BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10295
         (739 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB196698_1529694 Daucus carota DcNLP gene for nucellin-like p...   255   5e-69   
gb:AY086376_1571425 Arabidopsis thaliana clone 24738 mRNA, compl...   248   2e-67   
gb:AK118764_1816726 Arabidopsis thaliana At4g33490 mRNA for puta...   248   2e-67   
pir|T06000|T06000 aspartic proteinase homolog F17M5.250 - Arabid...   237   4e-64   Arabidopsis thaliana [mouse-ear cress]
pir|B96804|B96804 nucellin-like protein, 27671-25467 [imported] ...   207   1e-52   Arabidopsis thaliana [mouse-ear cress]
gb:AY062662_1565318 Arabidopsis thaliana nucellin-like protein (...   206   2e-52   
pir|F96505|F96505 probable nucellin [imported] - Arabidopsis tha...   190   2e-47   Arabidopsis thaliana [mouse-ear cress]
gb:AY115563_1578815 Zea mays nucellin-like aspartic protease mRN...   170   2e-42   
gb:AF308691_1784822 Oryza sativa nucellin-like protein (OSAP1) g...   139   4e-32   
gb:AY043216_1560978 Oryza sativa aspartyl proteinase (Asp1) gene...   139   7e-32   
gb:AY043217_1560979 Oryza sativa aspartyl proteinase (Asp1) mRNA...   136   5e-31   
gb:AE005173_892848 Arabidopsis thaliana chromosome 1, bottom arm...   127   3e-28   
gb:AP003575_1831154 Oryza sativa (japonica cultivar-group) genom...   118   1e-25   
pir|T06213|T06213 probable aspartic proteinase (EC 3.4.23.-) - b...   116   4e-25   Hordeum vulgare [barley]
pir|T04372|T04372 protein EEA1 - barley>gb:AF017430_1761550 Hord...   115   1e-24   Hordeum vulgare [barley]
gb:AP004888_1846669 Oryza sativa (japonica cultivar-group) genom...   108   1e-22   
gb:AB008267_1510437 Arabidopsis thaliana genomic DNA, chromosome...    65   2e-09   
gb:AP003846_1834158 Oryza sativa (japonica cultivar-group) genom...    63   5e-09   
pir|T45858|T45858 hypothetical protein F3A4.130 - Arabidopsis th...    62   1e-08   Arabidopsis thaliana [mouse-ear cress]
pir|T45764|T45764 hypothetical protein F24M12.370 - Arabidopsis ...    54   3e-06   Arabidopsis thaliana [mouse-ear cress]
gb:BT002746_1636349 Arabidopsis thaliana clone C105368 unknown p...    52   1e-05   
gb:AY045683_1561274 Arabidopsis thaliana AT3g51330/F24M12_370 mR...    52   1e-05   
gb:AP003335_1828167 Oryza sativa (japonica cultivar-group) genom...    50   4e-05   
gb:AY092970_1574924 Arabidopsis thaliana unknown protein (At1g08...    49   9e-05   
gb:OSJN00021_1693426 Oryza sativa genomic DNA, chromosome 4, BAC...    48   2e-04   
gb:AY775033_1180008 Nicotiana tabacum Avr9/Cf-9 rapidly elicited...    48   2e-04   
gb:AP004891_1846727 Oryza sativa (japonica cultivar-group) genom...    47   3e-04   
pir|C84783|C84783 probable proteinase [imported] - Arabidopsis t...    47   4e-04   Arabidopsis thaliana [mouse-ear cress]
pir|T45765|T45765 hypothetical protein F24M12.380 - Arabidopsis ...    47   4e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AP005065_1847445 Oryza sativa (japonica cultivar-group) genom...    47   5e-04   
gb:AB005243_1509532 Arabidopsis thaliana genomic DNA, chromosome...    47   5e-04   
gb:AY099617_1576642 Arabidopsis thaliana putative aspartyl prote...    45   0.001   
gb:ATAC018363_1543693 Arabidopsis thaliana chromosome III BAC F1...    45   0.001   
gb:OSJN00021_1693429 Oryza sativa genomic DNA, chromosome 4, BAC...    45   0.002   
gb:AC006580_1534488 Arabidopsis thaliana chromosome 2 clone F23E...    44   0.003   
pir|E84860|E84860 hypothetical protein At2g42980 [imported] - Ar...    44   0.003   Arabidopsis thaliana [mouse-ear cress]
gb:AP003344_1828372 Oryza sativa (japonica cultivar-group) genom...    44   0.004   
gb:AE005172_889828 Arabidopsis thaliana chromosome 1, top arm co...    43   0.007   
pir|T47790|T47790 hypothetical protein F17J16.130 - Arabidopsis ...    42   0.009   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00123_1695270 Oryza sativa genomic DNA, chromosome 4, BAC...    42   0.012   
gb:AB114914_1527502 Nepenthes gracilis nep1 mRNA for aspartic pr...    42   0.015   
gb:AB026661_1517394 Arabidopsis thaliana genomic DNA, chromosome...    42   0.015   
pir|T08860|T08860 hypothetical protein A_TM017A05.8 - Arabidopsi...    41   0.020   Arabidopsis thaliana [mouse-ear cress]
gb:CR382131_1664847 Yarrowia lipolytica chromosome E of strain C...    41   0.026   
pir|B84556|B84556 hypothetical protein At2g17760 [imported] - Ar...    41   0.026   Arabidopsis thaliana [mouse-ear cress]
gb:AY069886_1566629 Arabidopsis thaliana putative chloroplast nu...    40   0.034   
gb:AP004585_1841901 Oryza sativa (japonica cultivar-group) genom...    39   0.075   
gb:OSJN00287_1697982 Oryza sativa genomic DNA, chromosome 4, BAC...    38   0.17    
gb:AP004040_1836748 Oryza sativa (japonica cultivar-group) genom...    37   0.29    
gb:AP004040_1836747 Oryza sativa (japonica cultivar-group) genom...    37   0.29    
gb:AP002913_1823914 Oryza sativa (japonica cultivar-group) genom...    37   0.37    
gb:OSJN00013_1693275 Oryza sativa genomic DNA, chromosome 4, BAC...    37   0.37    
gb:CR382130_1662757 Yarrowia lipolytica chromosome D of strain C...    37   0.37    
gb:AE016959_1023644 Oryza sativa (japonica cultivar-group) chrom...    37   0.37    
gb:AP005393_1850992 Oryza sativa (japonica cultivar-group) genom...    37   0.49    
gb:AP003769_1833298 Oryza sativa (japonica cultivar-group) genom...    37   0.49    
gb:AC091774_1735050 Oryza sativa chromosome 6 BAC OJ1540_H01 gen...    37   0.49    
gb:AE016959_1023646 Oryza sativa (japonica cultivar-group) chrom...    37   0.49    
gb:AE016959_1023643 Oryza sativa (japonica cultivar-group) chrom...    37   0.49    
gb:AB025630_1516552 Arabidopsis thaliana genomic DNA, chromosome...    36   0.64    
gb:AK046550_1167829 Mus musculus 4 days neonate male adipose cDN...    36   0.64    
gb:AP003504_1830005 Oryza sativa (japonica cultivar-group) genom...    36   0.83    
gb:AP003292_1827426 Oryza sativa (japonica cultivar-group) genom...    36   0.83    
gb:AC136216_1742995 Oryza sativa (japonica cultivar-group) chrom...    36   0.83    
gb:AC105260_1737887 Oryza sativa (japonica cultivar-group) chrom...    36   0.83    
gb:AY584109_1339155 Plasmodium vivax isolate KOR 21 aspartic pro...    36   0.83    
gb:AY584090_1339136 Plasmodium vivax isolate KOR 1 aspartic prot...    36   0.83    
gb:AP004585_1841902 Oryza sativa (japonica cultivar-group) genom...    35   1.1     
gb:OSJN00092_1694767 Oryza sativa genomic DNA, chromosome 4, BAC...    35   1.1     
gb:CQ974046_1455432 Sequence 5 from Patent WO2004113520.               35   1.1     
gb:AK031317_1162388 Mus musculus 13 days embryo male testis cDNA...    35   1.1     
gb:AP003811_1833698 Oryza sativa (japonica cultivar-group) genom...    35   1.4     
gb:AE016788_333257 Pseudomonas putida KT2440 section 15 of 21 of...    35   1.4     
pir|F96686|F96686 unknown protein F15E12.7 [imported] - Arabidop...    35   1.4     Arabidopsis thaliana [mouse-ear cress]
gb:AP005065_1847446 Oryza sativa (japonica cultivar-group) genom...    35   1.9     
gb:AY088920_1573928 Arabidopsis thaliana clone 99625 mRNA, compl...    35   1.9     
gb:AY080874_1568558 Arabidopsis thaliana putative chloroplast nu...    35   1.9     
gb:AB026658_1517372 Arabidopsis thaliana genomic DNA, chromosome...    35   1.9     
pir|E96676|E96676 hypothetical protein T23K8.15 [imported] - Ara...    35   1.9     Arabidopsis thaliana [mouse-ear cress]
gb:AP004079_1837367 Oryza sativa (japonica cultivar-group) genom...    34   2.4     
gb:AP003811_1833697 Oryza sativa (japonica cultivar-group) genom...    34   2.4     
gb:AP004774_1844838 Oryza sativa (japonica cultivar-group) genom...    34   3.2     
gb:AE005172_891293 Arabidopsis thaliana chromosome 1, top arm co...    34   3.2     
gb:AE016827_341693 Mannheimia succiniciproducens MBEL55E, comple...    34   3.2     
gb:AP006149_1860977 Oryza sativa (japonica cultivar-group) genom...    33   4.1     
gb:AB109206_1526817 Oryza sativa (japonica cultivar-group) genom...    33   4.1     
gb:AY347858_1178016 Malus x domestica clone 13-6 nucleoid DNA-bi...    33   4.1     
pir|JE0370|PECH pepsin A (EC 3.4.23.1) precursor - chicken>gb:AB...    33   4.1     
sp|P00793|PEPA_CHICK|PEPA_CHICK Pepsin A precursor (EC 3.4.23.1).                 33   4.1     Gallus gallus [bantam]
gb:OSJN00206_1696703 Oryza sativa genomic DNA, chromosome 4, BAC...    33   5.4     
gb:LAL297568_1683890 Lupinus albus partial gene for conglutin ga...    33   5.4     
gb:AP002524_1822386 Oryza sativa (japonica cultivar-group) genom...    33   7.0     
gb:AE016959_1023651 Oryza sativa (japonica cultivar-group) chrom...    33   7.0     
gb:AF057718_474288 Agrobacterium tumefaciens plasmid pTiC58 auto...    33   7.0     
gb:AE007930_231631 Agrobacterium tumefaciens str. C58 plasmid Ti...    33   7.0     
pir|AG3231|AG3231 conjugal transfer protein trbG [imported] - Ag...    33   7.0     Agrobacterium tumefaciens
gb:AP004758_1844545 Oryza sativa (japonica cultivar-group) genom...    32   9.2     
gb:AF550679_521399 Escherichia coli plasmid p1658/97, complete s...    32   9.2     


>gb:AB196698_1529694 Daucus carota DcNLP gene for nucellin-like
           protein, complete cds.
          Length = 426

 Score =  255 bits (652), Expect(2) = 5e-69
 Identities = 113/174 (64%), Positives = 142/174 (81%)
 Frame = -1

Query: 697 TPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR 518
           TP  RDY KHY+PG AEL   G+S+G+KN++VVFDSGSSY+Y N+Q Y+  L  + K+L 
Sbjct: 246 TPMSRDYLKHYTPGFAELILNGRSSGLKNLLVVFDSGSSYTYFNTQTYQTLLSFIKKDLH 305

Query: 517 GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII 338
           GKPL+EA +D TLP CW+G++PF+SI D KKYFK  ALSF +GW++++ FEI  ESYLII
Sbjct: 306 GKPLKEAVEDDTLPVCWRGKKPFKSIRDAKKYFKPLALSFGSGWKTKSQFEIQQESYLII 365

Query: 337 SSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP 176
           SSKGSVCLG+LNGTE GL NYN+IGD+SMQ+++VIYDNEK  IGW  +NCDRPP
Sbjct: 366 SSKGSVCLGILNGTEVGLQNYNIIGDISMQEKLVIYDNEKQVIGWQPSNCDRPP 419



 Score = 28.9 bits (63), Expect(2) = 5e-69
 Identities = 9/14 (64%), Positives = 13/14 (92%)
 Frame = -2

Query: 735 GDEVYDASRVTWTP 694
           GD++YD+S+V WTP
Sbjct: 234 GDDIYDSSKVIWTP 247



>gb:AY086376_1571425 Arabidopsis thaliana clone 24738 mRNA, complete
           sequence.
          Length = 425

 Score =  248 bits (633), Expect(2) = 2e-67
 Identities = 114/172 (66%), Positives = 139/172 (80%), Gaps = 1/172 (0%)
 Frame = -1

Query: 697 TPCPRDYTKHYSPGPA-ELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL 521
           TP  R+Y+KHYSP    EL FGG++TG+KN++ VFDSGSSY+Y NS+ Y+A  Y + +EL
Sbjct: 241 TPMSREYSKHYSPAMGGELLFGGRTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKREL 300

Query: 520 RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI 341
            GKPL+EA DD TLP CW+GRRPF SI +VKKYFK  ALSF  GWRS+TLFEI PE+YLI
Sbjct: 301 SGKPLKEARDDHTLPLCWQGRRPFMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLI 360

Query: 340 ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCD 185
           IS KG+VCLG+LNGTE GL N N+IGD+SMQD+M+IYDNEK +IGW   +CD
Sbjct: 361 ISMKGNVCLGILNGTEIGLQNLNLIGDISMQDQMIIYDNEKQSIGWMPVDCD 412



 Score = 30.4 bits (67), Expect(2) = 2e-67
 Identities = 11/18 (61%), Positives = 15/18 (83%)
 Frame = -2

Query: 735 GDEVYDASRVTWTPHVHE 682
           GD++YD+SRV+WTP   E
Sbjct: 229 GDDLYDSSRVSWTPMSRE 246



>gb:AK118764_1816726 Arabidopsis thaliana At4g33490 mRNA for
           putative nucellin, complete cds, clone: RAFL21-10-K10.
          Length = 413

 Score =  248 bits (633), Expect(2) = 2e-67
 Identities = 114/172 (66%), Positives = 139/172 (80%), Gaps = 1/172 (0%)
 Frame = -1

Query: 697 TPCPRDYTKHYSPGPA-ELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL 521
           TP  R+Y+KHYSP    EL FGG++TG+KN++ VFDSGSSY+Y NS+ Y+A  Y + +EL
Sbjct: 229 TPMSREYSKHYSPAMGGELLFGGRTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKREL 288

Query: 520 RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI 341
            GKPL+EA DD TLP CW+GRRPF SI +VKKYFK  ALSF  GWRS+TLFEI PE+YLI
Sbjct: 289 SGKPLKEARDDHTLPLCWQGRRPFMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLI 348

Query: 340 ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCD 185
           IS KG+VCLG+LNGTE GL N N+IGD+SMQD+M+IYDNEK +IGW   +CD
Sbjct: 349 ISMKGNVCLGILNGTEIGLQNLNLIGDISMQDQMIIYDNEKQSIGWMPVDCD 400



 Score = 30.4 bits (67), Expect(2) = 2e-67
 Identities = 11/18 (61%), Positives = 15/18 (83%)
 Frame = -2

Query: 735 GDEVYDASRVTWTPHVHE 682
           GD++YD+SRV+WTP   E
Sbjct: 217 GDDLYDSSRVSWTPMSRE 234



>pir|T06000|T06000 aspartic proteinase homolog F17M5.250 -
           Arabidopsis thaliana>gb:ATCHRIV79_1547269 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           79.>gb:ATF17M5_1549028 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F17M5 (ESSA project).
          Length = 420

 Score =  237 bits (605), Expect(2) = 4e-64
 Identities = 114/189 (60%), Positives = 139/189 (73%), Gaps = 18/189 (9%)
 Frame = -1

Query: 697 TPCPRDYTKHYSPGPA-ELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKEL 521
           TP  R+Y+KHYSP    EL FGG++TG+KN++ VFDSGSSY+Y NS+ Y+A  Y + +EL
Sbjct: 219 TPMSREYSKHYSPAMGGELLFGGRTTGLKNLLTVFDSGSSYTYFNSKAYQAVTYLLKREL 278

Query: 520 RGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI 341
            GKPL+EA DD TLP CW+GRRPF SI +VKKYFK  ALSF  GWRS+TLFEI PE+YLI
Sbjct: 279 SGKPLKEARDDHTLPLCWQGRRPFMSIEEVKKYFKPLALSFKTGWRSKTLFEIPPEAYLI 338

Query: 340 IS-----------------SKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNA 212
           IS                  KG+VCLG+LNGTE GL N N+IGD+SMQD+M+IYDNEK +
Sbjct: 339 ISVWFSHTMLKGRFIKMLQMKGNVCLGILNGTEIGLQNLNLIGDISMQDQMIIYDNEKQS 398

Query: 211 IGWTRANCD 185
           IGW   +CD
Sbjct: 399 IGWMPVDCD 407



 Score = 30.4 bits (67), Expect(2) = 4e-64
 Identities = 11/18 (61%), Positives = 15/18 (83%)
 Frame = -2

Query: 735 GDEVYDASRVTWTPHVHE 682
           GD++YD+SRV+WTP   E
Sbjct: 207 GDDLYDSSRVSWTPMSRE 224



>pir|B96804|B96804 nucellin-like protein, 27671-25467 [imported] -
           Arabidopsis thaliana>gb:AE005173_895271 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010704_1537017 Arabidopsis thaliana
           chromosome 1 BAC T5M16 genomic sequence, complete
           sequence.
          Length = 427

 Score =  207 bits (526), Expect(2) = 1e-52
 Identities = 96/173 (55%), Positives = 126/173 (72%)
 Frame = -1

Query: 676 TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA 497
           +K+Y  GPAEL F  K+TGVK + VVFDSGSSY+Y N++ Y+A L  + K+L GKPL + 
Sbjct: 253 SKNYMAGPAELLFNDKTTGVKGINVVFDSGSSYTYFNAEAYQAILDLIRKDLNGKPLTDT 312

Query: 496 GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC 317
            DD +LP CWKG++P +S+ +VKKYFK+  L F N  ++  LF++ PESYLII+ KG VC
Sbjct: 313 KDDKSLPVCWKGKKPLKSLDEVKKYFKTITLRFGN-QKNGQLFQVPPESYLIITEKGRVC 371

Query: 316 LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPNVVF 158
           LG+LNGTE GL  YN+IGD+S Q  MVIYDNEK  IGW  ++CD+ P    +F
Sbjct: 372 LGILNGTEIGLEGYNIIGDISFQGIMVIYDNEKQRIGWISSDCDKLPKSEPLF 424



 Score = 22.3 bits (46), Expect(2) = 1e-52
 Identities = 8/14 (57%), Positives = 11/14 (78%)
 Frame = -2

Query: 738 LGDEVYDASRVTWT 697
           +GDE+  +S VTWT
Sbjct: 232 IGDELVPSSGVTWT 245



>gb:AY062662_1565318 Arabidopsis thaliana nucellin-like protein
           (At1g77480; T5M16.7) mRNA, complete
           cds.>gb:BT001225_1635480 Arabidopsis thaliana
           nucellin-like protein (At1g77480) mRNA, complete cds.
          Length = 466

 Score =  206 bits (525), Expect(2) = 2e-52
 Identities = 96/170 (56%), Positives = 125/170 (73%)
 Frame = -1

Query: 676 TKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA 497
           +K+Y  GPAEL F  K+TGVK + VVFDSGSSY+Y N++ Y+A L  + K+L GKPL + 
Sbjct: 258 SKNYMAGPAELLFNDKTTGVKGINVVFDSGSSYTYFNAEAYQAILDLIRKDLNGKPLTDT 317

Query: 496 GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVC 317
            DD +LP CWKG++P +S+ +VKKYFK+  L F N  ++  LF++ PESYLII+ KG VC
Sbjct: 318 KDDKSLPVCWKGKKPLKSLDEVKKYFKTITLRFGN-QKNGQLFQVPPESYLIITEKGRVC 376

Query: 316 LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPPAPN 167
           LG+LNGTE GL  YN+IGD+S Q  MVIYDNEK  IGW  ++CD+ P  N
Sbjct: 377 LGILNGTEIGLEGYNIIGDISFQGIMVIYDNEKQRIGWISSDCDKLPNVN 426



 Score = 22.3 bits (46), Expect(2) = 2e-52
 Identities = 8/14 (57%), Positives = 11/14 (78%)
 Frame = -2

Query: 738 LGDEVYDASRVTWT 697
           +GDE+  +S VTWT
Sbjct: 237 IGDELVPSSGVTWT 250



>pir|F96505|F96505 probable nucellin [imported] - Arabidopsis
           thaliana>gb:AE005173_892615 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC074228_1541253 Arabidopsis thaliana
           chromosome 1 BAC T7O23 genomic sequence, complete
           sequence.
          Length = 405

 Score =  190 bits (483), Expect = 2e-47
 Identities = 83/165 (50%), Positives = 122/165 (73%)
 Frame = -1

Query: 670 HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD 491
           HY+ GPA+L F GK TG+K + ++FD+GSSY+Y NS+ Y+  +  +  +L+  PL+ A +
Sbjct: 240 HYTTGPADLLFNGKPTGLKGLKLIFDTGSSYTYFNSKAYQTIINLIGNDLKVSPLKVAKE 299

Query: 490 DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG 311
           D TLP CWKG +PF+S+ +VK +FK+  ++F NG R+  L+ ++PE YLI+S  G+VCLG
Sbjct: 300 DKTLPICWKGAKPFKSVLEVKNFFKTITINFTNGRRNTQLY-LAPELYLIVSKTGNVCLG 358

Query: 310 VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRPP 176
           +LNG+E GL N NVIGD+SMQ  M+IYDNEK  +GW  ++C++ P
Sbjct: 359 LLNGSEVGLQNSNVIGDISMQGLMMIYDNEKQQLGWVSSDCNKLP 403



>gb:AY115563_1578815 Zea mays nucellin-like aspartic protease mRNA,
           partial cds.
          Length = 357

 Score =  170 bits (431), Expect(2) = 2e-42
 Identities = 87/163 (53%), Positives = 115/163 (70%)
 Frame = -1

Query: 670 HYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD 491
           +YSPG   L F  +S GVK M VVFDSGS+Y+Y  +QPY+A + S +K    K L++  D
Sbjct: 190 YYSPGSGTLYFDRRSLGVKPMEVVFDSGSTYTYFTAQPYQAVV-SALKGGLSKSLKQVSD 248

Query: 490 DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLG 311
            PTLP CWKG++ F+S+ DVK  FKS  LSFA+        EI PE+YLI++  G+VCLG
Sbjct: 249 -PTLPLCWKGQKAFKSVFDVKNEFKSMFLSFASA--KNAAMEIPPENYLIVTKNGNVCLG 305

Query: 310 VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR 182
           +L+GT A L ++NVIGD++MQD+MVIYDNEK+ +GW R  C R
Sbjct: 306 ILDGTAAKL-SFNVIGDITMQDQMVIYDNEKSQLGWARGACTR 347



 Score = 25.0 bits (53), Expect(2) = 2e-42
 Identities = 9/14 (64%), Positives = 11/14 (78%)
 Frame = -2

Query: 735 GDEVYDASRVTWTP 694
           GD+V  +SRVTW P
Sbjct: 168 GDDVVPSSRVTWVP 181



>gb:AF308691_1784822 Oryza sativa nucellin-like protein (OSAP1)
           gene, complete cds.>gb:AF308692_1784823 Oryza sativa
           nucellin-like protein (OSAP1) mRNA, complete cds.
          Length = 410

 Score =  139 bits (351), Expect = 4e-32
 Identities = 81/181 (44%), Positives = 112/181 (61%), Gaps = 7/181 (3%)
 Frame = -1

Query: 697 TPCPRDYTKHYSPGPAELTFGGKSTGVKN--MIVVFDSGSSYSYMNSQPYEAFLYSVVKE 524
           TP  R++ K+YSPG   L F   S  +    M V+FDSG++Y+Y  +QPY+A L  V   
Sbjct: 222 TPMNREH-KYYSPGHGTLHFDSNSKAISAAPMAVIFDSGATYTYFAAQPYQATLSVVKST 280

Query: 523 LRG--KPLREAGD-DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPE 353
           L    K L E  + D  L  CWKG+    +I +VKK F+S +L FA+G +  TL EI PE
Sbjct: 281 LNSECKFLTEVTEKDRALTVCWKGKDKIVTIDEVKKCFRSLSLEFADGDKKATL-EIPPE 339

Query: 352 SYLIISSKGSVCLGVLNGTEA--GLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRP 179
            YLIIS +G VCLG+L+G++    L   N+IG ++M D+MVIYD+E++ +GW    CDR 
Sbjct: 340 HYLIISQEGHVCLGILDGSKEHLSLAGTNLIGGITMLDQMVIYDSERSLLGWVNYQCDRI 399

Query: 178 P 176
           P
Sbjct: 400 P 400



>gb:AY043216_1560978 Oryza sativa aspartyl proteinase (Asp1) gene,
           complete cds.
          Length = 410

 Score =  139 bits (349), Expect = 7e-32
 Identities = 81/182 (44%), Positives = 111/182 (60%), Gaps = 8/182 (4%)
 Frame = -1

Query: 697 TPCPRDYTKHYSPGPAELTFGGKSTGVKN--MIVVFDSGSSYSYMNSQPYEAFLYSVVKE 524
           +P  R++ KHYSP    L F   S  +    M V+FDSG++Y+Y   QPY A L SVVK 
Sbjct: 222 SPMNREH-KHYSPRQGTLHFNSNSKPISAAPMEVIFDSGATYTYFALQPYHATL-SVVKS 279

Query: 523 LRGKPLREAGD----DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISP 356
              K  +   +    D  L  CWKG+   R+I +VKK F+S +L FA+G +  TL EI P
Sbjct: 280 TLSKECKFLTEVKEKDRALTVCWKGKDKIRTIDEVKKCFRSLSLKFADGDKKATL-EIPP 338

Query: 355 ESYLIISSKGSVCLGVLNGTEA--GLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR 182
           E YLIIS +G VCLG+L+G++    L   N+IG ++M D+MVIYD+E++ +GW    CDR
Sbjct: 339 EHYLIISQEGHVCLGILDGSKEHPSLAGTNLIGGITMLDQMVIYDSERSLLGWVNYQCDR 398

Query: 181 PP 176
            P
Sbjct: 399 IP 400



>gb:AY043217_1560979 Oryza sativa aspartyl proteinase (Asp1) mRNA,
           complete cds.
          Length = 411

 Score =  136 bits (342), Expect = 5e-31
 Identities = 80/183 (43%), Positives = 109/183 (59%), Gaps = 9/183 (4%)
 Frame = -1

Query: 697 TPCPRDYTKHYSPGPAELTFGGKSTG---VKNMIVVFDSGSSYSYMNSQPYEAFLYSVVK 527
           +P  R++ KHYSP    L F            M V+FDSG++Y+Y   QPY A L SVVK
Sbjct: 222 SPMNREH-KHYSPRQGTLHFNSNKQSPISAAPMEVIFDSGATYTYFALQPYHATL-SVVK 279

Query: 526 ELRGKPLREAGD----DPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEIS 359
               K  +   +    D  L  CWKG+   R+I +VKK F+S +L FA+G +  TL EI 
Sbjct: 280 STLSKECKFLTEVKEKDRALTVCWKGKDKIRTIDEVKKCFRSLSLKFADGDKKATL-EIP 338

Query: 358 PESYLIISSKGSVCLGVLNGTEA--GLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCD 185
           PE YLIIS +G VCLG+L+G++    L   N+IG ++M D+MVIYD+E++ +GW    CD
Sbjct: 339 PEHYLIISQEGHVCLGILDGSKEHPSLAGTNLIGGITMLDQMVIYDSERSLLGWVNYQCD 398

Query: 184 RPP 176
           R P
Sbjct: 399 RIP 401



>gb:AE005173_892848 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC016041_1538078 Genomic sequence
           for Arabidopsis thaliana BAC F27J15 from chromosome I,
           complete sequence.>gb:AY039998_1560501 Arabidopsis
           thaliana unknown protein (At1g49050) mRNA, complete
           cds.>gb:AF360182_1791137 Arabidopsis thaliana unknown
           protein (At1g49050) mRNA, complete cds.
          Length = 583

 Score =  127 bits (318), Expect = 3e-28
 Identities = 69/166 (41%), Positives = 102/166 (61%), Gaps = 4/166 (2%)
 Frame = -1

Query: 664 SPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDP 485
           S G   L+  G++  V    V+FD+GSSY+Y  +Q Y   + S+ +E+ G  L     D 
Sbjct: 410 SYGQGMLSLDGENGRVGK--VLFDTGSSYTYFPNQAYSQLVTSL-QEVSGLELTRDDSDE 466

Query: 484 TLPFCWKGRR--PFRSISDVKKYFKSFALSFANGWR--SRTLFEISPESYLIISSKGSVC 317
           TLP CW+ +   PF S+SDVKK+F+   L   + W   SR L  I PE YLIIS+KG+VC
Sbjct: 467 TLPICWRAKTNFPFSSLSDVKKFFRPITLQIGSKWLIISRKLL-IQPEDYLIISNKGNVC 525

Query: 316 LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRP 179
           LG+L+G+     +  ++GD+SM+  +++YDN K  IGW +++C RP
Sbjct: 526 LGILDGSSVHDGSTIILGDISMRGHLIVYDNVKRRIGWMKSDCVRP 571



>gb:AP003575_1831154 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0528B02.>gb:AP005387_1850839 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBa0084K06.
          Length = 538

 Score =  118 bits (295), Expect = 1e-25
 Identities = 70/170 (41%), Positives = 100/170 (58%), Gaps = 7/170 (4%)
 Frame = -1

Query: 667 YSPGPAELTFGGKSTGVKNMI-----VVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLR 503
           YS    ++ +G +   V+        V+FDSGSSY+Y+    Y   + S+ K L    L+
Sbjct: 353 YSTEVQKVNYGDQQLNVRRKAGKLTQVIFDSGSSYTYLPHDDYTNLIASL-KSLSPSLLQ 411

Query: 502 EAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGW--RSRTLFEISPESYLIISSK 329
           +  D  TLPFC K   P RS+ DVK  FK  +L F        RT F I PE YLIIS K
Sbjct: 412 DESDR-TLPFCMKPNFPVRSMDDVKHLFKPLSLVFKKRLFILPRT-FVIPPEDYLIISDK 469

Query: 328 GSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRP 179
            ++CLGVL+GTE G  +  VIGDVS++ ++V+Y+N++  IGW +++C +P
Sbjct: 470 NNICLGVLDGTEIGHDSAIVIGDVSLRGKLVVYNNDEKQIGWVQSDCAKP 519



>pir|T06213|T06213 probable aspartic proteinase (EC 3.4.23.-) -
           barley>gb:AY485643_1608491 Hordeum vulgare subsp.
           vulgare BAC 615K1, complete
           sequence.>gb:HVU87148_1682847 Hordeum vulgare nucellin
           mRNA, complete cds.>gb:HVU87149_1682848 Hordeum vulgare
           nucellin gene, complete cds.
          Length = 410

 Score =  116 bits (291), Expect = 4e-25
 Identities = 66/172 (38%), Positives = 95/172 (55%), Gaps = 4/172 (2%)
 Frame = -1

Query: 685 RDYTKHYSPGPAELTFGGKST-GVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKP 509
           R+   +YSPG AE+    +   G      VFDSGS+Y+++ +Q Y   +  V   L    
Sbjct: 229 RESLFYYSPGLAEVFIDKQPIRGNPTFEAVFDSGSTYTHVPAQIYNEIVSKVRGTLSESS 288

Query: 508 LREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSK 329
           L E      LP CWKG++PF S++DVK  FK+ +L   +  R     +I P++YL +   
Sbjct: 289 LEEV-KGRALPLCWKGKKPFGSVNDVKNQFKALSLKITHA-RGTNNLDIPPQNYLFVKED 346

Query: 328 GSVCLGVLNGTEAGLH---NYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR 182
           G  CL +L+ +   +    N+ +IG V+MQD  VIYDNEK  +GW RA CDR
Sbjct: 347 GETCLAILDASLDPVLKELNFILIGAVTMQDLFVIYDNEKKQLGWVRAQCDR 398



>pir|T04372|T04372 protein EEA1 - barley>gb:AF017430_1761550 Hordeum
           vulgare EEA1 mRNA, complete cds.
          Length = 410

 Score =  115 bits (287), Expect = 1e-24
 Identities = 65/172 (37%), Positives = 94/172 (54%), Gaps = 4/172 (2%)
 Frame = -1

Query: 685 RDYTKHYSPGPAELTFGGKST-GVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKP 509
           R+   +YSPG AE+    +   G      VFDSGS+Y+++ +Q Y   +  V        
Sbjct: 229 RESLFYYSPGLAEVFIDKQPIRGNPTFEAVFDSGSTYTHVPAQIYNEIVSKVRGTFSESS 288

Query: 508 LREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSK 329
           L E      LP CWKG++PF S++DVK  FK+ +L   +  R     +I P++YL +   
Sbjct: 289 LEEV-KGRALPLCWKGKKPFGSVNDVKNQFKALSLKITHA-RGTNNLDIPPQNYLFVKED 346

Query: 328 GSVCLGVLNGTEAGLH---NYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR 182
           G  CL +L+ +   +    N+ +IG V+MQD  VIYDNEK  +GW RA CDR
Sbjct: 347 GETCLAILDASLDPVLKELNFILIGAVTMQDLFVIYDNEKKQLGWVRAQCDR 398



>gb:AP004888_1846669 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0617A09.>gb:AP005751_1857182 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0072H09.
          Length = 573

 Score =  108 bits (270), Expect = 1e-22
 Identities = 62/162 (38%), Positives = 97/162 (59%), Gaps = 2/162 (1%)
 Frame = -1

Query: 658 GPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTL 479
           G  +L+  G S    ++ V+FDSGSSY+Y+  + Y+  L + +K      ++++ D  TL
Sbjct: 407 GDQQLSMRGASGN--SVQVIFDSGSSYTYLPDEIYKN-LIAAIKYAYPNFVQDSSDR-TL 462

Query: 478 PFCWKGRRPFRSISDVKKYFKSFALSFANGW--RSRTLFEISPESYLIISSKGSVCLGVL 305
           P C     P R + DVK+ FK   L F   W    RT F I P++YLIIS KG+VCLG L
Sbjct: 463 PLCLATDFPVRYLEDVKQLFKPLNLHFGKRWFVMPRT-FTILPDNYLIISDKGNVCLGFL 521

Query: 304 NGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRP 179
           NG +    +  ++GD +++ ++V+YDN++  IGWT ++C +P
Sbjct: 522 NGKDIDHGSTVIVGDNALRGKLVVYDNQQRQIGWTNSDCTKP 563



>gb:AB008267_1510437 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MMG4.
          Length = 586

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 40/141 (28%), Positives = 74/141 (52%), Gaps = 3/141 (2%)
 Frame = -1

Query: 601 VFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLP-FCWKGRRPFRSISDVKK 425
           V DSG++Y+Y   + + A   +V+KE+     R  G DP     C+ G    R ++++  
Sbjct: 288 VLDSGTTYAYFPKEAFIAIKDAVIKEIPSLK-RIHGPDPNYDDVCFSGAG--RDVAEIHN 344

Query: 424 YFKSFALSFANGWRSRTLFEISPESYLIISSK--GSVCLGVLNGTEAGLHNYNVIGDVSM 251
           +F   A+ F NG +      +SPE+YL   +K  G+ CLG+    ++      ++G + +
Sbjct: 345 FFPEIAMEFGNGQK----LILSPENYLFRHTKVRGAYCLGIFPDRDST----TLLGGIVV 396

Query: 250 QDRMVIYDNEKNAIGWTRANC 188
           ++ +V YD E + +G+ + NC
Sbjct: 397 RNTLVTYDRENDKLGFLKTNC 417



>gb:AP003846_1834158 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1710_H11.
          Length = 631

 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 44/142 (30%), Positives = 73/142 (51%), Gaps = 4/142 (2%)
 Frame = -1

Query: 601 VFDSGSSYSYMNSQPYEAFLYSVVKELRG-KPLREAGDDPTL-PFCWKGRRPFRSISDVK 428
           V DSG++Y+Y+  Q + AF  +V  ++   K +R  G DP     C+ G    R++S + 
Sbjct: 303 VLDSGTTYAYLPEQAFVAFKDAVTNKVNSLKKIR--GPDPNYKDICFAGAG--RNVSQLS 358

Query: 427 KYFKSFALSFANGWRSRTLFEISPESYLIISSK--GSVCLGVLNGTEAGLHNYNVIGDVS 254
           + F    + F NG +      +SPE+YL   SK  G+ CLGV    + G     ++G + 
Sbjct: 359 EVFPDVDMVFGNGQK----LSLSPENYLFRHSKVEGAYCLGVF---QNGKDPTTLLGGIV 411

Query: 253 MQDRMVIYDNEKNAIGWTRANC 188
           +++ +V YD     IG+ + NC
Sbjct: 412 VRNTLVTYDRHNEKIGFWKTNC 433



>pir|T45858|T45858 hypothetical protein F3A4.130 - Arabidopsis
           thaliana>gb:ATF3A4_1550559 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F3A4.>gb:BT015816_1642434
           Arabidopsis thaliana At3g50050 gene, complete
           cds.>gb:BT020205_1642600 Arabidopsis thaliana At3g50050
           mRNA, complete cds.
          Length = 632

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 45/174 (25%), Positives = 85/174 (48%), Gaps = 9/174 (5%)
 Frame = -1

Query: 682 DYTKHYSPGPAELTFGGKSTGVKNMI------VVFDSGSSYSYMNSQPYEAFLYSVVKEL 521
           D + +Y+     +   GK   + + +       V DSG++Y+Y+    + AF  +V++E+
Sbjct: 272 DRSPYYNIDLTGIRVAGKQLSLHSRVFDGEHGAVLDSGTTYAYLPDAAFAAFEEAVMREV 331

Query: 520 RGKPLREA-GDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYL 344
               L++  G DP              +S++ K F S  + F +G      + +SPE+Y+
Sbjct: 332 --STLKQIDGPDPNFKDTCFQVAASNYVSELSKIFPSVEMVFKSGQS----WLLSPENYM 385

Query: 343 IISSK--GSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANC 188
              SK  G+ CLGV      G  +  ++G + +++ +V+YD E + +G+ R NC
Sbjct: 386 FRHSKVHGAYCLGVFPN---GKDHTTLLGGIVVRNTLVVYDRENSKVGFWRTNC 436



>pir|T45764|T45764 hypothetical protein F24M12.370 - Arabidopsis
           thaliana>gb:ATF24M12_1549972 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F24M12.
          Length = 519

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 45/164 (27%), Positives = 80/164 (48%), Gaps = 6/164 (3%)
 Frame = -1

Query: 661 PGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPY----EAFLYSVVKELRGKPLREAG 494
           P   E++ GG + GV+ ++ +FD+G+S++++    Y    +AF   V  + R  P+    
Sbjct: 302 PSVTEVSVGGDAVGVQ-LLALFDTGTSFTHLLEPEYGLITKAFDDHVTDKRR--PI---- 354

Query: 493 DDPTLPF--CWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSV 320
            DP LPF  C+       S +     F   A++F  G +   +F  +P   L I +    
Sbjct: 355 -DPELPFEFCYD-----LSPNKTTILFPRVAMTFEGGSQ---MFLRNP---LFIDNSAMY 402

Query: 319 CLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANC 188
           CLG+L   +  +   N+IG   M    +++D E+  +GW R++C
Sbjct: 403 CLGILKSVDFKI---NIIGQNFMSGYRIVFDRERMILGWKRSDC 443



>gb:BT002746_1636349 Arabidopsis thaliana clone C105368 unknown
           protein (At3g51330) mRNA, complete cds.
          Length = 529

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 47/181 (25%), Positives = 90/181 (49%), Gaps = 9/181 (4%)
 Frame = -1

Query: 703 LDTPC-PRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPY----EAFLY 539
           ++TP  P + +  Y+    E++ GG + GV+ ++ +FD+G+S++++    Y    +AF  
Sbjct: 293 METPLLPTEPSPTYAVSVTEVSVGGDAVGVQ-LLALFDTGTSFTHLLEPEYGLITKAFDD 351

Query: 538 SVVKELRGKPLREAGDDPTLPF--CWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFE 365
            V  + R  P+     DP LPF  C+       S +     F   A++F  G +   +F 
Sbjct: 352 HVTDKRR--PI-----DPELPFEFCYD-----LSPNKTTILFPRVAMTFEGGSQ---MFL 396

Query: 364 ISPESYLIISSKGSV--CLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRAN 191
            +P  +++ +   S   CLG+L   +  +   N+IG   M    +++D E+  +GW R++
Sbjct: 397 RNP-LFIVWNEDNSAMYCLGILKSVDFKI---NIIGQNFMSGYRIVFDRERMILGWKRSD 452

Query: 190 C 188
           C
Sbjct: 453 C 453



>gb:AY045683_1561274 Arabidopsis thaliana AT3g51330/F24M12_370 mRNA,
           complete cds.>gb:AY143838_1583295 Arabidopsis thaliana
           At3g51330/F24M12_370 mRNA, complete cds.
          Length = 260

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 47/181 (25%), Positives = 90/181 (49%), Gaps = 9/181 (4%)
 Frame = -1

Query: 703 LDTPC-PRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPY----EAFLY 539
           ++TP  P + +  Y+    E++ GG + GV+ ++ +FD+G+S++++    Y    +AF  
Sbjct: 24  METPLLPTEPSPTYAVSVTEVSVGGDAVGVQ-LLALFDTGTSFTHLLEPEYGLITKAFDD 82

Query: 538 SVVKELRGKPLREAGDDPTLPF--CWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFE 365
            V  + R  P+     DP LPF  C+       S +     F   A++F  G +   +F 
Sbjct: 83  HVTDKRR--PI-----DPELPFEFCYD-----LSPNKTTILFPRVAMTFEGGSQ---MFL 127

Query: 364 ISPESYLIISSKGSV--CLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRAN 191
            +P  +++ +   S   CLG+L   +  +   N+IG   M    +++D E+  +GW R++
Sbjct: 128 RNP-LFIVWNEDNSAMYCLGILKSVDFKI---NIIGQNFMSGYRIVFDRERMILGWKRSD 183

Query: 190 C 188
           C
Sbjct: 184 C 184



>gb:AP003335_1828167 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1144G04.
          Length = 316

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 40/138 (28%), Positives = 65/138 (47%)
 Frame = -1

Query: 601 VFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSISDVKKY 422
           + DSG+S + +    Y A + ++ K L G P      DP   +C+    P  S SDV   
Sbjct: 189 ILDSGTSLTMLAKPAYRAVVAALSKRLAGLP--RVTMDP-FDYCYNWTSP--SGSDVAAP 243

Query: 421 FKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDR 242
               A+ FA   R     E   +SY+I ++ G  C+G+  G   GL   +VIG++  Q+ 
Sbjct: 244 LPMLAVHFAGSAR----LEPPAKSYVIDAAPGVKCIGLQEGPWPGL---SVIGNILQQEH 296

Query: 241 MVIYDNEKNAIGWTRANC 188
           +  YD +   + + R+ C
Sbjct: 297 LWEYDLKNRRLRFKRSRC 314



>gb:AY092970_1574924 Arabidopsis thaliana unknown protein
           (At1g08210) mRNA, complete cds.>gb:AY128724_1580804
           Arabidopsis thaliana unknown protein (At1g08210) mRNA,
           complete cds.>gb:AF329505_1786990 Arabidopsis thaliana
           unknown protein (At1g08210) mRNA, complete cds.
          Length = 492

 Score = 48.9 bits (115), Expect = 9e-05
 Identities = 30/140 (21%), Positives = 61/140 (43%), Gaps = 2/140 (1%)
 Frame = -1

Query: 601 VFDSGSSYSYMNSQPYEAFLYSVVKELR--GKPLREAGDDPTLPFCWKGRRPFRSISDVK 428
           + D+G++ +Y+  + Y  F+ +V   +   G+P+            ++  + F   +   
Sbjct: 316 IIDTGTTLAYLPDEAYSPFIQAVANAVSQYGRPIT-----------YESYQCFEITAGDV 364

Query: 427 KYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQ 248
             F   +LSFA G        + P +YL I S     +  +           ++GD+ ++
Sbjct: 365 DVFPQVSLSFAGG----ASMVLGPRAYLQIFSSSGSSIWCIGFQRMSHRRITILGDLVLK 420

Query: 247 DRMVIYDNEKNAIGWTRANC 188
           D++V+YD  +  IGW   +C
Sbjct: 421 DKVVVYDLVRQRIGWAEYDC 440



>gb:OSJN00021_1693426 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0008A08, complete
           sequence.>gb:OSJN00287_1697978 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0011K22, complete
           sequence.>gb:OSJN00300_1698235 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: B1159F04, complete sequence.
          Length = 431

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 3/90 (3%)
 Frame = -1

Query: 451 FRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN 272
           F  +  V   F      F N        ++ P  YL+       C G     +AG+H Y 
Sbjct: 327 FHFLGSVDDKFPKITFHFEND----LTLDVYPYDYLLEYEGNQYCFGF---QDAGIHGYK 379

Query: 271 ---VIGDVSMQDRMVIYDNEKNAIGWTRAN 191
              ++GD+ + +++V+YD EK AIGWT  N
Sbjct: 380 DMIILGDMVISNKVVVYDMEKQAIGWTEHN 409



>gb:AY775033_1180008 Nicotiana tabacum Avr9/Cf-9 rapidly elicited
           protein 36 (ACRE36) mRNA, partial cds.
          Length = 191

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 39/156 (25%), Positives = 75/156 (48%), Gaps = 2/156 (1%)
 Frame = -1

Query: 649 ELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFC 470
           E T+   + GV   I+  DSG++ SY     YE    + V +++  P+ +  D P L  C
Sbjct: 51  EETWNLSTEGVGGTII--DSGTTLSYFAEPAYEIIKQAFVNKVKRYPILD--DFPILKPC 106

Query: 469 WKGRRPFRSISDVKKY-FKSFALSFANGWRSRTLFEISPESYLI-ISSKGSVCLGVLNGT 296
           +       ++S V+K    SF + F +G     ++    E+Y I +  +  VCL +L   
Sbjct: 107 Y-------NVSGVEKLELPSFGIVFGDG----AIWTFPVENYFIKLEPEDIVCLAILGTP 155

Query: 295 EAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANC 188
            + +   ++IG+   Q+  ++YD +++ +G+    C
Sbjct: 156 HSAM---SIIGNYQQQNFHILYDTKRSRLGFAPRRC 188



>gb:AP004891_1846727 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0705A04.
          Length = 514

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 37/141 (26%), Positives = 68/141 (48%), Gaps = 3/141 (2%)
 Frame = -1

Query: 601 VFDSGSSYSYMNSQPYEAFLYSVVKEL-RGKPLREAGDDPTLPFCWKGRRPFRSISDVKK 425
           + DSG++ SY     YE    + V+ + +  PL    D P L  C+       ++S V++
Sbjct: 387 IIDSGTTLSYFAEPAYEVIRRAFVERMDKAYPL--VADFPVLSPCY-------NVSGVER 437

Query: 424 Y-FKSFALSFANGWRSRTLFEISPESYLI-ISSKGSVCLGVLNGTEAGLHNYNVIGDVSM 251
                F+L FA+G     +++   E+Y + +   G +CL VL    + +   ++IG+   
Sbjct: 438 VEVPEFSLLFADG----AVWDFPAENYFVRLDPDGIMCLAVLGTPRSAM---SIIGNFQQ 490

Query: 250 QDRMVIYDNEKNAIGWTRANC 188
           Q+  V+YD + N +G+    C
Sbjct: 491 QNFHVLYDLQNNRLGFAPRRC 511



>pir|C84783|C84783 probable proteinase [imported] - Arabidopsis
           thaliana>gb:AC006282_1533953 Arabidopsis thaliana
           chromosome 2 clone F13K3 map g6825, complete sequence.
          Length = 469

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 30/142 (21%), Positives = 60/142 (42%), Gaps = 4/142 (2%)
 Frame = -1

Query: 601 VFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSISDVKKY 422
           + D+G++ +Y+  + Y+ FL ++   +              P    G + +   + +   
Sbjct: 333 IVDTGTTLTYLVKEAYDLFLNAISNSV---------SQLVTPIISNGEQCYLVSTSISDM 383

Query: 421 FKSFALSFANGWRSRTLFEISPESYL----IISSKGSVCLGVLNGTEAGLHNYNVIGDVS 254
           F S +L+FA G        + P+ YL    I       C+G     E       ++GD+ 
Sbjct: 384 FPSVSLNFAGG----ASMMLRPQDYLFHYGIYDGASMWCIGFQKAPE----EQTILGDLV 435

Query: 253 MQDRMVIYDNEKNAIGWTRANC 188
           ++D++ +YD  +  IGW   +C
Sbjct: 436 LKDKVFVYDLARQRIGWASYDC 457



>pir|T45765|T45765 hypothetical protein F24M12.380 - Arabidopsis
           thaliana>gb:ATF24M12_1549973 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F24M12.
          Length = 518

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 43/184 (23%), Positives = 75/184 (40%), Gaps = 16/184 (8%)
 Frame = -1

Query: 667 YSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFL--YSVVKELRGKPLREAG 494
           Y      ++ GG    V  +  +FD+GSS++ +    Y  F   +  + E + +P+    
Sbjct: 294 YGVNVTGVSVGGVPVDVP-LFALFDTGSSFTLLLESAYGVFTKAFDDLMEDKRRPV---- 348

Query: 493 DDPTLPF--CWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGS- 323
            DP  PF  C+  R    +     ++ +S      N  R    + I  +S   +S     
Sbjct: 349 -DPDFPFEFCYDLREEHLNSDARPRHMQSKCY---NPCRDDFRWRIQNDSQESVSYSNEG 404

Query: 322 ---VCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANC--------DRPP 176
               CLG+L        N N+IG   M    +++D E+  +GW ++NC        + PP
Sbjct: 405 TKMYCLGILKSI-----NLNIIGQNLMSGHRIVFDRERMILGWKQSNCFEDESLASESPP 459

Query: 175 APNV 164
            P +
Sbjct: 460 PPEI 463



>gb:AP005065_1847445 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0046H03.>gb:AP005067_1847487 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0487H05.
          Length = 494

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 3/62 (4%)
 Frame = -1

Query: 364 ISPESYLIISSKGSVCLGVLNG---TEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRA 194
           +SP  YL  + K   C+G  NG   T+ G  +  ++GD+ + +++V+YD E  AIGW   
Sbjct: 387 VSPHDYLFQNGKNLYCMGFQNGGVQTKDG-KDMVLLGDLVLSNKLVLYDLENQAIGWADY 445

Query: 193 NC 188
           NC
Sbjct: 446 NC 447



>gb:AB005243_1509532 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MRN17.
          Length = 539

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 35/173 (20%), Positives = 74/173 (42%), Gaps = 12/173 (6%)
 Frame = -1

Query: 670 HYSPGPAELTFGGKSTGVKNMI--------VVFDSGSSYSYMNSQPYEAFLYSVVKELRG 515
           HY+     ++  G++  +   +         + D+G++ +Y++   Y  F+ ++      
Sbjct: 284 HYNVNLLSISVNGQALPINPSVFSTSNGQGTIIDTGTTLAYLSEAAYVPFVEAITN---- 339

Query: 514 KPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLI-- 341
                A      P   KG + +   + V   F   +L+FA G    ++F ++P+ YLI  
Sbjct: 340 -----AVSQSVRPVVSKGNQCYVITTSVGDIFPPVSLNFAGG---ASMF-LNPQDYLIQQ 390

Query: 340 --ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANC 188
             +      C+G       G+    ++GD+ ++D++ +YD     IGW   +C
Sbjct: 391 NNVGGTAVWCIGFQRIQNQGI---TILGDLVLKDKIFVYDLVGQRIGWANYDC 440



>gb:AY099617_1576642 Arabidopsis thaliana putative aspartyl protease
           (At3g02740) mRNA, complete cds.>gb:BT000270_1634548
           Arabidopsis thaliana putative aspartyl protease
           (At3g02740) mRNA, complete cds.
          Length = 320

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)
 Frame = -1

Query: 364 ISPESYLIISSKGSVCLGVLNG---TEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRA 194
           + P  YL    + + C G  NG   T+ G  +  ++GD+++ +++V+YD E   IGWT  
Sbjct: 211 VYPREYLFQVREDTWCFGWQNGGLQTKGGA-SLTILGDMALSNKLVVYDIENQVIGWTNH 269

Query: 193 NC 188
           NC
Sbjct: 270 NC 271



>gb:ATAC018363_1543693 Arabidopsis thaliana chromosome III BAC F13E7
           genomic sequence, complete sequence.>gb:AY088014_1573038
           Arabidopsis thaliana clone 40409 mRNA, complete
           sequence.
          Length = 488

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)
 Frame = -1

Query: 364 ISPESYLIISSKGSVCLGVLNG---TEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRA 194
           + P  YL    + + C G  NG   T+ G  +  ++GD+++ +++V+YD E   IGWT  
Sbjct: 379 VYPREYLFQVREDTWCFGWQNGGLQTKGGA-SLTILGDMALSNKLVVYDIENQVIGWTNH 437

Query: 193 NC 188
           NC
Sbjct: 438 NC 439



>gb:OSJN00021_1693429 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0008A08, complete sequence.
          Length = 494

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 42/175 (24%), Positives = 70/175 (40%), Gaps = 14/175 (8%)
 Frame = -1

Query: 670 HYSPGPAELTFGGKS---------TGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR 518
           HY+     +  GG +         TG K   ++ DSG++ +Y+    Y+  + +V    +
Sbjct: 290 HYNVNLKSIDVGGTALKLPSHMFDTGEKKGTII-DSGTTLTYLPEIVYKEIMLAVFA--K 346

Query: 517 GKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLII 338
            K +        L F + GR        V   F      F N         + P  Y   
Sbjct: 347 HKDITFHNVQEFLCFQYVGR--------VDDDFPKITFHFENDLP----LNVYPHDYFFE 394

Query: 337 SSKGSVCLGVLNGTEAGLHNYN-----VIGDVSMQDRMVIYDNEKNAIGWTRANC 188
           +     C+G  NG   GL + +     ++GD+ + +++V+YD E   IGWT  NC
Sbjct: 395 NGDNLYCVGFQNG---GLQSKDGKGMVLLGDLVLSNKLVVYDLENQVIGWTEYNC 446



>gb:AC006580_1534488 Arabidopsis thaliana chromosome 2 clone F23E6
           map m551, complete sequence.>gb:AC006931_1534811
           Arabidopsis thaliana chromosome 2 clone F7D19 map m551,
           complete sequence.
          Length = 527

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 32/142 (22%), Positives = 65/142 (45%), Gaps = 4/142 (2%)
 Frame = -1

Query: 601 VFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA----GDDPTLPFCWKGRRPFRSISD 434
           + DSG++ SY     YE     ++K    + ++E      D P L  C+        I +
Sbjct: 399 IIDSGTTLSYFAEPAYE-----IIKNKFAEKMKENYPIFRDFPVLDPCFN----VSGIEE 449

Query: 433 VKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVIGDVS 254
              +     ++F +G    T++    E+  I  S+  VCL +L   ++    +++IG+  
Sbjct: 450 NNIHLPELGIAFVDG----TVWNFPAENSFIWLSEDLVCLAILGTPKS---TFSIIGNYQ 502

Query: 253 MQDRMVIYDNEKNAIGWTRANC 188
            Q+  ++YD +++ +G+T   C
Sbjct: 503 QQNFHILYDTKRSRLGFTPTKC 524



>pir|E84860|E84860 hypothetical protein At2g42980 [imported] -
           Arabidopsis thaliana
          Length = 481

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 32/142 (22%), Positives = 65/142 (45%), Gaps = 4/142 (2%)
 Frame = -1

Query: 601 VFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREA----GDDPTLPFCWKGRRPFRSISD 434
           + DSG++ SY     YE     ++K    + ++E      D P L  C+        I +
Sbjct: 353 IIDSGTTLSYFAEPAYE-----IIKNKFAEKMKENYPIFRDFPVLDPCFN----VSGIEE 403

Query: 433 VKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVIGDVS 254
              +     ++F +G    T++    E+  I  S+  VCL +L   ++    +++IG+  
Sbjct: 404 NNIHLPELGIAFVDG----TVWNFPAENSFIWLSEDLVCLAILGTPKS---TFSIIGNYQ 456

Query: 253 MQDRMVIYDNEKNAIGWTRANC 188
            Q+  ++YD +++ +G+T   C
Sbjct: 457 QQNFHILYDTKRSRLGFTPTKC 478



>gb:AP003344_1828372 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0413G02.
          Length = 504

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 33/143 (23%), Positives = 64/143 (44%), Gaps = 5/143 (3%)
 Frame = -1

Query: 601 VFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTL-PFCWKGRRPFRSISDVKK 425
           + DSG++ +Y+    Y+ F+ ++           A   P++     KG + F + S V  
Sbjct: 326 IVDSGTTLAYLADGAYDPFVNAIT----------AAVSPSVRSLVSKGNQCFVTSSSVDS 375

Query: 424 YFKSFALSFANGWRSRTLFEISPESYLI----ISSKGSVCLGVLNGTEAGLHNYNVIGDV 257
            F + +L F  G        + PE+YL+    I +    C+G        +    ++GD+
Sbjct: 376 SFPTVSLYFMGG----VAMTVKPENYLLQQASIDNNVLWCIGWQRNQGQQI---TILGDL 428

Query: 256 SMQDRMVIYDNEKNAIGWTRANC 188
            ++D++ +YD     +GWT  +C
Sbjct: 429 VLKDKIFVYDLANMRMGWTDYDC 451



>gb:AE005172_889828 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC011438_1537215 Genomic sequence
           for Arabidopsis thaliana BAC T23G18 from chromosome I,
           complete sequence.
          Length = 566

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 23/98 (23%), Positives = 43/98 (43%)
 Frame = -1

Query: 478 PFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNG 299
           P  ++  + F   +     F   +LSFA G        + P +YL I S     +  +  
Sbjct: 442 PITYESYQCFEITAGDVDVFPQVSLSFAGG----ASMVLGPRAYLQIFSSSGSSIWCIGF 497

Query: 298 TEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCD 185
                    ++GD+ ++D++V+YD  +  IGW   +C+
Sbjct: 498 QRMSHRRITILGDLVLKDKVVVYDLVRQRIGWAEYDCE 535



>pir|T47790|T47790 hypothetical protein F17J16.130 - Arabidopsis
           thaliana>gb:ATF17J16_1548969 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F17J16.>gb:AY099818_1576843
           Arabidopsis thaliana putative protein (At3g59080) mRNA,
           complete cds.>gb:BT000326_1634604 Arabidopsis thaliana
           putative protein (At3g59080) mRNA, complete
           cds.>gb:AF424562_1798901 Arabidopsis thaliana
           AT3g59080/F17J16_130 mRNA, complete cds.
          Length = 535

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 37/155 (23%), Positives = 72/155 (46%), Gaps = 1/155 (0%)
 Frame = -1

Query: 649 ELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGK-PLREAGDDPTLPF 473
           E T+   S G    I+  DSG++ SY     YE     + ++ +GK P+    D P L  
Sbjct: 395 EETWNISSDGAGGTII--DSGTTLSYFAEPAYEFIKNKIAEKAKGKYPVYR--DFPILDP 450

Query: 472 CWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTE 293
           C+        I +V+       ++FA+G     ++    E+  I  ++  VCL +L   +
Sbjct: 451 CFN----VSGIHNVQ--LPELGIAFADG----AVWNFPTENSFIWLNEDLVCLAMLGTPK 500

Query: 292 AGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANC 188
           +    +++IG+   Q+  ++YD +++ +G+    C
Sbjct: 501 SA---FSIIGNYQQQNFHILYDTKRSRLGYAPTKC 532



>gb:OSJN00123_1695270 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0071D01, complete sequence.
          Length = 530

 Score = 42.0 bits (97), Expect = 0.012
 Identities = 39/164 (23%), Positives = 71/164 (43%), Gaps = 4/164 (2%)
 Frame = -1

Query: 667 YSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDD 488
           Y+   +E+T G   T ++    +FD+G+S++Y+    Y     S   ++     R A D 
Sbjct: 312 YTISISEITVGNSLTDLE-FSTIFDTGTSFTYLADPAYTYITQSFHAQVHAN--RHAADS 368

Query: 487 PTLPF--CWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSV-- 320
             +PF  C+       S S+ +    S +L    G    ++F +  E  +I   +     
Sbjct: 369 -RIPFEYCYD-----LSSSEDRIQTPSISLRTVGG----SVFPVIDEGQVISIQQHEYVY 418

Query: 319 CLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANC 188
           CL ++   +      N+IG   M    V++D E+  +GW + NC
Sbjct: 419 CLAIVKSAKL-----NIIGQNFMTGLRVVFDRERKILGWKKFNC 457



>gb:AB114914_1527502 Nepenthes gracilis nep1 mRNA for aspartic
           proteinase nepenthesin I, complete cds.
          Length = 437

 Score = 41.6 bits (96), Expect = 0.015
 Identities = 28/140 (20%), Positives = 61/140 (43%), Gaps = 1/140 (0%)
 Frame = -1

Query: 604 VVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSISDVKK 425
           ++ DSG++ +Y  +  Y++     + ++    +   G       C      F++ SD   
Sbjct: 312 IIIDSGTTLTYFVNNAYQSVRQEFISQINLPVVN--GSSSGFDLC------FQTPSDPSN 363

Query: 424 Y-FKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQ 248
               +F + F  G       E+  E+Y I  S G +CL + + ++      ++ G++  Q
Sbjct: 364 LQIPTFVMHFDGGD-----LELPSENYFISPSNGLICLAMGSSSQG----MSIFGNIQQQ 414

Query: 247 DRMVIYDNEKNAIGWTRANC 188
           + +V+YD   + + +  A C
Sbjct: 415 NMLVVYDTGNSVVSFASAQC 434



>gb:AB026661_1517394 Arabidopsis thaliana genomic DNA, chromosome 5,
           BAC clone:T30G6.
          Length = 478

 Score = 41.6 bits (96), Expect = 0.015
 Identities = 32/140 (22%), Positives = 56/140 (40%), Gaps = 2/140 (1%)
 Frame = -1

Query: 601 VFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSISDVKKY 422
           + DSG++ +Y+    Y + +  +  + + K          L    +    F   S+  K 
Sbjct: 304 IIDSGTTLAYLPQNLYNSLIEKITAKQQVK----------LHMVQETFACFSFTSNTDKA 353

Query: 421 FKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVI--GDVSMQ 248
           F    L F +  +      + P  YL    +   C G  +G        +VI  GD+ + 
Sbjct: 354 FPVVNLHFEDSLK----LSVYPHDYLFSLREDMYCFGWQSGGMTTQDGADVILLGDLVLS 409

Query: 247 DRMVIYDNEKNAIGWTRANC 188
           +++V+YD E   IGW   NC
Sbjct: 410 NKLVVYDLENEVIGWADHNC 429



>pir|T08860|T08860 hypothetical protein A_TM017A05.8 - Arabidopsis
           thaliana
          Length = 472

 Score = 41.2 bits (95), Expect = 0.020
 Identities = 37/153 (24%), Positives = 65/153 (42%), Gaps = 4/153 (2%)
 Frame = -1

Query: 634 GKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKGRR 455
           G +TG      VFDSG+S++Y+    Y     S       K  +    +    +C+  R 
Sbjct: 265 GGNTGDLEFDAVFDSGTSFTYLTDAAYTLISESFNSLALDKRYQTTDSELPFEYCYALRL 324

Query: 454 PFRS--ISDVKKYFKSFALSFA-NGWRSRTLFEISPESYLIISSKGSV-CLGVLNGTEAG 287
           P  S      K  F+  A++    G  S  ++       ++I  K +V CL ++      
Sbjct: 325 PLYSGHHHPNKDSFQYPAVNLTMKGGSSYPVY----HPLVVIPMKVNVYCLAIMK----- 375

Query: 286 LHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANC 188
           + + ++IG   M    V++D EK  +GW  ++C
Sbjct: 376 IEDISIIGQNFMTGYRVVFDREKLILGWKESDC 408



>gb:CR382131_1664847 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 397

 Score = 40.8 bits (94), Expect = 0.026
 Identities = 37/147 (25%), Positives = 61/147 (41%)
 Frame = -1

Query: 634 GKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKGRR 455
           G  T ++   VV DSG+S +Y+    Y+A +  V  +  G  L +AG   +   C     
Sbjct: 247 GDKTILEGEDVVLDSGTSLTYLTKSNYDAVINQV--QAAGIKLTDAGQGISALPC----- 299

Query: 454 PFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNY 275
                SD+ K    +  S      S     I P +YL  S    +C+  +  +   L N 
Sbjct: 300 -----SDIGKLSMEYTFSGKTIKVSGKDMTI-PATYLDSSDTSGLCIFGITESTGQLSNL 353

Query: 274 NVIGDVSMQDRMVIYDNEKNAIGWTRA 194
           N+ GD  ++    +YD + N +   +A
Sbjct: 354 NLFGDTFLRAIYSVYDLDNNQVSIAQA 380



>pir|B84556|B84556 hypothetical protein At2g17760 [imported] -
           Arabidopsis thaliana
          Length = 473

 Score = 40.8 bits (94), Expect = 0.026
 Identities = 35/152 (23%), Positives = 62/152 (40%), Gaps = 3/152 (1%)
 Frame = -1

Query: 634 GKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKGRR 455
           G +TG      VFDSG+S++Y+    Y     S       K  +    +    +C+  R 
Sbjct: 265 GGNTGDLEFDAVFDSGTSFTYLTDAAYTLISESFNSLALDKRYQTTDSELPFEYCYALRL 324

Query: 454 PFRS--ISDVKKYFKSFALSFA-NGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGL 284
           P  S      K  F+  A++    G  S  ++   P   + +      CL ++      +
Sbjct: 325 PLYSGHHHPNKDSFQYPAVNLTMKGGSSYPVYH--PLVVIPMKDTDVYCLAIMK-----I 377

Query: 283 HNYNVIGDVSMQDRMVIYDNEKNAIGWTRANC 188
            + ++IG   M    V++D EK  +GW  ++C
Sbjct: 378 EDISIIGQNFMTGYRVVFDREKLILGWKESDC 409



>gb:AY069886_1566629 Arabidopsis thaliana putative chloroplast
           nucleoid DNA-binding protein mRNA, complete
           cds.>gb:AY142012_1582849 Arabidopsis thaliana
           At2g17760/At2g17760 mRNA, complete cds.
          Length = 513

 Score = 40.4 bits (93), Expect = 0.034
 Identities = 33/150 (22%), Positives = 62/150 (41%), Gaps = 1/150 (0%)
 Frame = -1

Query: 634 GKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKGRR 455
           G +TG      VFDSG+S++Y+    Y     S       K  +    +    +C+    
Sbjct: 314 GGNTGDLEFDAVFDSGTSFTYLTDAAYTLISESFNSLALDKRYQTTDSELPFEYCY---- 369

Query: 454 PFRSISDVKKYFKSFALSFA-NGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHN 278
              ++S  K  F+  A++    G  S  ++   P   + +      CL ++      + +
Sbjct: 370 ---ALSPNKDSFQYPAVNLTMKGGSSYPVYH--PLVVIPMKDTDVYCLAIMK-----IED 419

Query: 277 YNVIGDVSMQDRMVIYDNEKNAIGWTRANC 188
            ++IG   M    V++D EK  +GW  ++C
Sbjct: 420 ISIIGQNFMTGYRVVFDREKLILGWKESDC 449



>gb:AP004585_1841901 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0470B03.
          Length = 448

 Score = 39.3 bits (90), Expect = 0.075
 Identities = 35/142 (24%), Positives = 62/142 (43%), Gaps = 2/142 (1%)
 Frame = -1

Query: 604 VVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGD-DPTLPFCWKGRRPFRSISDVK 428
           V  DSG+S +++    Y+A    +V  LR  PL    D +  L  C+    P+     V 
Sbjct: 320 VFIDSGTSLTWLQQDAYDAVRRELVSVLR--PLPPTNDTEIGLETCF----PWPPPPSVA 373

Query: 427 KYFKSFALSFANGWRSRTLFEISPESYLII-SSKGSVCLGVLNGTEAGLHNYNVIGDVSM 251
                  L F  G        + PE+Y++I  + G +CL ++   +A      +IG+   
Sbjct: 374 VTVPDMELHFDGG----ANMTVPPENYMLIDGATGFLCLAMIRSGDA-----TIIGNYQQ 424

Query: 250 QDRMVIYDNEKNAIGWTRANCD 185
           Q+  ++YD   + + +  A C+
Sbjct: 425 QNMHILYDIANSLLSFVPAPCN 446



>gb:OSJN00287_1697982 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0011K22, complete sequence.
          Length = 820

 Score = 38.1 bits (87), Expect = 0.17
 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 5/49 (10%)
 Frame = -1

Query: 319 CLGVLNGTEAGLHNYN-----VIGDVSMQDRMVIYDNEKNAIGWTRANC 188
           C+G  NG   GL + +     ++GD+ + +++V+YD E   IGWT  NC
Sbjct: 727 CVGFQNG---GLQSKDGKGMVLLGDLVLSNKLVVYDLENQVIGWTEYNC 772



>gb:AP004040_1836748 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1008_D06.>gb:AP005052_1847312 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0654B04.
          Length = 333

 Score = 37.4 bits (85), Expect = 0.29
 Identities = 33/147 (22%), Positives = 59/147 (40%)
 Frame = -1

Query: 628 STGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKGRRPF 449
           S+   ++  + DSG+  + + +  Y A   +V   ++G     A     L  C+KG+   
Sbjct: 204 SSAYSSLPTIIDSGTVITRLPTSVYSALSKAVAAAMKGTSRASAYS--ILDTCFKGQASR 261

Query: 448 RSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNV 269
            S   V        +SFA G       ++S ++ L+     + CL       A      +
Sbjct: 262 VSAPAV-------TMSFAGG----AALKLSAQNLLVDVDDSTTCLAFAPARSAA-----I 305

Query: 268 IGDVSMQDRMVIYDNEKNAIGWTRANC 188
           IG+   Q   V+YD + + IG+    C
Sbjct: 306 IGNTQQQTFSVVYDVKSSRIGFAAGGC 332



>gb:AP004040_1836747 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1008_D06.>gb:AP005052_1847311 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0654B04.
          Length = 458

 Score = 37.4 bits (85), Expect = 0.29
 Identities = 33/147 (22%), Positives = 59/147 (40%)
 Frame = -1

Query: 628 STGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKGRRPF 449
           S+   ++  + DSG+  + + +  Y A   +V   ++G     A     L  C+KG+   
Sbjct: 329 SSAYSSLPTIIDSGTVITRLPTSVYSALSKAVAAAMKGTSRASAYS--ILDTCFKGQASR 386

Query: 448 RSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNV 269
            S   V        +SFA G       ++S ++ L+     + CL       A      +
Sbjct: 387 VSAPAV-------TMSFAGG----AALKLSAQNLLVDVDDSTTCLAFAPARSAA-----I 430

Query: 268 IGDVSMQDRMVIYDNEKNAIGWTRANC 188
           IG+   Q   V+YD + + IG+    C
Sbjct: 431 IGNTQQQTFSVVYDVKSSRIGFAAGGC 457



>gb:AP002913_1823914 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0480E02.
          Length = 504

 Score = 37.0 bits (84), Expect = 0.37
 Identities = 41/153 (26%), Positives = 66/153 (43%), Gaps = 2/153 (1%)
 Frame = -1

Query: 640 FGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKG 461
           F   STG   +IV  DSG++ + + S  Y A   + V+  +  P R +G       C+  
Sbjct: 371 FAMDSTGAGGVIV--DSGTAVTRLQSSAYAALRDAFVRGTQSLP-RTSGVS-LFDTCY-- 424

Query: 460 RRPFRSISD-VKKYFKSFALSFANGWRSRTLFEISPESYLI-ISSKGSVCLGVLNGTEAG 287
                 +SD       + +L FA G   R    +  ++YLI +   G+ CL       A 
Sbjct: 425 -----DLSDRTSVEVPAVSLRFAGGGELR----LPAKNYLIPVDGAGTYCLAFAPTNAA- 474

Query: 286 LHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANC 188
               ++IG+V  Q   V +D  K+ +G+T   C
Sbjct: 475 ---VSIIGNVQQQGTRVSFDTAKSTVGFTTNKC 504



>gb:OSJN00013_1693275 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0064H22, complete sequence.
          Length = 444

 Score = 37.0 bits (84), Expect = 0.37
 Identities = 31/142 (21%), Positives = 62/142 (43%), Gaps = 1/142 (0%)
 Frame = -1

Query: 604 VVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSISDVKK 425
           V+ DSG+S +Y+  Q Y A   +   ++   P  + G    L  C+  R P + +  V+ 
Sbjct: 317 VIVDSGTSITYLEVQGYRALKKAFAAQM-ALPAAD-GSGVGLDLCF--RAPAKGVDQVE- 371

Query: 424 YFKSFALSFANGWRSRTLFEISPESYLIISS-KGSVCLGVLNGTEAGLHNYNVIGDVSMQ 248
                   F  G       ++  E+Y+++    G++CL V+     G    ++IG+   Q
Sbjct: 372 -VPRLVFHFDGG----ADLDLPAENYMVLDGGSGALCLTVM-----GSRGLSIIGNFQQQ 421

Query: 247 DRMVIYDNEKNAIGWTRANCDR 182
           +   +YD   + + +    C++
Sbjct: 422 NFQFVYDVGHDTLSFAPVQCNK 443



>gb:CR382130_1662757 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 403

 Score = 37.0 bits (84), Expect = 0.37
 Identities = 38/143 (26%), Positives = 62/143 (43%), Gaps = 1/143 (0%)
 Frame = -1

Query: 634 GKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKGRR 455
           G +  + N  ++ DSG+S +++ SQ Y +F+  V K   G  L   G       C     
Sbjct: 254 GDTQFISNGDIILDSGTSITFLESQSYNSFIDVVRKS--GIQLYPQGRGLNAFLC----- 306

Query: 454 PFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIIS-SKGSVCLGVLNGTEAGLHN 278
                SD  K       +F N     +L E S ++ +I S +  SVCL    G   G  +
Sbjct: 307 -----SDASKA-PDTTFTFGNKEIKISLREFSIQASVISSQNSASVCL---LGVALGDGS 357

Query: 277 YNVIGDVSMQDRMVIYDNEKNAI 209
            N+ GD  ++    +YD E++ +
Sbjct: 358 MNLFGDTFLRSVYSVYDLERSEV 380



>gb:AE016959_1023644 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC074196_1541241
           Oryza sativa chromosome 10 BAC OSJNBa0040D23 genomic
           sequence, complete sequence.>gb:AE017115_1753463 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           69 of 77 of the complete sequence.
          Length = 413

 Score = 37.0 bits (84), Expect = 0.37
 Identities = 40/181 (22%), Positives = 68/181 (37%), Gaps = 10/181 (5%)
 Frame = -1

Query: 688 PRDYTKHYSPGPAELTFGGKST---GVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR 518
           P D + HY     +    G +T        I+V  + S +S +    Y AF  +V + + 
Sbjct: 243 PDDDSHHYYLLSLDAIRAGNTTIATAQSGGILVMHTVSPFSLLVDSAYRAFKKAVTEAVG 302

Query: 517 GKPLREAGDDPTLPF--CWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYL 344
           G         P  PF  C+K    F          ++ A      ++      + P  YL
Sbjct: 303 GAAAPPMATPPQ-PFDLCFKKAAGFS---------RATAPDLVFTFQGAAALTVPPAKYL 352

Query: 343 II--SSKGSVCLGVLNGT---EAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRP 179
           I     K + C  +L+       GL   +V+G +  +D   +YD +K  + +  A+C   
Sbjct: 353 IDVGEEKDTACAAILSMAWLNRTGLEGVSVLGSLQQEDVHFLYDLKKETLSFEPADCSSL 412

Query: 178 P 176
           P
Sbjct: 413 P 413



>gb:AP005393_1850992 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0488D02.
          Length = 441

 Score = 36.6 bits (83), Expect = 0.49
 Identities = 31/141 (21%), Positives = 61/141 (43%), Gaps = 1/141 (0%)
 Frame = -1

Query: 604 VVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSISDVKK 425
           V+ DSG++ +++ +QP  A +        G P   A    T   C+K   P R +  + +
Sbjct: 314 VIIDSGTTVTFL-AQPAYAMVQGAFVAWVGLPRANATPSDTFDTCFKWPPPPRRMVTLPE 372

Query: 424 YFKSFALSFANGWRSRTLFEISPESYLIISS-KGSVCLGVLNGTEAGLHNYNVIGDVSMQ 248
               F              E+  E+Y+++    G++CL +L   +      ++IG    Q
Sbjct: 373 MVLHF---------DGADMELPLENYMVMDGGTGNLCLAMLPSDDG-----SIIGSFQHQ 418

Query: 247 DRMVIYDNEKNAIGWTRANCD 185
           +  ++YD E + + +  A C+
Sbjct: 419 NFHMLYDLENSLLSFVPAPCN 439



>gb:AP003769_1833298 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0541C02.
          Length = 307

 Score = 36.6 bits (83), Expect = 0.49
 Identities = 37/161 (22%), Positives = 70/161 (43%), Gaps = 14/161 (8%)
 Frame = -1

Query: 628 STGVKNMIVVF----DSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKG 461
           S G KN+ + F    DSG+S++Y+N   Y A+  +   ++  +    +G   + PF    
Sbjct: 78  SVGDKNLPLGFYAIADSGTSFTYLNDPAYTAYTTNFNAQISERRANFSGSTRSGPF---- 133

Query: 460 RRPFR---SISDVKKYFKSFALSFANGWRSRTLFEISPESYLIIS--SKGSV-----CLG 311
             PF    S+S  +   +   +S         +F ++   Y I +  + G +     CL 
Sbjct: 134 --PFEYCYSLSPDQTTVELPVVSLTTN--GGAVFPVTSPVYPIAAQMTNGEIRIIGYCLA 189

Query: 310 VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANC 188
           V+          ++IG   M    V+++ EK+ +GW + +C
Sbjct: 190 VIKSDLP----IDIIGQNFMTGLKVVFNREKSVLGWQKFDC 226



>gb:AC091774_1735050 Oryza sativa chromosome 6 BAC OJ1540_H01
           genomic sequence, complete sequence.>gb:AP003769_1833297
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 6, PAC clone:P0541C02.
          Length = 551

 Score = 36.6 bits (83), Expect = 0.49
 Identities = 37/161 (22%), Positives = 70/161 (43%), Gaps = 14/161 (8%)
 Frame = -1

Query: 628 STGVKNMIVVF----DSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKG 461
           S G KN+ + F    DSG+S++Y+N   Y A+  +   ++  +    +G   + PF    
Sbjct: 322 SVGDKNLPLGFYAIADSGTSFTYLNDPAYTAYTTNFNAQISERRANFSGSTRSGPF---- 377

Query: 460 RRPFR---SISDVKKYFKSFALSFANGWRSRTLFEISPESYLIIS--SKGSV-----CLG 311
             PF    S+S  +   +   +S         +F ++   Y I +  + G +     CL 
Sbjct: 378 --PFEYCYSLSPDQTTVELPVVSLTTN--GGAVFPVTSPVYPIAAQMTNGEIRIIGYCLA 433

Query: 310 VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANC 188
           V+          ++IG   M    V+++ EK+ +GW + +C
Sbjct: 434 VIKSDLP----IDIIGQNFMTGLKVVFNREKSVLGWQKFDC 470



>gb:AE016959_1023646 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC074196_1541243
           Oryza sativa chromosome 10 BAC OSJNBa0040D23 genomic
           sequence, complete sequence.>gb:AE017115_1753465 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           69 of 77 of the complete sequence.
          Length = 397

 Score = 36.6 bits (83), Expect = 0.49
 Identities = 42/181 (23%), Positives = 70/181 (38%), Gaps = 10/181 (5%)
 Frame = -1

Query: 688 PRDYTKHYSPGPAELTFGGKST---GVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELR 518
           P D + HY     +    G +T        I+V  + S +S +    Y AF  +V + + 
Sbjct: 226 PDDDSHHYYLLSLDAIRAGNTTIATAQSGGILVMHTVSPFSLLVDSAYRAFKKAVTEAVG 285

Query: 517 GKPLREAGDDPTLPF--CWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYL 344
           G         P  PF  C+K    F   +     F     +F  G  + T   + P  YL
Sbjct: 286 GAAAPPMATPPQ-PFDLCFKKAAGFSRATAPDLVF-----TFQGGGAALT---VPPAKYL 336

Query: 343 II--SSKGSVCLGVLNGTE---AGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRP 179
           I     K + C  +L+       GL   +V+G +  ++   +YD +K  + +  A+C   
Sbjct: 337 IDVGEEKDTACAAILSMARLNRTGLEGVSVLGSLQQENVHFLYDLKKETLSFEPADCSSL 396

Query: 178 P 176
           P
Sbjct: 397 P 397



>gb:AE016959_1023643 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC074196_1541240
           Oryza sativa chromosome 10 BAC OSJNBa0040D23 genomic
           sequence, complete sequence.>gb:AE017115_1753462 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           69 of 77 of the complete sequence.
          Length = 382

 Score = 36.6 bits (83), Expect = 0.49
 Identities = 35/156 (22%), Positives = 62/156 (39%), Gaps = 7/156 (4%)
 Frame = -1

Query: 634 GKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKGRR 455
           G   G + +I V  SG +       P    +  V ++L+       G     P       
Sbjct: 228 GIKAGDEAIITVPQSGRTVLLQTFSPVSFLVDGVYQDLKKAVTAAVGGPTATP-----PE 282

Query: 454 PFRSISDV--KKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGV-----LNGT 296
            F+SI D+  K+   S A      ++      + P +YL+     +VC+ +     LN T
Sbjct: 283 QFQSIFDLCFKRGGVSGAPDVVLTFQGAAALTVPPTNYLLDVGDDTVCVAIASSARLNST 342

Query: 295 EAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANC 188
           E      +++G +  Q+   +YD EK  + +  A+C
Sbjct: 343 EVA--GMSILGGLQQQNVHFLYDLEKETLSFEAADC 376



>gb:AB025630_1516552 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MPA22.>gb:AY054192_1563014 Arabidopsis thaliana
           AT5g37540/mpa22_p_70 mRNA, complete
           cds.>gb:AY092990_1574944 Arabidopsis thaliana unknown
           protein (At5g37540) mRNA, complete
           cds.>gb:BT000082_1634360 Arabidopsis thaliana unknown
           protein (At5g37540) mRNA, complete cds.
          Length = 442

 Score = 36.2 bits (82), Expect = 0.64
 Identities = 27/136 (19%), Positives = 56/136 (41%)
 Frame = -1

Query: 595 DSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFK 416
           DSGS ++++    Y+     +V+ +  +  +      T   C+ G        ++ +   
Sbjct: 312 DSGSEFTHLVDVAYDKVKEEIVRLVGSRLKKGYVYGSTADMCFDGNHSM----EIGRLIG 367

Query: 415 SFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMV 236
                F  G        +  +S L+    G  C+G+   +  G  + N+IG+V  Q+  V
Sbjct: 368 DLVFEFGRGVE----ILVEKQSLLVNVGGGIHCVGIGRSSMLGAAS-NIIGNVHQQNLWV 422

Query: 235 IYDNEKNAIGWTRANC 188
            +D     +G+++A C
Sbjct: 423 EFDVTNRRVGFSKAEC 438



>gb:AK046550_1167829 Mus musculus 4 days neonate male adipose cDNA,
           RIKEN full-length enriched library, clone:B430005F11
           product:LIMITIN, full insert sequence.
          Length = 182

 Score = 36.2 bits (82), Expect = 0.64
 Identities = 33/132 (25%), Positives = 58/132 (43%), Gaps = 1/132 (0%)
 Frame = -1

Query: 718 CLACHLDTPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLY 539
           CL    D PCP     + +P     T    S  +K ++ +FD+ +S +  + +  +  L 
Sbjct: 52  CLRDRTDFPCPWKEGTNITPMTLGETTSCYSQTLKQVLHLFDTEASRAAWHERALDQLLS 111

Query: 538 SVVKELRG-KPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEI 362
           S+ +EL+  K  RE G    LPF    R  FR      +Y K+ A S  +    R   ++
Sbjct: 112 SLWRELQVLKRPREQGQSCPLPFALAIRTYFRGFF---RYLKAKAYSACSWEIVRVQLQV 168

Query: 361 SPESYLIISSKG 326
              ++ + + +G
Sbjct: 169 DLPAFPLSARRG 180



>gb:AP003504_1830005 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0025A05.
          Length = 500

 Score = 35.8 bits (81), Expect = 0.83
 Identities = 18/60 (30%), Positives = 34/60 (56%), Gaps = 1/60 (1%)
 Frame = -1

Query: 364 ISPESYLI-ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANC 188
           + PE+YLI + S+G+ C     GT+ G+   ++IG++  Q   V++D +   +G+    C
Sbjct: 445 LPPENYLIPVDSRGTFCFAFA-GTDGGV---SIIGNIQQQGFRVVFDGDGQRLGFVPKGC 500



>gb:AP003292_1827426 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0690B02.
          Length = 446

 Score = 35.8 bits (81), Expect = 0.83
 Identities = 42/148 (28%), Positives = 57/148 (38%), Gaps = 9/148 (6%)
 Frame = -1

Query: 604 VVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLRE-AGDDPTLPFCWKGR-RPFRSISDV 431
           VV DSG++ S      Y A   +     R   +R  AG+      C+  R RP  S   +
Sbjct: 312 VVVDSGTAISRFARDAYAALRDAFDARARAAGMRRLAGEHSVFDACYDLRGRPAASAPLI 371

Query: 430 KKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSV-------CLGVLNGTEAGLHNYN 272
                   L FA G        + PE+Y +    G         CLG     EA     +
Sbjct: 372 -------VLHFAGG----ADMALPPENYFLPVDGGRRRAASYRRCLGF----EAADDGLS 416

Query: 271 VIGDVSMQDRMVIYDNEKNAIGWTRANC 188
           VIG+V  Q   V++D EK  IG+    C
Sbjct: 417 VIGNVQQQGFRVVFDVEKERIGFAPKGC 444



>gb:AC136216_1742995 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0022J22, complete sequence.
          Length = 481

 Score = 35.8 bits (81), Expect = 0.83
 Identities = 17/60 (28%), Positives = 35/60 (58%), Gaps = 1/60 (1%)
 Frame = -1

Query: 364 ISPESYLI-ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANC 188
           + PE+YLI + + G+ C  +  GT+ G+   ++IG++  Q   V++D +   +G+   +C
Sbjct: 426 LPPENYLIPVDTSGTFCFAMA-GTDGGV---SIIGNIQQQGFRVVFDGDAQRVGFVPKSC 481



>gb:AC105260_1737887 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1115_D04, complete sequence.
          Length = 475

 Score = 35.8 bits (81), Expect = 0.83
 Identities = 17/60 (28%), Positives = 35/60 (58%), Gaps = 1/60 (1%)
 Frame = -1

Query: 364 ISPESYLI-ISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANC 188
           + PE+YLI + + G+ C  +  GT+ G+   ++IG++  Q   V++D +   +G+   +C
Sbjct: 420 LPPENYLIPVDTSGTFCFAMA-GTDGGV---SIIGNIQQQGFRVVFDGDAQRVGFVPKSC 475



>gb:AY584109_1339155 Plasmodium vivax isolate KOR 21 aspartic
           protease PM5 mRNA, complete cds.>gb:AY584110_1339156
           Plasmodium vivax isolate KOR 22 aspartic protease PM5
           mRNA, complete cds.
          Length = 536

 Score = 35.8 bits (81), Expect = 0.83
 Identities = 21/61 (34%), Positives = 32/61 (52%)
 Frame = -1

Query: 358 PESYLIISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRP 179
           P SYL    +   C G+    E  ++N  ++G    ++R VI+D +KN IG+  ANC   
Sbjct: 415 PHSYLY-KKESFWCKGI----EKQVNNKPILGLTFFKNRQVIFDIQKNRIGFVDANCPSH 469

Query: 178 P 176
           P
Sbjct: 470 P 470



>gb:AY584090_1339136 Plasmodium vivax isolate KOR 1 aspartic
           protease PM5 mRNA, complete cds.>gb:AY584091_1339137
           Plasmodium vivax isolate KOR 2 aspartic protease PM5
           mRNA, complete cds.>gb:AY584092_1339138 Plasmodium vivax
           isolate KOR 3 aspartic protease PM5 mRNA, complete
           cds.>gb:AY584093_1339139 Plasmodium vivax isolate KOR 4
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584094_1339140 Plasmodium vivax isolate KOR 5
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584095_1339141 Plasmodium vivax isolate KOR 6
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584096_1339142 Plasmodium vivax isolate KOR 7
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584097_1339143 Plasmodium vivax isolate KOR 8
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584098_1339144 Plasmodium vivax isolate KOR 9
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584099_1339145 Plasmodium vivax isolate KOR 10
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584100_1339146 Plasmodium vivax isolate KOR 11
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584101_1339147 Plasmodium vivax isolate KOR 12
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584102_1339148 Plasmodium vivax isolate KOR 14
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584103_1339149 Plasmodium vivax isolate KOR 15
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584104_1339150 Plasmodium vivax isolate KOR 16
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584105_1339151 Plasmodium vivax isolate KOR 17
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584106_1339152 Plasmodium vivax isolate KOR 18
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584107_1339153 Plasmodium vivax isolate KOR 19
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584108_1339154 Plasmodium vivax isolate KOR 20
           aspartic protease PM5 mRNA, complete
           cds.>gb:AY584111_1339157 Plasmodium vivax isolate KOR 13
           aspartic protease PM5 mRNA, complete cds.
          Length = 536

 Score = 35.8 bits (81), Expect = 0.83
 Identities = 21/61 (34%), Positives = 32/61 (52%)
 Frame = -1

Query: 358 PESYLIISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANCDRP 179
           P SYL    +   C G+    E  ++N  ++G    ++R VI+D +KN IG+  ANC   
Sbjct: 415 PHSYLY-KKESFWCKGI----EKQVNNKPILGLTFFKNRQVIFDIQKNRIGFVDANCPSH 469

Query: 178 P 176
           P
Sbjct: 470 P 470



>gb:AP004585_1841902 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0470B03.
          Length = 373

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 31/140 (22%), Positives = 58/140 (41%)
 Frame = -1

Query: 601 VFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSISDVKKY 422
           + DSGS+ +Y+    +EA   +V+  +R        +D  L F    R    ++  V+  
Sbjct: 241 IVDSGSTVAYLVEAAFEAVKEAVMDVVRLPVANRTVEDYELCFVLPRRTAAAAMEAVQ-- 298

Query: 421 FKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDR 242
                L F  G        +  ++Y      G +CL V   T+      ++IG+V  Q+ 
Sbjct: 299 VPPLVLHFDGG----AAMVLPRDNYFQEPRAGLMCLAVGKTTDGS--GVSIIGNVQQQNM 352

Query: 241 MVIYDNEKNAIGWTRANCDR 182
            V++D + +   +    CD+
Sbjct: 353 HVLFDVQHHKFSFAPTQCDQ 372



>gb:OSJN00092_1694767 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0088H09, complete sequence.
          Length = 490

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 41/193 (21%), Positives = 77/193 (39%), Gaps = 29/193 (15%)
 Frame = -1

Query: 679 YTKHYSPGPAELTFGGKSTGVKNMIVV---------FDSGSSYSYMNSQPYEAFLYSVVK 527
           Y+ +Y      +T GGKS  +     V          DSG+++SY +   +E    +VV 
Sbjct: 303 YSVYYYLALTAITVGGKSVQLPERAFVAGGAGGGAIVDSGTTFSYFDRTVFEPVAAAVVA 362

Query: 526 ELRGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFK--SFALSFANGWRSRTLFEISPE 353
            + G+  R    +  L     G  P  ++    K  +    +L F  G    ++  +  E
Sbjct: 363 AVGGRYSRSKVVEEGL-----GLSPCFAMPPGTKTMELPEMSLHFKGG----SVMNLPVE 413

Query: 352 SYLIISSKG----------SVCLGVLNGTE-----AGLHNYN---VIGDVSMQDRMVIYD 227
           +Y +++             ++CL V++        AG+ +     ++G    Q+  + YD
Sbjct: 414 NYFVVAGPAPSGGAPAMAEAICLAVVSDVPTSSGGAGVSSGGPAIILGSFQQQNYYIEYD 473

Query: 226 NEKNAIGWTRANC 188
            EK  +G+ R  C
Sbjct: 474 LEKERLGFRRQQC 486



>gb:CQ974046_1455432 Sequence 5 from Patent WO2004113520.
          Length = 430

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 35/159 (22%), Positives = 63/159 (39%), Gaps = 3/159 (1%)
 Frame = -1

Query: 655 PAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLP 476
           P+++  GG  +G      + DSG++ +Y+    Y   +  +        +    ++    
Sbjct: 240 PSDVLGGGSGSGT-----IIDSGTTLAYLPDDVYTPLMEKITASQSNLKIHIV-ENQFKC 293

Query: 475 FCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNG- 299
           F + G        +V   F   +  F +   S T++   P  YL        C+G  N  
Sbjct: 294 FVYSG--------NVDDGFPVVSFHFEDSL-SLTVY---PHEYLFDLHDDQWCIGWQNKG 341

Query: 298 --TEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANC 188
             T  G     ++GD+ + +++V YD E   IGW   NC
Sbjct: 342 MQTRDG-REVTLLGDLVLANKLVSYDLENQTIGWAEYNC 379



>gb:AK031317_1162388 Mus musculus 13 days embryo male testis cDNA,
           RIKEN full-length enriched library, clone:6030405N23
           product:LIMITIN, full insert sequence.
          Length = 182

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 33/132 (25%), Positives = 58/132 (43%), Gaps = 1/132 (0%)
 Frame = -1

Query: 718 CLACHLDTPCPRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLY 539
           CL    D PCP     + +P     T    S  +K ++ +FD+ +S +  + +  +  L 
Sbjct: 52  CLRDRTDFPCPWKEGTNITPMTLGETTSCYSQTLKQVLHLFDTEASRAAWHERALDQLLS 111

Query: 538 SVVKELRG-KPLREAGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEI 362
           S+ +EL+  K  RE G    LPF    R  FR      +Y K+ A S  +    R   ++
Sbjct: 112 SLWRELQVLKRPREQGQSCPLPFALAIRTYFRGFF---RYLKAKAHSACSWEIVRVQLQV 168

Query: 361 SPESYLIISSKG 326
              ++ + + +G
Sbjct: 169 DLPAFPLSARRG 180



>gb:AP003811_1833698 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1131_E05.>gb:AP006753_1862869 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBa0039D04.
          Length = 453

 Score = 35.0 bits (79), Expect = 1.4
 Identities = 38/164 (23%), Positives = 70/164 (42%), Gaps = 5/164 (3%)
 Frame = -1

Query: 664 SPGPAEL-----TFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLRE 500
           S GPA L      F  ++ G   +I+  DSG++ + +    Y+  + + V+ L   P+ +
Sbjct: 302 SVGPAALPIPPGAFALRADGTGGLII--DSGTTITSLVDAAYKR-VRAAVRSLVKLPVTD 358

Query: 499 AGDDPTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSV 320
             +   L  C+       S S       S  L F  G        +  E+Y+I+   G  
Sbjct: 359 GSNATGLDLCFA----LPSSSAPPATLPSMTLHFGGG----ADMVLPVENYMILDG-GMW 409

Query: 319 CLGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANC 188
           CL + + T+  L   + +G+   Q+  ++YD +K  + +  A C
Sbjct: 410 CLAMRSQTDGEL---STLGNYQQQNLHILYDVQKETLSFAPAKC 450



>gb:AE016788_333257 Pseudomonas putida KT2440 section 15 of 21 of
           the complete genome.>gb:AE015451_948334 Pseudomonas
           putida KT2440 complete genome.
          Length = 768

 Score = 35.0 bits (79), Expect = 1.4
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 4/41 (9%)
 Frame = -1

Query: 664 SPGPAELTFGGKST----GVKNMIVVFDSGSSYSYMNSQPY 554
           S G AELT  G +T    G+KN+IV F+   +YSY ++  Y
Sbjct: 230 SSGKAELTIDGIATDDLAGIKNIIVTFNKNLAYSYSSTDTY 270



>pir|F96686|F96686 unknown protein F15E12.7 [imported] - Arabidopsis
           thaliana>gb:AE005173_894266 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC026480_1539651 Arabidopsis thaliana
           chromosome 1 BAC F15E12 genomic sequence, complete
           sequence.>gb:AY035077_1559849 Arabidopsis thaliana
           unknown protein (At1g66180) mRNA, complete
           cds.>gb:AY051031_1562507 Arabidopsis thaliana unknown
           protein (At1g66180) mRNA, complete cds.
          Length = 430

 Score = 35.0 bits (79), Expect = 1.4
 Identities = 26/139 (18%), Positives = 61/139 (43%), Gaps = 1/139 (0%)
 Frame = -1

Query: 595 DSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFK 416
           DSGS ++++    Y+     ++  +  +  +      T   C+ G     +++ + +   
Sbjct: 301 DSGSEFTHLVDAAYDKVRAEIMTRVGRRLKKGYVYGGTADMCFDG-----NVAMIPRLIG 355

Query: 415 SFALSFANGWRSRTLFEISPESYLIISSKGSV-CLGVLNGTEAGLHNYNVIGDVSMQDRM 239
                F  G        + P+  ++++  G + C+G+   +  G  + N+IG+V  Q+  
Sbjct: 356 DLVFVFTRGVEI-----LVPKERVLVNVGGGIHCVGIGRSSMLGAAS-NIIGNVHQQNLW 409

Query: 238 VIYDNEKNAIGWTRANCDR 182
           V +D     +G+ +A+C R
Sbjct: 410 VEFDVTNRRVGFAKADCSR 428



>gb:AP005065_1847446 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0046H03.>gb:AP005067_1847488 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0487H05.
          Length = 82

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 12/29 (41%), Positives = 20/29 (68%)
 Frame = -1

Query: 274 NVIGDVSMQDRMVIYDNEKNAIGWTRANC 188
           N++ D+ + +++V+YD E  AIGW   NC
Sbjct: 47  NLLSDLVLSNKLVLYDLENQAIGWADYNC 75



>gb:AY088920_1573928 Arabidopsis thaliana clone 99625 mRNA, complete
           sequence.
          Length = 430

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 27/138 (19%), Positives = 57/138 (41%)
 Frame = -1

Query: 595 DSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFK 416
           DSGS ++++    Y+     ++  +  +  +      T   C+ G     +++ + +   
Sbjct: 301 DSGSEFTHLVDAAYDKVRAEIMTRVGRRLKKGYVYGGTADMCFDG-----NVAMIPRLIG 355

Query: 415 SFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMV 236
                F  G        +  E  L+    G  C+G+   +  G  + N+IG+V  Q+  V
Sbjct: 356 DLVFVFTRGVE----IFVPKERVLVNVGGGIHCVGIGRSSMLGAAS-NIIGNVHQQNLWV 410

Query: 235 IYDNEKNAIGWTRANCDR 182
            +D     +G+ +A+C R
Sbjct: 411 EFDVTNRRVGFAKADCSR 428



>gb:AY080874_1568558 Arabidopsis thaliana putative chloroplast
           nucleoid DNA-binding protein (At3g18490) mRNA, complete
           cds.
          Length = 500

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 36/144 (25%), Positives = 60/144 (41%), Gaps = 5/144 (3%)
 Frame = -1

Query: 604 VVFDSGSSYSYMNSQPY----EAFLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSIS 437
           V+ D G++ + + +Q Y    +AFL   V   +G       D      C+     F S+S
Sbjct: 376 VILDCGTAVTRLQTQAYNSLRDAFLKLTVNLKKGSSSISLFDT-----CYD----FSSLS 426

Query: 436 DVKKYFKSFALSFANGWRSRTLFEISPESYLI-ISSKGSVCLGVLNGTEAGLHNYNVIGD 260
            VK    + A  F  G       ++  ++YLI +   G+ C      + +     ++IG+
Sbjct: 427 TVK--VPTVAFHFTGG----KSLDLPAKNYLIPVDDSGTFCFAFAPTSSS----LSIIGN 476

Query: 259 VSMQDRMVIYDNEKNAIGWTRANC 188
           V  Q   + YD  KN IG +   C
Sbjct: 477 VQQQGTRITYDLSKNVIGLSGNKC 500



>gb:AB026658_1517372 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MYF24.>gb:AY150497_1585062 Arabidopsis
           thaliana putative chloroplast nucleoid DNA-binding
           protein (At3g18490) mRNA, complete cds.
          Length = 500

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 36/144 (25%), Positives = 60/144 (41%), Gaps = 5/144 (3%)
 Frame = -1

Query: 604 VVFDSGSSYSYMNSQPY----EAFLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSIS 437
           V+ D G++ + + +Q Y    +AFL   V   +G       D      C+     F S+S
Sbjct: 376 VILDCGTAVTRLQTQAYNSLRDAFLKLTVNLKKGSSSISLFDT-----CYD----FSSLS 426

Query: 436 DVKKYFKSFALSFANGWRSRTLFEISPESYLI-ISSKGSVCLGVLNGTEAGLHNYNVIGD 260
            VK    + A  F  G       ++  ++YLI +   G+ C      + +     ++IG+
Sbjct: 427 TVK--VPTVAFHFTGG----KSLDLPAKNYLIPVDDSGTFCFAFAPTSSS----LSIIGN 476

Query: 259 VSMQDRMVIYDNEKNAIGWTRANC 188
           V  Q   + YD  KN IG +   C
Sbjct: 477 VQQQGTRITYDLSKNVIGLSGNKC 500



>pir|E96676|E96676 hypothetical protein T23K8.15 [imported] -
           Arabidopsis thaliana>gb:AE005173_894175 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:T23K8_1723841 Arabidopsis thaliana
           chromosome 1 BAC T23K8 sequence, complete sequence.
          Length = 449

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 30/145 (20%), Positives = 62/145 (42%), Gaps = 2/145 (1%)
 Frame = -1

Query: 619 VKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSI 440
           V+N   + DSG++ +Y     Y++ + ++   L  +P++    + T        + F   
Sbjct: 295 VRNGGTIVDSGTTLAYFPKVLYDSLIETI---LARQPVKLHIVEETF-------QCFSFS 344

Query: 439 SDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNG--TEAGLHNYNVI 266
           ++V + F   +  F +  +      + P  YL    +   C G   G  T        ++
Sbjct: 345 TNVDEAFPPVSFEFEDSVK----LTVYPHDYLFTLEEELYCFGWQAGGLTTDERSEVILL 400

Query: 265 GDVSMQDRMVIYDNEKNAIGWTRAN 191
           GD+ + +++V+YD +   IGW   N
Sbjct: 401 GDLVLSNKLVVYDLDNEVIGWADHN 425



>gb:AP004079_1837367 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1067_B01.>gb:AP005874_1859469 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0016G10.
          Length = 845

 Score = 34.3 bits (77), Expect = 2.4
 Identities = 19/48 (39%), Positives = 25/48 (52%)
 Frame = +2

Query: 368 EESSGSPSIGEAESKGLEVFLHITDASERPPALPAER*GRVIPSFSQW 511
           ++ S S  I +A+SKG  V    T  +  PPA PA R    IPS + W
Sbjct: 286 DDKSASKGISDAQSKGKSVMTSATPPT--PPAAPAFRPAPPIPSLNDW 331



>gb:AP003811_1833697 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1131_E05.>gb:AP006753_1862868 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBa0039D04.
          Length = 441

 Score = 34.3 bits (77), Expect = 2.4
 Identities = 31/140 (22%), Positives = 61/140 (43%), Gaps = 1/140 (0%)
 Frame = -1

Query: 604 VVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSISDVKK 425
           V+ DSG++++ +  + + A   ++   +R  PL  +G    L  C+    P     +V +
Sbjct: 317 VIIDSGTTFTALEERAFVALARALASRVR-LPLA-SGAHLGLSLCFAAASP--EAVEVPR 372

Query: 424 YFKSFALSFANGWRSRTLFEISPESYLIIS-SKGSVCLGVLNGTEAGLHNYNVIGDVSMQ 248
               F              E+  ESY++   S G  CLG+++         +V+G +  Q
Sbjct: 373 LVLHF---------DGADMELRRESYVVEDRSAGVACLGMVSA-----RGMSVLGSMQQQ 418

Query: 247 DRMVIYDNEKNAIGWTRANC 188
           +  ++YD E+  + +  A C
Sbjct: 419 NTHILYDLERGILSFEPAKC 438



>gb:AP004774_1844838 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0431B06.
          Length = 520

 Score = 33.9 bits (76), Expect = 3.2
 Identities = 37/163 (22%), Positives = 65/163 (39%), Gaps = 3/163 (1%)
 Frame = -1

Query: 667 YSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDD 488
           Y+    +   G K T       + D+G+S++ +    Y++      K++     R + DD
Sbjct: 302 YAVNVDKYCIGHKCTEGAGFQALVDTGTSFTSLPLDAYKSITMEFDKQINAS--RASSDD 359

Query: 487 PTLPFCWKGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSV---C 317
            +  +C+    P   + DV     +  L+FA     + +  I P +      +G     C
Sbjct: 360 YSFEYCYS-TGPLE-MPDVP----TITLTFAENKSFQAVNPILPFN----DRQGEFAVFC 409

Query: 316 LGVLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANC 188
           L VL   E       +IG   M    V++D E   +GW R+ C
Sbjct: 410 LAVLPSPEP----VGIIGQNFMVGYHVVFDRENMKLGWYRSEC 448



>gb:AE005172_891293 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC005292_1532436 Genomic sequence
           for Arabidopsis thaliana BAC F26F24 from chromosome I,
           complete sequence.>gb:AC007945_1536358 Genomic sequence
           for Arabidopsis thaliana BAC F28C11 from chromosome I,
           complete sequence.>gb:AY062732_1565388 Arabidopsis
           thaliana Unknown protein (At1g23390; F28C11.3) mRNA,
           complete cds.>gb:AY114649_1578691 Arabidopsis thaliana
           unknown protein (At1g23390) mRNA, complete cds.
          Length = 564

 Score = 33.9 bits (76), Expect = 3.2
 Identities = 28/98 (28%), Positives = 43/98 (43%), Gaps = 5/98 (5%)
 Frame = -1

Query: 688 PRDYTKHYSPGPAELTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYE-AFLYSVVKELRGK 512
           P   T++Y P    +  G  S+     I++ DSG SY  +   P+E  F YS   +++  
Sbjct: 72  PHHRTRYYKP----VKEGVISSDGDRTILIGDSGVSYQ-LPGAPFEFQFSYSETPKVKPV 126

Query: 511 PLREAG----DDPTLPFCWKGRRPFRSISDVKKYFKSF 410
            +RE        PT+P  W G+ P +        F SF
Sbjct: 127 GIREPAFMPFAPPTMPRPWTGKAPLKKSKKKIPLFDSF 164



>gb:AE016827_341693 Mannheimia succiniciproducens MBEL55E, complete
           genome.
          Length = 656

 Score = 33.9 bits (76), Expect = 3.2
 Identities = 35/119 (29%), Positives = 51/119 (42%), Gaps = 13/119 (10%)
 Frame = -1

Query: 565 SQPYEAFLYSVVK---ELRGKPLREAG---------DDPT-LPFCWKGRRPFRSISDVKK 425
           +Q  +A+  +VVK   EL G P+  AG         +DPT      KGR  FR+ SD+  
Sbjct: 389 NQAQKAYTENVVKNLPELAGLPVLSAGAPFKAGGRKNDPTGFTEVDKGRLTFRNASDLYL 448

Query: 424 YFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQ 248
           Y  +  +   NG   +   E S   +  I         +L+      +NY+VI  VS Q
Sbjct: 449 YPNTLVVLKVNGAELKEWLECSAGMFKQIDINSDKPQFLLDWEGFRTYNYDVIDGVSYQ 507



>gb:AP006149_1860977 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:B1274F11.
          Length = 476

 Score = 33.5 bits (75), Expect = 4.1
 Identities = 34/156 (21%), Positives = 63/156 (40%), Gaps = 3/156 (1%)
 Frame = -1

Query: 646 LTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCW 467
           +T G KS   +   +V DSG+S++ ++   Y     S   ++R          P   FC+
Sbjct: 268 ITVGSKSISTEFSAIV-DSGTSFTALSDPMYTQITSSFDAQIRSSRNMLDSSMP-FEFCY 325

Query: 466 KGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGS---VCLGVLNGT 296
                  S+S       + +L+   G    ++F ++     I  +  +    CL ++   
Sbjct: 326 -------SVSANGIVHPNVSLTAKGG----SIFPVNDPIITITDNAFNPVGYCLAIMKS- 373

Query: 295 EAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANC 188
                  N+IG+  M    V++D E+  +GW   NC
Sbjct: 374 ----EGVNLIGENFMSGLKVVFDRERMVLGWKNFNC 405



>gb:AB109206_1526817 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone: P0478E02.
          Length = 732

 Score = 33.5 bits (75), Expect = 4.1
 Identities = 34/156 (21%), Positives = 63/156 (40%), Gaps = 3/156 (1%)
 Frame = -1

Query: 646 LTFGGKSTGVKNMIVVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCW 467
           +T G KS   +   +V DSG+S++ ++   Y     S   ++R          P   FC+
Sbjct: 305 ITVGSKSISTEFSAIV-DSGTSFTALSDPMYTQITSSFDAQIRSSRNMLDSSMP-FEFCY 362

Query: 466 KGRRPFRSISDVKKYFKSFALSFANGWRSRTLFEISPESYLIISSKGS---VCLGVLNGT 296
                  S+S       + +L+   G    ++F ++     I  +  +    CL ++   
Sbjct: 363 -------SVSANGIVHPNVSLTAKGG----SIFPVNDPIITITDNAFNPVGYCLAIMKS- 410

Query: 295 EAGLHNYNVIGDVSMQDRMVIYDNEKNAIGWTRANC 188
                  N+IG+  M    V++D E+  +GW   NC
Sbjct: 411 ----EGVNLIGENFMSGLKVVFDRERMVLGWKNFNC 442



>gb:AY347858_1178016 Malus x domestica clone 13-6 nucleoid
           DNA-binding protein mRNA, partial cds; nuclear gene for
           chloroplast product.
          Length = 65

 Score = 33.5 bits (75), Expect = 4.1
 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 1/65 (1%)
 Frame = -1

Query: 379 RTLFEISPESYLIISSKGSVCLG-VLNGTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIGW 203
           RT  E+ P     ++S   VCL    NG ++ +    + G+V      V+YD     IG+
Sbjct: 3   RTTLELDPTGIFYVASADQVCLAFAANGDDSDI---GIFGNVQQMRVQVVYDVAGGKIGF 59

Query: 202 TRANC 188
             A C
Sbjct: 60  APAGC 64



>pir|JE0370|PECH pepsin A (EC 3.4.23.1) precursor -
           chicken>gb:AB025281_2461082 Gallus gallus cPgA mRNA for
           pepsinogen A, complete cds.>gb:AB025283_2461084 Gallus
           gallus cPgA gene for pepsinogen A, complete cds.
          Length = 382

 Score = 33.5 bits (75), Expect = 4.1
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%)
 Frame = -1

Query: 358 PESYLIISSKGSVCLGVLN-GTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIG 206
           P S  +++  GS  LG  N GT   L    ++GDV +++  VI+D   N +G
Sbjct: 326 PASAYVLNEDGSCMLGFENMGTPTELGEQWILGDVFIREYYVIFDRANNKVG 377



>sp|P00793|PEPA_CHICK Pepsin A precursor (EC 3.4.23.1).
          Length = 367

 Score = 33.5 bits (75), Expect = 4.1
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%)
 Frame = -1

Query: 358 PESYLIISSKGSVCLGVLN-GTEAGLHNYNVIGDVSMQDRMVIYDNEKNAIG 206
           P S  +++  GS  LG  N GT   L    ++GDV +++  VI+D   N +G
Sbjct: 311 PASAYVLNEDGSCMLGFENMGTPTELGEQWILGDVFIREYYVIFDRANNKVG 362



>gb:OSJN00206_1696703 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0054B09, complete sequence.
          Length = 329

 Score = 33.1 bits (74), Expect = 5.4
 Identities = 28/138 (20%), Positives = 59/138 (42%)
 Frame = -1

Query: 595 DSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSISDVKKYFK 416
           +SG+S + +  + Y A       +++   +     DP   F    R P   +  +  +F+
Sbjct: 201 NSGTSITSLPPRTYRAVREEFAAQVKLPVVPGNATDPFTCFSAPLRGPKPDVPTMALHFE 260

Query: 415 SFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQDRMV 236
              +      +   +FE+  +     SS+  +CL V+ G E       ++G+   Q+  V
Sbjct: 261 GATMRLP---QENYVFEVVDDDDAGNSSR-IICLAVIEGGEI------ILGNFQQQNMHV 310

Query: 235 IYDNEKNAIGWTRANCDR 182
           +YD + + + +  A CD+
Sbjct: 311 LYDLQNSKLSFVPAQCDQ 328



>gb:LAL297568_1683890 Lupinus albus partial gene for conglutin
           gamma, clone 48.
          Length = 413

 Score = 33.1 bits (74), Expect = 5.4
 Identities = 16/57 (28%), Positives = 34/57 (59%), Gaps = 2/57 (3%)
 Frame = -1

Query: 373 LFEISPESYLIISSKGSVCLGVLNGTEAGLHNYN--VIGDVSMQDRMVIYDNEKNAI 209
           ++ IS E+ ++ +  G  CLG ++G   G+H     V+G   +++ MV++D E++ +
Sbjct: 337 VWRISDENLMVQAQNGVSCLGFVDG---GMHTRTEIVLGTHQLEENMVVFDLERSRV 390



>gb:AP002524_1822386 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0406H10.>gb:AP002903_1823790 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0509B06.
          Length = 454

 Score = 32.7 bits (73), Expect = 7.0
 Identities = 26/141 (18%), Positives = 62/141 (43%), Gaps = 2/141 (1%)
 Frame = -1

Query: 604 VVFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWK--GRRPFRSISDV 431
           ++ DSG++ ++++       +  + + +   P++    D  L  C+   GR       + 
Sbjct: 323 IIVDSGTTLTFLDPSLLGPIVDELSRRITLPPVQSP--DGLLQLCYNVAGREV-----EA 375

Query: 430 KKYFKSFALSFANGWRSRTLFEISPESYLIISSKGSVCLGVLNGTEAGLHNYNVIGDVSM 251
            +      L F  G        + PE+  +   +G++CL ++  TE      +++G+++ 
Sbjct: 376 GESIPDLTLEFGGG----AAVALKPENAFVAVQEGTLCLAIVATTEQ--QPVSILGNLAQ 429

Query: 250 QDRMVIYDNEKNAIGWTRANC 188
           Q+  V YD +   + +  A+C
Sbjct: 430 QNIHVGYDLDAGTVTFAGADC 450



>gb:AE016959_1023651 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC096782_1736348
           Oryza sativa chromosome 10 BAC OSJNBa0025B05 genomic
           sequence, complete sequence.>gb:AE017116_1753470 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           70 of 77 of the complete sequence.
          Length = 405

 Score = 32.7 bits (73), Expect = 7.0
 Identities = 16/65 (24%), Positives = 36/65 (55%), Gaps = 6/65 (9%)
 Frame = -1

Query: 364 ISPESYLIISSKGSVCLGVLNGTEAGLH------NYNVIGDVSMQDRMVIYDNEKNAIGW 203
           + P +YL+ S  G+VCL +  G+ A L+        +++G +  ++  V++D ++  + +
Sbjct: 339 VPPANYLLASGNGTVCLTI--GSSASLNLTGELEGASILGSLQQENVHVLFDLKEETLSF 396

Query: 202 TRANC 188
             A+C
Sbjct: 397 KPADC 401



>gb:AF057718_474288 Agrobacterium tumefaciens plasmid pTiC58
           autoinducer synthase (traI) gene, complete cds; mating
           pair formation locus, complete sequence; and unknown
           gene.
          Length = 288

 Score = 32.7 bits (73), Expect = 7.0
 Identities = 20/75 (26%), Positives = 39/75 (52%), Gaps = 4/75 (5%)
 Frame = -1

Query: 415 SFALSFANGWRSRTLFEISPESYL----IISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQ 248
           S+++S + GWR   L+    ++Y+     IS + +  L V++G +  + NY + GD+ + 
Sbjct: 202 SYSVSGSAGWRPTRLYSDGEKTYIQFPRSISGQDAPVLFVVSGGQNRIVNYRMKGDMMIV 261

Query: 247 DRMVIYDNEKNAIGW 203
           D  V      + +GW
Sbjct: 262 DYNVDRAVLVSGVGW 276



>gb:AE007930_231631 Agrobacterium tumefaciens str. C58 plasmid Ti,
           section 8 of 20 of the complete
           sequence.>gb:AE007871_1084220 Agrobacterium tumefaciens
           str. C58 plasmid Ti, complete genome.
          Length = 291

 Score = 32.7 bits (73), Expect = 7.0
 Identities = 20/75 (26%), Positives = 39/75 (52%), Gaps = 4/75 (5%)
 Frame = -1

Query: 415 SFALSFANGWRSRTLFEISPESYL----IISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQ 248
           S+++S + GWR   L+    ++Y+     IS + +  L V++G +  + NY + GD+ + 
Sbjct: 205 SYSVSGSAGWRPTRLYSDGEKTYIQFPRSISGQDAPVLFVVSGGQNRIVNYRMKGDMMIV 264

Query: 247 DRMVIYDNEKNAIGW 203
           D  V      + +GW
Sbjct: 265 DYNVDRAVLVSGVGW 279



>pir|AG3231|AG3231 conjugal transfer protein trbG [imported] -
           Agrobacterium tumefaciens (strain C58, Dupont) plasmid
           Ti>gb:AE009422_251753 Agrobacterium tumefaciens str. C58
           Ti plasmid, section 5 of 21 of the complete
           sequence.>gb:AE008690_1089596 Agrobacterium tumefaciens
           str. C58 Ti plasmid, complete sequence.
          Length = 284

 Score = 32.7 bits (73), Expect = 7.0
 Identities = 20/75 (26%), Positives = 39/75 (52%), Gaps = 4/75 (5%)
 Frame = -1

Query: 415 SFALSFANGWRSRTLFEISPESYL----IISSKGSVCLGVLNGTEAGLHNYNVIGDVSMQ 248
           S+++S + GWR   L+    ++Y+     IS + +  L V++G +  + NY + GD+ + 
Sbjct: 198 SYSVSGSAGWRPTRLYSDGEKTYIQFPRSISGQDAPVLFVVSGGQNRIVNYRMKGDMMIV 257

Query: 247 DRMVIYDNEKNAIGW 203
           D  V      + +GW
Sbjct: 258 DYNVDRAVLVSGVGW 272



>gb:AP004758_1844545 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0664C05.
          Length = 454

 Score = 32.3 bits (72), Expect = 9.2
 Identities = 37/152 (24%), Positives = 56/152 (36%), Gaps = 12/152 (7%)
 Frame = -1

Query: 601 VFDSGSSYSYMNSQPYEAFLYSVVKELRGKPLREAGDDPTLPFCWKGRRPFRSISDVKKY 422
           + DSG+S + +    YEA     V ++ G P   AG    L  C                
Sbjct: 322 IIDSGASITTLPEDVYEAVKAEFVSQV-GLPAAAAGS-AALDLC---------------- 363

Query: 421 FKSFALSFANGWRSRTL------------FEISPESYLIISSKGSVCLGVLNGTEAGLHN 278
              FAL  A  WR   +            +E+   +Y+       V   VL   +A    
Sbjct: 364 ---FALPVAALWRRPAVPALTLHLDGGADWELPRGNYVFEDYAARVLCVVL---DAAAGE 417

Query: 277 YNVIGDVSMQDRMVIYDNEKNAIGWTRANCDR 182
             VIG+   Q+  V+YD E + + +  A CD+
Sbjct: 418 QVVIGNYQQQNTHVVYDLENDVLSFAPARCDK 449



>gb:AF550679_521399 Escherichia coli plasmid p1658/97, complete
           sequence.
          Length = 500

 Score = 32.3 bits (72), Expect = 9.2
 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 5/56 (8%)
 Frame = -1

Query: 427 KYFKSFALSFANG--WRSRTLFE---ISPESYLIISSKGSVCLGVLNGTEAGLHNY 275
           +YF +F L+  NG  W+S  +FE   +SP+SY  +++       +  G     +NY
Sbjct: 171 RYFGTFHLNLENGHVWKSEGVFENIELSPDSYKKMATLSKRMFDIFEGIHDSFYNY 226


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 830,427,555
Number of Sequences: 1806583
Number of extensions: 17850254
Number of successful extensions: 42200
Number of sequences better than 10.0: 98
Number of HSP's better than 10.0 without gapping: 40823
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 42139
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 45051857568
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)