAKEFAEKEGLFFLETSAFNATNVESA 170



>sp|Q40522|R11D_TOBAC Ras-related protein Rab11D.>pir|T03622|T03622
           GTP-binding protein Rab11d - common
           tobacco>gb:TOBNTRAC_1725463 Nicotiana tabacum SR1
           Nt-rab11d mRNA, complete cds.
          Length = 222

 Score =  194 bits (493), Expect = 2e-48
 Identities = 95/155 (61%), Positives = 119/155 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           Y+FKVV+IGDSAVGKS +L+RFAR+EF  +SKATIGVEFQT+ + +  K VKAQ+WDTAG
Sbjct: 14  YVFKVVLIGDSAVGKSQILARFARNEFSLDSKATIGVEFQTRTLAIQHKSVKAQIWDTAG 73

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RAVTSAYYRGAVGA++VYDIT++ TF++I RWLEEL  H D  +  ML+GNK DLE
Sbjct: 74  QERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADRNIVIMLIGNKTDLE 133

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             R V             LFF+ETSA+++TN+  A
Sbjct: 134 DQRAVPTEDAKEFAQKEGLFFLETSAMEATNLEDA 168



>sp|Q40193|R11C_LOTJA Ras-related protein
           Rab11C.>gb:LJRAB11C_1685013 L.japonicus mRNA for small
           GTP-binding protein, RAB11C.
          Length = 216

 Score =  194 bits (493), Expect = 2e-48
 Identities = 93/157 (59%), Positives = 120/157 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDS VGKSN+LSRF R+EF   SK+TIGVEF T+ ++V+GK VKAQ+WDTAG
Sbjct: 11  YLFKIVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTLQVEGKTVKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDIT++ TF+N++RWL EL  H D+ +  M+ GNK DL 
Sbjct: 71  QERYRAITSAYYRGAVGALLVYDITKRQTFDNVQRWLRELRDHADSNIVIMMAGNKSDLN 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R VS            L F+ETSAL++TN+  A +
Sbjct: 131 HLRAVSEDDGGALSEKEGLSFLETSALEATNIEKAFQ 167



>pir|F84750|F84750 probable GTP-binding protein [imported] -
           Arabidopsis thaliana>gb:U78721_1726464 Arabidopsis
           thaliana chromosome 2 clone T1B8 map TEn5, complete
           sequence.
          Length = 219

 Score =  193 bits (491), Expect = 4e-48
 Identities = 95/156 (60%), Positives = 117/156 (75%), Gaps = 1/156 (0%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQV-VEVDGKEVKAQVWDTA 702
           YLFKVV+ GDS VGKSNLLSRF R++F H+S++TIGVEF T+  ++VD K VKAQ+WDTA
Sbjct: 12  YLFKVVLTGDSGVGKSNLLSRFTRNDFSHDSRSTIGVEFATRRGIQVDDKIVKAQIWDTA 71

Query: 701 GQERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDL 522
           GQER+RA+TSAYYRGAVGAL+VYD+TR  TFEN++RWL+EL  H D     MLVGNK DL
Sbjct: 72  GQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDANTVIMLVGNKADL 131

Query: 521 ESIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             +R +S             FF+ETSAL++ NV  A
Sbjct: 132 NHLRAISTEEVKDFAERENTFFMETSALEAINVENA 167



>pir|T04872|T04872 GTP-binding protein F28A21.210 - Arabidopsis
           thaliana>gb:ATCHRIV49_1545681 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           49.>gb:ATF28A21_1550269 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F28A21 (ESSA
           project).>gb:BT003901_1637027 Arabidopsis thaliana clone
           RAFL15-17-A17 (R20645) putative ras-related GTP binding
           protein (At4g18800) mRNA, complete
           cds.>gb:BT004936_1637882 Arabidopsis thaliana clone
           U20645 putative ras-related GTP binding protein
           (At4g18800) mRNA, complete cds.
          Length = 214

 Score =  193 bits (491), Expect = 4e-48
 Identities = 96/155 (61%), Positives = 116/155 (74%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF   SK+TIGVEF T+ + V+ K +KAQ+WDTAG
Sbjct: 12  YLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLNVNEKVIKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR +TFEN++RWL EL  H D  +  MLVGNK DL 
Sbjct: 72  QERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLRELRDHTDPNIVVMLVGNKSDLR 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +  V             L+F+ETSAL+STNV  A
Sbjct: 132 HLVAVQTEDAKSFAENESLYFMETSALESTNVENA 166



>gb:AC093018_1735827 Oryza sativa chromosome 3 BAC OSJNBb0081B07
           genomic sequence, complete sequence.
          Length = 215

 Score =  193 bits (490), Expect = 5e-48
 Identities = 93/157 (59%), Positives = 119/157 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDS VGKSN+LSRF R+EF   SK+TIGVEF T+ ++++G+ +KAQ+WDTAG
Sbjct: 11  YLFKIVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTLQIEGQTIKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDIT+K TFENI+RWL EL  H D+ +  M+VGNK DL 
Sbjct: 71  QERYRAITSAYYRGAVGALLVYDITKKQTFENIQRWLRELRDHADSNIVIMMVGNKSDLN 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L F+ETSAL++ NV  A +
Sbjct: 131 HLRSVPEEDGQALAEKEGLSFLETSALEALNVEKAFQ 167



>gb:AB016890_1513205 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MNC17.>gb:AY040051_1560549 Arabidopsis thaliana
           putative GTP-binding protein rab11 (At5g59150) mRNA,
           complete cds.>gb:AF370127_1792015 Arabidopsis thaliana
           putative GTP-binding protein rab11 (At5g59150) mRNA,
           complete cds.
          Length = 217

 Score =  193 bits (490), Expect = 5e-48
 Identities = 93/161 (57%), Positives = 120/161 (74%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDS VGK+N+LSRF R+EF   SK+TIGVEF T+ ++V+GK VKAQ+WDTAG
Sbjct: 11  YLFKIVLIGDSGVGKTNILSRFTRNEFCLESKSTIGVEFATRTLQVEGKTVKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDIT++ TF+N+ RWL EL  H D+ +  M+ GNK DL 
Sbjct: 71  QERYRAITSAYYRGAVGALLVYDITKRQTFDNVLRWLRELRDHADSNIVIMMAGNKADLN 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFA 396
            +R V+            L F+ETSAL++TNV  A +   A
Sbjct: 131 HLRSVAEEDGQTLAETEGLSFLETSALEATNVEKAFQTVLA 171



>gb:MIRABX_1686474 M.indica mRNA for small GTPase.
          Length = 217

 Score =  192 bits (489), Expect = 7e-48
 Identities = 98/168 (58%), Positives = 120/168 (71%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKV +IGDS VGKSNL  RF R+EF   SK+TIGVEF T+ + VDGK +KAQ+WDTAG
Sbjct: 12  YLFKVGLIGDSGVGKSNLALRFTRNEFSLESKSTIGVEFATRSLNVDGKVIKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR +TFEN++RWL EL  H D  +  ML+GNK DL 
Sbjct: 72  QERYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLRELRDHTDPNIVVMLIGNKSDLR 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLA 375
            +  VS            L F+ETSAL++TNV+ A     + ST  LA
Sbjct: 132 HLVAVSTEDGNLLAERESLSFMETSALEATNVDNAFAEVLSKSTALLA 179



>gb:LES245570_1684504 Lycopersicon esculentum mRNA for Rab11 GTPase
           (Rab11a gene).
          Length = 218

 Score =  192 bits (489), Expect = 7e-48
 Identities = 93/155 (60%), Positives = 117/155 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDS VGKSNLLSRF ++EF+  SK+TIGVEF T+ + +DGK +KAQ+WDTAG
Sbjct: 12  YLFKLVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATKSLNIDGKVIKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+T AYYRGAVGAL+VYD+TR  TFEN+ RWL+EL  H D  +  ML+GNK DL 
Sbjct: 72  QERYRAITIAYYRGAVGALLVYDVTRHVTFENVNRWLKELRDHTDPNIVVMLLGNKSDLR 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +  VS            L+F+ETSAL++TNV  A
Sbjct: 132 HLVAVSTEEAKSLAEREALYFMETSALEATNVENA 166



>gb:AY585939_1616346 Paxillus involutus strain ATCC 200175 GTPase
           (rab) mRNA, complete cds.
          Length = 211

 Score =  192 bits (489), Expect = 7e-48
 Identities = 95/157 (60%), Positives = 120/157 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           +LFKVV+IGDS VGKSNLLSRF R+EF+ +SK+TIGVEF T+ + VD K VKAQ+WDTAG
Sbjct: 9   FLFKVVLIGDSGVGKSNLLSRFTRNEFNLDSKSTIGVEFATRSINVDSKTVKAQIWDTAG 68

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI++  T+ N+ RWL+EL  H D+ +  MLVGNK DL+
Sbjct: 69  QERYRAITSAYYRGAVGALLVYDISKHATYVNVTRWLKELRDHADSNIVIMLVGNKSDLK 128

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L FIETSALD++NV +A +
Sbjct: 129 HLRAVPTEEAKNFSAENELSFIETSALDASNVESAFQ 165



>sp|Q39434|RAB2_BETVU Ras-related protein Rab2BV.>pir|T14566|T14566
           GTP-binding protein 2 - beet>gb:BVRAB2_1643145
           B.vulgaris mRNA for small G protein (clone 1S2).
          Length = 214

 Score =  192 bits (489), Expect = 7e-48
 Identities = 92/157 (58%), Positives = 120/157 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDS VGKSN+LSRF R+EF   SK+TIGVEF T+ ++V+GK VKAQ+WDTAG
Sbjct: 11  YLFKIVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTLQVEGKTVKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDIT++ TF+N++RWL EL  H D+ +  M+ GNK DL+
Sbjct: 71  QERYRAITSAYYRGAVGALLVYDITKRQTFDNVQRWLRELRDHADSNIVIMMAGNKSDLK 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R VS            L F+ETSAL++ N+  A +
Sbjct: 131 HLRAVSEEDGQALAEKEGLSFLETSALEAVNIEKAFQ 167



>sp|Q96283|RB1A_ARATH Ras-related protein Rab11A.>pir|T12965|T12965
           GTP-binding protein rab11 - Arabidopsis
           thaliana>gb:ATRAB11_1554025 A.thaliana mRNA for Rab11
           protein.>gb:ATT6H20_1556348 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T6H20.>gb:AY065380_1566492
           Arabidopsis thaliana putative GTP-binding protein Rab11
           (At3g46830) mRNA, complete cds.>gb:AY087450_1572481
           Arabidopsis thaliana clone 35596 mRNA, complete
           sequence.>gb:AY096545_1576087 Arabidopsis thaliana
           putative GTP-binding protein Rab11 (At3g46830) mRNA,
           complete cds.
          Length = 217

 Score =  192 bits (488), Expect = 9e-48
 Identities = 92/157 (58%), Positives = 118/157 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDS VGKSN+LSRF R+EF   SK+TIGVEF T+  +V+GK +KAQ+WDTAG
Sbjct: 11  YLFKIVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTTQVEGKTIKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDIT++ TF+N+ RWL EL  H D+ +  M+ GNK DL 
Sbjct: 71  QERYRAITSAYYRGAVGALLVYDITKRQTFDNVLRWLRELRDHADSNIVIMMAGNKSDLN 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V+            L F+ETSAL++TNV  A +
Sbjct: 131 HLRSVAEEDGQSLAEKEGLSFLETSALEATNVEKAFQ 167



>gb:AB012245_1511777 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MRA19.>gb:AY059111_1564475 Arabidopsis thaliana
           putative Rab-type small GTP-binding protein (At5g45750)
           mRNA, complete cds.>gb:AF370219_1792104 Arabidopsis
           thaliana putative Rab-type small GTP-binding protein
           (At5g45750) mRNA, complete cds.
          Length = 216

 Score =  192 bits (487), Expect = 1e-47
 Identities = 94/155 (60%), Positives = 116/155 (74%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF ++EF   SK+TIGVEF T+ + VD K +KAQ+WDTAG
Sbjct: 12  YLFKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSLNVDDKVIKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR +TFEN++ WL+EL  H D  +  MLVGNK DL 
Sbjct: 72  QERYRAITSAYYRGAVGALLVYDVTRHSTFENVETWLKELRNHTDPNIVVMLVGNKSDLR 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +  V             L+F+ETSAL++TNV  A
Sbjct: 132 HLVAVQTEDAKSFAEKESLYFMETSALEATNVENA 166



>sp|P17610|YPT3_SCHPO Ras-related protein ypt3
           (RAB).>pir|S10026|S10026 GTP-binding protein ypt3 -
           fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC18G6_1716855 S.pombe chromosome I cosmid
           c18G6.>gb:SPRASGTP_1722034 Schizosaccharomyces pombe
           mRNA for a ras-related GTP-binding
           protein.>gb:SPYTP1_1722357 Schizosaccharomyces pombe
           ypt3 gene.
          Length = 214

 Score =  192 bits (487), Expect = 1e-47
 Identities = 94/157 (59%), Positives = 120/157 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK V+IGDS VGKSNLL RF R+EF+  SK+TIGVEF T+ + +D K++KAQ+WDTAG
Sbjct: 9   YLFKTVLIGDSGVGKSNLLMRFTRNEFNIESKSTIGVEFATRNIVLDNKKIKAQIWDTAG 68

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGALIVYDIT++++F+N+ RWL+EL  H D+ +  MLVGNK DL 
Sbjct: 69  QERYRAITSAYYRGAVGALIVYDITKQSSFDNVGRWLKELREHADSNIVIMLVGNKTDLL 128

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R VS            L FIETSA+D++NV  A +
Sbjct: 129 HLRAVSTEEAQAFAAENNLSFIETSAMDASNVEEAFQ 165



>sp|Q40194|R11D_LOTJA Ras-related protein
           Rab11D.>gb:LJRAB11D_1685014 L.japonicus mRNA for small
           GTP-binding protein, RAB11D.
          Length = 218

 Score =  192 bits (487), Expect = 1e-47
 Identities = 94/155 (60%), Positives = 116/155 (74%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDS VGKSNLLSRF ++EF+  SK+TIGVEF T+ + VD K VKAQ+WDTAG
Sbjct: 12  YLFKLVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATKTLNVDAKVVKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR+ TFEN  RWL+EL  H D  +  ML+GNK DL 
Sbjct: 72  QERYRAITSAYYRGAVGALLVYDVTRRATFENAARWLKELRDHTDPNIVVMLIGNKSDLR 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +  V             L+F+ETSAL++TNV  A
Sbjct: 132 HLVAVPTEDGKSFAERESLYFMETSALEATNVENA 166



>gb:AF532626_1809428 Glycine max small GTP-binding protein mRNA,
           complete cds.
          Length = 218

 Score =  191 bits (486), Expect = 2e-47
 Identities = 93/155 (60%), Positives = 116/155 (74%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ + +D K +KAQ+WDTAG
Sbjct: 12  YLFKLVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATKSLNIDAKVIKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR+ TFEN  RWL+EL  H D  +  ML+GNK DL 
Sbjct: 72  QERYRAITSAYYRGAVGALLVYDVTRRATFENAARWLKELRDHTDPNIVVMLIGNKSDLR 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +  V             L+F+ETSAL++TNV  A
Sbjct: 132 HLVAVPTEDGKSFAEKESLYFMETSALEATNVENA 166



>pir|T06448|T06448 GTP-binding protein - garden
           pea>gb:PEAGTPBP07_1699689 Pisum sativum mRNA for
           GTP-binding protein, complete cds, clone:pra7.
          Length = 218

 Score =  191 bits (486), Expect = 2e-47
 Identities = 93/155 (60%), Positives = 116/155 (74%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ + +D K +KAQ+WDTAG
Sbjct: 12  YLFKLVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATKSLNIDSKVIKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR+ TFEN  RWL+EL  H D  +  ML+GNK DL 
Sbjct: 72  QERYRAITSAYYRGAVGALLVYDVTRRATFENAARWLKELRDHTDPNIVVMLIGNKSDLR 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +  V             L+F+ETSAL++TNV  A
Sbjct: 132 HLVAVPTEDGKSFAERESLYFMETSALEATNVENA 166



>sp|Q01111|YPT3_NICPL Ras-related protein YPT3.>pir|S23523|S23523
           GTP-binding protein Np-ypt3 - curled-leaved
           tobacco>gb:NPYPT3_1691145 N.plumbaginifolia mRNA
           Np-ypt3.
          Length = 218

 Score =  191 bits (485), Expect = 2e-47
 Identities = 92/155 (59%), Positives = 117/155 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDS VGKSNLLSRF ++EF+  SK+TIGVEF T+ + +D K +KAQ+WDTAG
Sbjct: 12  YLFKLVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATKSLNIDNKVIKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR  T+EN+ RWL+EL  H D  +  ML+GNK DL 
Sbjct: 72  QERYRAITSAYYRGAVGALLVYDVTRHVTYENVTRWLKELRDHTDPNIVVMLIGNKSDLR 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +  VS            L+F+ETSAL++TNV  A
Sbjct: 132 HLVAVSTDEAKGLAEREGLYFMETSALEATNVENA 166



>gb:AC069473_1540884 Arabidopsis thaliana chromosome 3 BAC T21B14
           genomic sequence, complete sequence.
          Length = 220

 Score =  191 bits (484), Expect = 3e-47
 Identities = 95/155 (61%), Positives = 121/155 (78%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           Y+FKVV+IGDSAVGK+ LL+RFAR+EF  +SKATIGVEFQT+ + +D K VKAQ+WDTAG
Sbjct: 14  YVFKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVIDNKTVKAQIWDTAG 73

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER  AVTSAYYRGAVGA++VYD+T++ +F+++ +WLEEL  H D  +  ML+GNKCDL 
Sbjct: 74  QER--AVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVIMLIGNKCDLG 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
           S+R V             LFF+ETSAL++TNV TA
Sbjct: 132 SLRAVPTEDAQEFAQRENLFFMETSALEATNVETA 166



>gb:AY099331_1298683 Periplaneta americana Rab11 mRNA, partial cds.
          Length = 204

 Score =  190 bits (483), Expect = 3e-47
 Identities = 94/151 (62%), Positives = 113/151 (74%)
 Frame = -2

Query: 860 VIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAGQERFRA 681
           +IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ ++VDGK +KAQ+WDTAGQER+RA
Sbjct: 4   LIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRA 63

Query: 680 VTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLESIRDVS 501
           +TSAYYRGAVGAL+VYDI +  T+EN++RWL EL  H D  +  MLVGNK DL  +R V 
Sbjct: 64  ITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRAVP 123

Query: 500 VXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
                       L FIETSALDSTNV TA +
Sbjct: 124 TDEAKAFAERNGLSFIETSALDSTNVETAFQ 154



>gb:AB197058_1203137 Entamoeba histolytica gene for small GTPase
           EhRab11D, partial cds.
          Length = 213

 Score =  190 bits (483), Expect = 3e-47
 Identities = 88/155 (56%), Positives = 115/155 (74%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YL+KVV+IGDS VGKSNLL RF RDEFD   K+TIGVEF ++ +  + + V+ Q+WDTAG
Sbjct: 8   YLYKVVMIGDSGVGKSNLLLRFTRDEFDPEKKSTIGVEFSSKQIRYNDETVRTQIWDTAG 67

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+T+AYYRGA+GA++VYD+T+K++FE++ RWL EL  + D  V  M+VGNKCDLE
Sbjct: 68  QERYRAITNAYYRGALGAILVYDVTKKSSFESLDRWLSELRDNADKKVVEMIVGNKCDLE 127

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +R+VS+            FF ETSA D  NV TA
Sbjct: 128 QMREVSIKEGEDMAKKIGAFFFETSAFDGKNVETA 162



>gb:AC130609_1740863 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0048F12, complete sequence.
          Length = 217

 Score =  190 bits (482), Expect = 4e-47
 Identities = 90/157 (57%), Positives = 121/157 (77%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDS VGKSN+LSRF R+ F  +SK+TIGVEF T+ ++++GK +KAQ+WDTAG
Sbjct: 11  YLFKMVLIGDSGVGKSNILSRFTRNHFSLDSKSTIGVEFATKSLQMEGKTIKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDIT++ +F+N+ RWL EL  H D+++  M+VGNK DL 
Sbjct: 71  QERYRAITSAYYRGAVGALLVYDITKRQSFDNVHRWLRELRDHADSSIVIMMVGNKSDLI 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R VS            LFF+ETSA+++ NV  A +
Sbjct: 131 HLRAVSEDEGKALAEKEGLFFLETSAMEAVNVEEAFQ 167



>pir|T06446|T06446 GTP-binding protein - garden
           pea>gb:PEAGTPBP04_1699686 Pisum sativum mRNA for
           GTP-binding protein, complete cds, clone:pra4.
          Length = 215

 Score =  190 bits (482), Expect = 4e-47
 Identities = 96/155 (61%), Positives = 117/155 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDS VGKSNLLSRF R+EF+  SK+TIGVEF T+ V +  K VKAQ+WDTAG
Sbjct: 10  YLFKLVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVRILDKLVKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD TR  TFEN++RWL+EL  H D  V  MLVGNK DL 
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDSTRHVTFENVERWLKELRDHTDAYVVIMLVGNKTDLR 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +  VS            ++F+ETSAL+S NV++A
Sbjct: 130 HLCAVSTEEATAFAEKENIYFMETSALESMNVDSA 164



>gb:AP004127_1838035 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0005H10.
          Length = 216

 Score =  189 bits (481), Expect = 6e-47
 Identities = 90/155 (58%), Positives = 117/155 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDS VGKSN+LSRF R+EF   SK+TIGVEF T+ ++++GK +KAQ+WDTAG
Sbjct: 11  YLFKIVLIGDSGVGKSNILSRFTRNEFFLESKSTIGVEFATRTLQIEGKTIKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+V+DIT++ TF+N++RWL EL  H D  +  M+VGNK DL 
Sbjct: 71  QERYRAITSAYYRGAVGALLVFDITKRQTFDNVQRWLRELRDHADANIVVMMVGNKSDLN 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +R V             L F+ETSAL++ NV  A
Sbjct: 131 HLRSVPEEDGHAFSEKEGLSFLETSALEAINVEKA 165



>gb:AE016818_1748577 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 219

 Score =  189 bits (481), Expect = 6e-47
 Identities = 94/157 (59%), Positives = 117/157 (74%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDS VGKSNLLSRF  DEF+ NSK+TIGVEF T+ +EV+GK+VKAQ+WDTAG
Sbjct: 13  YLFKIVLIGDSGVGKSNLLSRFTTDEFNVNSKSTIGVEFATRTIEVEGKKVKAQIWDTAG 72

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGALIVYDI++ +++EN   WL EL  + D  VA  L+GNK DL 
Sbjct: 73  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENADENVAVGLIGNKSDLA 132

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             + F ETSAL++ NV+ A R
Sbjct: 133 HLRAVPTDEAKNFAQGNQMLFTETSALNAENVDLAFR 169



>sp|Q40520|R11C_TOBAC Ras-related protein Rab11C.>pir|T03613|T03613
           GTP-binding protein Rab11c - common
           tobacco>gb:TOBNTRAA_1725461 Nicotiana tabacum SR1
           Nt-rab11c mRNA, complete cds.
          Length = 222

 Score =  189 bits (480), Expect = 8e-47
 Identities = 93/155 (60%), Positives = 117/155 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           Y+FKVV+IGDSAVGK+ +L+RFAR+EF  +SKATIGVEFQT+ + +  K VKAQ+WDTAG
Sbjct: 14  YVFKVVLIGDSAVGKTQILARFARNEFSLDSKATIGVEFQTRTLVIQHKSVKAQIWDTAG 73

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RAVTSAYYRGAVGA++VYDIT++ TF++I RWLEEL  H D  +  ML GNK DLE
Sbjct: 74  QERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADRNIVIMLTGNKTDLE 133

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             R V             LFF+ETSA+++T +  A
Sbjct: 134 DQRAVPTEDAKEFAQKEGLFFLETSAMEATKLEDA 168



>sp|Q40723|RGP2_ORYSA Ras-related protein RGP2 (GTP-binding
           regulatory protein RGP2).>pir|S30273|S30273 GTP-binding
           protein rgp2 - rice>gb:RICRGP2_1703755 Oryza sativa
           (japonica cultivar-group) rgp2 mRNA for GTP binding
           protein, complete cds.
          Length = 217

 Score =  189 bits (479), Expect = 1e-46
 Identities = 89/157 (56%), Positives = 121/157 (77%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGD+ VGKSN+LSRF R+ F  +SK+TIGVEF T+ ++++GK +KAQ+WDTAG
Sbjct: 11  YLFKMVLIGDTGVGKSNILSRFTRNHFSLDSKSTIGVEFATKSLQMEGKTIKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDIT++ +F+N+ RWL EL  H D+++  M+VGNK DL 
Sbjct: 71  QERYRAITSAYYRGAVGALLVYDITKRQSFDNVHRWLRELRDHADSSIVIMMVGNKSDLI 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R VS            LFF+ETSA+++ NV  A +
Sbjct: 131 HLRAVSEDEGKALAEKEGLFFLETSAMEAVNVEEAFQ 167



>sp|P36412|RB11_DICDI Ras-related protein Rab11.>gb:DDU02925_1377273
           Dictyostelium discoideum Ax3 Rab11 mRNA, complete cds.
          Length = 214

 Score =  189 bits (479), Expect = 1e-46
 Identities = 91/157 (57%), Positives = 119/157 (75%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YL+K+V+IGDS VGKSNLLSRF R+EF   +K+TIGVEF T+ ++ +GK +KAQVWDTAG
Sbjct: 12  YLYKIVLIGDSGVGKSNLLSRFTRNEFSLETKSTIGVEFATRTIQTEGKTIKAQVWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYDI ++ T+++++RW+ EL  + D  +  MLVGNK DL 
Sbjct: 72  QERYRAITSAYYRGAVGALLVYDIAKQATYKSVERWILELRENADRNIEIMLVGNKSDLR 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R+VS            L FIETSALDS+NV  A +
Sbjct: 132 HLREVSTDEAKEFSEKHKLTFIETSALDSSNVELAFQ 168



>gb:AY585953_1616360 Paxillus involutus strain Maj GTPase (rab)
           gene, partial cds.>gb:AY585954_1616361 Paxillus
           involutus strain Nau GTPase (rab) gene, partial cds.
          Length = 161

 Score =  188 bits (477), Expect = 2e-46
 Identities = 93/153 (60%), Positives = 117/153 (76%)
 Frame = -2

Query: 866 VVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAGQERF 687
           VV+IGDS VGKSNLLSRF R+EF+ +SK+TIGVEF T+ + VDGK VKAQ+WDTAGQER+
Sbjct: 1   VVLIGDSGVGKSNLLSRFTRNEFNLDSKSTIGVEFATRSISVDGKTVKAQIWDTAGQERY 60

Query: 686 RAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLESIRD 507
           RA+TSAYYRGAVGAL+VYDI++  T+ N+ RWL+EL  H D+ +  MLVGNK DL+ +R 
Sbjct: 61  RAITSAYYRGAVGALLVYDISKHATYVNVTRWLKELRDHADSNIVIMLVGNKSDLKHLRA 120

Query: 506 VSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
           V             L FIETSALD++NV +A +
Sbjct: 121 VPTEEAKNFSTENELSFIETSALDASNVESAFQ 153



>sp|Q40523|R11A_TOBAC Ras-related protein Rab11A.>pir|T03625|T03625
           GTP-binding protein Rab11a - common
           tobacco>gb:TOBNTRAD_1725464 Nicotiana tabacum SR1
           Nt-rab11a mRNA, complete cds.
          Length = 216

 Score =  188 bits (477), Expect = 2e-46
 Identities = 92/157 (58%), Positives = 120/157 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDS VGKSN+LSRF R+EF   SK+TIGVEF T+ ++V+GK VKAQ+WDTAG
Sbjct: 11  YLFKMVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTLQVEGKTVKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+ YDIT++ TF+N++RWL EL  H D+ +  +L GNK DL+
Sbjct: 71  QERYRAITSAYYRGAVGALLFYDITKRQTFDNVQRWLRELRDHRDSNIVIILAGNKSDLK 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R VS            L F+ETSAL++ NV+ A +
Sbjct: 131 HLRAVSEQDDQALVKKEGLSFLETSALEALNVDKAFQ 167



>gb:BC086715_2564932 Danio rerio zgc:101648, mRNA (cDNA clone
           MGC:101648 IMAGE:7226117), complete cds.
          Length = 210

 Score =  187 bits (476), Expect = 2e-46
 Identities = 91/155 (58%), Positives = 119/155 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           ++FKVV+IG+S VGKSNLLSRF ++EF+H+S+ TIGVEF T+ V+VD   +KAQ+WDTAG
Sbjct: 9   FVFKVVLIGESGVGKSNLLSRFTKNEFNHDSRTTIGVEFSTRSVQVDSITIKAQIWDTAG 68

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
            ER+RA+TSAYYRGAVGAL+VYDIT+  T+E+++RWL+EL  H D  +  MLVGNK DL 
Sbjct: 69  LERYRAITSAYYRGAVGALLVYDITKHLTYESVERWLKELYDHADPHIVVMLVGNKNDLA 128

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
           ++R V             L F+ETSAL+STNV +A
Sbjct: 129 TVRTVPTEEAKDFADANGLLFMETSALESTNVESA 163



>gb:PEAGTPBP02_1699684 Pisum sativum mRNA for GTP-binding protein,
           partial cds, clone:pra2.
          Length = 222

 Score =  187 bits (476), Expect = 2e-46
 Identities = 91/155 (58%), Positives = 118/155 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           Y+FKVVVIGDSAVGK+ +LSRF ++EF  +SK+TIGVEFQT+ V ++GK +KAQ+WDTAG
Sbjct: 8   YVFKVVVIGDSAVGKTQILSRFTKNEFCFDSKSTIGVEFQTKTVTINGKLIKAQIWDTAG 67

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RAVTSAYYRGA+GA++VYDIT++ TF+++ RW+EEL +H D ++  ML+GNK DL 
Sbjct: 68  QERYRAVTSAYYRGALGAMLVYDITKRQTFDHVARWVEELRSHADGSIVIMLIGNKGDLV 127

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             R V             LFF ETSA    NVN+A
Sbjct: 128 DQRGVQTEDAVEFAEDQGLFFSETSAFSGENVNSA 162



>gb:CR382130_1662909 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 216

 Score =  187 bits (476), Expect = 2e-46
 Identities = 90/157 (57%), Positives = 116/157 (73%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           ++  VV+IGDS VGK+N+L RF RDEF+ +SK+TIGVEF T+ V +D K +KAQ+WDTAG
Sbjct: 11  HINSVVMIGDSGVGKTNILGRFTRDEFNLDSKSTIGVEFATRTVNIDNKIIKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL++YD+T   +++NI RWL+EL  H D+ +  MLVGNKCDL+
Sbjct: 71  QERYRAITSAYYRGAVGALLLYDVTSTQSYKNISRWLQELQDHADSNIVLMLVGNKCDLK 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L FIETSALD T+V  A R
Sbjct: 131 HLRAVPTEEAKQFASQNKLLFIETSALDGTDVALAFR 167



>gb:AY084274_1569366 Arabidopsis thaliana clone 102017 mRNA,
           complete sequence.
          Length = 216

 Score =  187 bits (476), Expect = 2e-46
 Identities = 92/155 (59%), Positives = 114/155 (73%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLS F ++EF   SK+TIGVEF T+ + VD K +KAQ+WDTAG
Sbjct: 12  YLFKVVLIGDSGVGKSNLLSLFTKNEFSLESKSTIGVEFATRSLNVDDKVIKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR +TFEN++ WL+EL  H D  +  MLVGNK DL 
Sbjct: 72  QERYRAITSAYYRGAVGALLVYDVTRHSTFENVETWLKELRNHTDPNIVVMLVGNKSDLR 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +  V             L+F+ETSA ++TNV  A
Sbjct: 132 HLVAVQTEDAKSFAEKESLYFMETSAFEATNVENA 166



>gb:AB007911_1510331 Pisum sativum gene for PRA2, complete cds.
          Length = 233

 Score =  187 bits (476), Expect = 2e-46
 Identities = 91/155 (58%), Positives = 118/155 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           Y+FKVVVIGDSAVGK+ +LSRF ++EF  +SK+TIGVEFQT+ V ++GK +KAQ+WDTAG
Sbjct: 19  YVFKVVVIGDSAVGKTQILSRFTKNEFCFDSKSTIGVEFQTKTVTINGKLIKAQIWDTAG 78

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RAVTSAYYRGA+GA++VYDIT++ TF+++ RW+EEL +H D ++  ML+GNK DL 
Sbjct: 79  QERYRAVTSAYYRGALGAMLVYDITKRQTFDHVARWVEELRSHADGSIVIMLIGNKGDLV 138

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             R V             LFF ETSA    NVN+A
Sbjct: 139 DQRGVQTEDAVEFAEDQGLFFSETSAFSGENVNSA 173



>gb:AB054587_1196630 Entamoeba histolytica EhRab11B mRNA for small
           GTPase Rab11B, complete cds.
          Length = 211

 Score =  187 bits (476), Expect = 2e-46
 Identities = 88/184 (47%), Positives = 129/184 (70%), Gaps = 4/184 (2%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           +L+K+V++G+S VGKSNLL RF R+EFD + ++TIGVEF T+ +    K ++AQ+WDTAG
Sbjct: 9   FLYKIVLVGESGVGKSNLLLRFTRNEFDPDKRSTIGVEFATRSINYCDKNIRAQIWDTAG 68

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+T+AYYRGA+GAL+VYDIT+KT+FE++++WL EL+ + D  V +M++GNKCDL 
Sbjct: 69  QERYRAITNAYYRGALGALVVYDITKKTSFESVEKWLAELHENADKKVVQMVIGNKCDLS 128

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVN----TALRLSFATSTRTLAGSCSTPTP 351
             R+V              FF ETSALD +NV     T L+  +  S++++ G  S    
Sbjct: 129 QTREVQTSEGEELAKKNNAFFFETSALDGSNVEEAFMTLLKKIYDDSSKSVDGEQSNTNE 188

Query: 350 TRPS 339
            +P+
Sbjct: 189 IKPA 192



>pir|T06444|T06444 GTP-binding protein - garden pea (fragment)
          Length = 222

 Score =  187 bits (476), Expect = 2e-46
 Identities = 91/155 (58%), Positives = 118/155 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           Y+FKVVVIGDSAVGK+ +LSRF ++EF  +SK+TIGVEFQT+ V ++GK +KAQ+WDTAG
Sbjct: 8   YVFKVVVIGDSAVGKTQILSRFTKNEFCFDSKSTIGVEFQTKTVTINGKLIKAQIWDTAG 67

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RAVTSAYYRGA+GA++VYDIT++ TF+++ RW+EEL +H D ++  ML+GNK DL 
Sbjct: 68  QERYRAVTSAYYRGALGAMLVYDITKRQTFDHVARWVEELRSHADGSIVIMLIGNKGDLV 127

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             R V             LFF ETSA    NVN+A
Sbjct: 128 DQRGVQTEDAVEFAEDQGLFFSETSAFSGENVNSA 162



>gb:CR382134_1667106 Debaryomyces hansenii chromosome B of strain
           CBS767 of Debaryomyces hansenii.
          Length = 220

 Score =  187 bits (475), Expect = 3e-46
 Identities = 91/153 (59%), Positives = 114/153 (74%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YL+K+V+IGDS VGKSNLLSRF RDEF+  S++TIGVEF T+ +E+DGK VKAQ+WDTAG
Sbjct: 14  YLYKIVLIGDSGVGKSNLLSRFTRDEFNLESRSTIGVEFATRTLEIDGKRVKAQIWDTAG 73

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGALIVYDI++  ++E++ RWL+EL  H D  +   LVGNK DL+
Sbjct: 74  QERYRAITSAYYRGAVGALIVYDISKAESYESVSRWLKELKEHADANIVIELVGNKSDLD 133

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVN 420
            +R V             L F E SAL S NV+
Sbjct: 134 HLRAVPTDEAKNFANENNLLFTEASALSSDNVD 166



>gb:CR380957_1652917 Candida glabrata strain CBS138 chromosome K
           complete sequence.
          Length = 221

 Score =  187 bits (475), Expect = 3e-46
 Identities = 94/157 (59%), Positives = 116/157 (73%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDS VGKSNLLSRF  +EF+  SK+TIGVEF T+ ++V+ K++KAQ+WDTAG
Sbjct: 13  YLFKIVLIGDSGVGKSNLLSRFTTNEFNLESKSTIGVEFATRTIKVEDKKIKAQIWDTAG 72

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGALIVYDI++  T+EN   WL EL  + D  VA  L+GNK DLE
Sbjct: 73  QERYRAITSAYYRGAVGALIVYDISKSGTYENCNHWLTELKENADDNVAIGLIGNKSDLE 132

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             LFF ETSAL+S NV+ A R
Sbjct: 133 HLRAVPTEEARGFASENQLFFTETSALNSENVDLAFR 169



>gb:PFMAL13_1191281 Plasmodium falciparum 3D7 chromosome 13, ***
           SEQUENCING IN PROGRESS ***, 33 ordered
           pieces.>gb:PFRAB11GN_1394953 P.falciparum mRNA for small
           GTPase rab11.
          Length = 216

 Score =  187 bits (475), Expect = 3e-46
 Identities = 93/156 (59%), Positives = 122/156 (78%), Gaps = 1/156 (0%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEV-DGKEVKAQVWDTA 702
           YLFK+V+IGDS VGKSNLLSRF RDEF+  SK+TIGVEF T+ +++ + K +KAQ+WDTA
Sbjct: 10  YLFKIVLIGDSGVGKSNLLSRFTRDEFNLESKSTIGVEFATKSIQLKNNKIIKAQIWDTA 69

Query: 701 GQERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDL 522
           GQER+RA+TSAYYRGAVGAL+VYDIT+K +FENI++WL+EL  + D+ +  +LVGNK DL
Sbjct: 70  GQERYRAITSAYYRGAVGALLVYDITKKNSFENIEKWLKELRDNADSNIVILLVGNKSDL 129

Query: 521 ESIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
           + +R ++            L FIETSAL++TNV  A
Sbjct: 130 KHLRVINDNDATQYAKKEKLAFIETSALEATNVELA 165



>sp|P25766|RGP1_ORYSA Ras-related protein RGP1 (GTP-binding
           regulatory protein RGP1).>pir|S16554|S16554 GTP-binding
           protein rgp1 - rice>gb:OSRGP1_1698336 Rice rgp1 mRNA for
           a ras-related GTP-binding protein.
          Length = 226

 Score =  186 bits (473), Expect = 5e-46
 Identities = 93/155 (60%), Positives = 119/155 (76%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           Y+FKVV+IGDSAVGKS LL+ FAR+EF+ +SKATIGVEFQT+ + +D + VKAQ  DTAG
Sbjct: 17  YVFKVVLIGDSAVGKSQLLAGFARNEFNLDSKATIGVEFQTRTLHIDARTVKAQTRDTAG 76

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RAVTSAYYRGAVGA++VYDIT++ +F+++ RWLEEL  H D  +  ML+GNK DL 
Sbjct: 77  QERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLIGNKSDLG 136

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
           ++R V             LFF+ETSAL+STN+  A
Sbjct: 137 TLRVVPTEDAKEFAERENLFFMETSALESTNLENA 171



>gb:CR380949_1649515 Candida glabrata strain CBS138 chromosome C
           complete sequence.
          Length = 218

 Score =  186 bits (472), Expect = 6e-46
 Identities = 92/157 (58%), Positives = 117/157 (74%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDS VGKSNLLSRF  +EF+ +SK+TIGVEF T+ ++VDGK++KAQ+WDTAG
Sbjct: 12  YLFKIVLIGDSGVGKSNLLSRFTTNEFNIDSKSTIGVEFATRTIDVDGKKIKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGALIVYDI++ +++EN   WL EL  + D  VA  L+GNK DL 
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCHHWLSELRENADDNVAVGLIGNKSDLA 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             L F ETSAL+S NV+ A +
Sbjct: 132 HLRAVPTEEAKQFASENQLLFTETSALNSDNVDLAFK 168



>gb:LJRAB11B_1685012 L.japonicus mRNA for small GTP-binding protein,
           RAB11B.
          Length = 242

 Score =  186 bits (471), Expect = 8e-46
 Identities = 95/169 (56%), Positives = 126/169 (74%), Gaps = 1/169 (0%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           Y+FKVVVIGDSAVGK+ +LSRFA++EF  +SKATIGVEFQT+ V ++ K +KAQ+WDTAG
Sbjct: 26  YVFKVVVIGDSAVGKTQILSRFAKNEFCFDSKATIGVEFQTRTVTINAKVIKAQIWDTAG 85

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RAVTSAYYRGA+GA++VYDIT++ +F+++ RW+EEL  H D+++  ML+GNK DL 
Sbjct: 86  QERYRAVTSAYYRGALGAMLVYDITKRQSFDHVARWVEELRAHADSSIVIMLIGNKGDLV 145

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA-LRLSFATSTRTLA 375
             R V             LFF ETSAL   NV +A L+L    +TR ++
Sbjct: 146 DQRVVLSEDAVEFAEEQGLFFSETSALTGENVESAFLKLLQEINTRVVS 194



>gb:AY585950_1616357 Paxillus involutus strain ATCC 200175 GTPase
           (rab) gene, partial cds.>gb:AY585951_1616358 Paxillus
           involutus strain Pi01SE GTPase (rab) gene, partial
           cds.>gb:AY585952_1616359 Paxillus involutus strain
           Pi08BE GTPase (rab) gene, partial cds.
          Length = 161

 Score =  186 bits (471), Expect = 8e-46
 Identities = 92/153 (60%), Positives = 116/153 (75%)
 Frame = -2

Query: 866 VVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAGQERF 687
           VV+IGDS VGKSNLLSRF R+EF+ +SK+TIGVEF T+ + VD K VKAQ+WDTAGQER+
Sbjct: 1   VVLIGDSGVGKSNLLSRFTRNEFNLDSKSTIGVEFATRSINVDSKTVKAQIWDTAGQERY 60

Query: 686 RAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLESIRD 507
           RA+TSAYYRGAVGAL+VYDI++  T+ N+ RWL+EL  H D+ +  MLVGNK DL+ +R 
Sbjct: 61  RAITSAYYRGAVGALLVYDISKHATYVNVTRWLKELRDHADSNIVIMLVGNKSDLKHLRA 120

Query: 506 VSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
           V             L FIETSALD++NV +A +
Sbjct: 121 VPTEEAKNFSAENELSFIETSALDASNVESAFQ 153



>sp|P51996|YP32_YEAST GTP-binding protein
           YPT32/YPT11.>pir|S58514|S58514 GTP-binding protein YPT32
           - yeast (Saccharomyces cerevisiae)>gb:AY558506_1614733
           Saccharomyces cerevisiae clone FLH002894.01X YGL210W
           gene, complete cds.>gb:SCU33754_1710169 Saccharomyces
           cerevisiae Vam7p (VAM7), ras-like GTPase (YPT11) and
           MIG1-like zinc finger protein (MLZ1) genes, complete cds
           and Sip2p (SPM2) gene, partial cds.>gb:SCYGL210W_1712141
           S.cerevisiae chromosome VII reading frame ORF
           YGL210w.>gb:SCYPT32_1714821 S.cerevisiae YPT3B gene.
          Length = 222

 Score =  186 bits (471), Expect = 8e-46
 Identities = 92/157 (58%), Positives = 115/157 (73%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+V+IGDS VGKSNLLSRF  DEF+  SK+TIGVEF T+ +EV+ K++KAQ+WDTAG
Sbjct: 12  YLFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGALIVYDI++ +++EN   WL EL  + D  VA  L+GNK DL 
Sbjct: 72  QERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENADDNVAVGLIGNKSDLA 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            +R V             + F ETSAL+S NV+ A R
Sbjct: 132 HLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFR 168



>gb:BC080339_2561656 Xenopus tropicalis rab25-prov protein, mRNA
           (cDNA clone MGC:79587 IMAGE:6979047), complete cds.
          Length = 216

 Score =  185 bits (470), Expect = 1e-45
 Identities = 90/156 (57%), Positives = 119/156 (76%), Gaps = 1/156 (0%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           ++FKVV+IG+S VGK+NLLSRF R+EF+H+S+ TIGVEF T+ + +DG  VK+Q+WDTAG
Sbjct: 10  FVFKVVLIGESGVGKTNLLSRFTRNEFNHDSRTTIGVEFSTRTLTIDGHLVKSQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDL- 522
            ER+RA+TSAYYRGAVGAL+VYDIT+  ++E++ RWL+EL  H D ++  MLVGNKCDL 
Sbjct: 70  LERYRAITSAYYRGAVGALLVYDITKHQSYESVDRWLKELYDHADASIVVMLVGNKCDLK 129

Query: 521 ESIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
           +  ++V             L FIETSALD+TNV  A
Sbjct: 130 DEAQEVPSEEAKAYAERNGLLFIETSALDATNVELA 165



>gb:AF030183_1234434 Entamoeba histolytica GTP-binding protein
           (Rab11) mRNA, partial cds.
          Length = 206

 Score =  185 bits (470), Expect = 1e-45
 Identities = 87/157 (55%), Positives = 117/157 (74%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           +L+K+V+IG+S VGKSNLL RF R+EFD   ++TIGVEF T+ ++ +GK ++AQ+WDTAG
Sbjct: 7   FLYKIVLIGESGVGKSNLLLRFTRNEFDAEKRSTIGVEFATRSIQHEGKVIRAQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+T+AYYRGAVGAL+VYDIT++ TF++I+RWL EL  + D  +  M++GNK DL 
Sbjct: 67  QERYRAITNAYYRGAVGALVVYDITKENTFKSIERWLSELKDNADPKIVIMIIGNKADLA 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
             R+V             LFF ETSALD TNV TA +
Sbjct: 127 QTREVEEATAKEFCQKQNLFFFETSALDGTNVETAFK 163



>gb:AB186370_1202818 Entamoeba histolytica EhRAB11A gene for
           EhRab11A protein, complete cds.
          Length = 207

 Score =  185 bits (470), Expect = 1e-45
 Identities = 87/157 (55%), Positives = 117/157 (74%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           +L+K+V+IG+S VGKSNLL RF R+EFD   ++TIGVEF T+ ++ +GK ++AQ+WDTAG
Sbjct: 8   FLYKIVLIGESGVGKSNLLLRFTRNEFDAEKRSTIGVEFATRSIQHEGKVIRAQIWDTAG 67

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+T+AYYRGAVGAL+VYDIT++ TF++I+RWL EL  + D  +  M++GNK DL 
Sbjct: 68  QERYRAITNAYYRGAVGALVVYDITKENTFKSIERWLSELKDNADPKIVIMIIGNKADLA 127

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
             R+V             LFF ETSALD TNV TA +
Sbjct: 128 QTREVEEATAKEFCQKQNLFFFETSALDGTNVETAFK 164



>gb:AE005172_891741 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC007508_1535903 Genomic sequence
           for Arabidopsis thaliana BAC F1K23 from chromosome I,
           complete sequence.
          Length = 212

 Score =  184 bits (467), Expect = 2e-45
 Identities = 91/155 (58%), Positives = 112/155 (72%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+ GDS VGKSNLLSRF R++F H+S+ATIGVEF T+ ++ D K VKAQ+WDTAG
Sbjct: 12  YLFKVVLTGDSGVGKSNLLSRFTRNDFSHDSRATIGVEFATRSIQCDDKIVKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QE      SAYYRGAVGAL+VYD+TR  TFEN++RWL+EL  H D  +  MLVGNK DL 
Sbjct: 72  QE------SAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDANIVIMLVGNKADLR 125

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +R +S             FF+ETSAL++ NV+ A
Sbjct: 126 HLRAISTEEAKAFAERENTFFMETSALEAVNVDNA 160



>sp|P38555|YP31_YEAST GTP-binding protein
           YPT31/YPT8.>pir|S42679|S42679 GTP-binding protein YPT8 -
           yeast (Saccharomyces cerevisiae)>gb:SCE9537_1708135
           Saccharomyces cerevisiae chromosome V cosmids 9537,
           9581, 9495, 9867, and lambda clone
           5898.>gb:SCYPT31_1714820 S.cerevisiae YPT3A
           gene.>gb:YSCGP_1728974 Saccharomyces cerevisiae Ypt/Rab
           family GTPase-activating protein (YPT8/YPT31) gene,
           complete cds.
          Length = 223

 Score =  184 bits (467), Expect = 2e-45
 Identities = 91/154 (59%), Positives = 115/154 (74%)
 Frame = -2

Query: 875 LFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAGQ 696
           LFK+V+IGDS VGKSNLLSRF ++EF+ +SK+TIGVEF T+ +E+DGK +KAQ+WDTAGQ
Sbjct: 13  LFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQ 72

Query: 695 ERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLES 516
           ER+RA+TSAYYRGAVGALIVYDI++ +++EN   WL EL  + D  VA  L+GNK DL  
Sbjct: 73  ERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENADDNVAVGLIGNKSDLAH 132

Query: 515 IRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
           +R V             L F ETSAL+S NV+ A
Sbjct: 133 LRAVPTEESKTFAQENQLLFTETSALNSENVDKA 166



>gb:AP003614_1831397 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0481E08.
          Length = 225

 Score =  183 bits (465), Expect = 4e-45
 Identities = 89/155 (57%), Positives = 111/155 (71%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           Y+FKVVVIGDSAVGK+ LL RF +DEF  +SK+TIG+EFQT+ VE+ GK VKAQ+WDTAG
Sbjct: 6   YVFKVVVIGDSAVGKTQLLGRFTKDEFFIDSKSTIGIEFQTRTVEIGGKRVKAQIWDTAG 65

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RAVTSAYYRGA+GA++VYD+T + +F +  RWL +L  H D ++  ML+GNK DL 
Sbjct: 66  QERYRAVTSAYYRGALGAMLVYDVTSRRSFHHAARWLHDLRAHADNSIVVMLIGNKADLS 125

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             R V+            LFF E SAL   NV  A
Sbjct: 126 HARAVAADEAAAFAEDQGLFFSEASALSGDNVEEA 160



>gb:FSGTP1_1679276 F.sylvatica mRNA for GTP1 protein.
          Length = 215

 Score =  183 bits (464), Expect = 5e-45
 Identities = 99/182 (54%), Positives = 125/182 (68%), Gaps = 7/182 (3%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF   SK+TIGVEF T+ ++V+G+ VKAQ+WDTAG
Sbjct: 11  YLFKVVLIGDSGVGKSNLLSRFTRNEFCLESKSTIGVEFATRTLQVEGRTVKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+T+ TTFE +  WL+EL  H D+ +  ML+GNK DL+
Sbjct: 71  QERYRAITSAYYRGAVGALLVYDVTKPTTFEQV--WLKELRDHADSNIVIMLIGNKTDLK 128

Query: 518 SIRDVSVXXXXXXXXXXXLF-FIETSALDSTNVNTA------LRLSFATSTRTLAGSCST 360
             R V                FIETSAL +TNV  A      LR +   S ++L+     
Sbjct: 129 HSRAVRTEDAQGFMLRKKALSFIETSALKATNVEKAFQTILCLRFTGIISKKSLSSDEPA 188

Query: 359 PT 354
           P+
Sbjct: 189 PS 190



>pir|T03636|T03636 GTP-binding protein mgp1 -
           maize>gb:MZEMGP1_1687946 Maize mRNA for mgp1 GTP-binding
           protein, complete cds.
          Length = 211

 Score =  183 bits (464), Expect = 5e-45
 Identities = 94/168 (55%), Positives = 115/168 (68%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           Y+FK+VVIGD AVGKS LLS FAR+EF  +SK TIGVEF T+ +  + K VKAQ+WDTAG
Sbjct: 12  YVFKIVVIGDDAVGKSQLLSGFARNEFSLDSKGTIGVEFATRSIRFEDKVVKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+ A+TSAYYRGA GAL+VYD+TR  TFE + RWL+EL  H D+ +  MLVGNK DL 
Sbjct: 72  QERYLAITSAYYRGAAGALLVYDVTRHATFETVGRWLKELRDHTDSNIVIMLVGNKADLR 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLA 375
            +R VS            +FF+ETSA D TNV T+         R L+
Sbjct: 132 HLRAVSTEDAKAFAEKESIFFMETSAQD-TNVKTSFETLLTDIYRILS 178



>pir|D96763|D96763 hypothetical protein F25P22.5 [imported] -
           Arabidopsis thaliana>gb:AE005173_894910 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC012679_1537773 Arabidopsis thaliana
           chromosome 1 BAC F25P22 genomic sequence, complete
           sequence.>gb:AY084805_1569888 Arabidopsis thaliana clone
           118351 mRNA, complete sequence.
          Length = 233

 Score =  182 bits (463), Expect = 7e-45
 Identities = 92/155 (59%), Positives = 114/155 (73%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK V+IGDSAVGKSNLLSRF++DEF  +SK TIGVEF  + V V  K +KAQ+WDTAG
Sbjct: 12  YLFKAVLIGDSAVGKSNLLSRFSKDEFRFDSKPTIGVEFAYRNVHVGDKIIKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFRA+TS+YYRGA+GAL++YDITR+TTF+NIK+WL EL    +     +LVGNK DL 
Sbjct: 72  QERFRAITSSYYRGALGALLIYDITRRTTFDNIKKWLFELRDFANPETVVVLVGNKSDLR 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             R+V             L+F+ETSAL++ NV  A
Sbjct: 132 QSREVEEDEGKTLAESEGLYFLETSALENVNVEEA 166



>gb:BC074344_2557855 Xenopus laevis MGC84182 protein, mRNA (cDNA
           clone MGC:84182 IMAGE:6953232), complete cds.
          Length = 216

 Score =  181 bits (460), Expect = 2e-44
 Identities = 89/156 (57%), Positives = 118/156 (75%), Gaps = 1/156 (0%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           ++FKVV+IG+S VGK+NLLSRF R+EF+H+S+ TIGVEF T+ + +DG  VK+Q+WDTAG
Sbjct: 10  FVFKVVLIGESGVGKTNLLSRFTRNEFNHDSRTTIGVEFSTRTLTIDGHLVKSQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDL- 522
            ER+RA+TSAYYRGAVGAL+VYDIT+  ++E++ RWL+EL  H D ++  MLVGNK DL 
Sbjct: 70  LERYRAITSAYYRGAVGALLVYDITKHQSYESVDRWLKELYDHADASIVVMLVGNKSDLK 129

Query: 521 ESIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
           +  ++V             L FIETSALD+TNV  A
Sbjct: 130 DEAQEVPSEEAKAYAERNGLLFIETSALDATNVELA 165



>pir|A86209|A86209 protein F22G5.24 [imported] - Arabidopsis
           thaliana>gb:AE005172_889744 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC022464_1539015 Genomic sequence for
           Arabidopsis thaliana BAC F22G5 from chromosome I,
           complete sequence.
          Length = 231

 Score =  181 bits (458), Expect = 3e-44
 Identities = 93/174 (53%), Positives = 118/174 (67%), Gaps = 17/174 (9%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVD------------- 738
           YLFK+V+IGDS VGKSN+LSRF R+EF   SK+TIGVEF T+ ++V              
Sbjct: 11  YLFKIVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTLQVISLLSLSLNLDNFP 70

Query: 737 ----GKEVKAQVWDTAGQERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTH 570
               GK VKAQ+WDTAGQER+RA+TSAYYRGAVGAL+VYDIT++ TFEN+ RWL EL  H
Sbjct: 71  PDQFGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKRQTFENVLRWLRELRDH 130

Query: 569 CDTTVARMLVGNKCDLESIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
            D+ +  M+ GNK DL  +R V+            L F+ETSAL++TN+  A +
Sbjct: 131 ADSNIVIMMAGNKSDLNHLRSVADEDGRSLAEKEGLSFLETSALEATNIEKAFQ 184



>gb:AF119675_2055308 Mus musculus small GTP-binding protein RAB25
           (Rab25) mRNA, complete cds.>gb:AF119676_2055309 Mus
           musculus small GTP-binding protein RAB25 (Rab25) gene,
           complete cds.
          Length = 213

 Score =  180 bits (456), Expect = 5e-44
 Identities = 94/181 (51%), Positives = 122/181 (67%), Gaps = 4/181 (2%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           ++FKVV+IG+S VGK+NLLSRF R+EF H+S+ TIGVEF T+ V +    VKAQ+WDTAG
Sbjct: 11  FVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAVKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
            ER+RA+TSAYYRGAVGAL+V+D+T+  T+  ++RWL+EL  H + T+  MLVGNK DL 
Sbjct: 71  LERYRAITSAYYRGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDLS 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNV----NTALRLSFATSTRTLAGSCSTPTP 351
             R+V             L F+ETSALDSTNV     T L+  FA  ++    S  T   
Sbjct: 131 QAREVPTEEACMFAENNGLLFLETSALDSTNVELAFQTVLKEIFAKVSKQKQNSTRTSAI 190

Query: 350 T 348
           T
Sbjct: 191 T 191



>gb:AF274025_1894209 Homo sapiens GTP-binding protein Rab25 mRNA,
           complete cds.
          Length = 217

 Score =  180 bits (456), Expect = 5e-44
 Identities = 93/177 (52%), Positives = 121/177 (68%), Gaps = 4/177 (2%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           ++FKVV+IG+S VGK+NLLSRF R+EF H+S+ TIGVEF T+ V +    VKAQ+WDTAG
Sbjct: 15  FVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAVKAQIWDTAG 74

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
            ER+RA+TSAYYRGAVGAL+V+D+T+  T+  ++RWL+EL  H + T+  MLVGNK DL 
Sbjct: 75  LERYRAITSAYYRGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDLS 134

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNV----NTALRLSFATSTRTLAGSCST 360
             R+V             L F+ETSALDSTNV     T L+  FA  ++    S  T
Sbjct: 135 QAREVPTEEARMFAENNGLLFLETSALDSTNVELAFETVLKEIFAKVSKQRQNSIRT 191



>gb:AF083124_1881603 Homo sapiens CATX-8 mRNA, complete cds.
          Length = 256

 Score =  180 bits (456), Expect = 5e-44
 Identities = 93/177 (52%), Positives = 121/177 (68%), Gaps = 4/177 (2%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           ++FKVV+IG+S VGK+NLLSRF R+EF H+S+ TIGVEF T+ V +    VKAQ+WDTAG
Sbjct: 11  FVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAVKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
            ER+RA+TSAYYRGAVGAL+V+D+T+  T+  ++RWL+EL  H + T+  MLVGNK DL 
Sbjct: 71  LERYRAITSAYYRGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDLS 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNV----NTALRLSFATSTRTLAGSCST 360
             R+V             L F+ETSALDSTNV     T L+  FA  ++    S  T
Sbjct: 131 QAREVPTEEARMFAENNGLLFLETSALDSTNVELAFETVLKEIFAKVSKQRQNSIRT 187



>gb:AP005681_1855910 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OJ1439_F07.
          Length = 239

 Score =  180 bits (456), Expect = 5e-44
 Identities = 90/156 (57%), Positives = 114/156 (73%), Gaps = 1/156 (0%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           Y+FKVVV+GDSAVGK+ LL RF +DEF  +SK+TIGVEFQT+ + +  K VKAQ+WDTAG
Sbjct: 21  YVFKVVVVGDSAVGKTQLLGRFTKDEFFLDSKSTIGVEFQTRTLSLHRKRVKAQIWDTAG 80

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RAVTSAYYRGA+GA++VYDITR+ TFEN+ RW+EEL  H D +    L+GNK D+ 
Sbjct: 81  QERYRAVTSAYYRGALGAMVVYDITRRRTFENVARWVEELRAHADGSTVVALIGNKADMP 140

Query: 518 S-IRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
           +  R+V+            LFF E SAL   NV+ A
Sbjct: 141 AGRREVAADEAARFAEEQGLFFSEASALSGDNVDRA 176



>sp|P46629|RB25_RABIT Ras-related protein Rab-25.>pir|A48500|A48500
           GTP-binding protein Rab25 - rabbit>gb:RABGTPBP_1443717
           Oryctolagus cuniculus GTP-binding protein (Rab25) mRNA,
           complete cds.
          Length = 213

 Score =  180 bits (456), Expect = 5e-44
 Identities = 92/174 (52%), Positives = 121/174 (69%), Gaps = 4/174 (2%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           ++FKVV+IG+S VGK+NLLSRF R+EF H+S+ TIGVEF T+ V +    VKAQ+WDTAG
Sbjct: 11  FVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVLLGTAAVKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
            ER+RA+TSAYYRGAVGAL+V+D+T+  T+  ++RWL+EL  H + T+  MLVGNK DL 
Sbjct: 71  LERYRAITSAYYRGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDLS 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNV----NTALRLSFATSTRTLAGS 369
             R+V             L F+ETSALDSTNV     T L+  FA  ++ +  S
Sbjct: 131 QAREVPTEEARMFAENNGLLFLETSALDSTNVELAFETVLKEIFAKVSKQIQNS 184



>sp|Q9WTL2|RB25_MOUSE Ras-related protein
           Rab-25.>gb:AK003260_1151751 Mus musculus 18-day embryo
           whole body cDNA, RIKEN full-length enriched library,
           clone:1110001O11 product:RAB25, member RAS oncogene
           family, full insert sequence.>gb:BC006624_2090254 Mus
           musculus RAB25, member RAS oncogene family, mRNA (cDNA
           clone MGC:11604 IMAGE:3968810), complete cds.
          Length = 213

 Score =  180 bits (456), Expect = 5e-44
 Identities = 94/181 (51%), Positives = 122/181 (67%), Gaps = 4/181 (2%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           ++FKVV+IG+S VGK+NLLSRF R+EF H+S+ TIGVEF T+ V +    VKAQ+WDTAG
Sbjct: 11  FVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAVKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
            ER+RA+TSAYYRGAVGAL+V+D+T+  T+  ++RWL+EL  H + T+  MLVGNK DL 
Sbjct: 71  LERYRAITSAYYRGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDLS 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNV----NTALRLSFATSTRTLAGSCSTPTP 351
             R+V             L F+ETSALDSTNV     T L+  FA  ++    S  T   
Sbjct: 131 QAREVPTEEACMFAENNGLLFLETSALDSTNVELAFQTVLKEIFAKVSKQKQNSTRTSAI 190

Query: 350 T 348
           T
Sbjct: 191 T 191



>sp|P57735|RB25_HUMAN Ras-related protein Rab-25
           (CATX-8).>gb:AL355388_1923868 Human DNA sequence from
           clone RP11-336K24 on chromosome 1 Contains the 5' end of
           the RIT1 gene for Ras-like without CAAX 1, the gene for
           a novel protein (KIAA0907), the ARHGEF2 gene for rho/rac
           guanine nucleotide exchange factor (GEF) 2, four novel
           genes, the SSR2 gene for signal sequence receptor beta
           (translocon-associated protein beta), the C1orf6 gene
           for chromosome 1 open reading frame 6, the gene for
           mitogen-activated protein-binding protein-interacting
           protein (MAPBPIP), the RAB25 gene for RAB25 (member RAS
           oncogene family), the 5' end of the LMNA gene for lamin
           A/C and three CpG islands, complete
           sequence.>gb:BC009831_1972288 Homo sapiens RAB25, member
           RAS oncogene family, mRNA (cDNA clone MGC:15077
           IMAGE:3926839), complete cds.>gb:BC033322_1980901 Homo
           sapiens RAB25, member RAS oncogene family, mRNA (cDNA
           clone MGC:30083 IMAGE:4775725), complete cds.
          Length = 213

 Score =  180 bits (456), Expect = 5e-44
 Identities = 93/177 (52%), Positives = 121/177 (68%), Gaps = 4/177 (2%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           ++FKVV+IG+S VGK+NLLSRF R+EF H+S+ TIGVEF T+ V +    VKAQ+WDTAG
Sbjct: 11  FVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAVKAQIWDTAG 70

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
            ER+RA+TSAYYRGAVGAL+V+D+T+  T+  ++RWL+EL  H + T+  MLVGNK DL 
Sbjct: 71  LERYRAITSAYYRGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDLS 130

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNV----NTALRLSFATSTRTLAGSCST 360
             R+V             L F+ETSALDSTNV     T L+  FA  ++    S  T
Sbjct: 131 QAREVPTEEARMFAENNGLLFLETSALDSTNVELAFETVLKEIFAKVSKQRQNSIRT 187



>pir|B86142|B86142 protein probable GTP-binding protein [imported] -
           Arabidopsis thaliana>gb:AE005172_889171 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC023628_1539175 Arabidopsis thaliana
           chromosome I BAC F6F3 genomic sequence, complete
           sequence.>gb:BT010707_1640653 Arabidopsis thaliana
           At1g01200 mRNA, complete cds.>gb:BT010979_1640925
           Arabidopsis thaliana At1g01200 mRNA, complete cds.
          Length = 237

 Score =  178 bits (452), Expect = 1e-43
 Identities = 91/156 (58%), Positives = 114/156 (73%), Gaps = 1/156 (0%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           Y+FKVVVIGDSAVGK+ LLSRF  +EF ++SK+TIGVEFQT+ + + GK VKAQ+WDTAG
Sbjct: 27  YVFKVVVIGDSAVGKTQLLSRFTHNEFCYDSKSTIGVEFQTRTITLRGKLVKAQIWDTAG 86

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RAVTSAYYRGA+GA++VYDIT++ +F+++ RW+EEL  H D +   MLVGNK DL 
Sbjct: 87  QERYRAVTSAYYRGALGAMVVYDITKRLSFDHVARWVEELRAHADDSAVIMLVGNKADLS 146

Query: 518 -SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
              R V             LFF E SAL   NV+ A
Sbjct: 147 VGKRAVPTEDAVEFAETQRLFFSEVSALSGGNVDEA 182



>gb:T10F20_1723324 Sequence of BAC T10F20 from Arabidopsis thaliana
           chromosome 1, complete sequence.
          Length = 326

 Score =  177 bits (449), Expect = 3e-43
 Identities = 90/155 (58%), Positives = 112/155 (72%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK V+IGDSAVGKSNLLSRF+RDEF  +SK TIGV+F  + V V  K +KAQ+WDTAG
Sbjct: 12  YLFKAVLIGDSAVGKSNLLSRFSRDEFRLDSKPTIGVDFAYRNVRVGDKTIKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFRA+TS+YYRGA+GAL++YDITR+ TF+NI++WL EL          +LVGNK DL 
Sbjct: 72  QERFRAITSSYYRGALGALLIYDITRRITFKNIEKWLSELRGFSSPETVVVLVGNKSDLG 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             R+V             L+F+ETSAL++ NV  A
Sbjct: 132 QSREVEEEEGKTLAESEGLYFLETSALENQNVEEA 166



>gb:CEU68258_1368630 Caenorhabditis elegans rab11-like mRNA, partial
           cds.
          Length = 127

 Score =  175 bits (444), Expect = 1e-42
 Identities = 82/118 (69%), Positives = 98/118 (83%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF R+EF   SK+TIGVEF T+ + V+GK VKAQ+WDTAG
Sbjct: 10  YLFKVVLIGDSGVGKSNLLSRFTRNEFHLESKSTIGVEFATRSISVEGKTVKAQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCD 525
           QER+RA+TSAYYRGAVGAL+VYDI +  T+EN++RWL+EL  H D  +  M VGNKCD
Sbjct: 70  QERYRAITSAYYRGAVGALLVYDIAKHVTYENVERWLKELRDHADQNIVIMPVGNKCD 127



>gb:AB054588_1196631 Entamoeba histolytica EhRab11C mRNA for small
           GTPase Rab11C, complete cds.
          Length = 212

 Score =  175 bits (443), Expect = 1e-42
 Identities = 81/154 (52%), Positives = 111/154 (72%)
 Frame = -2

Query: 875 LFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAGQ 696
           ++K+V+IG+S VGKSNLL RF R+EF+   K TIGVEF T+ +E +GK ++AQ+WDTAGQ
Sbjct: 8   MYKLVIIGESGVGKSNLLLRFTRNEFEPEKKFTIGVEFATRTIEYEGKTIRAQIWDTAGQ 67

Query: 695 ERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLES 516
           E++RA+T AYYRGA GA+ VYD+++K +F+ I+RW+ EL    D+ +  M+VGNK DL+ 
Sbjct: 68  EKYRAITDAYYRGAEGAMCVYDVSKKDSFDAIERWMNELKNGRDSDITIMIVGNKADLKQ 127

Query: 515 IRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            R+V+             FFIETSALD TNV  A
Sbjct: 128 EREVNTSDGTEFAQKHSAFFIETSALDGTNVEKA 161



>gb:AC117075_1207790 Dictyostelium discoideum chromosome 2 map
           5201047-5455781 strain AX4, complete sequence.
          Length = 220

 Score =  174 bits (441), Expect = 3e-42
 Identities = 89/153 (58%), Positives = 108/153 (70%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK     DSAVGKSNLL+RF R+EF   +KATIGV+F T+ +E+D K + AQ WDTAG
Sbjct: 9   YLFK----SDSAVGKSNLLNRFTRNEFTEKTKATIGVDFGTKSIEIDNKTITAQCWDTAG 64

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFRAVTS YYRGAVGA+IVYDIT K +F+N+ RWL EL    +  +  M+VGNK DLE
Sbjct: 65  QERFRAVTSGYYRGAVGAMIVYDITSKISFKNVTRWLNELREMAEQDILIMMVGNKSDLE 124

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVN 420
             R+V             + F+ETSAL+STNVN
Sbjct: 125 MSREVPTKEAQAFAESNKISFLETSALNSTNVN 157



>gb:AE017345_1756792 Cryptococcus neoformans var. neoformans JEC21
           chromosome 5, complete sequence.
          Length = 205

 Score =  172 bits (437), Expect = 7e-42
 Identities = 85/141 (60%), Positives = 105/141 (74%)
 Frame = -2

Query: 830 NLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAGQERFRAVTSAYYRGAV 651
           NLLSRF R+EF+  SK+TIGVEF T+ + VDGK VKAQ+WDTAGQER+RA+TSAYYRGAV
Sbjct: 17  NLLSRFTRNEFNLESKSTIGVEFATRSINVDGKTVKAQIWDTAGQERYRAITSAYYRGAV 76

Query: 650 GALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLESIRDVSVXXXXXXXXX 471
           GAL+VYDI +  T+EN+ RWL+EL  H D  +  MLVGNK DL+ +R VS          
Sbjct: 77  GALLVYDIAKHQTYENVTRWLKELRDHADANIVIMLVGNKSDLKHLRAVSTDEAKQFATE 136

Query: 470 XXLFFIETSALDSTNVNTALR 408
             L FIETSALD++NV +A +
Sbjct: 137 NGLSFIETSALDASNVESAFQ 157



>gb:AJ697970_1813433 Medicago sativa rab11f gene for small GTPase.
          Length = 218

 Score =  171 bits (434), Expect = 2e-41
 Identities = 88/152 (57%), Positives = 111/152 (73%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK V+IGDS VGKSNLLSRFA+DEF  +SK TIGVEF  + ++V  K +KAQ+WDTAG
Sbjct: 14  YLFKAVLIGDSGVGKSNLLSRFAKDEFRLDSKPTIGVEFAYRNIKVRDKLIKAQIWDTAG 73

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFRA+TS+YYRGA+GAL+VYDITR++++E++ RWL EL       +  +LVGNKCDL 
Sbjct: 74  QERFRAITSSYYRGALGALLVYDITRRSSYESVGRWLVELREFGGEEMVVILVGNKCDLG 133

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNV 423
             R+V             L F+ETSAL + NV
Sbjct: 134 ESREVEEEEAKGFAEAEGLCFMETSALKNLNV 165



>pir|S45023|S45023 GTP-binding protein Rab -
           alfalfa>gb:MSRAB_1687227 M.sativa Rab mRNA.
          Length = 217

 Score =  171 bits (434), Expect = 2e-41
 Identities = 88/155 (56%), Positives = 111/155 (71%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFKVV+IGDS VGKSNLLSRF ++EF+  SK+TIGVEF T+ + VD K +KAQ+WDTAG
Sbjct: 12  YLFKVVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATRTLNVDSKVIKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QER+RA+TSAYYRGAVGAL+VYD+TR  TFEN+++  E            +LVGNK DL 
Sbjct: 72  QERYRAITSAYYRGAVGALLVYDVTRHGTFENVRQMAERTAKPHRFQHCCVLVGNKADLR 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
            +  VS            L+F+ETSAL++TNV  +
Sbjct: 132 HLVAVSTEDGKSYAEKESLYFMETSALEATNVENS 166



>pir|T03637|T03637 GTP-binding protein mgp2 -
           maize>gb:MZEMGP2_1687947 Maize mRNA for mgp2 GTP-binding
           protein, complete cds.
          Length = 216

 Score =  171 bits (434), Expect = 2e-41
 Identities = 93/180 (51%), Positives = 117/180 (65%), Gaps = 8/180 (4%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHN--SKATIGVEFQTQVVEVDGKEVKAQVWDT 705
           Y+FKVVVIGDS VGKS LL  FAR+   HN  SK+TIGVEF T+ +  + K VKAQ+WDT
Sbjct: 10  YVFKVVVIGDSGVGKSQLLMGFARN---HNLESKSTIGVEFATRSIRFEDKVVKAQIWDT 66

Query: 704 AGQERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCD 525
           AGQER+RA+TSAYYRGAVGAL+VYD+TR  TFEN++RWL+EL  H D+ +  MLVGNK D
Sbjct: 67  AGQERYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDSNIVIMLVGNKAD 126

Query: 524 LESIRDVSVXXXXXXXXXXXLFFI------ETSALDSTNVNTALRLSFATSTRTLAGSCS 363
           L  +R V+             FF+      ETSAL     N    +    S + L+ + +
Sbjct: 127 LRHLRAVATEDAKAFAEMESTFFMGNIRYGETSALKEAFKNVLTDIYRIASQKNLSANAA 186



>gb:AF152531_1245603 Trypanosoma brucei small GTPase Rab11 (Rab11)
           gene, complete cds.>gb:AF234188_1253363 Trypanosoma
           brucei RAB11A GTPase (RAB11A) gene, complete cds.
          Length = 216

 Score =  168 bits (426), Expect = 1e-40
 Identities = 83/178 (46%), Positives = 118/178 (66%), Gaps = 1/178 (0%)
 Frame = -2

Query: 872 FKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAGQE 693
           FKVV++GDS VGKSNL++R+  DEF  ++ ATIGVEF T+ ++++G++ K Q+WDTAGQE
Sbjct: 8   FKVVIVGDSGVGKSNLMTRYTADEFSQDTPATIGVEFMTKSIKIEGRDAKVQIWDTAGQE 67

Query: 692 RFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLESI 513
           RFRA++ + Y GA GA++VYDIT +T+F++I  WL+EL      T +  L+GNKCDLE +
Sbjct: 68  RFRAISRSIYHGAKGAMLVYDITNQTSFDSISTWLQELRAFVPATCSIFLIGNKCDLEHL 127

Query: 512 RDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR-LSFATSTRTLAGSCSTPTPTRP 342
           R +             L F+ETSAL+ TNV+ A   L+ +     +A   S  T  RP
Sbjct: 128 RVIKKEVADRFARENGLSFLETSALEKTNVDKAFEWLAKSVYDHVVAPVDSAATGKRP 185



>gb:SCRASX_1709324 Yeast YP2 gene The YP2 protein shows homology
           with the p21 proteins encoded by the human c-has/bas
           proto-oncogenes and transforming p21 proteins of the
           Harvey (v-rasH) and Kirsten (v-rasK) murine sarcoma
           viral oncogenes.
          Length = 206

 Score =  167 bits (423), Expect = 3e-40
 Identities = 85/172 (49%), Positives = 118/172 (68%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IG+S VGKS LL RF+ D + ++  +TIGV+F+ + VE+DGK VK Q+WDTAG
Sbjct: 7   YLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRG+ G +IVYD+T + +F  +K WL+E++ +  +TV ++LVGNKCDL+
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLK 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCS 363
             R V             + F+ETSALDSTNV  A    F T  R +  S S
Sbjct: 127 DKRVVEYDVAKEFADANKMPFLETSALDSTNVEDA----FLTMARQIKQSMS 174



>gb:CR857602_1181826 Pongo pygmaeus mRNA; cDNA DKFZp469D1215 (from
           clone DKFZp469D1215).
          Length = 207

 Score =  167 bits (423), Expect = 3e-40
 Identities = 77/155 (49%), Positives = 109/155 (70%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGK+ LL RF+ D F+    +TIG++F+ + +E+DGK++K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +T+AYYRGA+G ++VYDIT + +F+NIK W+  +  H  + V RM++GNKCD+ 
Sbjct: 67  QERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMN 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             R VS            + F+ETSA  STNV  A
Sbjct: 127 DKRQVSKERGEKLAIDYGIKFLETSAKSSTNVEEA 161



>sp|P01123|YPT1_YEAST GTP-binding protein YPT1 (Protein
           YP2).>pir|S56216|TVBYQ2 GTP-binding protein YPT1 - yeast
           (Saccharomyces cerevisiae)>gb:AY558467_1614694
           Saccharomyces cerevisiae clone FLH111583.01X YFL038C
           gene, complete cds.>gb:YSCCHRVIN_1728471 Saccharomyces
           cerevisiae chromosome VI complete DNA sequence.
          Length = 206

 Score =  167 bits (423), Expect = 3e-40
 Identities = 85/172 (49%), Positives = 118/172 (68%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IG+S VGKS LL RF+ D + ++  +TIGV+F+ + VE+DGK VK Q+WDTAG
Sbjct: 7   YLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRG+ G +IVYD+T + +F  +K WL+E++ +  +TV ++LVGNKCDL+
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLK 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCS 363
             R V             + F+ETSALDSTNV  A    F T  R +  S S
Sbjct: 127 DKRVVEYDVAKEFADANKMPFLETSALDSTNVEDA----FLTMARQIKESMS 174



>sp|P61028|RB8B_MOUSE Ras-related protein Rab-8B.>sp|P70550|RB8B_RAT
           Ras-related protein Rab-8B.>gb:AK084650_1174290 Mus
           musculus 13 days embryo heart cDNA, RIKEN full-length
           enriched library, clone:D330025I23 product:RAS-RELATED
           PROTEIN RAB-8B homolog [Rattus norvegicus], full insert
           sequence.>gb:BC059208_2103690 Mus musculus RAB8B, member
           RAS oncogene family, mRNA (cDNA clone MGC:66509
           IMAGE:6405462), complete cds.>gb:RNU53475_2137433 Rattus
           norvegicus GTPase Rab8b (Rab8b) mRNA, complete cds.
          Length = 207

 Score =  167 bits (423), Expect = 3e-40
 Identities = 77/155 (49%), Positives = 109/155 (70%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGK+ LL RF+ D F+    +TIG++F+ + +E+DGK++K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +T+AYYRGA+G ++VYDIT + +F+NIK W+  +  H  + V RM++GNKCD+ 
Sbjct: 67  QERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMN 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             R VS            + F+ETSA  STNV  A
Sbjct: 127 DKRQVSKERGEKLAIDYGIKFLETSAKSSTNVEEA 161



>gb:AJ634908_1813314 Cucumis sativus partial mRNA for putative
           Ras-related GTP-binding protein (rasgbp gene).
          Length = 203

 Score =  167 bits (422), Expect = 4e-40
 Identities = 89/167 (53%), Positives = 113/167 (67%), Gaps = 5/167 (2%)
 Frame = -2

Query: 863 VVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAGQERFR 684
           V+ GDS VGKSNLLSRF+++EF  +S+ TIGVEF  + ++V  K VK Q+WDTAGQERFR
Sbjct: 1   VLTGDSGVGKSNLLSRFSKNEFRFDSRPTIGVEFAYRNIKVADKLVKTQIWDTAGQERFR 60

Query: 683 AVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLESIRDV 504
           A+TS+YYRGA+GAL+VYDITR  TF+NIK+WL EL    +  +  +LVGNKCDL   R+V
Sbjct: 61  AITSSYYRGALGALLVYDITRVATFDNIKKWLRELREFGNPEMVIILVGNKCDLHQSREV 120

Query: 503 SVXXXXXXXXXXXLFFIETSALDSTNVNTAL-----RLSFATSTRTL 378
                        LFF+ETSA D+ NV  A      R+    S +TL
Sbjct: 121 QEEEARHLAELENLFFMETSAKDNLNVEEAFLEMVRRIHAIASQKTL 167



>gb:AB112929_1200243 Caenorhabditis elegans rab8 mRNA for Rab8,
           complete cds.>gb:AF106592_1241761 Caenorhabditis elegans
           cosmid D1037, complete sequence.
          Length = 211

 Score =  167 bits (422), Expect = 4e-40
 Identities = 75/155 (48%), Positives = 112/155 (72%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGK+ +L RF+ D F+++  +TIG++F+ + +E+DGK++K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTIELDGKKIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +T+AYYRGA+G ++VYDIT + +FENIK W+  +  H  + V RM++GNKCD+E
Sbjct: 67  QERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASDVERMIIGNKCDIE 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             R+VS              F+ETSA  + N++ A
Sbjct: 127 ERREVSRDRGEQLAIEYGTKFLETSAKANLNIDEA 161



>pir|T33855|T33855 hypothetical protein D1037.4 - Caenorhabditis
           elegans
          Length = 224

 Score =  167 bits (422), Expect = 4e-40
 Identities = 75/155 (48%), Positives = 112/155 (72%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGK+ +L RF+ D F+++  +TIG++F+ + +E+DGK++K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTIELDGKKIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +T+AYYRGA+G ++VYDIT + +FENIK W+  +  H  + V RM++GNKCD+E
Sbjct: 67  QERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASDVERMIIGNKCDIE 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             R+VS              F+ETSA  + N++ A
Sbjct: 127 ERREVSRDRGEQLAIEYGTKFLETSAKANLNIDEA 161



>gb:GMU58854_1680708 Glycine max small GTP-binding protein (sra2)
           mRNA, complete cds.
          Length = 202

 Score =  166 bits (421), Expect = 5e-40
 Identities = 81/155 (52%), Positives = 110/155 (70%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RF+ D +  +  +TIGV+F+ + VE DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFSDDSYIESYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G +IVYD+T + +F N+K+WL E++ +    V ++LVGNKCDLE
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTDEESFNNVKQWLSEIDRYASDNVNKLLVGNKCDLE 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
           + R VS            + F+ETSA D+TNV  A
Sbjct: 127 ANRAVSYETAKAFADGIGIPFMETSAKDATNVEQA 161



>gb:AY223134_1176598 Schistosoma japonicum clone ZZD1452 mRNA
           sequence.
          Length = 198

 Score =  166 bits (421), Expect = 5e-40
 Identities = 81/155 (52%), Positives = 109/155 (70%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA + F     +TIGV+F+ + +++DGK VK Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLIRFADESFSETYISTIGVDFKIRTIDLDGKVVKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G +IVYD+T KT+F N+K WL+E+  + ++TV R+LVGNKCDL 
Sbjct: 67  QERFRTITSSYYRGAQGIIIVYDVTDKTSFINVKSWLQEIEHYANSTVNRLLVGNKCDLP 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             R V             + F+ETSA ++ NV  A
Sbjct: 127 KSRAVDTVDAMNFAKEHQMPFLETSAKEAINVEDA 161



>pir|T33781|T33781 hypothetical protein C39F7.4 - Caenorhabditis
           elegans>gb:AF101310_1241301 Caenorhabditis elegans
           cosmid C39F7, complete sequence.
          Length = 205

 Score =  166 bits (421), Expect = 5e-40
 Identities = 83/169 (49%), Positives = 116/169 (68%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + +E+DGK +K Q+WDTAG
Sbjct: 10  YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++VYDIT + TF N+K+WL+E++ +    V ++LVGNKCDL 
Sbjct: 70  QERFRTITSSYYRGAHGIIVVYDITDQETFNNVKQWLQEIDRYACENVNKLLVGNKCDLT 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAG 372
           + R V             + F+ETSA  STNV  A  L+ A+  ++  G
Sbjct: 130 AKRAVETQAAQDYAGQLGIPFLETSAKSSTNVEQAF-LTMASEIKSRMG 177



>sp|P16976|YPT1_MAIZE GTP-binding protein YPTM1.>pir|A38202|A38202
           GTP-binding protein - maize>gb:ZMYPTM1_1732275 Z.mays
           yptm1 cDNA.
          Length = 208

 Score =  166 bits (421), Expect = 5e-40
 Identities = 84/170 (49%), Positives = 115/170 (67%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS+VGKS  L RFA D +  +  +TIGV+F+ + VEV+GK VK Q+WDTAG
Sbjct: 7   YLFKLLLIGDSSVGKSCFLLRFADDSYVDSYISTIGVDFKIRTVEVEGKTVKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G +IVYDIT   +F N+K+WL+E++ + + +V ++LVGNKCDL 
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDITDMESFNNVKQWLDEIDRYANDSVRKLLVGNKCDLA 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGS 369
             R V             + F+ETSA +S NV  A     A   ++ AGS
Sbjct: 127 ENRAVDTSVAQAYAQEVGIPFLETSAKESINVEEAFLAMSAAIKKSKAGS 176



>gb:KLA249367_1683512 Kluyveromyces lactis ypt1 gene.
          Length = 206

 Score =  166 bits (419), Expect = 9e-40
 Identities = 85/172 (49%), Positives = 117/172 (68%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IG+S VGKS LL RF+ D + ++  +TIGV+F+ + VE+DGK VK Q+WDTAG
Sbjct: 7   YLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRG+ G +IVYD+T + +F  +K WL+E++    +TV ++LVGNKCDL+
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDRESFNGVKMWLQEIDRIATSTVLKLLVGNKCDLK 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCS 363
             R V             + F+ETSALDSTNV  A    F T  R +  S S
Sbjct: 127 DKRVVEYDVAKEFADANKMPFLETSALDSTNVEDA----FLTMARQIKESMS 174



>gb:AF461435_1273271 Babesia gibsoni small GTP binding protein rab11
           (rab11) mRNA, complete cds.
          Length = 212

 Score =  166 bits (419), Expect = 9e-40
 Identities = 85/158 (53%), Positives = 112/158 (70%), Gaps = 1/158 (0%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQ-VVEVDGKEVKAQVWDTA 702
           YLFK+V+IGDS VGKSNLL RF +  F  +SK+TIGVEF T+ VV  +GK  KAQ+WDTA
Sbjct: 9   YLFKIVLIGDSNVGKSNLLDRFVKGNFKLDSKSTIGVEFATKNVVLNNGKIAKAQIWDTA 68

Query: 701 GQERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDL 522
           GQER+RA+TSAYYRGA+GA++VYDI  K++F ++ +WL EL+ + D  +   LVGNK DL
Sbjct: 69  GQERYRAITSAYYRGAMGAIVVYDIACKSSFVSVSKWLTELHDYADGNITICLVGNKSDL 128

Query: 521 ESIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
             +R+V+            L F ETS L+S NV+ A +
Sbjct: 129 THLREVAKEDGEAFANENDLIFFETSCLNSENVDVAFK 166



>gb:CR380957_1653056 Candida glabrata strain CBS138 chromosome K
           complete sequence.
          Length = 206

 Score =  165 bits (418), Expect = 1e-39
 Identities = 84/170 (49%), Positives = 116/170 (68%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IG+S VGKS LL RF+ D + ++  +TIGV+F+ + VE+DGK VK Q+WDTAG
Sbjct: 7   YLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRG+ G +IVYD+T + +F  +K WL+E++ +  +TV ++LVGNKCDL 
Sbjct: 67  QERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLA 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGS 369
             R V             + F+ETSALDSTNV  A    F T  R +  S
Sbjct: 127 DKRVVEYDVAKEFAEANKMPFLETSALDSTNVEEA----FLTMARQIKES 172



>pir|S41430|S41430 GTP-binding protein, ras-like (clone vfa-ypt1) -
           fava bean>gb:PEAGTPBP11_1699693 Pisum sativum mRNA for
           GTP-binding protein, complete cds,
           clone:pra9C.>gb:VFGNRPR1_1727138 V.faba mRNA for guanine
           nucleotide regulatory protein (923bp).
          Length = 202

 Score =  165 bits (418), Expect = 1e-39
 Identities = 86/180 (47%), Positives = 117/180 (65%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + VE DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDSYIDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G +IVYD+T + +F N+K+WL E++ +    V ++LVGNKCDL 
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTDEESFNNVKQWLSEIDRYASDNVNKLLVGNKCDLT 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCSTPTPTRPS 339
             R V             + F+ETSA DSTNV  A  ++ A+S +    S  T     P+
Sbjct: 127 ENRAVPYETAKAFADEIGIPFMETSAKDSTNVEQAF-MAMASSIKERMASQPTNNARPPT 185



>sp|Q92930|RB8B_HUMAN Ras-related protein
           Rab-8B.>gb:HSM804678_1187250 Homo sapiens mRNA; cDNA
           DKFZp667F1514 (from clone
           DKFZp667F1514).>gb:AX236076_1464502 Sequence 7 from
           Patent WO0164887.>gb:AX876024_1476341 Sequence 10929
           from Patent EP1074617.>gb:AB038995_1866740 Homo sapiens
           mRNA for RAB-8b protein, complete
           cds.>gb:BC020654_1977121 Homo sapiens RAB8B, member RAS
           oncogene family, mRNA (cDNA clone MGC:22321
           IMAGE:4701429), complete cds.
          Length = 207

 Score =  165 bits (418), Expect = 1e-39
 Identities = 76/155 (49%), Positives = 108/155 (69%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGK+ LL RF+ D F+    +TIG++F+ + +E+DGK++K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +T+AYYRGA+G ++VYDIT + +F+NIK W+  +  H  + V RM++GNKCD+ 
Sbjct: 67  QERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMN 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             R VS            + F+ETSA  S NV  A
Sbjct: 127 DKRQVSKERGEKLAIDYGIKFLETSAKSSANVEEA 161



>gb:BC078493_2561034 Xenopus laevis MGC85265 protein, mRNA (cDNA
           clone MGC:85265 IMAGE:6873913), complete cds.
          Length = 207

 Score =  164 bits (416), Expect = 2e-39
 Identities = 76/155 (49%), Positives = 108/155 (69%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGK+ LL RF+ D F+    +TIG++F+ + +E+DGK++K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +T+AYYRGA+G ++VYDIT + +F+NIK W+  +  H  + V RM++GNKCD+ 
Sbjct: 67  QERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMN 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             R VS            + F+ETSA  S NV  A
Sbjct: 127 DKRQVSREKGEKLAIDYGIKFLETSAKSSINVEEA 161



>gb:BC078133_2560769 Xenopus laevis RAB8B, member RAS oncogene
           family, mRNA (cDNA clone MGC:84543 IMAGE:5084603),
           complete cds.
          Length = 207

 Score =  164 bits (416), Expect = 2e-39
 Identities = 76/152 (50%), Positives = 107/152 (70%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGK+ LL RF+ D F+    +TIG++F+ + +E+DGK++K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +T+AYYRGA+G ++VYDIT + +FENIK W+  +  H  + V RM++GNKCD+ 
Sbjct: 67  QERFRTITTAYYRGAMGIMLVYDITNEKSFENIKNWIRNIEEHASSDVERMILGNKCDMN 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNV 423
             R VS            + F+ETSA  S NV
Sbjct: 127 DKRQVSREKGEKLAIDYGIKFLETSAKSSINV 158



>gb:AP003443_1829474 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:B1144D11.>gb:AP003924_1835316 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:B1064G04.
          Length = 202

 Score =  164 bits (416), Expect = 2e-39
 Identities = 84/180 (46%), Positives = 116/180 (64%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + VE DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDSYLESYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++VYD+T + +F N+K+WL E++ +    V ++LVGNKCDL 
Sbjct: 67  QERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLNEIDRYASENVNKLLVGNKCDLA 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCSTPTPTRPS 339
             R VS            + F+ETSA D+TNV  A          T+AG       ++P+
Sbjct: 127 ENRVVSYEAGKALADEIGIPFLETSAKDATNVEKAF--------MTMAGEIKNRMASQPA 178



>gb:PEAGTPBP08_1699690 Pisum sativum mRNA for GTP-binding protein,
           complete cds, clone:pra8.
          Length = 201

 Score =  164 bits (416), Expect = 2e-39
 Identities = 83/170 (48%), Positives = 115/170 (67%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS+VGKS LL RFA D +  +  +TIGV+F+ + VE++GK VK Q+WDTAG
Sbjct: 7   YLFKLLIIGDSSVGKSCLLLRFADDSYVDSYISTIGVDFKIRTVELEGKTVKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G +IVYD+T   +F N+K+WL E++ + + +V ++LVGNKCDL 
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTDMESFNNVKQWLHEIDRYANDSVCKLLVGNKCDLT 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGS 369
             + V             + F+ETSA DS NV  A  L+ A   +   GS
Sbjct: 127 ENKVVQTQTAKAFADELGIPFLETSAKDSINVEQAF-LTMAAEIKKKMGS 175



>gb:NP43GTP_1691039 N.plumbaginifolia mRNA for small GTP-binding
           protein, clone Np43GTP.
          Length = 203

 Score =  164 bits (415), Expect = 3e-39
 Identities = 83/179 (46%), Positives = 118/179 (65%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + VE DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDSYLESYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++VYD+T + +F N+K+WL E++ +   +V ++LVGNKCDL 
Sbjct: 67  QERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLSEIDRYASDSVNKLLVGNKCDLT 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCSTPTPTRP 342
           + + VS            + F+ETSA ++TNV  A  ++ A S +    S       RP
Sbjct: 127 AQKVVSTETAQAFADEIGIPFMETSAKNATNVEQAF-MAMAASIKNRMASQPASNNARP 184



>gb:SLU38464_1715387 Solanum lycopersicum small GTP-binding protein
           (LeRab1A) mRNA, complete cds.
          Length = 203

 Score =  164 bits (414), Expect = 3e-39
 Identities = 82/179 (45%), Positives = 117/179 (65%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + V+ DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSRLLLRFADDSYLESYISTIGVDFKIRTVDQDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++VYD+T + +F N+K+WL E++ +    V ++LVGNKCDL 
Sbjct: 67  QERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLSEIDRYASDNVNKLLVGNKCDLT 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCSTPTPTRP 342
           + + VS            + F+ETSA ++TNV  A  ++ A S +    S       RP
Sbjct: 127 AQKVVSTETAQAFADEIGIPFMETSAKNATNVEQAF-MAMAASIKNRMASQPASNNARP 184



>gb:LJRAB11F_1685016 L.japonicus mRNA for small GTP-binding protein,
           RAB11F.
          Length = 218

 Score =  164 bits (414), Expect = 3e-39
 Identities = 85/155 (54%), Positives = 108/155 (69%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK V+IGDS VGKSNL+SRFA+DEF  +SK TIGVEF  + ++V  K +KAQ+WDTAG
Sbjct: 12  YLFKAVLIGDSGVGKSNLISRFAKDEFRLDSKPTIGVEFAYRNIKVRDKLIKAQIWDTAG 71

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFRA+TS+YYRGA+G ++VYDITR+ TF N+ +WL EL    +  +  +LV NK DL 
Sbjct: 72  QERFRAITSSYYRGALGPMLVYDITRRPTFMNVIKWLHELREFGNEDMVVVLVANKSDLV 131

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             R+V             L F+ETSAL + NV  A
Sbjct: 132 QSREVEKEEGEEFAEIEGLCFMETSALQNLNVEEA 166



>sp|P40392|RIC1_ORYSA Ras-related protein RIC1.>pir|S38740|S38740
           GTP-binding protein - rice>gb:S66160_1704399
           ric1=ras-related GTP binding protein possessing GTPase
           activity [Oryza sativa=rice, Yamahoushi, callus, mRNA,
           955 nt].
          Length = 202

 Score =  164 bits (414), Expect = 3e-39
 Identities = 80/155 (51%), Positives = 108/155 (69%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + VE DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDSYLESYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++VYD+T + +F N+K+WL E++ +    V ++LVGNKCDL 
Sbjct: 67  QERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLNEIDRYASENVNKLLVGNKCDLA 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             R VS            + F+ETSA D+TNV  A
Sbjct: 127 ENRVVSYEAGKALADEIGIPFLETSAKDATNVEKA 161



>gb:BC047816_2549902 Danio rerio zgc:56049, mRNA (cDNA clone
           MGC:56049 IMAGE:3820257), complete cds.
          Length = 201

 Score =  163 bits (413), Expect = 4e-39
 Identities = 79/180 (43%), Positives = 120/180 (66%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + +E+DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++VYD+T + ++ N+K+WL+E++ +    V ++LVGNKCDL 
Sbjct: 67  QERFRTITSSYYRGAHGIIVVYDVTDQESYNNVKQWLQEIDRYASENVNKLLVGNKCDLT 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCSTPTPTRPS 339
           + + V             + F+ETSA ++TNV  A  ++ A   +   G  +T    +P+
Sbjct: 127 TKKVVDYTTAKEFADSLAIPFLETSAKNATNVEQAF-MTMAAEIKKRMGPGATTGGDKPN 185



>pir|S72515|S72515 GTP-binding protein RAB1 - garden
           petunia>gb:PHU35026_1700205 Petunia hybrida Rab1-like
           small GTP-binding protein mRNA, complete cds.
          Length = 202

 Score =  163 bits (413), Expect = 4e-39
 Identities = 79/155 (50%), Positives = 109/155 (70%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS+VGKS LL RFA D +  +  +TIGV+F+ + VE+DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSSVGKSCLLLRFADDSYVDSYISTIGVDFKIRTVELDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G +IVYD+T   +F N+K+WL E++ + + +V ++LVGNKCDL 
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTEMESFNNVKQWLSEIDRYANESVCKLLVGNKCDLV 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             + V             + F+ETSA DS NV  A
Sbjct: 127 ENKVVDTQTGKALADELGIPFLETSAKDSINVEQA 161



>sp|P22128|RAB8_DISOM Ras-related protein Rab-8
           (ORA2).>gb:DYGORA2_2571458 Discopyge ommata GTP-binding
           protein (ora2) mRNA, complete cds.
          Length = 210

 Score =  163 bits (413), Expect = 4e-39
 Identities = 77/155 (49%), Positives = 107/155 (69%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGK+ LL RF+ D F+    +TIG++F+ + VE+DGK++K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTVELDGKKIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +T+AYYRGA+G + VYDIT + +F+NIK W+  +  H  + V RM++GNKCD+ 
Sbjct: 67  QERFRTITTAYYRGAMGIMKVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMN 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             R VS            + F+ETSA  S NV  A
Sbjct: 127 EKRQVSKERGEKLAIDYGIKFLETSAKSSINVEEA 161



>gb:AL772154_2504473 Zebrafish DNA sequence from clone CH211-101N13
           in linkage group 13 Contains part of two novel genes, a
           novel gene for a protein similar to asparaginases, a
           novel gene similar to RAB1B (RAS oncogene family member
           1B), a novel gene, two novel genes similar to SLC1A4 and
           SLC1A1 (solute carrier family 1 members 4 and 1) and
           ORF1 and ORF2 of a novel and possibly functional
           LINE-like retrotransposon, complete
           sequence.>gb:BC050239_2550362 Danio rerio RAB1A, member
           RAS oncogene family, mRNA (cDNA clone MGC:55751
           IMAGE:3816472), complete cds.>gb:BC062857_2553446 Danio
           rerio RAB1A, member RAS oncogene family, mRNA (cDNA
           clone MGC:77818 IMAGE:7001559), complete cds.
          Length = 201

 Score =  163 bits (412), Expect = 6e-39
 Identities = 84/190 (44%), Positives = 121/190 (63%), Gaps = 10/190 (5%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + +E+DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++VYD+T + +F N+K+WL+E++ +    V ++LVGNKCDL 
Sbjct: 67  QERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLT 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTR------TLAGSCST- 360
           + + V             + F+ETSA ++TNV  A     A   +      T  GS  T 
Sbjct: 127 TKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGATAGGSEKTM 186

Query: 359 ---PTPTRPS 339
               TP +P+
Sbjct: 187 KIESTPVKPA 196



>gb:LJRAB1E_1685025 L.japonicus mRNA for small GTP-binding protein,
           RAB1E.
          Length = 203

 Score =  163 bits (412), Expect = 6e-39
 Identities = 84/179 (46%), Positives = 116/179 (64%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + VE D K +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDSYIESYISTIGVDFKIRTVEQDAKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G +IVYD+T + +F N+K+WL E++ +    V ++LVGNKCDL 
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTDEESFNNVKQWLSEIDRYASDNVNKLLVGNKCDLT 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCSTPTPTRP 342
           + R VS            + F+ETSA D+TNV  A  +  + S +    S  +    RP
Sbjct: 127 ANRAVSYDTAKEFADQIGIPFMETSAKDATNVEQAF-MGMSASIKNRMASQPSANNGRP 184



>gb:BC045014_2548971 Xenopus laevis RAB1, member RAS oncogene
           family, mRNA (cDNA clone MGC:53138 IMAGE:5542649),
           complete cds.>gb:BC074522_2558017 Xenopus tropicalis
           MGC69496 protein, mRNA (cDNA clone MGC:69496
           IMAGE:5336329), complete cds.
          Length = 204

 Score =  162 bits (411), Expect = 8e-39
 Identities = 76/155 (49%), Positives = 110/155 (70%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + +E+DGK +K Q+WDTAG
Sbjct: 10  YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++VYD+T + +F N+K+WL+E++ +    V ++LVGNKCDL 
Sbjct: 70  QERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLT 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
           + + V             + F+ETSA ++TNV  A
Sbjct: 130 TKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQA 164



>gb:LJRAB1D_1685024 L.japonicus mRNA for small GTP-binding protein,
           RAB1D.
          Length = 203

 Score =  162 bits (411), Expect = 8e-39
 Identities = 83/180 (46%), Positives = 114/180 (63%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RF  D +  +  +TIGV+F+ + VE D K +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFGDDSYIESYISTIGVDFKIRTVEQDAKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G +IVYD+T + +F N+K+WL E++ +    V ++LVGNKCDL 
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTDEESFNNVKQWLSEIDRYASDNVNKLLVGNKCDLT 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCSTPTPTRPS 339
           + R VS            + F+ETSA D+TNV  A     A+    +A   S      P+
Sbjct: 127 ANRAVSYDTAKEFADQIGIPFMETSAKDATNVEQAFMAMSASIKNRMASQPSANNGRPPT 186



>gb:AY060495_1564804 Arabidopsis thaliana AT4g17530/dl4800c mRNA,
           complete cds.
          Length = 202

 Score =  162 bits (411), Expect = 8e-39
 Identities = 85/179 (47%), Positives = 117/179 (65%), Gaps = 4/179 (2%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + VE DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++ YD+T   +F N+K+WL E++ +    V ++LVGNKCDL 
Sbjct: 67  QERFRTITSSYYRGAHGIIVTYDVTDLESFNNVKQWLNEIDRYASENVNKLLVGNKCDLT 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA-LRLSFATSTRTL---AGSCSTPT 354
           S + VS            + F+ETSA ++TNV  A + ++ A  TR     AG    PT
Sbjct: 127 SQKVVSTETAKAFADELGIPFLETSAKNATNVEEAFMAMTAAIKTRMASQPAGGSKPPT 185



>gb:ATCHRIV46_1545555 Arabidopsis thaliana DNA chromosome 4, contig
           fragment No. 46.>gb:AY052204_1562578 Arabidopsis
           thaliana AT4g17530/dl4800c mRNA, complete
           cds.>gb:AF127134_1770505 Arabidopsis thaliana
           ras-related small GTP-binding protein (RAB1c) mRNA,
           complete cds.
          Length = 202

 Score =  162 bits (411), Expect = 8e-39
 Identities = 85/179 (47%), Positives = 117/179 (65%), Gaps = 4/179 (2%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + VE DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++ YD+T   +F N+K+WL E++ +    V ++LVGNKCDL 
Sbjct: 67  QERFRTITSSYYRGAHGIIVTYDVTDLESFNNVKQWLNEIDRYASENVNKLLVGNKCDLT 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA-LRLSFATSTRTL---AGSCSTPT 354
           S + VS            + F+ETSA ++TNV  A + ++ A  TR     AG    PT
Sbjct: 127 SQKVVSTETAKAFADELGIPFLETSAKNATNVEEAFMAMTAAIKTRMASQPAGGSKPPT 185



>pir|H71444|H71444 GTP-binding protein - Arabidopsis
           thaliana>gb:ATFCA8_1551803 Arabidopsis thaliana DNA
           chromosome 4, ESSA I FCA contig fragment No. 8.
          Length = 221

 Score =  162 bits (411), Expect = 8e-39
 Identities = 85/179 (47%), Positives = 117/179 (65%), Gaps = 4/179 (2%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + VE DGK +K Q+WDTAG
Sbjct: 26  YLFKLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 85

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++ YD+T   +F N+K+WL E++ +    V ++LVGNKCDL 
Sbjct: 86  QERFRTITSSYYRGAHGIIVTYDVTDLESFNNVKQWLNEIDRYASENVNKLLVGNKCDLT 145

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA-LRLSFATSTRTL---AGSCSTPT 354
           S + VS            + F+ETSA ++TNV  A + ++ A  TR     AG    PT
Sbjct: 146 SQKVVSTETAKAFADELGIPFLETSAKNATNVEEAFMAMTAAIKTRMASQPAGGSKPPT 204



>sp|Q05974|RAB1_LYMST Ras-related protein Rab-1A.>pir|S38339|S38339
           GTP-binding protein rab1 - great pond
           snail>gb:LSRAB1_1389174 L.stagnalis LS-rab1 mRNA.
          Length = 205

 Score =  162 bits (411), Expect = 8e-39
 Identities = 79/180 (43%), Positives = 120/180 (66%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + +E+DGK +K Q+WDTAG
Sbjct: 10  YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++VYD+T + +F N+K+WL+E++ +    V ++LVGNK DL 
Sbjct: 70  QERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKSDLT 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCSTPTPTRPS 339
           + + V             + F+ETSA ++TNV  A  ++ A   +   G  +  + ++PS
Sbjct: 130 TKKVVDFTTAKEYADQLGIPFLETSAKNATNVEQAF-MTMAAEIKNRMGPITAASDSKPS 188



>sp|P22125|RAB1_DISOM Ras-related protein
           ORAB-1.>gb:DYGORAB1_2571460 Discopyge ommata GTP-binding
           protein (o-rab1) mRNA, complete cds.
          Length = 202

 Score =  162 bits (411), Expect = 8e-39
 Identities = 76/155 (49%), Positives = 110/155 (70%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + +E+DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++VYD+T + +F N+K+WL+E++ +    V ++LVGNKCDL 
Sbjct: 67  QERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLT 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
           + + V             + F+ETSA ++TNV  A
Sbjct: 127 TKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQA 161



>gb:AF346820_1789995 Pichia angusta GTP-binding protein (YPT1) gene,
           complete cds.>gb:AF454544_1801102 Pichia angusta strain
           DL-1 GTP-binding protein (YPT1) and phosphomannose
           isomerase (PMI40) genes, complete cds; and unknown
           genes.
          Length = 203

 Score =  162 bits (410), Expect = 1e-38
 Identities = 77/155 (49%), Positives = 108/155 (69%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + +E+DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFAEDTYTQDYISTIGVDFKIRTIELDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G +IVYD+T + +F N+ +WL+E++ +  + V ++LVGNKCDL 
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTDQESFNNVNQWLQEIDRYATSGVMKLLVGNKCDLT 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             + V             + F+ETSA  STNV  A
Sbjct: 127 DKKVVDYAVAKEFADSRGIKFLETSASQSTNVEQA 161



>gb:AF037357_1235071 Dictyostelium discoideum GTPase rab11b (RAB11B)
           gene, complete cds.
          Length = 220

 Score =  162 bits (410), Expect = 1e-38
 Identities = 79/160 (49%), Positives = 109/160 (68%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YL K+VVIGDS VGKSNLLSR+ ++EF     +TIGVEF T+ +++D K +K Q+WDTAG
Sbjct: 10  YLCKIVVIGDSGVGKSNLLSRYNKNEFSVGKLSTIGVEFSTKTLKIDNKLIKLQLWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QE++ ++T +YY+GA+GALIVY+I  + +F N+++WL++   +       MLVGNK DL+
Sbjct: 70  QEKYNSITESYYKGAIGALIVYNIADRNSFNNLEKWLKKFRENAHQDYGIMLVGNKSDLK 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSF 399
             R+VS            + FIETSALDS NV TA    F
Sbjct: 130 EYREVSTLEGKQFAEKHYMQFIETSALDSNNVETAFNNLF 169



>pir|S39565|S39565 GTP-binding protein rab1 -
           soybean>gb:SOYRAB1P_1716083 Glycine max (Rab1p) mRNA,
           complete cds.
          Length = 201

 Score =  162 bits (410), Expect = 1e-38
 Identities = 84/173 (48%), Positives = 116/173 (67%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS+VGKS LL RFA D +  +  +TIGV+F+ + VE++GK VK Q+WDTAG
Sbjct: 7   YLFKLLLIGDSSVGKSCLLLRFADDSYVDSYISTIGVDFKIRTVELEGKTVKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G +IVYD+T   +F N+K+WL E++ + + TV ++LVGNK DL 
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTEMESFNNVKQWLNEIDRYANDTVCKLLVGNKSDLV 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCST 360
             + V             + F+ETSA DS NV  A  L+ A   +   GS +T
Sbjct: 127 DNKVVDSLTAKAFADELGIPFLETSAKDSINVEQAF-LTMAAEIKKKMGSQTT 178



>sp|Q39571|YPT1_CHLRE GTP-binding protein YPTC1.>pir|JC4105|JC4105
           GTP-binding protein yptC1 - Chlamydomonas
           reinhardtii>gb:CRU13168_1673612 Chlamydomonas
           reinhardtii YptC1 (yptC1) gene, complete cds.
          Length = 203

 Score =  162 bits (410), Expect = 1e-38
 Identities = 83/178 (46%), Positives = 116/178 (65%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + VE+DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTVELDGKVIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++VYD+T + +F N+K+WL E++ +    V ++LVGNK DL 
Sbjct: 67  QERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLNEIDRYASENVNKLLVGNKSDLT 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCSTPTPTR 345
           S + V             + F+ETSA ++TNV  A     A     +A   S P PT+
Sbjct: 127 SKKVVEYSVAKAFADEIGIPFLETSAKNATNVEQAFMTMAAEIKNRMA---SQPIPTK 181



>gb:AC104285_1737519 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0035J08, complete sequence.
          Length = 205

 Score =  162 bits (409), Expect = 1e-38
 Identities = 78/155 (50%), Positives = 107/155 (69%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS+VGKS LL RFA D +     +TIGV+F+ + +E+DGK VK Q+WDTAG
Sbjct: 6   YLFKLLLIGDSSVGKSCLLLRFADDSYIDTYISTIGVDFKIRTIELDGKTVKLQIWDTAG 65

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G +IVYD+T   +F N+K+WL E++ +   +V ++LVGNKCDL 
Sbjct: 66  QERFRTITSSYYRGAHGIIIVYDVTDMESFNNVKQWLSEIDRYASDSVCKLLVGNKCDLV 125

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             + V             + F+ETSA +S NV  A
Sbjct: 126 DSKVVDTEEAKAFAESLGISFLETSAKESINVEEA 160



>gb:SLU38465_1715388 Solanum lycopersicum small GTP-binding protein
           (LeRab1B) mRNA, complete cds.
          Length = 202

 Score =  162 bits (409), Expect = 1e-38
 Identities = 79/155 (50%), Positives = 108/155 (69%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS+VGKS LL RFA D +  +  +TIGV+F+ + VE DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSSVGKSCLLLRFADDSYVDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G +IVYD+T   +F N+K+WL E++ + + +V ++LVGNKCDL 
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTEMESFNNVKQWLNEIDRYANESVCKLLVGNKCDLV 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             + V             + F+ETSA DS NV  A
Sbjct: 127 ENKVVDTQMGKALADELGIPFLETSAKDSINVEQA 161



>gb:BT019527_2151403 Synthetic construct Homo sapiens RAB1A, member
           RAS oncogene family mRNA, partial cds.
          Length = 206

 Score =  161 bits (408), Expect = 2e-38
 Identities = 75/152 (49%), Positives = 109/152 (71%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + +E+DGK +K Q+WDTAG
Sbjct: 10  YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++VYD+T + +F N+K+WL+E++ +    V ++LVGNKCDL 
Sbjct: 70  QERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLT 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNV 423
           + + V             + F+ETSA ++TNV
Sbjct: 130 TKKVVDYTTAKEFADSLGIPFLETSAKNATNV 161



>gb:AL606522_2071425 Mouse DNA sequence from clone RP23-19L22 on
           chromosome 11 Contains the Actr2 gene for ARP2
           actin-related protein 2 homolog (yeast), a small nuclear
           ribonucleoprotein polypeptide G (Snrpg) pseudogene, two
           novel genes, the Rab1 gene for RAB1, member RAS oncogene
           family and three CpG islands, complete sequence.
          Length = 202

 Score =  161 bits (408), Expect = 2e-38
 Identities = 75/152 (49%), Positives = 109/152 (71%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + +E+DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++VYD+T + +F N+K+WL+E++ +    V ++LVGNKCDL 
Sbjct: 67  QERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLT 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNV 423
           + + V             + F+ETSA ++TNV
Sbjct: 127 TKKVVDYTTAKEFADSLGIPFLETSAKNATNV 158



>gb:PEAGTPBP10_1699692 Pisum sativum mRNA for GTP-binding protein,
           complete cds, clone:pra9B.
          Length = 203

 Score =  161 bits (408), Expect = 2e-38
 Identities = 84/179 (46%), Positives = 117/179 (65%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + VE DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDSYIESYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G +IVYD+T + +F N+K+WL E++ +    V ++LVGNK DL 
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTDEESFNNVKQWLSEIDRYASDNVNKLLVGNKSDLT 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCSTPTPTRP 342
           + R VS            + F+ETSA D+TNV  A  ++ A + +    S  +    RP
Sbjct: 127 ANRVVSYDTAKEFADQIGIPFMETSAKDATNVEGAF-MAMAAAIKDRMASQPSANNARP 184



>gb:AB054578_1196621 Entamoeba histolytica EhRab1A mRNA for small
           GTPase Rab1A, complete cds.
          Length = 205

 Score =  161 bits (408), Expect = 2e-38
 Identities = 83/185 (44%), Positives = 117/185 (63%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +     ATIGV+F+ + V++DGK VK Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDTYTDTHIATIGVDFKIKTVQIDGKNVKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++VY +    TF+N+++WL+E+  +   TV ++L+GNKCDL+
Sbjct: 67  QERFRTITSSYYRGAQGIIVVYSVIDLQTFQNVRQWLQEIERYASETVIKLLIGNKCDLD 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCSTPTPTRPS 339
             R V+V           + F+E SA  S NV+  L +  AT         +T  P+  +
Sbjct: 127 DERAVTVEQGQELANSLNVSFMEASAKKSLNVD-ELFIRIATDIMKNIQPANTSKPSEQA 185

Query: 338 CL*TG 324
            L  G
Sbjct: 186 DLKKG 190



>gb:AE016959_1022248 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC079935_1733067
           Genomic sequence for Oryza sativa (japonica
           cultivar-group) cultivar Nipponbare clone OSJNBa0095C06,
           from Chromosome 10, complete
           sequence.>gb:AE017086_1752067 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 40 of 77 of the
           complete sequence.
          Length = 202

 Score =  161 bits (408), Expect = 2e-38
 Identities = 87/157 (55%), Positives = 108/157 (68%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           Y+FKVV+IGDSAVGKS +L+RFAR+EF  +SKATIGVEFQT+ + +D K           
Sbjct: 9   YVFKVVLIGDSAVGKSQILARFARNEFSIDSKATIGVEFQTRTLLIDHK----------- 57

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
              +RAVTSAYYRGA+GAL+VYDIT++ +F++I RWLEEL  H D  +  MLVGNK DLE
Sbjct: 58  ---YRAVTSAYYRGALGALLVYDITKRQSFDHIPRWLEELRGHADKNIVIMLVGNKSDLE 114

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALR 408
             R VS            LFF+ETSAL +TNV  A +
Sbjct: 115 DERAVSTEDAKEFAEKENLFFLETSALQATNVENAFQ 151



>gb:AE005172_890785 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC069551_1540959 Genomic sequence
           for Arabidopsis thaliana BAC T10O22 from chromosome I,
           complete sequence.
          Length = 356

 Score =  161 bits (408), Expect = 2e-38
 Identities = 90/185 (48%), Positives = 112/185 (60%), Gaps = 30/185 (16%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK V+IGDSAVGKSNLLSRF+RDEF  +SK TIGV+F  + V V  K +KAQ+WDTAG
Sbjct: 12  YLFKAVLIGDSAVGKSNLLSRFSRDEFRLDSKPTIGVDFAYRNVRVGDKTIKAQIWDTAG 71

Query: 698 QER------------------------------FRAVTSAYYRGAVGALIVYDITRKTTF 609
           QER                              FRA+TS+YYRGA+GAL++YDITR+ TF
Sbjct: 72  QERIVNFFNNLCVFTYLKYNTVLFFIFAWEEKRFRAITSSYYRGALGALLIYDITRRITF 131

Query: 608 ENIKRWLEELNTHCDTTVARMLVGNKCDLESIRDVSVXXXXXXXXXXXLFFIETSALDST 429
           +NI++WL EL          +LVGNK DL   R+V             L+F+ETSAL++ 
Sbjct: 132 KNIEKWLSELRGFSSPETVVVLVGNKSDLGQSREVEEEEGKTLAESEGLYFLETSALENQ 191

Query: 428 NVNTA 414
           NV  A
Sbjct: 192 NVEEA 196



>pir|JE0318|JE0318 GTP-binding protein rabB -
           silkworm>gb:AF013572_1231794 Bombyx mori small
           GTP-binding protein (rabB) mRNA, complete cds.
          Length = 202

 Score =  161 bits (408), Expect = 2e-38
 Identities = 82/173 (47%), Positives = 116/173 (67%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + V+++GK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTVDLNGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G +IVYD T + +F N+K+WLEE++ +    V ++LVGNKCDL 
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDCTDQDSFSNVKQWLEEIDRYACDNVNKLLVGNKCDLT 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCST 360
           + + V             + F+ETSA +STNV  A  ++ A   +   G  ST
Sbjct: 127 TKKVVDFSTAKQYAEQLGIPFLETSAKNSTNVEQAF-MTMAAEIKARVGPPST 178



>sp|P11476|RB1A_HUMAN Ras-related protein Rab-1A (YPT1-related
           protein).>pir|S19104|TVDGYP GTP-binding protein Rab1 -
           dog>pir|A34323|TVHUYP GTP-binding protein Rab1 -
           human>pir|S05551|TVMSYP GTP-binding protein ypt1 -
           mouse>gb:AK034408_1163742 Mus musculus adult male
           diencephalon cDNA, RIKEN full-length enriched library,
           clone:9330187I11 product:RAB1, member RAS oncogene
           family, full insert sequence.>gb:HSM806623_1187700 Homo
           sapiens mRNA; cDNA DKFZp686E08159 (from clone
           DKFZp686E08159).>gb:CFRAB1_1438650 Canine rab1 mRNA for
           ras-related GTP-binding protein involved in membrane
           traffic.>gb:AF498929_1905313 Homo sapiens small GTP
           binding protein RAB1A (RAB1A) mRNA, complete
           cds.>gb:BC000905_1967117 Homo sapiens RAB1A, member RAS
           oncogene family, mRNA (cDNA clone MGC:5233
           IMAGE:2900705), complete cds.>gb:BT019528_1991112 Homo
           sapiens RAB1A, member RAS oncogene family mRNA, complete
           cds.>gb:BT019529_1991113 Homo sapiens RAB1A, member RAS
           oncogene family mRNA, complete cds.>gb:CR536488_1993783
           Homo sapiens full open reading frame cDNA clone
           RZPDo834E0917D for gene RAB1A, RAB1A, member RAS
           oncogene family; complete cds, incl.
           stopcodon.>gb:HUMRAB1A_2036108 Homo sapiens GTP-binding
           protein (RAB1) mRNA, complete cds.>gb:AF226873_2059908
           Mus musculus small GTP-binding protein RAB1A mRNA,
           complete cds.>gb:BC002077_2088848 Mus musculus RAB1,
           member RAS oncogene family, mRNA (cDNA clone MGC:6226
           IMAGE:3592802), complete cds.>gb:BC066662_2105809 Rattus
           norvegicus RAB1, member RAS oncogene family, mRNA (cDNA
           clone MGC:72414 IMAGE:5623442), complete
           cds.>gb:MMYPT1_2124603 Mouse mRNA for ras-related YPT1
           protein.>gb:MMYPT11_2124604 Mouse ypt1 gene for
           ras-related GTP-binding protein, exon
           1.>gb:BC083951_2563364 Xenopus laevis hypothetical
           LOC494888, mRNA (cDNA clone MGC:97957 IMAGE:7197825),
           complete cds.
          Length = 205

 Score =  161 bits (408), Expect = 2e-38
 Identities = 75/152 (49%), Positives = 109/152 (71%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + +E+DGK +K Q+WDTAG
Sbjct: 10  YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++VYD+T + +F N+K+WL+E++ +    V ++LVGNKCDL 
Sbjct: 70  QERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLT 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNV 423
           + + V             + F+ETSA ++TNV
Sbjct: 130 TKKVVDYTTAKEFADSLGIPFLETSAKNATNV 161



>gb:CR382134_1667256 Debaryomyces hansenii chromosome B of strain
           CBS767 of Debaryomyces hansenii.
          Length = 208

 Score =  161 bits (407), Expect = 2e-38
 Identities = 82/175 (46%), Positives = 114/175 (65%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + +E+DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDTYTPDYISTIGVDFKIRTIELDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G +IVYD+T + +F N+K+WL+E++ +    V ++LVGNK DL 
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKQWLQEIDRYATGGVMKLLVGNKADLS 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCSTPT 354
             + V             + F+ETSAL STNV  A    F T  R +    +  T
Sbjct: 127 DKKVVEYTAAKEFADALDIPFLETSALSSTNVEQA----FYTMARQIKAQMTNNT 177



>sp|P31584|YPT1_VOLCA GTP-binding protein yptV1.>pir|JC1247|JC1247
           GTP-binding protein yptV1 - Volvox
           carteri>gb:VVCYPTV_1727485 Volvox carteri small
           G-protein (yptV1) gene, complete cds.
          Length = 203

 Score =  161 bits (407), Expect = 2e-38
 Identities = 82/179 (45%), Positives = 115/179 (64%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + VE+DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTVELDGKVIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++VYD+T + +F N+K+WL E++ +    V ++LVGNK DL 
Sbjct: 67  QERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLAEIDRYASENVNKLLVGNKSDLT 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCSTPTPTRP 342
             + V             + F+ETSA ++TNV  A     A     +A   S P P +P
Sbjct: 127 GKKVVDYQAAKAFADEIGIPFLETSAKNATNVEQAFMTMAAEIKNRMA---SQPVPPKP 182



>sp|Q01890|YPT1_PHYIN Ras-like GTP-binding protein
           YPT1.>pir|JC5337|JC5337 GTP-binding protein ypt1 -
           Phytophthora infestans>gb:PIU30474_1700499 Phytophthora
           infestans ras related protein PiYpt1 (ypt1) gene,
           complete cds.
          Length = 201

 Score =  161 bits (407), Expect = 2e-38
 Identities = 79/174 (45%), Positives = 115/174 (66%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + +E+DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++VYD+T + +F N+K+WL E++ +    V ++LVGNK DL 
Sbjct: 67  QERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLHEIDRYACENVNKLLVGNKSDLT 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCSTP 357
           + R VS            + F+ETSA ++ NV  A  +  A   + +A +   P
Sbjct: 127 AKRVVSTDAAKEFAESLGIEFLETSAKNAANVEKAFMMMAAQIKKRMANAPVAP 180



>gb:BC053195_2550587 Danio rerio RAB13, member RAS oncogene family,
           mRNA (cDNA clone MGC:64010 IMAGE:6792909), complete cds.
          Length = 200

 Score =  160 bits (406), Expect = 3e-38
 Identities = 75/152 (49%), Positives = 109/152 (71%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           +LFK+++IGDS VGK+ L+ RFA D F+    +TIG++F+ + +EV+GK+VK QVWDTAG
Sbjct: 7   FLFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKVKTIEVEGKKVKLQVWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERF+ +T+AYYRGA+G ++VYDIT + ++ENI+ W++ +  +    V+RML+GNKCD+E
Sbjct: 67  QERFKTITTAYYRGAMGIILVYDITDEKSYENIQNWMKSIKENASAGVSRMLLGNKCDIE 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNV 423
           + R VS            + F ETSA  S NV
Sbjct: 127 AKRKVSKETGEKLAKEHGIRFFETSAKSSINV 158



>gb:AF330211_1787105 Candida albicans small GTP-binding protein
           Ypt1p (YPT1) gene, complete cds.
          Length = 207

 Score =  160 bits (406), Expect = 3e-38
 Identities = 78/155 (50%), Positives = 108/155 (69%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + +E+DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDTYTPDYISTIGVDFKIRTIELDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G +IVYD+T + +F N+K+WL+E++ +    V ++LVGNK DL 
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKQWLQEIDRYATGGVMKLLVGNKADLS 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             + V             + F+ETSAL STNV  A
Sbjct: 127 DKKIVEYTAAKEFADALDIPFLETSALSSTNVEQA 161



>gb:LJRAB1C_1685023 L.japonicus mRNA for small GTP-binding protein,
           RAB1C.
          Length = 202

 Score =  160 bits (405), Expect = 4e-38
 Identities = 78/155 (50%), Positives = 108/155 (69%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + VE DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++VYD+T + +F N+K+WL E++ +    V ++LVGNKCDL 
Sbjct: 67  QERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLNEIDRYASENVNKLLVGNKCDLT 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             + VS            + F+ETSA ++TNV  A
Sbjct: 127 ENKVVSYETAKAFADEIGIPFMETSAKNATNVEQA 161



>gb:AB024994_1516075 Cicer arietinum mRNA for rab-type small
           GTP-binding protein, complete cds.
          Length = 202

 Score =  160 bits (405), Expect = 4e-38
 Identities = 78/155 (50%), Positives = 109/155 (70%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + VE DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++VYD+T + +F N+K+WL E++ +    V ++LVGNKCDL 
Sbjct: 67  QERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLNEIDRYASENVNKLLVGNKCDLA 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
           + + VS            + F+ETSA ++TNV  A
Sbjct: 127 ANKVVSSETAKAFADEIGIPFMETSAKNATNVEQA 161



>sp|Q9DD03|RB13_MOUSE Ras-related protein
           Rab-13.>gb:AK002303_1151108 Mus musculus adult male
           kidney cDNA, RIKEN full-length enriched library,
           clone:0610007N03 product:RAB13, MEMBER RAS ONCOGENE
           FAMILY homolog [Homo sapiens], full insert
           sequence.>gb:BC027214_2095833 Mus musculus RAB13, member
           RAS oncogene family, mRNA (cDNA clone MGC:25544
           IMAGE:3709140), complete cds.
          Length = 202

 Score =  160 bits (405), Expect = 4e-38
 Identities = 82/186 (44%), Positives = 120/186 (64%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           +LFK+++IGDS VGK+ L+ RFA D F+    +TIG++F+ + V+++GK +K QVWDTAG
Sbjct: 7   HLFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKIRTVDIEGKRIKLQVWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERF+ +T+AYYRGA+G ++VYDIT + +FENI+ W++ +  +    V R+L+GNKCD+E
Sbjct: 67  QERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDME 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCSTPTPTRPS 339
           + R V             + F ETSA  S NV+ A   S A       G   + T ++PS
Sbjct: 127 AKRQVQREQAEKLAREHRIRFFETSAKSSVNVDEAFS-SLARDILLKTGGRRSGTNSKPS 185

Query: 338 CL*TGL 321
              TGL
Sbjct: 186 S--TGL 189



>gb:CR382124_1656560 Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 204

 Score =  160 bits (404), Expect = 5e-38
 Identities = 81/155 (52%), Positives = 108/155 (69%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D + ++  +TIGV+F+ + VE+DGK VK Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G +IVYD+T + +F N+K WL+E++      V ++LVGNK DL 
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEIDRFGTAGVLKLLVGNKNDLT 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             + V             + FIETSALDS+NV  A
Sbjct: 127 DKKVVDTEVAKEFADSIGIPFIETSALDSSNVEEA 161



>pir|T14391|T14391 GTP-binding protein homolog -
           turnip>gb:BNAYPTRP_1633499 Brassica campestris L.
           pekinensis ypt-related protein mRNA, complete cds.
          Length = 206

 Score =  160 bits (404), Expect = 5e-38
 Identities = 83/180 (46%), Positives = 117/180 (65%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS+VGKS LL RFA D +  +  +TIGV+F+ + +E DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSSVGKSCLLLRFADDAYIDSYISTIGVDFKIRTIEQDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G +IVYD T   +F N+K+WL E++ + + +V ++L+GNK D+ 
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDCTEMESFNNVKQWLSEIDRYANDSVCKLLIGNKNDMV 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCSTPTPTRPS 339
             + VS            + F+ETSA DSTNV  A  L+ A   +   GS +    T  S
Sbjct: 127 ESKVVSTETGKALADELGIPFLETSAKDSTNVEQAF-LTIAGEIKKKMGSHTNANKTSGS 185



>gb:AB158369_2048971 Mesocricetus auratus mRNA for Rab13, complete
           cds.
          Length = 203

 Score =  159 bits (403), Expect = 6e-38
 Identities = 79/180 (43%), Positives = 118/180 (65%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           +LFK+++IGDS VGK+ L+ RFA D F++   +TIG++F+ + VE++GK +K QVWDTAG
Sbjct: 7   HLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVEIEGKRIKLQVWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERF+ +T+AYYRGA+G ++VYDIT + +FENI+ W++ +  +    V R+L+GNKCD+E
Sbjct: 67  QERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDME 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCSTPTPTRPS 339
           + R V             + F ETSA  S NV+ A   S A      +G   +   ++PS
Sbjct: 127 AKRKVLKEQADKLAREHGIRFFETSAKSSMNVDEAFN-SLARDILLKSGGRRSGNHSKPS 185



>gb:LJRAB1A_1685021 L.japonicus mRNA for small GTP-binding protein,
           RAB1A.
          Length = 201

 Score =  159 bits (403), Expect = 6e-38
 Identities = 82/173 (47%), Positives = 114/173 (65%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS+VGKS LL RFA D +  +  +TIGV+F+ + VE+ GK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSSVGKSCLLLRFADDSYVDSYISTIGVDFKIRTVELQGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G +IVYD+T   +F N+K+WL E++ + + +V ++LVGNK DL 
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTEMESFNNVKQWLNEIDRYANDSVCKLLVGNKSDLV 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCST 360
             + V             + F+ETSA DS NV  A  L+ A   +   GS  T
Sbjct: 127 ENKVVDTQTAKAFADELGIPFLETSAKDSINVEQAF-LTMAAEIKKKMGSQPT 178



>gb:AK129477_2069708 Mus musculus mRNA for mKIAA3012 protein.
          Length = 253

 Score =  159 bits (402), Expect = 8e-38
 Identities = 75/152 (49%), Positives = 108/152 (71%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + +E+DGK +K Q WDTAG
Sbjct: 58  YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQRWDTAG 117

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++VYD+T + +F N+K+WL+E++ +    V ++LVGNKCDL 
Sbjct: 118 QERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLT 177

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNV 423
           + + V             + F+ETSA ++TNV
Sbjct: 178 TKKVVDYTTAKEFADSLGIPFLETSAKNATNV 209



>gb:CR533462_1993667 Homo sapiens full open reading frame cDNA clone
           RZPDo834B0317D for gene RAB1B, RAB1B, member RAS
           oncogene family; complete cds, incl. stopcodon.
          Length = 201

 Score =  159 bits (402), Expect = 8e-38
 Identities = 79/180 (43%), Positives = 118/180 (65%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  N  +TIGV+F+ + +E+DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDTYTENYISTIGVDFKIRTIELDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++VYD+T + ++ N+K+WL+E++ +    V ++LVGNK DL 
Sbjct: 67  QERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLT 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCSTPTPTRPS 339
           + + V             + F+ETSA ++TNV  A  ++ A   +   G  +     RP+
Sbjct: 127 TKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAF-MTMAAEIKKRMGPGAASGGERPN 185



>gb:AJ810707_1814165 Poa pratensis mRNA for RAB1-like (rab1-1 gene).
          Length = 203

 Score =  159 bits (402), Expect = 8e-38
 Identities = 82/180 (45%), Positives = 116/180 (64%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + VE DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDSYLESYISTIGVDFKIRTVEQDGKTMKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G +IVYD+T + +F N+K+WL E++ +    V ++LVGNKCDL 
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTDQDSFNNVKQWLNEIDRYASDNVNKLLVGNKCDLT 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCSTPTPTRPS 339
             + VS            + F+ETSA ++ NV  A  ++ + S +    S       RP+
Sbjct: 127 DKKVVSYETAKAFADEIGIPFMETSAKNALNVEQAF-MAMSASIKDRMASQPAANNARPA 185



>pir|S06147|S06147 GTP-binding protein rab1B - rat
          Length = 201

 Score =  159 bits (402), Expect = 8e-38
 Identities = 80/180 (44%), Positives = 118/180 (65%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + +E+DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR VTS+YYRGA G ++VYD+T + +F N+K+WL+E++ +    V ++LVGNK DL 
Sbjct: 67  QERFRTVTSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKSDLT 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCSTPTPTRPS 339
           + + V             + F+ETSA ++TNV  A  ++ A   +   G  +     RP+
Sbjct: 127 TKKVVDNTTAKEFADSLGVPFLETSAKNATNVEQAF-MTMAAEIKKRMGPGAASGGERPN 185



>pir|S34253|S34253 GTP-binding protein, ras-related - common
           tobacco>gb:NTRRGBP_1691759 N.tabacum mRNA for
           ras-related GTP-binding protein.
          Length = 203

 Score =  159 bits (402), Expect = 8e-38
 Identities = 79/155 (50%), Positives = 108/155 (69%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + VE DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDTYLESYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++VYD+T + +F N+K+WL E++ +    V ++LVGNK DL 
Sbjct: 67  QERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLSEIDRYASDGVNKILVGNKSDLT 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
           + R VS            + F+ETSA D+TNV  A
Sbjct: 127 ANRVVSYETAKAFADEIGIPFLETSAKDATNVEQA 161



>sp|P34139|RB1A_DICDI Ras-related protein Rab1A.>gb:DDIRAB1A_1377154
           Dictyostelium discoideum Rab1A mRNA, complete cds.
          Length = 167

 Score =  159 bits (402), Expect = 8e-38
 Identities = 77/155 (49%), Positives = 108/155 (69%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + +E++GK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDTYSESFISTIGVDFKIRTIELNGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++VYD+T K TFEN+++WL+E++      V ++LVGNK DL 
Sbjct: 67  QERFRTITSSYYRGAHGIIVVYDVTDKLTFENVRQWLQEIDRFACENVNKLLVGNKSDLV 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
           + + V             + F+ETSA  STNV  A
Sbjct: 127 AKKVVDFNTAKAFADSLQIPFLETSAKQSTNVEQA 161



>sp|P35286|RB13_RAT Ras-related protein Rab-13.>gb:AF525280_2067544
           Rattus norvegicus GTP-binding protein RAB13 mRNA,
           complete cds.
          Length = 203

 Score =  159 bits (402), Expect = 8e-38
 Identities = 79/180 (43%), Positives = 116/180 (64%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           +LFK+++IGDS VGK+ L+ RFA D F+    +TIG++F+ + VE++GK +K QVWDTAG
Sbjct: 7   HLFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKIRTVEIEGKRIKLQVWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERF+ +T+AYYRGA+G ++VYDIT + +FENI+ W++ +  +    V R+L+GNKCD+E
Sbjct: 67  QERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDME 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCSTPTPTRPS 339
           + R V             + F ETSA  S NV+ A   S A       G   +   ++PS
Sbjct: 127 AKRKVQREQAERLAREHRIRFFETSAKSSVNVDEAFS-SLARDILLKTGGRRSGNSSKPS 185



>gb:BT008275_2151207 Synthetic construct Homo sapiens mel
           transforming oncogene (derived from cell line NK14)-
           RAB8 homolog mRNA, partial cds.
          Length = 208

 Score =  159 bits (401), Expect = 1e-37
 Identities = 72/155 (46%), Positives = 106/155 (68%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGK+ +L RF+ D F+    +TIG++F+ + +E+DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +T+AYYRGA+G ++VYDIT + +F+NI+ W+  +  H    V +M++GNKCD+ 
Sbjct: 67  QERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVN 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             R VS            + F+ETSA  + NV  A
Sbjct: 127 DKRQVSKERGEKLALDYGIKFMETSAKANINVENA 161



>gb:BC071176_2106411 Rattus norvegicus cDNA clone IMAGE:7098881,
           partial cds.
          Length = 206

 Score =  159 bits (401), Expect = 1e-37
 Identities = 72/155 (46%), Positives = 106/155 (68%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGK+ +L RF+ D F+    +TIG++F+ + +E+DGK +K Q+WDTAG
Sbjct: 6   YLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAG 65

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +T+AYYRGA+G ++VYDIT + +F+NI+ W+  +  H    V +M++GNKCD+ 
Sbjct: 66  QERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVN 125

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             R VS            + F+ETSA  + NV  A
Sbjct: 126 DKRQVSKERGEKLALDYGIKFMETSAKANINVENA 160



>gb:S53268_2040415 Homo sapiens RAS-related protein MEL (MEL) gene,
           complete cds.
          Length = 206

 Score =  159 bits (401), Expect = 1e-37
 Identities = 72/155 (46%), Positives = 106/155 (68%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGK+ +L RF+ D F+    +TIG++F+ + +E+DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +T+AYYRGA+G ++VYDIT + +F+NI+ W+  +  H    V +M++GNKCD+ 
Sbjct: 67  QERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVN 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             R VS            + F+ETSA  + NV  A
Sbjct: 127 DKRQVSKERGEKLALDYGIKFMETSAKANINVENA 161



>gb:AE016815_1746457 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome II, complete sequence.
          Length = 204

 Score =  159 bits (401), Expect = 1e-37
 Identities = 83/172 (48%), Positives = 116/172 (67%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D + ++  +TIGV+F+ + VE+DGK VK Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G +IVYD+T + +F+N+K WL+E++ +    V ++LVGNK DL+
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTDQESFDNMKTWLQEIDRYGTAGVVKLLVGNKNDLK 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCS 363
             + V             +  +ETSALDS+NV  A    F T  R +  + S
Sbjct: 127 DKKVVDFEVAREFADSLNIPVLETSALDSSNVEEA----FLTMARQIKETMS 174



>gb:OSA307662_1692475 Oryza sativa genomic DNA fragment, chromosome
           2.>gb:AP002485_1822260 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 2, BAC
           clone:P0491E01.
          Length = 203

 Score =  159 bits (401), Expect = 1e-37
 Identities = 83/179 (46%), Positives = 116/179 (64%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + VE DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G +IVYD+T + +F N+K+WL E++ +    V ++LVGNK DL 
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVGNKSDLT 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCSTPTPTRP 342
           + + VS            + F+ETSA ++TNV  A  ++ A S +    S       RP
Sbjct: 127 ANKVVSSETAKAFADEMGIPFMETSAKNATNVEQAF-MAMAASIKDRMASQPAAANARP 184



>gb:AK076048_1171195 Mus musculus 11 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2700008D04
           product:cell line NK14 derived transforming oncogene,
           full insert sequence.>gb:AK079306_1172654 Mus musculus
           16 days neonate cerebellum cDNA, RIKEN full-length
           enriched library, clone:9630001I24 product:cell line
           NK14 derived transforming oncogene, full insert
           sequence.>gb:AK080740_1173054 Mus musculus adult retina
           cDNA, RIKEN full-length enriched library,
           clone:A930028D15 product:cell line NK14 derived
           transforming oncogene, full insert
           sequence.>gb:BC019990_2093191 Mus musculus RAB8A, member
           RAS oncogene family, mRNA (cDNA clone MGC:28462
           IMAGE:4161110), complete cds.
          Length = 207

 Score =  159 bits (401), Expect = 1e-37
 Identities = 72/155 (46%), Positives = 106/155 (68%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGK+ +L RF+ D F+    +TIG++F+ + +E+DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +T+AYYRGA+G ++VYDIT + +F+NI+ W+  +  H    V +M++GNKCD+ 
Sbjct: 67  QERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVN 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             R VS            + F+ETSA  + NV  A
Sbjct: 127 DKRQVSKERGEKLALDYGIKFMETSAKANINVENA 161



>pir|D38625|D38625 GTP-binding protein o-rab1 - electric ray
           (Discopyge ommata)
          Length = 201

 Score =  159 bits (401), Expect = 1e-37
 Identities = 76/155 (49%), Positives = 109/155 (70%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + +E+DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++VYD+T + +F N+K+WL+E++ +    V ++LVGNKCDL 
Sbjct: 67  QERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLT 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             + V             + F+ETSA ++TNV  A
Sbjct: 127 K-KVVDYTTAKEFADSLGIPFLETSAKNATNVEQA 160



>sp|Q05737|YPT2_MAIZE GTP-binding protein YPTM2.>pir|B38202|B38202
           GTP-binding protein - maize>gb:ZMYPTM2A_1732276 Z.mays
           yptm2 cDNA.
          Length = 203

 Score =  159 bits (401), Expect = 1e-37
 Identities = 82/180 (45%), Positives = 117/180 (65%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + VE DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G +IVYD+T + +F N+K+WL E++ +    V ++LVGNK DL 
Sbjct: 67  QERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVGNKSDLT 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTALRLSFATSTRTLAGSCSTPTPTRPS 339
           + + V+            + F+ETSA ++TNV  A  ++ A S +    S       RP+
Sbjct: 127 ANKVVATETAKAFADEMGIPFMETSAKNATNVQQAF-MAMAASIKDRMASQPAAANARPA 185



>sp|P55258|RB8A_MOUSE Ras-related protein Rab-8A (Oncogene
           c-mel).>pir|I78851|I78851 GTP-binding protein MEL -
           mouse>gb:S53270_2138586 MEL=RAS-related [mice, mRNA
           Partial, 638 nt].
          Length = 206

 Score =  159 bits (401), Expect = 1e-37
 Identities = 72/155 (46%), Positives = 106/155 (68%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGK+ +L RF+ D F+    +TIG++F+ + +E+DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +T+AYYRGA+G ++VYDIT + +F+NI+ W+  +  H    V +M++GNKCD+ 
Sbjct: 67  QERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVN 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             R VS            + F+ETSA  + NV  A
Sbjct: 127 DKRQVSKERGEKLALDYGIKFMETSAKANINVENA 161



>sp|P61007|RB8A_CANFA Ras-related protein Rab-8A (Oncogene
           c-mel).>sp|P61006|RB8A_HUMAN Ras-related protein Rab-8A
           (Oncogene c-mel).>pir|B49647|B49647 GTP-binding protein
           rab8 - human>pir|B36364|B36364 GTP-binding protein rab8
           - dog>gb:CFRAB8_1438657 Canine rab8 mRNA for ras-related
           GTP-binding protein.>gb:AF498943_1905327 Homo sapiens
           small GTP binding protein RAB8 (RAB8) mRNA, complete
           cds.>gb:BC002977_1968577 Homo sapiens RAB8A, member RAS
           oncogene family, mRNA (cDNA clone MGC:2196
           IMAGE:3547214), complete cds.>gb:BT007184_1990622 Homo
           sapiens mel transforming oncogene (derived from cell
           line NK14)- RAB8 homolog mRNA, complete
           cds.>gb:CR536583_1993876 Homo sapiens full open reading
           frame cDNA clone RZPDo834C0322D for gene RAB8A, RAB8A,
           member RAS oncogene family; complete cds, incl.
           stopcodon.>gb:CR542274_1994499 Homo sapiens full open
           reading frame cDNA clone RZPDo834F0726D for gene RAB8A,
           RAB8A, member RAS oncogene family; complete cds, without
           stopcodon.>gb:HSMRAB8_2018882 H.sapiens mRNA for rab8
           gene.
          Length = 207

 Score =  159 bits (401), Expect = 1e-37
 Identities = 72/155 (46%), Positives = 106/155 (68%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGK+ +L RF+ D F+    +TIG++F+ + +E+DGK +K Q+WDTAG
Sbjct: 7   YLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +T+AYYRGA+G ++VYDIT + +F+NI+ W+  +  H    V +M++GNKCD+ 
Sbjct: 67  QERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVN 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
             R VS            + F+ETSA  + NV  A
Sbjct: 127 DKRQVSKERGEKLALDYGIKFMETSAKANINVENA 161



>sp|P05711|RB1A_RAT Ras-related protein Rab-1A.>pir|A39963|TVRTYP
           GTP-binding protein Rab1 - rat>gb:RATRASA_2133651 Rat
           ras-related protein mRNA, clone NTRAB1R.
          Length = 205

 Score =  159 bits (401), Expect = 1e-37
 Identities = 74/152 (48%), Positives = 107/152 (70%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           YLFK+++IGDS VGKS LL RFA D +  +  +TIGV+F+ + +E+DGK +K Q+WDTAG
Sbjct: 10  YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAG 69

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERFR +TS+YYRGA G ++VYD+T + +F N+K+WL+E++ +    V ++LVGNKCDL 
Sbjct: 70  QERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLT 129

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNV 423
           + + V             + F+ETSA +  NV
Sbjct: 130 TKKVVDYTTAKEFADSLGIPFLETSAKNEKNV 161



>gb:BT019699_2151495 Synthetic construct Homo sapiens RAB13, member
           RAS oncogene family mRNA, partial cds.
          Length = 204

 Score =  158 bits (400), Expect = 1e-37
 Identities = 73/155 (47%), Positives = 110/155 (70%)
 Frame = -2

Query: 878 YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG 699
           +LFK+++IGDS VGK+ L+ RFA D F++   +TIG++F+ + V+++GK++K QVWDTAG
Sbjct: 7   HLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAG 66

Query: 698 QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE 519
           QERF+ +T+AYYRGA+G ++VYDIT + +FENI+ W++ +  +    V R+L+GNKCD+E
Sbjct: 67  QERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDME 126

Query: 518 SIRDVSVXXXXXXXXXXXLFFIETSALDSTNVNTA 414
           + R V             + F ETSA  S NV+ A
Sbjct: 127 AKRKVQKEQADKLAREHGIRFFETSAKSSMNVDEA 161


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 848,752,393
Number of Sequences: 1806583
Number of extensions: 15061291
Number of successful extensions: 59130
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 55033
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 57395
length of database: 581,917,975
effective HSP length: 125
effective length of database: 356,095,100
effective search space used: 76560446500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)