BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10253
         (856 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY072140_1567033 Arabidopsis thaliana unknown protein (At1g55...   244   2e-63   
gb:AC130604_1740815 Oryza sativa (japonica cultivar-group) chrom...   240   3e-62   
gb:AE005173_893469 Arabidopsis thaliana chromosome 1, bottom arm...   220   2e-56   
gb:AE017341_1754339 Cryptococcus neoformans var. neoformans JEC2...   145   7e-34   
pir|S60927|S60927 hypothetical protein YPL063w - yeast (Saccharo...   136   6e-31   Saccharomyces cerevisiae [brewer's yeast]
gb:AE014134_1130087 Drosophila melanogaster chromosome 2L, compl...   134   2e-30   
gb:AY188754_1588360 Neurospora crassa TIM50 (tim50) mRNA, comple...   134   2e-30   
gb:AY751581_1626708 Phytophthora sojae putative nuclear LIM inte...   130   4e-29   
gb:BC010303_2090947 Mus musculus translocase of inner mitochondr...   129   7e-29   
gb:AK008340_1154526 Mus musculus adult male small intestine cDNA...   129   7e-29   
gb:AY751575_1626702 Phytophthora infestans putative nuclear LIM ...   128   2e-28   
gb:CR380954_1651279 Candida glabrata strain CBS138 chromosome H ...   127   2e-28   
pir|T39693|T39693 hypothetical protein SPAC17A3.01c - fission ye...   127   4e-28   Schizosaccharomyces pombe
gb:BC010736_1972777 Homo sapiens translocase of inner mitochondr...   126   5e-28   
gb:BC009072_1971790 Homo sapiens translocase of inner mitochondr...   126   5e-28   
gb:AY551341_1956487 Homo sapiens translocase of inner mitochondr...   126   5e-28   
gb:CR859017_1183157 Pongo pygmaeus mRNA; cDNA DKFZp469H221 (from...   126   5e-28   
gb:AF130109_1150171 Homo sapiens clone FLB5740 PRO1512 mRNA, com...   126   5e-28   
pir|T25076|T25076 hypothetical protein T21C9.12 - Caenorhabditis...   126   6e-28   Caenorhabditis elegans [roundworm]
gb:BC070846_2555815 Xenopus laevis hypothetical protein LOC43182...   125   1e-27   
gb:AP003274_1826988 Oryza sativa (japonica cultivar-group) genom...   125   1e-27   
gb:CR382125_1658257 Kluyveromyces lactis strain NRRL Y-1140 chro...   125   1e-27   
gb:AE014298_1124109 Drosophila melanogaster chromosome X, comple...   125   1e-27   
gb:CR382134_1667634 Debaryomyces hansenii chromosome B of strain...   124   2e-27   
gb:AY551343_2537057 Danio rerio translocase of inner mitochondri...   124   2e-27   
gb:BC067634_2554806 Danio rerio translocase of inner mitochondri...   123   5e-27   
gb:BC025844_2095174 Mus musculus translocase of inner mitochondr...   122   7e-27   
gb:AE014296_1133994 Drosophila melanogaster chromosome 3L, compl...   121   1e-26   
gb:CR382128_1661205 Yarrowia lipolytica chromosome B of strain C...   117   2e-25   
gb:AE016817_1747429 Ashbya gossypii (= Eremothecium gossypii) AT...   105   1e-21   
pir|T13651|T13651 hypothetical protein 95B7.3 - fruit fly (Droso...   105   1e-21   Drosophila melanogaster
gb:AY089295_1296951 Drosophila melanogaster AT08867 full insert ...    97   5e-19   
gb:MMU344340_2120912 Mus musculus mRNA for Mya22 protein.              91   3e-17   
gb:HSA575645_2009274 Homo sapiens mRNA for RB serine phosphatase...    91   3e-17   
gb:AY279532_1941834 Homo sapiens small CTD phosphatase 3 mRNA, c...    91   3e-17   
pir|JC5707|JC5707 HYA22 protein - human                                91   3e-17   Homo sapiens [man]
sp|P58465|NIF1_MOUSE|NIF1_MOUSE Nuclear LIM interactor-interacting factor 1...    91   3e-17   Mus musculus [mouse]
sp|O15194|NIF1_HUMAN|NIF1_HUMAN Nuclear LIM interactor-interacting factor 1...    91   3e-17   Homo sapiens [man]
sp|Q09695|YA22_SCHPO|YA22_SCHPO Hypothetical protein C2F7.02c in chromosome...    90   6e-17   Schizosaccharomyces pombe
gb:AF189776_2479211 Gallus gallus NLI-interacting factor isoform...    89   1e-16   
gb:AF189774_2479209 Gallus gallus NLI-interacting factor isoform...    89   1e-16   
gb:CR382135_1668283 Debaryomyces hansenii chromosome C of strain...    89   1e-16   
sp|Q9PTJ6|NIF1_CHICK|NIF1_CHICK Nuclear LIM interactor-interacting factor 1...    89   1e-16   Gallus gallus [bantam]
gb:CR380950_1649890 Candida glabrata strain CBS138 chromosome D ...    88   2e-16   
gb:AY693081_1623128 Saccharomyces cerevisiae clone FLH113579.01X...    87   3e-16   
pir|S64841|S64841 hypothetical protein YLR019w - yeast (Saccharo...    87   3e-16   Saccharomyces cerevisiae [brewer's yeast]
gb:AY280863_2524408 Xenopus laevis NIF (NIF) mRNA, complete cds.       85   2e-15   
gb:CR382130_1662791 Yarrowia lipolytica chromosome D of strain C...    85   2e-15   
gb:AF111941_1242075 Dictyostelium discoideum AX4 development pro...    85   2e-15   
gb:SPBC8D2_1720517 S.pombe chromosome II cosmid c8D2.                  85   2e-15   
gb:CR382126_1659046 Kluyveromyces lactis strain NRRL Y-1140 chro...    85   2e-15   
gb:AE017349_1758864 Cryptococcus neoformans var. neoformans JEC2...    84   4e-15   
gb:BC076658_2559407 Xenopus tropicalis CTD (carboxy-terminal dom...    83   6e-15   
gb:AF441288_2494513 Xenopus laevis Os4 mRNA, complete cds.>gb:BC...    83   6e-15   
gb:AE016814_1745672 Ashbya gossypii (= Eremothecium gossypii) AT...    83   6e-15   
gb:CR380950_1649794 Candida glabrata strain CBS138 chromosome D ...    83   8e-15   
pir|S64752|S64752 hypothetical protein YLL010c - yeast (Saccharo...    83   8e-15   Saccharomyces cerevisiae [brewer's yeast]
gb:CEB0379_1359765 Caenorhabditis elegans cosmid B0379, complete...    82   1e-14   
gb:CEB0379_1359764 Caenorhabditis elegans cosmid B0379, complete...    82   1e-14   
gb:BT009984_1357350 Drosophila melanogaster RE52350 full insert ...    82   1e-14   
gb:AE014296_1136469 Drosophila melanogaster chromosome 3L, compl...    82   1e-14   
gb:AY279530_1941832 Homo sapiens small CTD phosphatase 1 splice ...    82   2e-14   
gb:AY279529_1941831 Homo sapiens small CTD phosphatase 1 mRNA, c...    82   2e-14   
pir|T48545|T48545 hypothetical protein F14F18.30 - Arabidopsis t...    82   2e-14   Arabidopsis thaliana [mouse-ear cress]
sp|P58466|NIF3_MOUSE|NIF3_MOUSE Carboxy-terminal domain RNA polymerase II p...    82   2e-14   Mus musculus [mouse]
sp|Q9GZU7|NIF3_HUMAN|NIF3_HUMAN Carboxy-terminal domain RNA polymerase II p...    82   2e-14   Homo sapiens [man]
gb:AY341983_1321212 Drosophila miranda CG2713-like protein gene,...    81   2e-14   
gb:AY751569_1626696 Phytophthora infestans putative nuclear LIM ...    81   3e-14   
gb:BC063974_2553675 Danio rerio zgc:77714, mRNA (cDNA clone MGC:...    80   5e-14   
gb:AY751574_1626701 Phytophthora infestans putative nuclear LIM ...    80   6e-14   
gb:AY751572_1626699 Phytophthora infestans putative nuclear LIM ...    79   8e-14   
gb:AY751570_1626697 Phytophthora infestans putative nuclear LIM ...    79   8e-14   
gb:BC085403_2564353 Danio rerio zgc:101656, mRNA (cDNA clone MGC...    79   1e-13   
gb:BC089307_2110764 Mus musculus CTD (carboxy-terminal domain, R...    79   1e-13   
gb:AY751579_1626706 Phytophthora sojae putative nuclear LIM inte...    79   1e-13   
gb:AK049271_1168697 Mus musculus ES cells cDNA, RIKEN full-lengt...    79   1e-13   
gb:CR548612_1375192 Paramecium tetraurelia macronuclear largest ...    78   2e-13   
gb:BC065920_1986957 Homo sapiens cDNA clone MGC:70608 IMAGE:5756...    78   2e-13   
gb:AF022231_1877088 Homo sapiens unknown protein mRNA, complete ...    78   2e-13   
sp|O14595|NIF2_HUMAN|NIF2_HUMAN Carboxy-terminal domain RNA polymerase II p...    78   2e-13   Homo sapiens [man]
gb:AB084264_2463712 Xenopus laevis Dullard mRNA, complete cds.         77   3e-13   
gb:AP003222_1825535 Oryza sativa (japonica cultivar-group) genom...    77   3e-13   
gb:AC092559_1735530 Oryza sativa chromosome 3 BAC OSJNBb0096M04 ...    77   4e-13   
gb:AY751576_1626703 Phytophthora sojae nuclear LIM factor intera...    77   4e-13   
gb:BC082639_2562787 Xenopus laevis cDNA clone MGC:81552 IMAGE:68...    77   5e-13   
gb:AY751571_1626698 Phytophthora infestans putative nuclear LIM ...    77   5e-13   
pir|D86421|D86421 hypothetical protein F1N18.16 - Arabidopsis th...    77   5e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AB012245_1511770 Arabidopsis thaliana genomic DNA, chromosome...    76   7e-13   
gb:AC006780_1204030 Caenorhabditis elegans cosmid Y47D9A, comple...    76   7e-13   
gb:AY751577_1626704 Phytophthora sojae nuclear LIM factor intera...    76   9e-13   
gb:BC083672_2108747 Rattus norvegicus cDNA clone MGC:94517 IMAGE...    75   1e-12   
gb:BC052660_2101187 Mus musculus DNA segment, Chr 2, ERATO Doi 4...    75   1e-12   
gb:AY751578_1626705 Phytophthora sojae nuclear LIM factor intera...    75   1e-12   
gb:AX876636_1476623 Sequence 11541 from Patent EP1074617.>gb:AK0...    75   1e-12   
gb:AX405886_1467814 Sequence 301 from Patent WO0222660.>gb:BC035...    75   1e-12   
gb:CR627421_1180790 Homo sapiens mRNA; cDNA DKFZp781F2227 (from ...    75   1e-12   
gb:AK053513_1170460 Mus musculus 0 day neonate eyeball cDNA, RIK...    75   1e-12   
gb:AK030085_1161818 Mus musculus adult male testis cDNA, RIKEN f...    75   1e-12   
gb:AK028251_1160885 Mus musculus 12 days embryo head cDNA, RIKEN...    75   1e-12   
gb:AF161543_1150436 Homo sapiens HSPC058 mRNA, complete cds.           75   1e-12   
gb:AF161478_1150371 Homo sapiens HSPC129 mRNA, complete cds.           75   1e-12   
gb:BC087638_2110111 Rattus norvegicus cDNA clone IMAGE:7309162, ...    75   2e-12   
gb:BC018265_2092621 Mus musculus Dullard homolog (Xenopus laevis...    75   2e-12   
gb:AL596185_2070985 Mouse DNA sequence from clone RP23-172M21 on...    75   2e-12   
gb:HSA011916_2000069 Homo sapiens mRNA for hypothetical protein.       75   2e-12   
gb:BC009295_1971890 Homo sapiens dullard homolog (Xenopus laevis...    75   2e-12   
gb:AC006780_1204031 Caenorhabditis elegans cosmid Y47D9A, comple...    75   2e-12   
gb:BC080328_2561647 Xenopus tropicalis MGC79498 protein, mRNA (c...    75   2e-12   
gb:BC047962_2549954 Xenopus laevis hypothetical protein MGC52903...    75   2e-12   
gb:BC085649_2564526 Danio rerio zgc:92207, mRNA (cDNA clone MGC:...    74   4e-12   
gb:AY341861_1600806 Hordeum vulgare subsp. vulgare CTD-phosphata...    73   6e-12   
gb:PFMAL7P1_1191977 Plasmodium falciparum 3D7 chromosome 7, *** ...    73   6e-12   
gb:NC20H10_1688480 Neurospora crassa DNA linkage group V Cosmid ...    72   1e-11   
gb:PFA929353_1393061 Plasmodium falciparum strain 3D7, chromosom...    72   1e-11   
pir|C86421|C86421 F1N18.17 protein - Arabidopsis thaliana>gb:AE0...    72   2e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AC135918_1742827 Oryza sativa (japonica cultivar-group) chrom...    71   3e-11   
gb:CNS07EGG_1374112 chromosome X of strain GB-M1 of Encephalitoz...    70   7e-11   
gb:AE013599_1130687 Drosophila melanogaster chromosome 2R, compl...    69   9e-11   
gb:AE016820_1749884 Ashbya gossypii (= Eremothecium gossypii) AT...    68   2e-10   
gb:AY231886_1177179 Drosophila yakuba clone yak-em_CG1696 mRNA s...    68   2e-10   
gb:AE014298_1126688 Drosophila melanogaster chromosome X, comple...    68   2e-10   
gb:BC025650_2095128 Mus musculus CTD (carboxy-terminal domain, R...    66   7e-10   
pir|T16371|T16371 hypothetical protein F45E12.1 - Caenorhabditis...    65   2e-09   Caenorhabditis elegans [roundworm]
gb:AE017344_1756260 Cryptococcus neoformans var. neoformans JEC2...    64   3e-09   
gb:AP004366_1840845 Oryza sativa (japonica cultivar-group) genom...    64   4e-09   
gb:AK117371_1815410 Arabidopsis thaliana At5g46410 mRNA for unkn...    64   5e-09   
gb:AY074261_1567423 Arabidopsis thaliana unknown protein (At5g46...    64   5e-09   
pir|T49208|T49208 hypothetical protein F27K19.140 - Arabidopsis ...    61   3e-08   Arabidopsis thaliana [mouse-ear cress]
pir|T18721|T18721 hypothetical protein B0379.4 - Caenorhabditis ...    61   3e-08   Caenorhabditis elegans [roundworm]
pir|T40330|T40330 hypothetical protein SPBC3B8.10c - fission yea...    60   7e-08   Schizosaccharomyces pombe
gb:CNS07EGG_1374043 chromosome X of strain GB-M1 of Encephalitoz...    59   1e-07   
gb:AE014296_1134522 Drosophila melanogaster chromosome 3L, compl...    59   1e-07   
gb:AY751580_1626707 Phytophthora sojae putative nuclear LIM inte...    58   3e-07   
gb:CR382129_1661429 Yarrowia lipolytica chromosome C of strain C...    57   6e-07   
gb:CR382125_1658055 Kluyveromyces lactis strain NRRL Y-1140 chro...    57   6e-07   
gb:AY751573_1626700 Phytophthora infestans putative nuclear LIM ...    57   6e-07   
gb:AP003256_1826473 Oryza sativa (japonica cultivar-group) genom...    56   8e-07   
gb:CR380957_1652640 Candida glabrata strain CBS138 chromosome K ...    55   2e-06   
sp|P38757|YHG4_YEAST|YHG4_YEAST Hypothetical 50.6 kDa protein in RPL14B-GPA...    55   2e-06   Saccharomyces cerevisiae [brewer's yeast]
gb:CR382134_1667075 Debaryomyces hansenii chromosome B of strain...    49   9e-05   
gb:AY118321_1300043 Drosophila melanogaster LD08201 full insert ...    46   8e-04   
gb:AC108503_1738533 Oryza sativa (japonica cultivar-group) chrom...    45   0.002   
gb:AB010698_1511232 Arabidopsis thaliana genomic DNA, chromosome...    42   0.015   
pir|T14814|T14814 hypothetical protein F15J5.110 - Arabidopsis t...    42   0.015   Arabidopsis thaliana [mouse-ear cress]
gb:AC125735_1208147 Leishmania major strain Friedlin chromosome ...    39   0.13    
gb:AE017349_1758926 Cryptococcus neoformans var. neoformans JEC2...    36   0.82    
gb:PFMAL7P1_1191988 Plasmodium falciparum 3D7 chromosome 7, *** ...    35   1.8     
gb:AF486633_1804176 Arabidopsis thaliana CTD phosphatase-like 3 ...    34   3.1     
gb:GGBBMI_2572940 Chicken mRNA for brush border myosin I (BBMI),...    34   4.1     
pir|A33620|A33620 myosin heavy chain I, brush border - chicken (...    34   4.1     Gallus gallus [bantam]
sp|P47807|MY1A_CHICK|MY1A_CHICK Myosin Ia (Brush border myosin I) (BBM-I) (...    34   4.1     Gallus gallus [bantam]
gb:AY380826_2339230 Lymphocystis disease virus - isolate China, ...    33   5.3     
gb:PFMAL13_1191605 Plasmodium falciparum 3D7 chromosome 13, *** ...    33   5.3     
gb:BX908798_830602 Parachlamydia-related symbiont UWE25, complet...    33   5.3     
gb:BC082811_2108465 Mus musculus cDNA clone IMAGE:5694507, parti...    33   6.9     
gb:BC030845_2096875 Mus musculus trinucleotide repeat containing...    33   6.9     
gb:BC027137_2095776 Mus musculus trinucleotide repeat containing...    33   6.9     
gb:AY176043_2078129 Mus musculus Grb10 interacting GYF protein 2...    33   6.9     
gb:AK122337_2069002 Mus musculus mRNA for mKIAA0642 protein.           33   6.9     
gb:AY850394_1630828 Lycopersicon esculentum cultivar Heinz1706 c...    33   6.9     
gb:AC117072_1207654 Dictyostelium discoideum chromosome 2 map 38...    33   9.0     
pir|G84746|G84746 hypothetical protein At2g33540 [imported] - Ar...    33   9.0     Arabidopsis thaliana [mouse-ear cress]


>gb:AY072140_1567033 Arabidopsis thaliana unknown protein
           (At1g55900) mRNA, complete cds.>gb:AY122975_1579853
           Arabidopsis thaliana unknown protein (At1g55900) mRNA,
           complete cds.
          Length = 376

 Score =  244 bits (622), Expect = 2e-63
 Identities = 114/169 (67%), Positives = 141/169 (83%)
 Frame = -1

Query: 856 RDRGWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATK 677
           R+RGWRTFKRPGVDAFLEHL +F+EIVVYSDQ  MYV PV E+LDP   IRY+L+RGATK
Sbjct: 208 RERGWRTFKRPGVDAFLEHLGKFYEIVVYSDQMEMYVLPVCEKLDPNGYIRYKLARGATK 267

Query: 676 YLNGKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           Y NGKHYRDLS LNRDP K++++S +A ES+LQPEN + IKP+  E++DTAL+DLIPFLE
Sbjct: 268 YENGKHYRDLSKLNRDPKKILFVSANAFESTLQPENSVPIKPYKLEADDTALVDLIPFLE 327

Query: 496 YVGKHRPGDIRAVLSSYEGRDVSKEFIERSKEHQRRMQEQKQQGRIWRR 350
           YV ++ P DIR VL+S+E +D++KEFI+RS E+Q+R Q Q  QGR WRR
Sbjct: 328 YVARNSPADIRPVLASFERKDIAKEFIDRSIEYQKRKQGQLGQGRFWRR 376



>gb:AC130604_1740815 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone B1155G07, complete sequence.
          Length = 407

 Score =  240 bits (612), Expect = 3e-62
 Identities = 114/154 (74%), Positives = 132/154 (85%)
 Frame = -1

Query: 856 RDRGWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATK 677
           R+RGWRTFKRPGVDAF+EH+ +F+E+VVYSDQ  MYVDPV+ERLD K  I  RLSR ATK
Sbjct: 198 RERGWRTFKRPGVDAFIEHMGKFYEVVVYSDQMPMYVDPVLERLDTKGFITGRLSRPATK 257

Query: 676 YLNGKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           Y +GKHYRDLS LNR+P++VIYIS HALES LQPENC++IKPW  E++DT LLDLIPFLE
Sbjct: 258 YQDGKHYRDLSKLNRNPAQVIYISSHALESCLQPENCVQIKPWKLETDDTQLLDLIPFLE 317

Query: 496 YVGKHRPGDIRAVLSSYEGRDVSKEFIERSKEHQ 395
           YV   RP DIR VL+SY+GRDV+ EFIERSKEHQ
Sbjct: 318 YVAMVRPSDIRTVLASYQGRDVAAEFIERSKEHQ 351



>gb:AE005173_893469 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC002304_1530193 Genomic sequence
           for Arabidopsis thaliana BAC F14J16 from chromosome I,
           complete sequence.
          Length = 414

 Score =  220 bits (561), Expect = 2e-56
 Identities = 105/160 (65%), Positives = 132/160 (82%), Gaps = 5/160 (3%)
 Frame = -1

Query: 856 RDRGWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSM-----YVDPVVERLDPKNCIRYRLS 692
           R+RGWRTFKRPGVDAFLEHL +F+EIVVYSDQ  M     YV PV E+LDP   IRY+L+
Sbjct: 208 RERGWRTFKRPGVDAFLEHLGKFYEIVVYSDQMEMVKSQLYVLPVCEKLDPNGYIRYKLA 267

Query: 691 RGATKYLNGKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDL 512
           RGATKY NGKHYRDLS LNRDP K++++S +A ES+LQPEN + IKP+  E++DTAL+DL
Sbjct: 268 RGATKYENGKHYRDLSKLNRDPKKILFVSANAFESTLQPENSVPIKPYKLEADDTALVDL 327

Query: 511 IPFLEYVGKHRPGDIRAVLSSYEGRDVSKEFIERSKEHQR 392
           IPFLEYV ++ P DIR VL+S+E +D++KEFI+RS E+Q+
Sbjct: 328 IPFLEYVARNSPADIRPVLASFERKDIAKEFIDRSIEYQK 367



>gb:AE017341_1754339 Cryptococcus neoformans var. neoformans JEC21
           chromosome 1, complete sequence.
          Length = 516

 Score =  145 bits (367), Expect = 7e-34
 Identities = 70/161 (43%), Positives = 103/161 (63%), Gaps = 1/161 (0%)
 Frame = -1

Query: 856 RDRGWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIR-YRLSRGAT 680
           R  GWRT KRPGVD FL +L+QF+EIV++S Q      P+ E++DP      YRL R +T
Sbjct: 253 RTHGWRTAKRPGVDYFLGYLSQFYEIVLFSSQPLYTAAPIAEKIDPYQAFMPYRLFREST 312

Query: 679 KYLNGKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFL 500
           + + GK  +D+S LNRDPSKVI +  +    +LQPEN + ++PW G   D  L+D+IPFL
Sbjct: 313 RSVKGKVVKDISFLNRDPSKVIVLDVNPEHVALQPENGIVLQPWNGSPGDKGLVDMIPFL 372

Query: 499 EYVGKHRPGDIRAVLSSYEGRDVSKEFIERSKEHQRRMQEQ 377
           E +G   P D+R +L +Y G+D+  E+ ++  E + +  E+
Sbjct: 373 ESIGIFNPADVRPILQAYAGKDIPIEYAKKEAEAKAKAIEE 413



>pir|S60927|S60927 hypothetical protein YPL063w - yeast
           (Saccharomyces cerevisiae)>gb:SCU39205_1710242
           Saccharomyces cerevisiae chromosome XVI, left arm,
           cosmid 8460.
          Length = 476

 Score =  136 bits (342), Expect = 6e-31
 Identities = 73/175 (41%), Positives = 107/175 (61%), Gaps = 2/175 (1%)
 Frame = -1

Query: 847 GWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNC-IRYRLSRGATKYL 671
           GWRT KRPG D FL +L+Q++EIV++S    MY D + E+LDP +  + Y L +    Y 
Sbjct: 212 GWRTAKRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYK 271

Query: 670 NGKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYV 491
           +G H +DLS LNRD SKVI I        LQPEN + ++PW GE++D  L+ LIPFLEY+
Sbjct: 272 DGVHIKDLSKLNRDLSKVIIIDTDPNSYKLQPENAIPMEPWNGEADD-KLVRLIPFLEYL 330

Query: 490 GKHRPGDIRAVLSSYEG-RDVSKEFIERSKEHQRRMQEQKQQGRIWRR*IQGLAN 329
              +  D+R +L+S+E  +++++EF  R K+ + +     + G  W     GL N
Sbjct: 331 ATQQTKDVRPILNSFEDKKNLAEEFDHRVKKLKDKFYGDHKSGGNWAMTALGLGN 385



>gb:AE014134_1130087 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003782_1224459 Drosophila melanogaster
           chromosome 2L, section 81 of 83 of the complete
           sequence.
          Length = 343

 Score =  134 bits (338), Expect = 2e-30
 Identities = 67/160 (41%), Positives = 100/160 (62%)
 Frame = -1

Query: 847 GWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLN 668
           GWR  KRPGVD FL+  ++ FEIV+Y+ +Q M   P+++ LDP   I+YRL RGAT  + 
Sbjct: 160 GWRFKKRPGVDYFLQQCSRNFEIVIYTSEQGMTAFPLLDALDPYGYIKYRLVRGATDLVE 219

Query: 667 GKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVG 488
           G+H ++L  LNRD S+VI +      + L P+N L +  W G  +D  L DL  FL+ + 
Sbjct: 220 GQHTKNLDYLNRDLSRVIVVDCDPYTTPLHPDNSLVLTKWLGNDDDVQLFDLTAFLQLIA 279

Query: 487 KHRPGDIRAVLSSYEGRDVSKEFIERSKEHQRRMQEQKQQ 368
           +H+  D+R VL  Y      ++ +E+ K++QRR+QEQ Q+
Sbjct: 280 EHQVNDVREVLRYYR---QFEDPMEQFKDNQRRLQEQSQE 316



>gb:AY188754_1588360 Neurospora crassa TIM50 (tim50) mRNA, complete
           cds; nuclear gene for mitochondrial product.
          Length = 540

 Score =  134 bits (337), Expect = 2e-30
 Identities = 66/149 (44%), Positives = 93/149 (62%)
 Frame = -1

Query: 856 RDRGWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATK 677
           RD GWR  KRPGVD FL +L+Q++EIV+++       +P+V ++DP   I + L R ATK
Sbjct: 266 RDHGWRLAKRPGVDYFLRYLSQYYEIVLFTSVPFANAEPIVRKMDPYRFIMWPLFREATK 325

Query: 676 YLNGKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           Y +G+  +DLS LNRD SKVI I         QPEN + +  W G+ +DT L+ L+PFLE
Sbjct: 326 YKDGEIVKDLSYLNRDLSKVIIIDTDPKHVRAQPENAIVLPKWKGDPKDTELVSLVPFLE 385

Query: 496 YVGKHRPGDIRAVLSSYEGRDVSKEFIER 410
           ++      D+R VL S+EG+ +  EF  R
Sbjct: 386 FIHTMNFPDVRKVLKSFEGQHIPTEFARR 414



>gb:AY751581_1626708 Phytophthora sojae putative nuclear LIM
           interactor-interacting protein (NIF6) gene, complete
           cds.
          Length = 379

 Score =  130 bits (326), Expect = 4e-29
 Identities = 69/171 (40%), Positives = 104/171 (60%), Gaps = 7/171 (4%)
 Frame = -1

Query: 856 RDRGWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATK 677
           R  GWR  KRPGVD FLE L Q++EIV++S  Q+   + +V++LDPK C  + LSR AT+
Sbjct: 182 RKHGWRHAKRPGVDEFLETLCQYYEIVIFS--QNYGAEEIVQKLDPKQCALHVLSRDATR 239

Query: 676 YLNGKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTG--ESEDTALLDLIPF 503
           YLNG H +DLS LNRD  +V+ +        LQPEN + +KP+T   + +D  L DLIPF
Sbjct: 240 YLNGAHVKDLSNLNRDLRQVVILDDDPAAYQLQPENAIPVKPFTNGRDRDDHELKDLIPF 299

Query: 502 LEYVGKHRPGDIRAVLSSYEG-----RDVSKEFIERSKEHQRRMQEQKQQG 365
           L+ +   R  D R V+  +       RD++ ++  R  + +   +++K++G
Sbjct: 300 LKALASERVPDFRQVIGEFRDDDGVVRDLATKYGARVHQLEMEKEQKKKKG 350



>gb:BC010303_2090947 Mus musculus translocase of inner mitochondrial
           membrane 50 homolog (yeast), mRNA (cDNA clone MGC:11857
           IMAGE:3597676), complete cds.>gb:BC037056_2097961 Mus
           musculus RIKEN cDNA 2810403L02 gene, mRNA (cDNA clone
           MGC:47068 IMAGE:4948744), complete cds.
          Length = 229

 Score =  129 bits (324), Expect = 7e-29
 Identities = 61/160 (38%), Positives = 98/160 (61%)
 Frame = -1

Query: 847 GWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLN 668
           GWR  KRPG++   + LA  +EIV+++ +  M   P+++ +DP   I YRL R AT+Y+ 
Sbjct: 44  GWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYME 103

Query: 667 GKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVG 488
           G H +D+S LNRDP++V+ +        LQP N + ++PW G S+D  LLDL  FL+ + 
Sbjct: 104 GHHVKDISCLNRDPARVVVVDCKKEAFRLQPFNGVALRPWDGNSDDRVLLDLSAFLKTIA 163

Query: 487 KHRPGDIRAVLSSYEGRDVSKEFIERSKEHQRRMQEQKQQ 368
            ++  D+R VL  Y   D   + +E  K+ Q R+++++QQ
Sbjct: 164 LNQVEDVRTVLEHYALED---DPLEAFKQRQSRLEQEEQQ 200



>gb:AK008340_1154526 Mus musculus adult male small intestine cDNA,
           RIKEN full-length enriched library, clone:2010107H04
           product:hypothetical NLI interacting factor containing
           protein, full insert sequence.>gb:AY551342_2086488 Mus
           musculus translocase of inner mitochondrial membrane
           50-like protein mRNA, complete cds; nuclear gene for
           mitochondrial product.
          Length = 353

 Score =  129 bits (324), Expect = 7e-29
 Identities = 61/160 (38%), Positives = 98/160 (61%)
 Frame = -1

Query: 847 GWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLN 668
           GWR  KRPG++   + LA  +EIV+++ +  M   P+++ +DP   I YRL R AT+Y+ 
Sbjct: 168 GWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYME 227

Query: 667 GKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVG 488
           G H +D+S LNRDP++V+ +        LQP N + ++PW G S+D  LLDL  FL+ + 
Sbjct: 228 GHHVKDISCLNRDPARVVVVDCKKEAFRLQPFNGVALRPWDGNSDDRVLLDLSAFLKTIA 287

Query: 487 KHRPGDIRAVLSSYEGRDVSKEFIERSKEHQRRMQEQKQQ 368
            ++  D+R VL  Y   D   + +E  K+ Q R+++++QQ
Sbjct: 288 LNQVEDVRTVLEHYALED---DPLEAFKQRQSRLEQEEQQ 324



>gb:AY751575_1626702 Phytophthora infestans putative nuclear LIM
           factor interactor-interacting protein hyphal form
           (NIFH3) mRNA, complete cds.
          Length = 409

 Score =  128 bits (321), Expect = 2e-28
 Identities = 69/168 (41%), Positives = 103/168 (61%), Gaps = 5/168 (2%)
 Frame = -1

Query: 856 RDRGWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATK 677
           R  GWR  KRPGVD FLE L Q++EIV++S  Q+   + +V++LDPK C  + LSR AT+
Sbjct: 186 RKHGWRHAKRPGVDEFLETLCQYYEIVIFS--QNYGAEEIVQKLDPKQCALHILSRDATR 243

Query: 676 YLNGKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTG--ESEDTALLDLIPF 503
           YLNG H +DLS LNRD  +V+ +        LQPEN + + P+T   + +D  L DLIPF
Sbjct: 244 YLNGAHVKDLSNLNRDLRQVVILDDDPAAYQLQPENAIPVTPFTNGRDRDDHELKDLIPF 303

Query: 502 LEYVGKHRPGDIRAVLSSYEGRD-VSKEFIER--SKEHQRRMQEQKQQ 368
           L+ +   R  D R V+  +   D V ++   +  ++ HQ  MQ+++++
Sbjct: 304 LKALASERVPDFRQVIGEFRDEDGVVRDLATKYGARVHQLEMQKEQKK 351



>gb:CR380954_1651279 Candida glabrata strain CBS138 chromosome H
           complete sequence.
          Length = 485

 Score =  127 bits (320), Expect = 2e-28
 Identities = 70/176 (39%), Positives = 106/176 (60%), Gaps = 4/176 (2%)
 Frame = -1

Query: 847 GWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNC-IRYRLSRGATKYL 671
           GWRT KRPG D FL +L+Q++EIV++S    MY + + E++DP +  I Y L +    Y 
Sbjct: 218 GWRTAKRPGADYFLGYLSQYYEIVLFSSNYMMYAEKIAEKMDPIHAFISYNLFKEHCVYK 277

Query: 670 NGKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYV 491
           +G H +DLS LNRD  KV+ I        LQPEN + + PW G+++D  LL LIPFLEY+
Sbjct: 278 DGVHIKDLSKLNRDLKKVMIIDTDENSYKLQPENAIPMDPWDGKADD-KLLRLIPFLEYM 336

Query: 490 GKHRPGDIRAVLSSYEG-RDVSKEFIERSKEHQRRMQ--EQKQQGRIWRR*IQGLA 332
              +  D+R +L SY   R++  EF +R ++ + + +  ++K+    W   + GLA
Sbjct: 337 ATQQVEDVRPILKSYHNKRELPAEFEQRVQKLKNKFEQDQKKKNDSNWLLKLLGLA 392



>pir|T39693|T39693 hypothetical protein SPAC17A3.01c - fission yeast
            (Schizosaccharomyces pombe)>gb:AB004537_1509122
           Schizosaccharomyces pombe 37 kb genomic DNA, clone
           c213.>gb:SPBC17A3_1719299 S.pombe chromosome II cosmid
           c17A3.
          Length = 452

 Score =  127 bits (318), Expect = 4e-28
 Identities = 64/169 (37%), Positives = 106/169 (62%), Gaps = 5/169 (2%)
 Frame = -1

Query: 856 RDRGWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNC-IRYRLSRGAT 680
           R  GWRT KRPG+D FL +L+ ++E+V+++ Q      P+++++DP +  I   L+R ++
Sbjct: 194 RQHGWRTAKRPGLDYFLGYLSMYYEVVIFTRQYLATAKPIIDKIDPYHVSISAVLTRESS 253

Query: 679 KYLNGKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFL 500
           KY  GK  +DLS LNRD S+VI I  +    S QP+N + + PWTG  +D  L+ LIP L
Sbjct: 254 KYEKGKVIKDLSYLNRDLSRVIMIDTNPESWSKQPDNAIAMAPWTGNPKDKELVGLIPLL 313

Query: 499 EYVGKHRPGDIRAVLSSYEGRDVSKEFIERSKEHQRRM----QEQKQQG 365
           E++      D+R VL SY+G+++  E+  R ++ + ++     E+K++G
Sbjct: 314 EFIAIMDIKDVRPVLKSYQGKNIPLEYARREEKLRTKLIEDWNEKKKKG 362



>gb:BC010736_1972777 Homo sapiens translocase of inner mitochondrial
           membrane 50 homolog (yeast), mRNA (cDNA clone
           IMAGE:3900630), partial cds.
          Length = 351

 Score =  126 bits (317), Expect = 5e-28
 Identities = 60/160 (37%), Positives = 97/160 (60%)
 Frame = -1

Query: 847 GWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLN 668
           GWR  KRPG++   + LA  +EIV+++ +  M   P+++ +DP   I YRL R AT+Y++
Sbjct: 166 GWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMD 225

Query: 667 GKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVG 488
           G H +D+S LNRDP++V+ +        LQP N + ++PW G S+D  LLDL  FL+ + 
Sbjct: 226 GHHVKDISCLNRDPARVVVVDCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLSAFLKTIA 285

Query: 487 KHRPGDIRAVLSSYEGRDVSKEFIERSKEHQRRMQEQKQQ 368
            +   D+R VL  Y   D   + +   K+ Q R+++++QQ
Sbjct: 286 LNGVEDVRTVLEHYALED---DPLAAFKQRQSRLEQEEQQ 322



>gb:BC009072_1971790 Homo sapiens translocase of inner mitochondrial
           membrane 50 homolog (yeast), mRNA (cDNA clone
           IMAGE:3868486), partial cds.
          Length = 344

 Score =  126 bits (317), Expect = 5e-28
 Identities = 60/160 (37%), Positives = 97/160 (60%)
 Frame = -1

Query: 847 GWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLN 668
           GWR  KRPG++   + LA  +EIV+++ +  M   P+++ +DP   I YRL R AT+Y++
Sbjct: 159 GWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMD 218

Query: 667 GKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVG 488
           G H +D+S LNRDP++V+ +        LQP N + ++PW G S+D  LLDL  FL+ + 
Sbjct: 219 GHHVKDISCLNRDPARVVVVDCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLSAFLKTIA 278

Query: 487 KHRPGDIRAVLSSYEGRDVSKEFIERSKEHQRRMQEQKQQ 368
            +   D+R VL  Y   D   + +   K+ Q R+++++QQ
Sbjct: 279 LNGVEDVRTVLEHYALED---DPLAAFKQRQSRLEQEEQQ 315



>gb:AY551341_1956487 Homo sapiens translocase of inner mitochondrial
           membrane 50-like protein mRNA, complete cds; nuclear
           gene for mitochondrial product.
          Length = 353

 Score =  126 bits (317), Expect = 5e-28
 Identities = 60/160 (37%), Positives = 97/160 (60%)
 Frame = -1

Query: 847 GWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLN 668
           GWR  KRPG++   + LA  +EIV+++ +  M   P+++ +DP   I YRL R AT+Y++
Sbjct: 168 GWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMD 227

Query: 667 GKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVG 488
           G H +D+S LNRDP++V+ +        LQP N + ++PW G S+D  LLDL  FL+ + 
Sbjct: 228 GHHVKDISCLNRDPARVVVVDCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLSAFLKTIA 287

Query: 487 KHRPGDIRAVLSSYEGRDVSKEFIERSKEHQRRMQEQKQQ 368
            +   D+R VL  Y   D   + +   K+ Q R+++++QQ
Sbjct: 288 LNGVEDVRTVLEHYALED---DPLAAFKQRQSRLEQEEQQ 324



>gb:CR859017_1183157 Pongo pygmaeus mRNA; cDNA DKFZp469H221 (from
           clone DKFZp469H221).
          Length = 353

 Score =  126 bits (317), Expect = 5e-28
 Identities = 60/160 (37%), Positives = 97/160 (60%)
 Frame = -1

Query: 847 GWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLN 668
           GWR  KRPG++   + LA  +EIV+++ +  M   P+++ +DP   I YRL R AT+Y++
Sbjct: 168 GWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMD 227

Query: 667 GKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVG 488
           G H +D+S LNRDP++V+ +        LQP N + ++PW G S+D  LLDL  FL+ + 
Sbjct: 228 GHHVKDISCLNRDPARVVVVDCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLSAFLKTIA 287

Query: 487 KHRPGDIRAVLSSYEGRDVSKEFIERSKEHQRRMQEQKQQ 368
            +   D+R VL  Y   D   + +   K+ Q R+++++QQ
Sbjct: 288 LNGVEDVRTVLEHYALED---DPLAAFKQRQSRLEQEEQQ 324



>gb:AF130109_1150171 Homo sapiens clone FLB5740 PRO1512 mRNA,
           complete cds.
          Length = 298

 Score =  126 bits (317), Expect = 5e-28
 Identities = 60/160 (37%), Positives = 97/160 (60%)
 Frame = -1

Query: 847 GWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLN 668
           GWR  KRPG++   + LA  +EIV+++ +  M   P+++ +DP   I YRL R AT+Y++
Sbjct: 113 GWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMD 172

Query: 667 GKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVG 488
           G H +D+S LNRDP++V+ +        LQP N + ++PW G S+D  LLDL  FL+ + 
Sbjct: 173 GHHVKDISCLNRDPARVVVVDCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLSAFLKTIA 232

Query: 487 KHRPGDIRAVLSSYEGRDVSKEFIERSKEHQRRMQEQKQQ 368
            +   D+R VL  Y   D   + +   K+ Q R+++++QQ
Sbjct: 233 LNGVEDVRTVLEHYALED---DPLAAFKQRQSRLEQEEQQ 269



>pir|T25076|T25076 hypothetical protein T21C9.12 - Caenorhabditis
           elegans>gb:CET21C9_1367942 Caenorhabditis elegans cosmid
           T21C9, complete sequence.
          Length = 452

 Score =  126 bits (316), Expect = 6e-28
 Identities = 69/162 (42%), Positives = 96/162 (59%), Gaps = 2/162 (1%)
 Frame = -1

Query: 847 GWRTFKRPGVDAFLEHLAQ-FFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYL 671
           G+R  KRP +D FL+ +    FE+V+YS +  M   PVV+  DPK  I Y+L R  TKY+
Sbjct: 268 GYRFLKRPALDYFLDVIGYPNFEVVIYSSESMMTAAPVVDSFDPKQRIMYKLFRDCTKYM 327

Query: 670 NGKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYV 491
           NG H +DLS LNRD SKVIYI   A    L PEN L +  W G  +DT+L+DL   L+ +
Sbjct: 328 NGHHVKDLSKLNRDLSKVIYIDFDAKSGQLNPENMLRVPEWKGNMDDTSLVDLAELLKTI 387

Query: 490 GKHRPGDIRAVLSSY-EGRDVSKEFIERSKEHQRRMQEQKQQ 368
                 D+R +L  Y +  D +KEF  R+    ++ +++KQQ
Sbjct: 388 HLSDAEDVRPMLQYYSQYDDPAKEFRRRAVYLSQQEEQKKQQ 429



>gb:BC070846_2555815 Xenopus laevis hypothetical protein LOC431826,
           mRNA (cDNA clone IMAGE:6639541), partial cds.
          Length = 354

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/160 (37%), Positives = 96/160 (60%)
 Frame = -1

Query: 847 GWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLN 668
           GWR  KR G+D   + L+  +EIV+++ +  +   P+++ +DP+  + YRL R AT+Y +
Sbjct: 168 GWRFKKRAGIDNLFQQLSPLYEIVIFTSETGLTAFPLIDSVDPQGFVSYRLFRDATRYTD 227

Query: 667 GKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVG 488
           G H +D+S LNRDPS V+ +        LQP N L IK W G SED AL DL  FL+ + 
Sbjct: 228 GHHVKDISCLNRDPSHVVIVDCKREAFKLQPYNGLAIKKWDGNSEDRALYDLAAFLKTIA 287

Query: 487 KHRPGDIRAVLSSYEGRDVSKEFIERSKEHQRRMQEQKQQ 368
            +   D+R VL +Y    + ++ +E  K  Q ++++++QQ
Sbjct: 288 MNGISDVRTVLENY---SLEEDALEAFKRRQTQLEQEEQQ 324



>gb:AP003274_1826988 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0512C01.
          Length = 262

 Score =  125 bits (313), Expect = 1e-27
 Identities = 56/68 (82%), Positives = 63/68 (92%)
 Frame = -1

Query: 856 RDRGWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATK 677
           R+RGWRTFKRPGVDAFLEHL +F+EIVVYSDQ SMYVDPV+ERLDPK C+++RLSR ATK
Sbjct: 193 RERGWRTFKRPGVDAFLEHLGKFYEIVVYSDQLSMYVDPVIERLDPKGCVQHRLSRVATK 252

Query: 676 YLNGKHYR 653
           Y NGKHYR
Sbjct: 253 YENGKHYR 260



>gb:CR382125_1658257 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 480

 Score =  125 bits (313), Expect = 1e-27
 Identities = 64/161 (39%), Positives = 101/161 (62%), Gaps = 2/161 (1%)
 Frame = -1

Query: 847 GWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNC-IRYRLSRGATKYL 671
           GWRT KRPGVD FL +L+Q++EIV++S    MY + + E+LDP +  I Y L +    Y 
Sbjct: 215 GWRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLDPIHAFITYNLFKEHCLYK 274

Query: 670 NGKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYV 491
           +G H +DLS LNRD  KV+ I        LQPEN + ++PW G+++D  LL LIPFLEY+
Sbjct: 275 DGVHIKDLSKLNRDLGKVLIIDTDENSFKLQPENAIYLEPWDGKADD-RLLRLIPFLEYL 333

Query: 490 GKHRPGDIRAVLSSY-EGRDVSKEFIERSKEHQRRMQEQKQ 371
              +  D+R +L S+ + +++ + F +R +  + + +  ++
Sbjct: 334 ATQQVSDVRPILKSFPDNKNIPEAFEKRVQVLKEKFERDER 374



>gb:AE014298_1124109 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003425_1209291 Drosophila melanogaster
           chromosome X, section 9 of 74 of the complete
           sequence.>gb:AY070535_1294680 Drosophila melanogaster
           LD05179 full length cDNA.
          Length = 428

 Score =  125 bits (313), Expect = 1e-27
 Identities = 66/157 (42%), Positives = 95/157 (60%)
 Frame = -1

Query: 847 GWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLN 668
           GWR  KRPGVD FL   A+ FEIVV++ +Q M V P+++ LDP   I YRL R AT +++
Sbjct: 249 GWRFKKRPGVDHFLAECAKDFEIVVFTAEQGMTVFPILDALDPNGYIMYRLVRDATHFVD 308

Query: 667 GKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVG 488
           G H ++L  LNRD  KVI +   A  + + P+N   +  W G  +D  LLDLI FL+ + 
Sbjct: 309 GHHVKNLDNLNRDLKKVIVVDWDANATKMHPDNTFGLARWHGNDDDGQLLDLIAFLKIIA 368

Query: 487 KHRPGDIRAVLSSYEGRDVSKEFIERSKEHQRRMQEQ 377
           ++   D+R VL  Y   D   + I + +E+QR++ EQ
Sbjct: 369 QNNVDDVREVLHYYRQFD---DPINQFRENQRKLAEQ 402



>gb:CR382134_1667634 Debaryomyces hansenii chromosome B of strain
           CBS767 of Debaryomyces hansenii.
          Length = 471

 Score =  124 bits (312), Expect = 2e-27
 Identities = 66/159 (41%), Positives = 102/159 (64%), Gaps = 2/159 (1%)
 Frame = -1

Query: 847 GWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNC-IRYRLSRGATKYL 671
           GWRT KRPG+D FL +L+Q++EIV++     MY +  V +LDP +  + Y L R A +Y 
Sbjct: 210 GWRTGKRPGLDYFLGYLSQYYEIVIFGSNYQMYSENTVGKLDPFHAYVSYALFREACRYK 269

Query: 670 NGKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYV 491
           +GK  +DLS+LNRD  K + I       S+QP+N + +KPW G  +DT L+ LIPFLEY+
Sbjct: 270 DGKLVKDLSLLNRDLGKTVLIDVEEDSWSMQPDNAIPMKPWDGSYDDT-LVKLIPFLEYL 328

Query: 490 GKHRPGDIRAVLSSYEGR-DVSKEFIERSKEHQRRMQEQ 377
                 D+R +L+S++ + ++ +EF ER    + +++EQ
Sbjct: 329 ATQPVKDVRPILNSFKDKSNIVQEFAER----EAKLREQ 363



>gb:AY551343_2537057 Danio rerio translocase of inner mitochondrial
           membrane 50-like protein mRNA, complete cds; nuclear
           gene for mitochondrial product.>gb:BC057522_2552149
           Danio rerio translocase of inner mitochondrial membrane
           50 homolog (yeast), mRNA (cDNA clone MGC:66357
           IMAGE:5604737), complete cds.
          Length = 387

 Score =  124 bits (311), Expect = 2e-27
 Identities = 67/182 (36%), Positives = 98/182 (53%), Gaps = 16/182 (8%)
 Frame = -1

Query: 847 GWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLN 668
           GWR  KRPG+D   + LA  +EIV+++ +  M   P+++ +DP+  + YRL R AT+Y+ 
Sbjct: 203 GWRFKKRPGIDYLFQQLAPLYEIVIFTSETGMTAYPLIDSIDPQGFVMYRLFRDATRYME 262

Query: 667 GKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVG 488
           G H +D+S LNRD SKVI +        LQP N L +  W G SED  L DL  FL+ + 
Sbjct: 263 GHHVKDVSCLNRDTSKVIVVDCKREAFGLQPFNGLALCKWDGNSEDRTLYDLAAFLKTIA 322

Query: 487 KHRPGDIRAVLSSYEGRDVSKEFIER-----SKEHQRRMQEQKQQ-----------GRIW 356
                D+R+VL +Y   +   E  +R     ++E ++R+ E  QQ           GR W
Sbjct: 323 TSGVEDVRSVLENYAHEEDPIEAFKRRQAQLAREEEQRISEMAQQKKQGFSLGTIAGRFW 382

Query: 355 RR 350
            R
Sbjct: 383 SR 384



>gb:BC067634_2554806 Danio rerio translocase of inner mitochondrial
           membrane 50 homolog (yeast), mRNA (cDNA clone
           IMAGE:6961389), partial cds.
          Length = 382

 Score =  123 bits (308), Expect = 5e-27
 Identities = 67/182 (36%), Positives = 98/182 (53%), Gaps = 16/182 (8%)
 Frame = -1

Query: 847 GWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLN 668
           GWR  KRPG+D   + LA  +EIV+++ +  M   P+++ +DP+  + YRL R AT+Y+ 
Sbjct: 198 GWRFKKRPGIDYLFQQLAPLYEIVIFTSETGMTAYPLIDSIDPQGFVMYRLFRDATRYME 257

Query: 667 GKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVG 488
           G H +D+S LNRD SKVI +        LQP N L +  W G SED  L DL  FL+ + 
Sbjct: 258 GHHVKDVSCLNRDTSKVIVVDCKREAFGLQPFNGLALCKWDGNSEDRTLYDLAAFLKTIA 317

Query: 487 KHRPGDIRAVLSSYEGRDVSKEFIER-----SKEHQRRMQEQKQQ-----------GRIW 356
                D+R+VL +Y   +   E  +R     ++E ++R+ E  QQ           GR W
Sbjct: 318 ISGVEDVRSVLENYAHEEDPIEAFKRRQAQLAQEEEQRISEMAQQKKQGFSLGTIAGRFW 377

Query: 355 RR 350
            R
Sbjct: 378 SR 379



>gb:BC025844_2095174 Mus musculus translocase of inner mitochondrial
           membrane 50 homolog (yeast), mRNA (cDNA clone
           IMAGE:5006445), partial cds.
          Length = 184

 Score =  122 bits (307), Expect = 7e-27
 Identities = 58/155 (37%), Positives = 95/155 (61%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRPG++   + LA  +EIV+++ +  M   P+++ +DP   I YRL R AT+Y+ G H +
Sbjct: 4   KRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMEGHHVK 63

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPG 473
           D+S LNRDP++V+ +        LQP N + ++PW G S+D  LLDL  FL+ +  ++  
Sbjct: 64  DISCLNRDPARVVVVDCKKEAFRLQPFNGVALRPWDGNSDDRVLLDLSAFLKTIALNQVE 123

Query: 472 DIRAVLSSYEGRDVSKEFIERSKEHQRRMQEQKQQ 368
           D+R VL  Y   D   + +E  K+ Q R+++++QQ
Sbjct: 124 DVRTVLEHYALED---DPLEAFKQRQSRLEQEEQQ 155



>gb:AE014296_1133994 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003467_1211293 Drosophila melanogaster
           chromosome 3L, section 1 of 83 of the complete sequence.
          Length = 409

 Score =  121 bits (304), Expect = 1e-26
 Identities = 61/158 (38%), Positives = 90/158 (56%)
 Frame = -1

Query: 853 DRGWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKY 674
           + GWR  KRPGVD FL+  A++FEIVVY+ +Q + V P+V+ LDP  CI YRL R +T +
Sbjct: 228 ETGWRFKKRPGVDVFLKECAKYFEIVVYTAEQGVTVFPLVDALDPNGCIMYRLVRDSTHF 287

Query: 673 LNGKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEY 494
             G H ++L  LNRD  +V+ +      +   P N   I  W+G   DT L +L  FL  
Sbjct: 288 DGGHHVKNLDNLNRDLKRVVVVDWDRNSTKFHPSNSFSIPRWSGNDNDTTLFELTSFLSV 347

Query: 493 VGKHRPGDIRAVLSSYEGRDVSKEFIERSKEHQRRMQE 380
           +G     D+R VL  Y   +   + + + +E+QR++ E
Sbjct: 348 LGTSEIDDVREVLQYY---NQFSDSLSQFRENQRKLGE 382



>gb:CR382128_1661205 Yarrowia lipolytica chromosome B of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 466

 Score =  117 bits (294), Expect = 2e-25
 Identities = 60/150 (40%), Positives = 90/150 (60%), Gaps = 1/150 (0%)
 Frame = -1

Query: 856 RDRGWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNC-IRYRLSRGAT 680
           R+ GWR  KRPGVD FL +L Q++EIV++S Q     + ++ +LDP +    + L+R  T
Sbjct: 210 REHGWRVAKRPGVDYFLGYLGQYYEIVLFSSQYMANCEKLIMKLDPYHAWFSHVLTREHT 269

Query: 679 KYLNGKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFL 500
            Y +GK  +DLS++NRD  K+I I      +  QPEN + I+PW G   D  L+ LIPFL
Sbjct: 270 TYEDGKLVKDLSLMNRDMGKIIIIDPDTGCTMKQPENSIPIEPWKGTPGDKELVKLIPFL 329

Query: 499 EYVGKHRPGDIRAVLSSYEGRDVSKEFIER 410
           E++      D+R +L +++G  +  EF  R
Sbjct: 330 EWLVSQNVNDVRPILKAFDGTYLPDEFTRR 359



>gb:AE016817_1747429 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 476

 Score =  105 bits (261), Expect = 1e-21
 Identities = 60/148 (40%), Positives = 86/148 (58%), Gaps = 2/148 (1%)
 Frame = -1

Query: 847 GWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDP-KNCIRYRLSRGATKYL 671
           GWRT  RPG D  L +L+ ++E V++     +Y   VVE+LDP +  I Y L +    Y 
Sbjct: 211 GWRTVIRPGADYLLGYLSDYYENVLFPSNYMVYSKKVVEKLDPIRAFITYNLFKDHCVYK 270

Query: 670 NGKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYV 491
           +G H +DLS LNRD  K + I        LQ EN +  +PW G+++D ALL  IPFLEY+
Sbjct: 271 DGIHIKDLSHLNRDLGKTLIIDTDPNSVKLQMENAILAEPWDGKADD-ALLRYIPFLEYL 329

Query: 490 GKHRPGDIRAVLSSYEGR-DVSKEFIER 410
                 D+R +L+S++ R  + +EF ER
Sbjct: 330 VTQPINDVRPILNSFKDRHHIPEEFAER 357



>pir|T13651|T13651 hypothetical protein 95B7.3 - fruit fly
           (Drosophila melanogaster)>gb:DMC95B7_1378476 Drosophila
           melanogaster cosmid clone 95B7.
          Length = 415

 Score =  105 bits (261), Expect = 1e-21
 Identities = 60/157 (38%), Positives = 86/157 (54%)
 Frame = -1

Query: 847 GWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLN 668
           GWR  KRPGVD FL   A+ FEIVV++ +Q M V P+++ LDP   I YRL R AT ++ 
Sbjct: 249 GWRFKKRPGVDHFLAECAKDFEIVVFTAEQGMTVFPILDALDPNGYIMYRLVRDATHFVG 308

Query: 667 GKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVG 488
           G H             VI +   A  + + P+N   +  W G  +D  LLDLI FL+ + 
Sbjct: 309 GHH-------------VIVVDWDANATKMHPDNTFGLARWHGNDDDGQLLDLIAFLKIIA 355

Query: 487 KHRPGDIRAVLSSYEGRDVSKEFIERSKEHQRRMQEQ 377
           ++   D+R VL  Y   D   + I + +E+QR++ EQ
Sbjct: 356 QNNVDDVREVLHYYRQFD---DPINQFRENQRKLAEQ 389



>gb:AY089295_1296951 Drosophila melanogaster AT08867 full insert
           cDNA.
          Length = 172

 Score = 96.7 bits (239), Expect = 5e-19
 Identities = 49/138 (35%), Positives = 76/138 (55%)
 Frame = -1

Query: 793 QFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYRDLSMLNRDPSKVI 614
           ++FEIVVY+ +Q + V P+V+ LDP  CI YRL R +T +  G H ++L  LNRD  +V+
Sbjct: 11  KYFEIVVYTAEQGVTVFPLVDALDPNGCIMYRLVRDSTHFDGGHHVKNLDNLNRDLKRVV 70

Query: 613 YISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPGDIRAVLSSYEGRD 434
            +      +   P N   I  W+G   DT L +L  FL  +G     D+R VL  Y   +
Sbjct: 71  VVDWDRNSTKFHPSNSFSIPRWSGNDNDTTLFELTSFLSVLGTSEIDDVREVLQYY---N 127

Query: 433 VSKEFIERSKEHQRRMQE 380
              + + + +E+QR++ E
Sbjct: 128 QFSDSLSQFRENQRKLGE 145



>gb:MMU344340_2120912 Mus musculus mRNA for Mya22 protein.
          Length = 276

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 49/126 (38%), Positives = 69/126 (54%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FL+ + Q FE V+++   + Y DPV + LD     R RL R +  +  G + +
Sbjct: 147 KRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVK 206

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPG 473
           DLS L R+ SKVI +          PEN + ++ W  +  DT LLDLIPF E  G  R  
Sbjct: 207 DLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFE--GLSRED 264

Query: 472 DIRAVL 455
           D+ ++L
Sbjct: 265 DVYSML 270



>gb:HSA575645_2009274 Homo sapiens mRNA for RB serine phosphatase
           (RBSP3 gene),.
          Length = 276

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 49/126 (38%), Positives = 69/126 (54%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FL+ + Q FE V+++   + Y DPV + LD     R RL R +  +  G + +
Sbjct: 147 KRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVK 206

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPG 473
           DLS L R+ SKVI +          PEN + ++ W  +  DT LLDLIPF E  G  R  
Sbjct: 207 DLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFE--GLSRED 264

Query: 472 DIRAVL 455
           D+ ++L
Sbjct: 265 DVYSML 270



>gb:AY279532_1941834 Homo sapiens small CTD phosphatase 3 mRNA,
           complete cds.>gb:HSA575644_2009273 Homo sapiens mRNA for
           RB serine phosphatase (RBSP3 gene), splice variant A.
          Length = 265

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 49/126 (38%), Positives = 69/126 (54%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FL+ + Q FE V+++   + Y DPV + LD     R RL R +  +  G + +
Sbjct: 136 KRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVK 195

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPG 473
           DLS L R+ SKVI +          PEN + ++ W  +  DT LLDLIPF E  G  R  
Sbjct: 196 DLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFE--GLSRED 253

Query: 472 DIRAVL 455
           D+ ++L
Sbjct: 254 DVYSML 259



>pir|JC5707|JC5707 HYA22 protein - human
          Length = 338

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 49/126 (38%), Positives = 69/126 (54%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FL+ + Q FE V+++   + Y DPV + LD     R RL R +  +  G + +
Sbjct: 209 KRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVK 268

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPG 473
           DLS L R+ SKVI +          PEN + ++ W  +  DT LLDLIPF E  G  R  
Sbjct: 269 DLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFE--GLSRED 326

Query: 472 DIRAVL 455
           D+ ++L
Sbjct: 327 DVYSML 332



>sp|P58465|NIF1_MOUSE Nuclear LIM interactor-interacting factor 1
           (NLI-interacting factor 1) (NIF-like protein).
          Length = 348

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 49/126 (38%), Positives = 69/126 (54%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FL+ + Q FE V+++   + Y DPV + LD     R RL R +  +  G + +
Sbjct: 219 KRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVK 278

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPG 473
           DLS L R+ SKVI +          PEN + ++ W  +  DT LLDLIPF E  G  R  
Sbjct: 279 DLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFE--GLSRED 336

Query: 472 DIRAVL 455
           D+ ++L
Sbjct: 337 DVYSML 342



>sp|O15194|NIF1_HUMAN Nuclear LIM interactor-interacting factor 1
           (NLI-interacting factor 1) (NIF-like protein) (YA22
           protein) (HYA22).>gb:D88153_1995408 Homo sapiens mRNA
           for HYA22, complete cds.
          Length = 340

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 49/126 (38%), Positives = 69/126 (54%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FL+ + Q FE V+++   + Y DPV + LD     R RL R +  +  G + +
Sbjct: 211 KRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVK 270

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPG 473
           DLS L R+ SKVI +          PEN + ++ W  +  DT LLDLIPF E  G  R  
Sbjct: 271 DLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFE--GLSRED 328

Query: 472 DIRAVL 455
           D+ ++L
Sbjct: 329 DVYSML 334



>sp|Q09695|YA22_SCHPO Hypothetical protein C2F7.02c in chromosome
           I.>pir|T38550|S58146 hypothetical protein SPAC2F7.02c -
           fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC2F7_1717615 S.pombe chromosome I cosmid
           c2F7.
          Length = 325

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 50/130 (38%), Positives = 69/130 (53%)
 Frame = -1

Query: 841 RTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGK 662
           R  KRPGVD FL+ +   FEIVV++   + Y DPV++ LD  + IR+RL R A     G 
Sbjct: 195 RVVKRPGVDEFLKKMGDMFEIVVFTASLAKYADPVLDMLDHSHVIRHRLFREACCNYEGN 254

Query: 661 HYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKH 482
             +DLS L R+    I I          P + + I  W  +  D  L+DLIPFLE++   
Sbjct: 255 FVKDLSQLGRNLEDSIIIDNSPSSYIFHPSHAVPISSWFNDMHDMELIDLIPFLEHLA-- 312

Query: 481 RPGDIRAVLS 452
           R  D+  VL+
Sbjct: 313 RVPDVSTVLN 322



>gb:AF189776_2479211 Gallus gallus NLI-interacting factor isoform R5
           (NIF) mRNA, complete cds.
          Length = 264

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 45/116 (38%), Positives = 64/116 (55%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FL+ + + FE V+++   + Y DPV + LD     R RL R +  +  G + +
Sbjct: 135 KRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVK 194

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGK 485
           DLS L R+ SKVI +          PEN + ++ W  +  DT LLDLIPF E + K
Sbjct: 195 DLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSK 250



>gb:AF189774_2479209 Gallus gallus NLI-interacting factor isoform T2
           (NIF) mRNA, complete cds.
          Length = 293

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 45/116 (38%), Positives = 64/116 (55%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FL+ + + FE V+++   + Y DPV + LD     R RL R +  +  G + +
Sbjct: 135 KRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVK 194

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGK 485
           DLS L R+ SKVI +          PEN + ++ W  +  DT LLDLIPF E + K
Sbjct: 195 DLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSK 250



>gb:CR382135_1668283 Debaryomyces hansenii chromosome C of strain
           CBS767 of Debaryomyces hansenii.
          Length = 365

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 45/126 (35%), Positives = 69/126 (54%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRPGVD FLE + ++FE+VV++     Y DP++++LD  N + +RL R +     G   +
Sbjct: 236 KRPGVDEFLEKVGRWFEVVVFTASVQKYGDPLLDKLDIYNSVHHRLFRDSCYNYQGNFIK 295

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPG 473
           +LS L R  +  I I          P++ + I  W  ++ D  LLDL+PFLE + K    
Sbjct: 296 NLSQLGRPLTDSIIIDNSPASYIFHPQHSIPISSWFSDTHDNELLDLLPFLEDISKPNVD 355

Query: 472 DIRAVL 455
           D+  VL
Sbjct: 356 DVGLVL 361



>sp|Q9PTJ6|NIF1_CHICK Nuclear LIM interactor-interacting factor 1
           (NLI-interacting factor 1).>gb:AF189773_2479208 Gallus
           gallus NLI-interacting factor isoform T1 (NIF) mRNA,
           complete cds.
          Length = 275

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 45/116 (38%), Positives = 64/116 (55%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FL+ + + FE V+++   + Y DPV + LD     R RL R +  +  G + +
Sbjct: 146 KRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVK 205

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGK 485
           DLS L R+ SKVI +          PEN + ++ W  +  DT LLDLIPF E + K
Sbjct: 206 DLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSK 261



>gb:CR380950_1649890 Candida glabrata strain CBS138 chromosome D
           complete sequence.
          Length = 447

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 45/126 (35%), Positives = 70/126 (55%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRPGVD FL+ + + +E+VV++   S Y DP+++ LD  N I +RL R A     G + +
Sbjct: 318 KRPGVDEFLQRVGELYEVVVFTASVSRYGDPLLDVLDKSNNIHHRLFRDACYTYEGNYIK 377

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPG 473
           +LS + R  S++I +          P++ + I  W  +S D  LLD++P LE + K    
Sbjct: 378 NLSQIGRPLSEIIILDNSPPSYIFHPQHAIPISSWFSDSHDNELLDILPLLEDLAKPSLP 437

Query: 472 DIRAVL 455
           DI  VL
Sbjct: 438 DIGKVL 443



>gb:AY693081_1623128 Saccharomyces cerevisiae clone FLH113579.01X
           YLR019W gene, complete cds.
          Length = 397

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 43/126 (34%), Positives = 69/126 (54%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRPGVD FL  ++Q +E+VV++   S Y +P+++ LDP   I +RL R A     G + +
Sbjct: 268 KRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNGTIHHRLFREACYNYEGNYIK 327

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPG 473
           +LS + R  S+ I +          P++ + I  W  ++ D  LLD+IP LE +      
Sbjct: 328 NLSQIGRPLSETIILDNSPASYIFHPQHAVPISSWFSDTHDNELLDIIPLLEDLSSGNVL 387

Query: 472 DIRAVL 455
           D+ +VL
Sbjct: 388 DVGSVL 393



>pir|S64841|S64841 hypothetical protein YLR019w - yeast
           (Saccharomyces cerevisiae)>gb:SCYLR019W_1713421
           S.cerevisiae chromosome XII reading frame ORF YLR019w.
          Length = 397

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 43/126 (34%), Positives = 69/126 (54%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRPGVD FL  ++Q +E+VV++   S Y +P+++ LDP   I +RL R A     G + +
Sbjct: 268 KRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNGTIHHRLFREACYNYEGNYIK 327

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPG 473
           +LS + R  S+ I +          P++ + I  W  ++ D  LLD+IP LE +      
Sbjct: 328 NLSQIGRPLSETIILDNSPASYIFHPQHAVPISSWFSDTHDNELLDIIPLLEDLSSGNVL 387

Query: 472 DIRAVL 455
           D+ +VL
Sbjct: 388 DVGSVL 393



>gb:AY280863_2524408 Xenopus laevis NIF (NIF) mRNA, complete cds.
          Length = 276

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 44/116 (37%), Positives = 62/116 (53%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FL+ + + FE V+++   + Y DPV + LD       RL R +  +  G + +
Sbjct: 147 KRPHVDEFLQKMGEMFECVLFTASLAKYADPVADLLDRWGVFNARLFRESCVFHRGNYVK 206

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGK 485
           DLS L R+ SKVI I          PEN + +  W  +  DT LLDL+PF E + K
Sbjct: 207 DLSRLGRELSKVIIIDNSPASYIFHPENAVPVMSWFDDMADTELLDLLPFFEGLSK 262



>gb:CR382130_1662791 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 528

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 41/126 (32%), Positives = 70/126 (55%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRPGVD F++ + + +E+VV++   S Y DP++++LD  N + +RL R +     G + +
Sbjct: 399 KRPGVDEFMKRVGELYEVVVFTASVSKYGDPLLDQLDIHNVVHHRLFRESCYNHQGNYIK 458

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPG 473
           +LS L R    VI I          P++ + +  W  ++ D  LLD++ FLE + K +  
Sbjct: 459 NLSQLGRPLKDVIIIDNSPASYIFHPQHAIPVSSWFSDAHDNELLDMLDFLEDMSKPKVE 518

Query: 472 DIRAVL 455
           D+  VL
Sbjct: 519 DVSLVL 524



>gb:AF111941_1242075 Dictyostelium discoideum AX4 development
           protein DG1148 (DG1148) gene, complete cds.
          Length = 306

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 49/126 (38%), Positives = 67/126 (53%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FL  +A+ FEIVV++   + Y DPV++ LD    I YRL R +     G + +
Sbjct: 177 KRPFVDDFLRAIAEKFEIVVFTASLAKYADPVLDFLDTGRVIHYRLFRESCHNHKGNYVK 236

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPG 473
           DLS L RD    I +          PEN + I  W  + +D  LLDL+P L+ + K    
Sbjct: 237 DLSRLGRDLKSTIIVDNSPSSYLFHPENAIPIDSWFDDKDDRELLDLLPLLDDLIKVE-- 294

Query: 472 DIRAVL 455
           D+R VL
Sbjct: 295 DVRLVL 300



>gb:SPBC8D2_1720517 S.pombe chromosome II cosmid c8D2.
          Length = 215

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 44/115 (38%), Positives = 71/115 (61%), Gaps = 4/115 (3%)
 Frame = -1

Query: 697 LSRGATKYLNGKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALL 518
           L+R ++KY  GK  +DLS LNRD S+VI I  +    S QP+N + + PWTG  +D  L+
Sbjct: 11  LTRESSKYEKGKVIKDLSYLNRDLSRVIMIDTNPESWSKQPDNAIAMAPWTGNPKDKELV 70

Query: 517 DLIPFLEYVGKHRPGDIRAVLSSYEGRDVSKEFIERSKEHQRRM----QEQKQQG 365
            LIP LE++      D+R VL SY+G+++  E+  R ++ + ++     E+K++G
Sbjct: 71  GLIPLLEFIAIMDIKDVRPVLKSYQGKNIPLEYARREEKLRTKLIEDWNEKKKKG 125



>gb:CR382126_1659046 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 414

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 41/126 (32%), Positives = 68/126 (53%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRPGVD FL  + + +E+VV++   S Y DP+++ LD    I +RL R +     G + +
Sbjct: 285 KRPGVDEFLRRITELYEVVVFTASVSRYGDPLLDILDKDKTIHHRLFRDSCYNYEGNYIK 344

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPG 473
           +LS + R  S +I +          P++ + I  W  ++ D  LLD+IP LE + + R  
Sbjct: 345 NLSQIGRPLSDMIILDNSPASYIFHPQHAIPISSWFSDAHDNELLDIIPLLEDLAEERVP 404

Query: 472 DIRAVL 455
           D+  +L
Sbjct: 405 DVGEIL 410



>gb:AE017349_1758864 Cryptococcus neoformans var. neoformans JEC21
           chromosome 9, complete sequence.
          Length = 613

 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 46/126 (36%), Positives = 64/126 (50%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRPGVD FL  +A+ +EIVV++   S Y DPV++ LD    + +RL R +     G + +
Sbjct: 486 KRPGVDHFLTEMAKIYEIVVFTASLSKYADPVLDMLDENRVVAHRLFRESCYNHKGNYVK 545

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPG 473
           DLS L RD    I I          P N + +  W  +  D+ L DL PFL  +      
Sbjct: 546 DLSQLGRDIEHSIIIDNSPASYIFHPNNAVPVSTWFSDPHDSELTDLCPFLADLA--TVD 603

Query: 472 DIRAVL 455
           D+R VL
Sbjct: 604 DVRGVL 609



>gb:BC076658_2559407 Xenopus tropicalis CTD (carboxy-terminal
           domain, RNA polymerase II, polypeptide A) small
           phosphatase 1, mRNA (cDNA clone MGC:79551
           IMAGE:6978340), complete cds.
          Length = 271

 Score = 83.2 bits (204), Expect = 6e-15
 Identities = 42/112 (37%), Positives = 58/112 (51%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FLE + Q +E V+++   + Y DPV + LD     R RL R A  +  G + +
Sbjct: 142 KRPYVDEFLERMGQLYECVLFTASLAKYADPVTDLLDKSGVFRSRLFREACVFHQGCYVK 201

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           DLS L RD  K + +          PEN + ++ W  +  DT LL LIP  E
Sbjct: 202 DLSRLGRDLKKTVILDNSPASYIFHPENAVPVQSWFDDMSDTELLSLIPIFE 253



>gb:AF441288_2494513 Xenopus laevis Os4 mRNA, complete
           cds.>gb:BC057696_2552169 Xenopus laevis Os4, mRNA (cDNA
           clone MGC:68415 IMAGE:6863055), complete cds.
          Length = 271

 Score = 83.2 bits (204), Expect = 6e-15
 Identities = 42/112 (37%), Positives = 58/112 (51%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FLE + Q +E V+++   + Y DPV + LD     R RL R A  +  G + +
Sbjct: 142 KRPYVDEFLERMGQLYECVLFTASLAKYADPVTDLLDKSGVFRSRLFREACVFHQGCYVK 201

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           DLS L RD  K + +          PEN + ++ W  +  DT LL LIP  E
Sbjct: 202 DLSRLGRDLKKTVILDNSPASYIFHPENAVPVQSWFDDMSDTELLSLIPIFE 253



>gb:AE016814_1745672 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome I, complete sequence.
          Length = 478

 Score = 83.2 bits (204), Expect = 6e-15
 Identities = 39/126 (30%), Positives = 68/126 (53%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRPGVD FL+ + + FE+VV++   S Y DP+++ LD    + +RL R +     G + +
Sbjct: 349 KRPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILDQYKAVHHRLFRDSCYNYEGNYIK 408

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPG 473
           +LS + R  S +I +          P++ + I  W  ++ D  LLD++P LE +   +  
Sbjct: 409 NLSQIGRPLSDLIILDNSPASYIFHPQHAVPISSWFSDAHDNELLDILPLLEDLSSRKVP 468

Query: 472 DIRAVL 455
           D+  +L
Sbjct: 469 DVARIL 474



>gb:CR380950_1649794 Candida glabrata strain CBS138 chromosome D
           complete sequence.
          Length = 410

 Score = 82.8 bits (203), Expect = 8e-15
 Identities = 39/126 (30%), Positives = 69/126 (54%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRPGVD FL+ + + +E+VV++   + Y DP+++ LD    I +RL R A     G + +
Sbjct: 281 KRPGVDEFLKRVGELYEVVVFTASVARYGDPLLDILDQHKSIHHRLFREACYNYEGNYIK 340

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPG 473
           +LS + R  S++I +          P++ + +  W  +S D  L+D++P LE +  +   
Sbjct: 341 NLSQIGRPLSEIIILDNSPASYIFHPQHAIPVSSWFSDSHDNELIDIVPLLEDLSSNSVL 400

Query: 472 DIRAVL 455
           D+  VL
Sbjct: 401 DVGKVL 406



>pir|S64752|S64752 hypothetical protein YLL010c - yeast
           (Saccharomyces cerevisiae)>gb:SCCEN12RG_1706692
           S.cerevisiae DNA from CEN12 region including ATS/APSG,
           SCD25, SOF1, DRS1, MMM1 and DNM1
           genes.>gb:SCYLL010C_1713337 S.cerevisiae chromosome XII
           reading frame ORF YLL010c.
          Length = 427

 Score = 82.8 bits (203), Expect = 8e-15
 Identities = 42/126 (33%), Positives = 67/126 (53%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRPGV+ FLE + + FE+VV++   S Y DP+++ LD    I +RL R A     G + +
Sbjct: 298 KRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTDKVIHHRLFREACYNYEGNYIK 357

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPG 473
           +LS + R  S +I +          P++ + I  W  ++ D  LLD+IP LE +      
Sbjct: 358 NLSQIGRPLSDIIILDNSPASYIFHPQHAIPISSWFSDTHDNELLDIIPLLEDLSVKTSL 417

Query: 472 DIRAVL 455
           D+  +L
Sbjct: 418 DVGKIL 423



>gb:CEB0379_1359765 Caenorhabditis elegans cosmid B0379, complete
           sequence.
          Length = 491

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 40/114 (35%), Positives = 63/114 (55%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FL  + + FE ++++   + Y DPV + LD K   R RL R A  +  G + +
Sbjct: 352 KRPYVDEFLAKVGEHFECILFTASLAKYADPVADLLDKKRVFRGRLFREACVFHKGNYVK 411

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYV 491
           DLS L R+ ++ + I       +  PEN + +  W  +  DT LLD++P LE++
Sbjct: 412 DLSRLGRNLNQTLIIDNSPASYAFHPENAVPVTTWFDDPSDTELLDILPSLEHL 465



>gb:CEB0379_1359764 Caenorhabditis elegans cosmid B0379, complete
           sequence.
          Length = 345

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 40/114 (35%), Positives = 63/114 (55%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FL  + + FE ++++   + Y DPV + LD K   R RL R A  +  G + +
Sbjct: 206 KRPYVDEFLAKVGEHFECILFTASLAKYADPVADLLDKKRVFRGRLFREACVFHKGNYVK 265

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYV 491
           DLS L R+ ++ + I       +  PEN + +  W  +  DT LLD++P LE++
Sbjct: 266 DLSRLGRNLNQTLIIDNSPASYAFHPENAVPVTTWFDDPSDTELLDILPSLEHL 319



>gb:BT009984_1357350 Drosophila melanogaster RE52350 full insert
           cDNA.
          Length = 329

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 39/116 (33%), Positives = 61/116 (52%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FL+ + + +E V+++   + Y DPV + LD  N  R RL R +  Y  G + +
Sbjct: 130 KRPHVDEFLQKMGELYECVLFTASLAKYADPVADLLDKWNVFRARLFRESCVYYRGNYIK 189

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGK 485
           DL+ L RD  K++ +          P+N + +K W  +  D  L +LIP  E + K
Sbjct: 190 DLNRLGRDLQKIVIVDNSPASYIFHPDNAVPVKSWFDDVTDCELRELIPLFEKLSK 245



>gb:AE014296_1136469 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003529_1214258 Drosophila melanogaster
           chromosome 3L, section 56 of 83 of the complete
           sequence.
          Length = 329

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 39/116 (33%), Positives = 61/116 (52%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FL+ + + +E V+++   + Y DPV + LD  N  R RL R +  Y  G + +
Sbjct: 130 KRPHVDEFLQKMGELYECVLFTASLAKYADPVADLLDKWNVFRARLFRESCVYYRGNYIK 189

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGK 485
           DL+ L RD  K++ +          P+N + +K W  +  D  L +LIP  E + K
Sbjct: 190 DLNRLGRDLQKIVIVDNSPASYIFHPDNAVPVKSWFDDVTDCELRELIPLFEKLSK 245



>gb:AY279530_1941832 Homo sapiens small CTD phosphatase 1 splice
           variant mRNA, complete cds; alternatively spliced.
          Length = 213

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 43/126 (34%), Positives = 65/126 (51%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FL+ + + FE V+++   + Y DPV + LD     R RL R +  +  G + +
Sbjct: 83  KRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVK 142

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPG 473
           DLS L RD  +V+ +          P+N + +  W     DT L DL+PF E +   R  
Sbjct: 143 DLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLS--RVD 200

Query: 472 DIRAVL 455
           D+ +VL
Sbjct: 201 DVYSVL 206



>gb:AY279529_1941831 Homo sapiens small CTD phosphatase 1 mRNA,
           complete cds; alternatively spliced.
          Length = 260

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 43/126 (34%), Positives = 65/126 (51%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FL+ + + FE V+++   + Y DPV + LD     R RL R +  +  G + +
Sbjct: 130 KRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVK 189

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPG 473
           DLS L RD  +V+ +          P+N + +  W     DT L DL+PF E +   R  
Sbjct: 190 DLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLS--RVD 247

Query: 472 DIRAVL 455
           D+ +VL
Sbjct: 248 DVYSVL 253



>pir|T48545|T48545 hypothetical protein F14F18.30 - Arabidopsis
           thaliana>gb:ATF14F18_1548532 Arabidopsis thaliana DNA
           chromosome 5, BAC clone F14F18 (ESSA
           project).>gb:AY085441_1570510 Arabidopsis thaliana clone
           151766 mRNA, complete sequence.>gb:BT020406_1642801
           Arabidopsis thaliana At5g11860 mRNA, complete cds.
          Length = 305

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 40/112 (35%), Positives = 68/112 (60%), Gaps = 1/112 (0%)
 Frame = -1

Query: 829 RPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCI-RYRLSRGATKYLNGKHYR 653
           RP +  F+E +++ FEI++++  QS+Y + ++  LDPK  + R+R+ R +  + +G + +
Sbjct: 153 RPHLKEFMERVSRLFEIIIFTASQSIYAEQLLNVLDPKRKLFRHRVYRDSCVFFDGNYLK 212

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           DLS+L RD S+VI +         Q EN + I+ W  +  D  LL L+PFLE
Sbjct: 213 DLSVLGRDLSRVIIVDNSPQAFGFQVENGVPIESWFNDPSDKELLHLLPFLE 264



>sp|P58466|NIF3_MOUSE Carboxy-terminal domain RNA polymerase II
           polypeptide A small phosphatase 1 (EC 3.1.3.16) (Nuclear
           LIM interactor-interacting factor 3) (NLI-interacting
           factor 3) (Golli-interacting protein)
           (GIP).>gb:AY028804_2074041 Mus musculus
           golli-interacting protein mRNA, complete
           cds.>gb:BC049184_2099968 Mus musculus CTD
           (carboxy-terminal domain, RNA polymerase II, polypeptide
           A) small phosphatase 1, mRNA (cDNA clone MGC:54918
           IMAGE:6439402), complete cds.>gb:BC065158_2105566 Mus
           musculus CTD (carboxy-terminal domain, RNA polymerase
           II, polypeptide A) small phosphatase 1, mRNA (cDNA clone
           MGC:90129 IMAGE:5717102), complete
           cds.>gb:BC079638_2107632 Mus musculus CTD
           (carboxy-terminal domain, RNA polymerase II, polypeptide
           A) small phosphatase 1, mRNA (cDNA clone MGC:90589
           IMAGE:5717102), complete cds.
          Length = 261

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 43/126 (34%), Positives = 65/126 (51%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FL+ + + FE V+++   + Y DPV + LD     R RL R +  +  G + +
Sbjct: 131 KRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVK 190

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPG 473
           DLS L RD  +V+ +          P+N + +  W     DT L DL+PF E +   R  
Sbjct: 191 DLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLS--RVD 248

Query: 472 DIRAVL 455
           D+ +VL
Sbjct: 249 DVYSVL 254



>sp|Q9GZU7|NIF3_HUMAN Carboxy-terminal domain RNA polymerase II
           polypeptide A small phosphatase 1 (EC 3.1.3.16) (Nuclear
           LIM interactor-interacting factor 3) (NLI-interacting
           factor 3) (NLI-IF).>gb:AF229162_1891619 Homo sapiens
           nuclear LIM interactor-interacting factor (NLI-IF) mRNA,
           complete cds.>gb:AF229163_1891622 Homo sapiens natural
           resistance-associated macrophage protein 1 (SLC11A1)
           gene, complete cds, alternatively spliced; and nuclear
           LIM interactor-interacting factor (NLI-IF) gene,
           complete cds.>gb:BC012977_1973878 Homo sapiens CTD
           (carboxy-terminal domain, RNA polymerase II, polypeptide
           A) small phosphatase 1, mRNA (cDNA clone MGC:15065
           IMAGE:3687816), complete cds.
          Length = 261

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 43/126 (34%), Positives = 65/126 (51%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FL+ + + FE V+++   + Y DPV + LD     R RL R +  +  G + +
Sbjct: 131 KRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVK 190

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPG 473
           DLS L RD  +V+ +          P+N + +  W     DT L DL+PF E +   R  
Sbjct: 191 DLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLS--RVD 248

Query: 472 DIRAVL 455
           D+ +VL
Sbjct: 249 DVYSVL 254



>gb:AY341983_1321212 Drosophila miranda CG2713-like protein gene,
           partial cds.
          Length = 151

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 39/73 (53%), Positives = 52/73 (71%)
 Frame = -1

Query: 847 GWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLN 668
           GWR  KRPGVD FL  LA+ FEIVV++ +Q M V P+++ LDP   I YRL R AT +++
Sbjct: 77  GWRFKKRPGVDHFLSELAKEFEIVVFTAEQGMTVFPILDALDPHGYIMYRLVRDATHFVD 136

Query: 667 GKHYRDLSMLNRD 629
           G H ++L+ LNRD
Sbjct: 137 GHHVKNLNNLNRD 149



>gb:AY751569_1626696 Phytophthora infestans putative nuclear LIM
           factor interactor-interacting protein spore-specific
           form (NIFS) mRNA, complete cds.
          Length = 297

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 38/111 (34%), Positives = 64/111 (57%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRPG + FL  +A+++EIV+Y+   S Y DP++++LDP+  IRYRL R       G + +
Sbjct: 167 KRPGAEEFLIEMAKYYEIVIYTASLSKYADPLLDKLDPEGTIRYRLYREHCVQYEGSYVK 226

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFL 500
           DLS+L+RD +++I +    +  +  P N +    +  +  D  L  +  FL
Sbjct: 227 DLSLLDRDITQMIIVDNSPMAYAFHPRNAIGCSSFIDDPNDRELDSIARFL 277



>gb:BC063974_2553675 Danio rerio zgc:77714, mRNA (cDNA clone
           MGC:77714 IMAGE:7000552), complete cds.
          Length = 258

 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 41/112 (36%), Positives = 59/112 (52%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FL+ + + FE V+++   + Y DPV + LD     R RL R +  +  G + +
Sbjct: 129 KRPYVDEFLQRMGELFECVLFTASLAKYADPVTDLLDQCGVFRTRLFRESCVFYQGCYVK 188

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           DLS L R+  K + +          PEN + +  W  +SEDT LL LIP  E
Sbjct: 189 DLSRLGRELHKTLILDNSPASYIFHPENAVPVLSWFDDSEDTELLHLIPVFE 240



>gb:AY751574_1626701 Phytophthora infestans putative nuclear LIM
           factor interactor-interacting protein hyphal form
           (NIFH2) mRNA, complete cds.
          Length = 211

 Score = 79.7 bits (195), Expect = 6e-14
 Identities = 41/113 (36%), Positives = 67/113 (59%), Gaps = 1/113 (0%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDP-KNCIRYRLSRGATKYLNGKHY 656
           KRP ++ FL+ +++ FEIVV++    +Y + +   LDP +N I+YRL R     + G + 
Sbjct: 69  KRPHMEYFLKRVSKLFEIVVFTASHKVYAEKLTNMLDPHRNLIKYRLYRDDCLDVFGNYL 128

Query: 655 RDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           +DL++L RD SKV+ +         Q  N + I+ W  ++ D  LL+L+PFLE
Sbjct: 129 KDLNVLGRDLSKVVLVDNSPHAFGYQVNNGIPIETWYDDAADAELLNLLPFLE 181



>gb:AY751572_1626699 Phytophthora infestans putative nuclear LIM
           factor interactor-interacting protein cleavage-specific
           form (NIFC3) mRNA, complete cds.
          Length = 299

 Score = 79.3 bits (194), Expect = 8e-14
 Identities = 39/111 (35%), Positives = 64/111 (57%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRPG + FL  +A+++EIVVY+   S+Y DP++++LDP+  IRYRL R       G + +
Sbjct: 158 KRPGAEEFLIEMAKYYEIVVYTASLSVYADPLLDKLDPEGTIRYRLYREHCVQYEGCYVK 217

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFL 500
           DLS+L+RD ++ I +    +  +  P N +    +  +  D  L  +  FL
Sbjct: 218 DLSLLDRDITQTIIVDNSPMAYAFHPRNAIGCSSFYDDLNDRELQSIGRFL 268



>gb:AY751570_1626697 Phytophthora infestans putative nuclear LIM
           factor interactor-interacting protein cleavage-specific
           form (NIFC1) mRNA, complete cds.
          Length = 339

 Score = 79.3 bits (194), Expect = 8e-14
 Identities = 39/111 (35%), Positives = 64/111 (57%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRPG + FL  +A+++EIVVY+   S+Y DP++++LDP+  IRYRL R       G + +
Sbjct: 209 KRPGAEEFLIEMAKYYEIVVYTASLSVYADPLLDKLDPEGTIRYRLYREHCVQYEGCYVK 268

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFL 500
           DLS+L+RD ++ I +    +  +  P N +    +  +  D  L  +  FL
Sbjct: 269 DLSLLDRDITQTIIVDNSPMAYAFHPRNAIGCSSFYDDLNDRELQSIGRFL 319



>gb:BC085403_2564353 Danio rerio zgc:101656, mRNA (cDNA clone
           MGC:101656 IMAGE:7226373), complete cds.
          Length = 245

 Score = 79.0 bits (193), Expect = 1e-13
 Identities = 45/128 (35%), Positives = 73/128 (57%), Gaps = 1/128 (0%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCI-RYRLSRGATKYLNGKHY 656
           KRP VD FLE ++Q++E+VV++    +Y   V ++LD    I + R  R      +G + 
Sbjct: 111 KRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNNKAILKRRYYRQHCTLDSGSYI 170

Query: 655 RDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRP 476
           +DLS+++ D S V+ +          P+N + IK W  +  DTALL+L+P L+ +    P
Sbjct: 171 KDLSVVHDDLSSVVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDAL--RFP 228

Query: 475 GDIRAVLS 452
            D+R+VLS
Sbjct: 229 ADVRSVLS 236



>gb:BC089307_2110764 Mus musculus CTD (carboxy-terminal domain, RNA
           polymerase II, polypeptide A) small phosphatase 2, mRNA
           (cDNA clone IMAGE:6827536), partial cds.
          Length = 212

 Score = 79.0 bits (193), Expect = 1e-13
 Identities = 41/112 (36%), Positives = 58/112 (51%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FL  + + FE V+++   + Y DPV + LD     R RL R A  +  G + +
Sbjct: 83  KRPYVDEFLRRMGELFECVLFTASLAKYADPVTDLLDRCGVFRARLFREACVFHQGCYVK 142

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           DLS L RD  K + +          PEN + ++ W  +  DT LL+LIP  E
Sbjct: 143 DLSRLGRDLRKTVILDNSPASYIFHPENAVPVQSWFDDMADTELLNLIPVFE 194



>gb:AY751579_1626706 Phytophthora sojae putative nuclear LIM
           interactor-interacting protein (NIF4) gene, complete
           cds.
          Length = 261

 Score = 79.0 bits (193), Expect = 1e-13
 Identities = 41/113 (36%), Positives = 67/113 (59%), Gaps = 1/113 (0%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDP-KNCIRYRLSRGATKYLNGKHY 656
           KRP ++ FL+ +++ FEIVV++    +Y + ++  LDP +N I+YRL R     + G + 
Sbjct: 119 KRPHLEYFLKRVSKLFEIVVFTASHKVYAEKLMNMLDPNRNFIKYRLYREDCLDVFGNYL 178

Query: 655 RDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           +DL++L RD SKV+ +         Q  N + I+ W  +  D  LL+L+PFLE
Sbjct: 179 KDLNVLGRDLSKVVLVDNSPHAFGYQVNNGIPIETWYDDEADAELLNLLPFLE 231



>gb:AK049271_1168697 Mus musculus ES cells cDNA, RIKEN full-length
           enriched library, clone:C330018I01 product:NUCLEAR LIM
           INTERACTOR-INTERACTING FACTOR 2 (NLI-INTERACTING FACTOR
           2) (PROTEIN OS-4) homolog [Homo sapiens], full insert
           sequence.>gb:BC085142_2109090 Mus musculus CTD
           (carboxy-terminal domain, RNA polymerase II, polypeptide
           A) small phosphatase 2, mRNA (cDNA clone MGC:109690
           IMAGE:6413242), complete cds.
          Length = 270

 Score = 79.0 bits (193), Expect = 1e-13
 Identities = 41/112 (36%), Positives = 58/112 (51%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FL  + + FE V+++   + Y DPV + LD     R RL R A  +  G + +
Sbjct: 141 KRPYVDEFLRRMGELFECVLFTASLAKYADPVTDLLDRCGVFRARLFREACVFHQGCYVK 200

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           DLS L RD  K + +          PEN + ++ W  +  DT LL+LIP  E
Sbjct: 201 DLSRLGRDLRKTVILDNSPASYIFHPENAVPVQSWFDDMADTELLNLIPVFE 252



>gb:CR548612_1375192 Paramecium tetraurelia macronuclear largest
           chromosome, complete sequence.
          Length = 276

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 46/132 (34%), Positives = 75/132 (56%), Gaps = 2/132 (1%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP +  FL+ L+ ++EI+V++     Y D V++ +D    I    +R   +++NG   +
Sbjct: 80  KRPYLREFLQQLSAYYEIIVFTAGYESYCDKVLQHIDIDRHISDYFARSNCRFVNGICLK 139

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPG 473
           DLS+L+R   ++I+I  +A    +QPEN L I  +    ED  LL LIPFL+ +  H+P 
Sbjct: 140 DLSILDRPLDQLIFIDNNANAFEMQPENGLLIPSFLDSDEDECLLRLIPFLKQMA-HKPK 198

Query: 472 --DIRAVLSSYE 443
              + + LS YE
Sbjct: 199 VIPVSSFLSDYE 210



>gb:BC065920_1986957 Homo sapiens cDNA clone MGC:70608
           IMAGE:5756196, complete cds.
          Length = 271

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 40/112 (35%), Positives = 58/112 (51%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FL  + + FE V+++   + Y DPV + LD     R RL R +  +  G + +
Sbjct: 142 KRPYVDEFLRRMGELFECVLFTASLAKYADPVTDLLDRCGVFRARLFRESCVFHQGCYVK 201

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           DLS L RD  K + +          PEN + ++ W  +  DT LL+LIP  E
Sbjct: 202 DLSRLGRDLRKTLILDNSPASYIFHPENAVPVQSWFDDMADTELLNLIPIFE 253



>gb:AF022231_1877088 Homo sapiens unknown protein mRNA, complete
           cds.
          Length = 271

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 40/112 (35%), Positives = 58/112 (51%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FL  + + FE V+++   + Y DPV + LD     R RL R +  +  G + +
Sbjct: 142 KRPYVDEFLRRMGELFECVLFTASLAKYADPVTDLLDRCGVFRARLFRESCVFHQGCYVK 201

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           DLS L RD  K + +          PEN + ++ W  +  DT LL+LIP  E
Sbjct: 202 DLSRLGRDLRKTLILDNSPASYIFHPENAVPVQSWFDDMADTELLNLIPIFE 253



>sp|O14595|NIF2_HUMAN Carboxy-terminal domain RNA polymerase II
           polypeptide A small phosphatase 2 (EC 3.1.3.16) (Nuclear
           LIM interactor-interacting factor 2) (NLI-interacting
           factor 2) (Protein OS-4).>gb:AY279531_1941833 Homo
           sapiens small CTD phosphatase 2 mRNA, complete
           cds.>gb:HSAF000152_2010056 Homo sapiens OS-4 protein
           (OS-4) mRNA, complete cds.
          Length = 283

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 40/112 (35%), Positives = 58/112 (51%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FL  + + FE V+++   + Y DPV + LD     R RL R +  +  G + +
Sbjct: 142 KRPYVDEFLRRMGELFECVLFTASLAKYADPVTDLLDRCGVFRARLFRESCVFHQGCYVK 201

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           DLS L RD  K + +          PEN + ++ W  +  DT LL+LIP  E
Sbjct: 202 DLSRLGRDLRKTLILDNSPASYIFHPENAVPVQSWFDDMADTELLNLIPIFE 253



>gb:AB084264_2463712 Xenopus laevis Dullard mRNA, complete cds.
          Length = 244

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 45/128 (35%), Positives = 72/128 (56%), Gaps = 1/128 (0%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDP-KNCIRYRLSRGATKYLNGKHY 656
           KRP VD FLE ++Q++E+VV++    +Y   V ++LD  K  +R R  R       G + 
Sbjct: 110 KRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNNKGVLRRRFYRQHCTLELGSYI 169

Query: 655 RDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRP 476
           +DLS+++ D S V+ +          P+N + IK W  +  DTALL+L+P L+ +     
Sbjct: 170 KDLSVVHSDLSSVVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDAL--RFT 227

Query: 475 GDIRAVLS 452
            D+R+VLS
Sbjct: 228 ADVRSVLS 235



>gb:AP003222_1825535 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0003E08.
          Length = 439

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 45/141 (31%), Positives = 78/141 (55%), Gaps = 3/141 (2%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDP-KNCIRYRLSRGATKYLNGKHY 656
           KRP +  FL+ +A+ FE+V+++  QS+Y D +++ LDP K     R  R +  + N  + 
Sbjct: 300 KRPHLHMFLQKMAEMFEVVIFTASQSVYADQLLDILDPEKKLFSRRYFRESCVFTNTSYT 359

Query: 655 RDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRP 476
           +DL+++  D +KV+ I        LQ  N + I+ W  +  D AL  LIPFLE +     
Sbjct: 360 KDLTVVGVDLAKVVIIDNTPQVFQLQVNNGIPIESWFSDDSDEALPQLIPFLETLAS--A 417

Query: 475 GDIRAVLSSYEG--RDVSKEF 419
            D+R +++   G  +D+++ F
Sbjct: 418 DDVRPIIAKKFGDKKDIAEIF 438



>gb:AC092559_1735530 Oryza sativa chromosome 3 BAC OSJNBb0096M04
           genomic sequence, complete sequence.>gb:AC096688_1736234
           Oryza sativa chromosome 3 BAC OSJNBa0015N08 genomic
           sequence, complete sequence.
          Length = 444

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 38/112 (33%), Positives = 67/112 (59%), Gaps = 1/112 (0%)
 Frame = -1

Query: 829 RPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCI-RYRLSRGATKYLNGKHYR 653
           RP +  FLE +A  FEI++++  QS+Y + ++  LDPK  + R+R+ R +  ++ G + +
Sbjct: 301 RPYLKEFLETVASMFEIIIFTASQSIYAEQLLNILDPKRRLFRHRVYRESCLFVEGNYLK 360

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           DLS+L RD ++V+ +         Q +N + I+ W  +  D  LL L+PFL+
Sbjct: 361 DLSVLGRDLARVVIVDNSPQAFGFQLDNGVPIESWFDDRNDRELLTLLPFLQ 412



>gb:AY751576_1626703 Phytophthora sojae nuclear LIM factor
           interactor-interacting protein (NIF1) gene, complete
           cds.
          Length = 336

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 38/114 (33%), Positives = 63/114 (55%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRPG + FL  +A+++EIV+Y+   S Y DP++++LDP+  I+YRL R       G + +
Sbjct: 206 KRPGAEEFLVEMAKYYEIVIYTASLSKYADPLLDQLDPEGVIKYRLYRQHCVQYEGNYVK 265

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYV 491
           DLS+L R+ S+ I +    +     P+N +    +  +  D  L  +  FL  V
Sbjct: 266 DLSLLARELSQTIIVDNSPMAYIWHPKNAIGCSSFIDDPNDRELESISRFLSKV 319



>gb:BC082639_2562787 Xenopus laevis cDNA clone MGC:81552
           IMAGE:6862930, complete cds.
          Length = 244

 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 45/128 (35%), Positives = 72/128 (56%), Gaps = 1/128 (0%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDP-KNCIRYRLSRGATKYLNGKHY 656
           KRP VD FLE ++Q++E+VV++    +Y   V ++LD  K  +R R  R       G + 
Sbjct: 110 KRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNNKAVLRRRFYRQHCTLELGSYI 169

Query: 655 RDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRP 476
           +DLS+++ D S V+ +          P+N + IK W  +  DTALL+L+P L+ +     
Sbjct: 170 KDLSVVHSDLSSVVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDAL--RFT 227

Query: 475 GDIRAVLS 452
            D+R+VLS
Sbjct: 228 ADVRSVLS 235



>gb:AY751571_1626698 Phytophthora infestans putative nuclear LIM
           factor interactor-interacting protein cleavage-specific
           form (NIFC2) mRNA, complete cds.
          Length = 325

 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 39/111 (35%), Positives = 61/111 (54%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           +RPG +  L  +A+F+EIVVY+   S Y DP++++LDP+  IR+RL R       G + +
Sbjct: 195 RRPGCEEILIEMAKFYEIVVYTASLSKYADPLLDKLDPEGVIRHRLYREHCVQYEGSYVK 254

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFL 500
           DLS+L+RD S+ I I    +     P N +    +  +  D  L  +  FL
Sbjct: 255 DLSLLDRDISQTIIIDNAPMSYIFHPRNAIGCSSFIDDPSDRELESISRFL 305



>pir|D86421|D86421 hypothetical protein F1N18.16 - Arabidopsis
           thaliana>gb:AE005172_891828 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC008030_1536476 Arabidopsis thaliana
           chromosome I BAC F1N18 genomic sequence, complete
           sequence.
          Length = 247

 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 41/113 (36%), Positives = 66/113 (58%), Gaps = 1/113 (0%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRPGV  FLE L + +++VV++     Y   V+++LD    I  RL R +   +NGK+ +
Sbjct: 117 KRPGVTEFLERLGENYKVVVFTAGLEEYASQVLDKLDKNGVISQRLYRDSCTEVNGKYVK 176

Query: 652 DLSM-LNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           DLS+ + +D    + +  +    SLQPEN + IK +  + +D  LL+L+ FLE
Sbjct: 177 DLSLVVGKDLRSALIVDDNPSSYSLQPENGVPIKAFVDDLKDQELLNLVEFLE 229



>gb:AB012245_1511770 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MRA19.
          Length = 272

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 46/134 (34%), Positives = 74/134 (55%), Gaps = 1/134 (0%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYR-LSRGATKYLNGKHY 656
           KRPGVD FL+ + + ++IVV++     Y   V+++LDP+  +  R   R A   ++G+  
Sbjct: 139 KRPGVDEFLKKIGEKYQIVVFTAGLREYASLVLDKLDPERRVISRSFYRDACSEIDGRLV 198

Query: 655 RDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRP 476
           +DL  + RD  +V+ +  +    +LQPEN   IKP++ + ED  L  L  FL Y    + 
Sbjct: 199 KDLGFVMRDLRRVVIVDDNPNSYALQPENAFPIKPFSDDLEDVELKKLGEFL-YGDCVKF 257

Query: 475 GDIRAVLSSYEGRD 434
            D+R  L  + GRD
Sbjct: 258 EDMRVALKEFVGRD 271



>gb:AC006780_1204030 Caenorhabditis elegans cosmid Y47D9A, complete
           sequence.
          Length = 312

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 50/146 (34%), Positives = 80/146 (54%), Gaps = 13/146 (8%)
 Frame = -1

Query: 829 RPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDP-KNCIRYRLSRGATKYLNGKHYR 653
           RP +  FL  +A+ FEI++++  + +Y + + + LDP KN IR+RL R     + G + +
Sbjct: 106 RPHLRTFLSRMAKTFEIIIFTASKKVYANKLCDILDPRKNHIRHRLFREHCVCVFGNYVK 165

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVG----- 488
           DL++L RDPSK + +       + Q +N + I+ W  +  DT LL L  FLE +      
Sbjct: 166 DLTILGRDPSKTMILDNAVQSFAYQLDNGIPIESWFHDRNDTELLKLCSFLEAIPTLVNF 225

Query: 487 ----KHRPGDI-RAVLSS--YEGRDV 431
               K +   I  A+LSS  ++GRDV
Sbjct: 226 HFEIKVKTNSICLAILSSNNFQGRDV 251



>gb:AY751577_1626704 Phytophthora sojae nuclear LIM factor
           interactor-interacting protein (NIF2) gene, complete
           cds.
          Length = 335

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 40/123 (32%), Positives = 66/123 (53%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRPG + FL  +++++EIVVY+   S Y DP++++LD +N I+YRL R       G + +
Sbjct: 205 KRPGAEEFLVEMSKYYEIVVYTASLSKYADPLLDKLDLENVIKYRLFREHCVQYEGNYVK 264

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPG 473
           DLS+L+R+  + I I    +     P N +    +  +  D  L  +  FL  +  H   
Sbjct: 265 DLSLLDREIPQTIIIDNSPMSYIFHPRNAIGCSSFIDDPNDRELESISRFLTKI--HDVE 322

Query: 472 DIR 464
           D+R
Sbjct: 323 DVR 325



>gb:BC083672_2108747 Rattus norvegicus cDNA clone MGC:94517
           IMAGE:7135706, complete cds.
          Length = 465

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 41/112 (36%), Positives = 63/112 (56%), Gaps = 1/112 (0%)
 Frame = -1

Query: 829 RPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKN-CIRYRLSRGATKYLNGKHYR 653
           RP    FLE ++Q +EI++++  + +Y D ++  LDPK   +R+RL R     + G + +
Sbjct: 328 RPFFREFLERMSQMYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIK 387

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           DL++L RD SK I I       + Q  N + I+ W  +  D  LL LIPFLE
Sbjct: 388 DLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDNELLKLIPFLE 439



>gb:BC052660_2101187 Mus musculus DNA segment, Chr 2, ERATO Doi 485,
           expressed, mRNA (cDNA clone MGC:60703 IMAGE:30049400),
           complete cds.
          Length = 465

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 41/112 (36%), Positives = 63/112 (56%), Gaps = 1/112 (0%)
 Frame = -1

Query: 829 RPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKN-CIRYRLSRGATKYLNGKHYR 653
           RP    FLE ++Q +EI++++  + +Y D ++  LDPK   +R+RL R     + G + +
Sbjct: 328 RPFFREFLERMSQMYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIK 387

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           DL++L RD SK I I       + Q  N + I+ W  +  D  LL LIPFLE
Sbjct: 388 DLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDNELLKLIPFLE 439



>gb:AY751578_1626705 Phytophthora sojae nuclear LIM factor
           interactor-interacting protein (NIF3) gene, complete
           cds.
          Length = 336

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 40/123 (32%), Positives = 67/123 (54%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRPG + FL  +A+++EIV+Y+   S Y DP++++LDP+  I+YRL R       G + +
Sbjct: 206 KRPGAEEFLVEMAKYYEIVIYTASLSKYADPLLDQLDPEGVIKYRLYRQHCVQYEGNYVK 265

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPG 473
           DLS+L R+ S+ I +    +     P++ +    +  +  D  L  +  FL  V  H   
Sbjct: 266 DLSLLARELSQTIIVDNSPMAYIWYPKSAIGCSSFIDDPNDRELESISRFLTNV--HDVE 323

Query: 472 DIR 464
           D+R
Sbjct: 324 DVR 326



>gb:AX876636_1476623 Sequence 11541 from Patent
           EP1074617.>gb:AK001385_1908410 Homo sapiens cDNA
           FLJ10523 fis, clone NT2RP2000863.
          Length = 286

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 41/112 (36%), Positives = 63/112 (56%), Gaps = 1/112 (0%)
 Frame = -1

Query: 829 RPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKN-CIRYRLSRGATKYLNGKHYR 653
           RP    FLE ++Q +EI++++  + +Y D ++  LDPK   +R+RL R     + G + +
Sbjct: 149 RPFFREFLERMSQMYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIK 208

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           DL++L RD SK I I       + Q  N + I+ W  +  D  LL LIPFLE
Sbjct: 209 DLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDNELLKLIPFLE 260



>gb:AX405886_1467814 Sequence 301 from Patent
           WO0222660.>gb:BC035744_1981688 Homo sapiens hypothetical
           protein HSPC129, mRNA (cDNA clone MGC:46091
           IMAGE:5744745), complete cds.
          Length = 466

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 41/112 (36%), Positives = 63/112 (56%), Gaps = 1/112 (0%)
 Frame = -1

Query: 829 RPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKN-CIRYRLSRGATKYLNGKHYR 653
           RP    FLE ++Q +EI++++  + +Y D ++  LDPK   +R+RL R     + G + +
Sbjct: 329 RPFFREFLERMSQMYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIK 388

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           DL++L RD SK I I       + Q  N + I+ W  +  D  LL LIPFLE
Sbjct: 389 DLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDNELLKLIPFLE 440



>gb:CR627421_1180790 Homo sapiens mRNA; cDNA DKFZp781F2227 (from
           clone DKFZp781F2227).
          Length = 394

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 41/112 (36%), Positives = 63/112 (56%), Gaps = 1/112 (0%)
 Frame = -1

Query: 829 RPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKN-CIRYRLSRGATKYLNGKHYR 653
           RP    FLE ++Q +EI++++  + +Y D ++  LDPK   +R+RL R     + G + +
Sbjct: 257 RPFFREFLERMSQMYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIK 316

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           DL++L RD SK I I       + Q  N + I+ W  +  D  LL LIPFLE
Sbjct: 317 DLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDNELLKLIPFLE 368



>gb:AK053513_1170460 Mus musculus 0 day neonate eyeball cDNA, RIKEN
           full-length enriched library, clone:E130104C24
           product:HSPC129 homolog [Homo sapiens], full insert
           sequence.
          Length = 464

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 41/112 (36%), Positives = 63/112 (56%), Gaps = 1/112 (0%)
 Frame = -1

Query: 829 RPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKN-CIRYRLSRGATKYLNGKHYR 653
           RP    FLE ++Q +EI++++  + +Y D ++  LDPK   +R+RL R     + G + +
Sbjct: 327 RPFFREFLERMSQMYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIK 386

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           DL++L RD SK I I       + Q  N + I+ W  +  D  LL LIPFLE
Sbjct: 387 DLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDNELLKLIPFLE 438



>gb:AK030085_1161818 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4932437H15
           product:HSPC129 homolog [Homo sapiens], full insert
           sequence.>gb:AK033382_1163302 Mus musculus 16 days
           embryo lung cDNA, RIKEN full-length enriched library,
           clone:8430419B22 product:HSPC129 homolog [Homo sapiens],
           full insert sequence.>gb:AK049463_1168807 Mus musculus 7
           days embryo whole body cDNA, RIKEN full-length enriched
           library, clone:C430014O22 product:HSPC129 homolog [Homo
           sapiens], full insert sequence.>gb:AK082646_1173608 Mus
           musculus 0 day neonate cerebellum cDNA, RIKEN
           full-length enriched library, clone:C230075O11
           product:HSPC129 homolog [Homo sapiens], full insert
           sequence.
          Length = 465

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 41/112 (36%), Positives = 63/112 (56%), Gaps = 1/112 (0%)
 Frame = -1

Query: 829 RPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKN-CIRYRLSRGATKYLNGKHYR 653
           RP    FLE ++Q +EI++++  + +Y D ++  LDPK   +R+RL R     + G + +
Sbjct: 328 RPFFREFLERMSQMYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIK 387

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           DL++L RD SK I I       + Q  N + I+ W  +  D  LL LIPFLE
Sbjct: 388 DLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDNELLKLIPFLE 439



>gb:AK028251_1160885 Mus musculus 12 days embryo head cDNA, RIKEN
           full-length enriched library, clone:3002006F17
           product:HSPC129 homolog [Homo sapiens], full insert
           sequence.
          Length = 351

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 41/112 (36%), Positives = 63/112 (56%), Gaps = 1/112 (0%)
 Frame = -1

Query: 829 RPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKN-CIRYRLSRGATKYLNGKHYR 653
           RP    FLE ++Q +EI++++  + +Y D ++  LDPK   +R+RL R     + G + +
Sbjct: 214 RPFFREFLERMSQMYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIK 273

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           DL++L RD SK I I       + Q  N + I+ W  +  D  LL LIPFLE
Sbjct: 274 DLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDNELLKLIPFLE 325



>gb:AF161543_1150436 Homo sapiens HSPC058 mRNA, complete cds.
          Length = 352

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 41/112 (36%), Positives = 63/112 (56%), Gaps = 1/112 (0%)
 Frame = -1

Query: 829 RPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKN-CIRYRLSRGATKYLNGKHYR 653
           RP    FLE ++Q +EI++++  + +Y D ++  LDPK   +R+RL R     + G + +
Sbjct: 215 RPFFREFLERMSQMYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIK 274

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           DL++L RD SK I I       + Q  N + I+ W  +  D  LL LIPFLE
Sbjct: 275 DLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDNELLKLIPFLE 326



>gb:AF161478_1150371 Homo sapiens HSPC129 mRNA, complete cds.
          Length = 466

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 41/112 (36%), Positives = 63/112 (56%), Gaps = 1/112 (0%)
 Frame = -1

Query: 829 RPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKN-CIRYRLSRGATKYLNGKHYR 653
           RP    FLE ++Q +EI++++  + +Y D ++  LDPK   +R+RL R     + G + +
Sbjct: 329 RPFFREFLERMSQMYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIK 388

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           DL++L RD SK I I       + Q  N + I+ W  +  D  LL LIPFLE
Sbjct: 389 DLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDNELLKLIPFLE 440



>gb:BC087638_2110111 Rattus norvegicus cDNA clone IMAGE:7309162,
           partial cds.
          Length = 190

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 42/128 (32%), Positives = 73/128 (57%), Gaps = 1/128 (0%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLD-PKNCIRYRLSRGATKYLNGKHY 656
           KRP VD FLE ++Q++E+VV++    +Y   V ++LD  ++ ++ R  R       G + 
Sbjct: 56  KRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYI 115

Query: 655 RDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRP 476
           +DLS+++ D S ++ +          P+N + IK W  +  DTALL+L+P L+ +     
Sbjct: 116 KDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDAL--RFT 173

Query: 475 GDIRAVLS 452
            D+R+VLS
Sbjct: 174 ADVRSVLS 181



>gb:BC018265_2092621 Mus musculus Dullard homolog (Xenopus laevis),
           mRNA (cDNA clone MGC:25664 IMAGE:4486464), complete cds.
          Length = 244

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 42/128 (32%), Positives = 73/128 (57%), Gaps = 1/128 (0%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLD-PKNCIRYRLSRGATKYLNGKHY 656
           KRP VD FLE ++Q++E+VV++    +Y   V ++LD  ++ ++ R  R       G + 
Sbjct: 110 KRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYI 169

Query: 655 RDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRP 476
           +DLS+++ D S ++ +          P+N + IK W  +  DTALL+L+P L+ +     
Sbjct: 170 KDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDAL--RFT 227

Query: 475 GDIRAVLS 452
            D+R+VLS
Sbjct: 228 ADVRSVLS 235



>gb:AL596185_2070985 Mouse DNA sequence from clone RP23-172M21 on
           chromosome 11 Contains the 5' end of the Centb1 gene for
           centaurin beta 1, the gene for a novel protein similar
           to protein phosphatase 1 regulatory (inhibitor) subunit
           2 Ppp1r2, a novel gene, the Gps2 gene for G protein
           pathway suppressor 2, the Eif5a gene for eukaryotic
           translation initiation factor 5A, the Ybx2 gene for Y
           box protein 2, the Slc2a4 gene for solute carrier family
           2 (facilitated glucose transporter) member 4, a
           non-muscle cofilin 1 (Cfl1) pseudogene, the Cldn7 gene
           for claudin 7, the Rai12 gene for retinoic acid induced
           12, the Dullard gene for Dullard homolog (Xenopus
           laevis) (novel NLI interacting factor-like phosphatase),
           the gene for novel PHD-finger protein JUNE1, the Dvl2
           gene for dishevelled 2 dsh homolog (Drosophila), the
           Acadvl gene for acyl-Coenzyme A dehydrogenase very long
           chain, the Dlgh4 gene for discs large homolog 4
           (Drosophila), the Asgr1 and Asgr2 genes for
           asialoglycoprotein receptor 1 and 2, a ribosomal protein
           L26 (Rpl26) pseudogene, the 5' end of the Mgl2 gene for
           macrophage galactose N-acetyl-galactosamine specific
           lectin 2 and nine CpG islands, complete sequence.
          Length = 243

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 42/128 (32%), Positives = 73/128 (57%), Gaps = 1/128 (0%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLD-PKNCIRYRLSRGATKYLNGKHY 656
           KRP VD FLE ++Q++E+VV++    +Y   V ++LD  ++ ++ R  R       G + 
Sbjct: 109 KRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYI 168

Query: 655 RDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRP 476
           +DLS+++ D S ++ +          P+N + IK W  +  DTALL+L+P L+ +     
Sbjct: 169 KDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDAL--RFT 226

Query: 475 GDIRAVLS 452
            D+R+VLS
Sbjct: 227 ADVRSVLS 234



>gb:HSA011916_2000069 Homo sapiens mRNA for hypothetical protein.
          Length = 244

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 42/128 (32%), Positives = 73/128 (57%), Gaps = 1/128 (0%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLD-PKNCIRYRLSRGATKYLNGKHY 656
           KRP VD FLE ++Q++E+VV++    +Y   V ++LD  ++ ++ R  R       G + 
Sbjct: 110 KRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYI 169

Query: 655 RDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRP 476
           +DLS+++ D S ++ +          P+N + IK W  +  DTALL+L+P L+ +     
Sbjct: 170 KDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDAL--RFT 227

Query: 475 GDIRAVLS 452
            D+R+VLS
Sbjct: 228 ADVRSVLS 235



>gb:BC009295_1971890 Homo sapiens dullard homolog (Xenopus laevis),
           mRNA (cDNA clone MGC:16648 IMAGE:4123279), complete cds.
          Length = 244

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 42/128 (32%), Positives = 73/128 (57%), Gaps = 1/128 (0%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLD-PKNCIRYRLSRGATKYLNGKHY 656
           KRP VD FLE ++Q++E+VV++    +Y   V ++LD  ++ ++ R  R       G + 
Sbjct: 110 KRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYI 169

Query: 655 RDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRP 476
           +DLS+++ D S ++ +          P+N + IK W  +  DTALL+L+P L+ +     
Sbjct: 170 KDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDAL--RFT 227

Query: 475 GDIRAVLS 452
            D+R+VLS
Sbjct: 228 ADVRSVLS 235



>gb:AC006780_1204031 Caenorhabditis elegans cosmid Y47D9A, complete
           sequence.
          Length = 287

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 40/114 (35%), Positives = 66/114 (57%), Gaps = 1/114 (0%)
 Frame = -1

Query: 829 RPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDP-KNCIRYRLSRGATKYLNGKHYR 653
           RP +  FL  +A+ FEI++++  + +Y + + + LDP KN IR+RL R     + G + +
Sbjct: 106 RPHLRTFLSRMAKTFEIIIFTASKKVYANKLCDILDPRKNHIRHRLFREHCVCVFGNYVK 165

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYV 491
           DL++L RDPSK + +       + Q +N + I+ W  +  DT LL L  FLE +
Sbjct: 166 DLTILGRDPSKTMILDNAVQSFAYQLDNGIPIESWFHDRNDTELLKLCSFLEAI 219



>gb:BC080328_2561647 Xenopus tropicalis MGC79498 protein, mRNA (cDNA
           clone MGC:79498 IMAGE:6976927), complete cds.
          Length = 466

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 40/112 (35%), Positives = 63/112 (56%), Gaps = 1/112 (0%)
 Frame = -1

Query: 829 RPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKN-CIRYRLSRGATKYLNGKHYR 653
           RP    FLE ++Q +EI++++  + +Y D ++  LDPK   +R+RL R     + G + +
Sbjct: 329 RPFFREFLERMSQIYEIILFTASKKVYADKLLNILDPKKRLVRHRLFREHCVCVQGNYIK 388

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           DL++L RD SK I I       + Q  N + I+ W  +  D  LL L+PFLE
Sbjct: 389 DLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDKELLKLVPFLE 440



>gb:BC047962_2549954 Xenopus laevis hypothetical protein MGC52903,
           mRNA (cDNA clone MGC:52903 IMAGE:4889354), complete cds.
          Length = 466

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 40/112 (35%), Positives = 63/112 (56%), Gaps = 1/112 (0%)
 Frame = -1

Query: 829 RPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKN-CIRYRLSRGATKYLNGKHYR 653
           RP    FLE ++Q +EI++++  + +Y D ++  LDPK   +R+RL R     + G + +
Sbjct: 329 RPFFREFLERMSQIYEIILFTASKKVYADKLLNILDPKKRLVRHRLFREHCVCVQGNYIK 388

Query: 652 DLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           DL++L RD SK I I       + Q  N + I+ W  +  D  LL L+PFLE
Sbjct: 389 DLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDKELLKLVPFLE 440



>gb:BC085649_2564526 Danio rerio zgc:92207, mRNA (cDNA clone
           MGC:92207 IMAGE:7051951), complete cds.
          Length = 245

 Score = 73.9 bits (180), Expect = 4e-12
 Identities = 42/128 (32%), Positives = 72/128 (56%), Gaps = 1/128 (0%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDP-KNCIRYRLSRGATKYLNGKHY 656
           KRP VD FLE ++Q++E+VV++    +Y   V ++LD  +  ++ R  R       G + 
Sbjct: 111 KRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNNRGILKRRYYRQHCTLDLGSYI 170

Query: 655 RDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRP 476
           +DLS+++ D S ++ +          P+N + IK W  +  DTALL+L+P L+ +     
Sbjct: 171 KDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDAL--RFT 228

Query: 475 GDIRAVLS 452
            D+R+VLS
Sbjct: 229 SDVRSVLS 236



>gb:AY341861_1600806 Hordeum vulgare subsp. vulgare
           CTD-phosphatase-like protein (Cpl1) mRNA, complete cds;
           alternatively spliced.>gb:AY341862_1600807 Hordeum
           vulgare subsp. vulgare CTD-phosphatase-like protein
           (Cpl1) gene, complete cds; alternatively spliced.
          Length = 445

 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 41/132 (31%), Positives = 72/132 (54%), Gaps = 1/132 (0%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCI-RYRLSRGATKYLNGKHY 656
           KRP +  FL+ +A+ F++V+++  QS+Y D +++RLDP+N +   R  R +  +    + 
Sbjct: 315 KRPHLHMFLQKMAEMFDVVIFTASQSVYADQLLDRLDPENTLFSKRFFRESCVFTESGYT 374

Query: 655 RDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRP 476
           +DL+++  D +KV  I        LQ  N + I+ W  +  D  L  LIPFLE +     
Sbjct: 375 KDLTVIGVDLAKVAIIDNTPQVFQLQVNNGIPIESWYNDPFDEGLSQLIPFLETLAV--A 432

Query: 475 GDIRAVLSSYEG 440
            D+R +++   G
Sbjct: 433 DDVRPIIAKRFG 444



>gb:PFMAL7P1_1191977 Plasmodium falciparum 3D7 chromosome 7, ***
           SEQUENCING IN PROGRESS ***, 12 ordered pieces.
          Length = 519

 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 51/174 (29%), Positives = 86/174 (49%), Gaps = 7/174 (4%)
 Frame = -1

Query: 856 RDRGWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVER--LDPKNCI-RYRLSRG 686
           R  GWR  KRP  D F + L+ F+EIV++SD        V+ +  +    C+ R + S+ 
Sbjct: 339 RKTGWRVLKRPYADRFFKELSSFYEIVIWSDDNFPVAQEVISKWGIPAIGCLHRDQCSKK 398

Query: 685 ATKYLNGKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIP 506
              Y+     +DL  L R+  +V+ I   A    LQPEN + IK + G+  D  +L LI 
Sbjct: 399 KKSYV-----KDLKRLGRNLDRVVIIDHDAKAFMLQPENGILIKEFHGDLNDKEMLCLID 453

Query: 505 FLE--YVGKHRPGDIRAVLSSYEGRD--VSKEFIERSKEHQRRMQEQKQQGRIW 356
            L+   +  H   DI   L  + G D  + K ++++  + +++ Q  +  G+I+
Sbjct: 454 LLKSFAISTH---DISQFLKKHGGGDYNIGKRYLQQKSDTEQKSQRIRNIGKIF 504



>gb:NC20H10_1688480 Neurospora crassa DNA linkage group V Cosmid
           contig 20H10.
          Length = 531

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 42/134 (31%), Positives = 69/134 (51%), Gaps = 1/134 (0%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDP-KNCIRYRLSRGATKYLNGKHY 656
           KRP  D FL  +++++ +VV++     Y DPV++ L+  +     R  R    + +G   
Sbjct: 395 KRPHCDEFLRRVSKWYNLVVFTASVQEYADPVIDWLESDRKYFSARYYRQHCTFRHGAFI 454

Query: 655 RDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRP 476
           +DLS +  D SKV+ +    L      +N + I+ W  +  D  L+ LIPFLE  G    
Sbjct: 455 KDLSSVEPDLSKVMILDNSPLSYMFHQDNAIPIQGWISDPTDLDLMYLIPFLE--GLQYV 512

Query: 475 GDIRAVLSSYEGRD 434
            D+RA+L+  +G D
Sbjct: 513 SDVRALLALRDGED 526



>gb:PFA929353_1393061 Plasmodium falciparum strain 3D7, chromosome
           5, segment 3/4.
          Length = 328

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 55/186 (29%), Positives = 89/186 (47%), Gaps = 3/186 (1%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHY- 656
           KRP +D F   L  F+EI++++     Y D V+  +D  + I  +  R     +N K Y 
Sbjct: 98  KRPYIDLFFSSLYPFYEIIIFTTAIKSYADTVLNIIDVDHYIDKKFYREDCYEMNEKLYI 157

Query: 655 RDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRP 476
           ++L+ + ++ SK+I I    +     P+N   IK W G+  D  LL LIPF  ++   + 
Sbjct: 158 KNLTNIKKELSKIILIDDSNISGFQYPDNFFPIKKWQGDLNDNELLHLIPF--FLNLRKL 215

Query: 475 GDIRAVLS--SYEGRDVSKEFIERSKEHQRRMQEQKQQGRIWRR*IQGLANCRIVYLFET 302
            DIR++ S      +DVSK     S +H + + +   +  ++R     LA   I YL   
Sbjct: 216 KDIRSLCSFRLISQKDVSKLLCTSSSKHIKYLTDDNSK-YLYR---HSLAFQAINYLKIF 271

Query: 301 MNNNNY 284
           MN   Y
Sbjct: 272 MNKFRY 277



>pir|C86421|C86421 F1N18.17 protein - Arabidopsis
           thaliana>gb:AE005172_891827 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC008030_1536477 Arabidopsis thaliana
           chromosome I BAC F1N18 genomic sequence, complete
           sequence.>gb:BT012604_1641674 Arabidopsis thaliana
           At1g29770 gene, complete cds.>gb:BT014842_1641832
           Arabidopsis thaliana At1g29770 gene, complete cds.
          Length = 278

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 39/124 (31%), Positives = 69/124 (55%), Gaps = 1/124 (0%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRPGV  FLE +++ + + +++     Y   V+++LD    I  RL R +   +NG++ +
Sbjct: 145 KRPGVTEFLERISKNYRVAIFTAGLPEYASQVLDKLDKNRVISQRLYRDSCTEVNGRYAK 204

Query: 652 DLSML-NRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRP 476
           DLS++   D   V+ +  +    SLQP+N + IKP+  + ED  L+ L  F +  G ++ 
Sbjct: 205 DLSLVAKNDLGSVLLVDDNPFSYSLQPDNGVPIKPFMDDMEDQELMKLAEFFD--GCYQY 262

Query: 475 GDIR 464
            D+R
Sbjct: 263 EDLR 266



>gb:AC135918_1742827 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0115F21, complete sequence.
          Length = 307

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 46/144 (31%), Positives = 76/144 (52%), Gaps = 2/144 (1%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCI-RYRLSRGATKYL-NGKH 659
           KRPGVDAFL   A  FE+VV++     Y   V++RLDP+  +  +RL RGA +   +G+ 
Sbjct: 172 KRPGVDAFLAAAAAAFELVVFTAGLPEYASLVLDRLDPRGALFAHRLYRGACRDAGDGRL 231

Query: 658 YRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHR 479
            +DL+   RD  + + +  +    SLQP+N + + P+  +++D  L  ++  L    +  
Sbjct: 232 VKDLAATGRDLRRAVIVDDNPNAYSLQPDNAVPVAPFIDDADDHELERVMGILSIAAEF- 290

Query: 478 PGDIRAVLSSYEGRDVSKEFIERS 407
             D+R  +  Y      KE +E S
Sbjct: 291 -DDVRDAIKRY------KEIVEAS 307



>gb:CNS07EGG_1374112 chromosome X of strain GB-M1 of Encephalitozoon
           cuniculi (Microspora).
          Length = 226

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 36/115 (31%), Positives = 60/115 (52%)
 Frame = -1

Query: 829 RPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYRD 650
           RP    F+      +E+V+++  +  Y   VV+R+D    I   L R +  + NG++ +D
Sbjct: 89  RPYAAEFISAAEALYEVVIFTSAKREYAKKVVDRIDTNKNISRILYRESCTFTNGRYVKD 148

Query: 649 LSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGK 485
           L  + R   +VI I  +     LQP N + I P+TG  +D +LL ++ FLE + K
Sbjct: 149 LRKVGRSLDRVILIDDNPYSYELQPRNGIHIPPYTGAEDDDSLLKILRFLEGLPK 203



>gb:AE013599_1130687 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003836_1227019 Drosophila melanogaster
           chromosome 2R, section 14 of 74 of the complete
           sequence.>gb:AY089227_1296883 Drosophila melanogaster
           AT02326 full insert cDNA.
          Length = 293

 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 44/147 (29%), Positives = 80/147 (54%), Gaps = 1/147 (0%)
 Frame = -1

Query: 844 WRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDP-KNCIRYRLSRGATKYLN 668
           +R FKRP VD FL+ +++++++V+Y+    +Y   VV+ LD  +  I  R  R   +  +
Sbjct: 147 FRVFKRPHVDEFLDFVSKWYDLVIYTASLEVYAAQVVDHLDAGRGLITRRFYRQHCRASS 206

Query: 667 GKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVG 488
               +DL+++  D S V+ I          P+N + IK +  + +DT LL ++PFL+ + 
Sbjct: 207 PMVSKDLTLVTPDMSGVLIIDNSPYAYRDFPDNAIPIKTFIYDPDDTELLKMLPFLDALR 266

Query: 487 KHRPGDIRAVLSSYEGRDVSKEFIERS 407
             +  D+R++L    GR V + +  RS
Sbjct: 267 FTK--DVRSIL----GRRVIRHYYNRS 287



>gb:AE016820_1749884 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VII, complete sequence.
          Length = 343

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 37/134 (27%), Positives = 74/134 (55%), Gaps = 3/134 (2%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYL--NGKH 659
           KRP  D FL  +++++++V+++     Y DPV++ L+    +R+   R  +  L  +G  
Sbjct: 207 KRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVG 266

Query: 658 Y-RDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKH 482
           Y +DLS+++++   +I +    +  ++  +N ++++ W  +  DT LL+L+P LE  G  
Sbjct: 267 YVKDLSIISKNLQDIIIVDNSPISYAMNVDNAIQVEGWISDPTDTGLLNLLPLLE--GLR 324

Query: 481 RPGDIRAVLSSYEG 440
              D R +LS   G
Sbjct: 325 FTTDTRNILSLKNG 338



>gb:AY231886_1177179 Drosophila yakuba clone yak-em_CG1696 mRNA
           sequence.
          Length = 144

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 42/128 (32%), Positives = 69/128 (53%), Gaps = 1/128 (0%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDP-KNCIRYRLSRGATKYLNGKHY 656
           KRP VD FL+ ++Q++++VV++    +Y   V ++LD  +N +R R  R       G + 
Sbjct: 10  KRPHVDYFLDVVSQWYDLVVFTASMEIYGAAVADKLDNGRNILRRRYYRQHCTPDYGSYT 69

Query: 655 RDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRP 476
           +DLS +  D +++  I          P N + IK W  +  DTALL L+P L+ +     
Sbjct: 70  KDLSAICSDLNRIFIIDNSPGAYRCFPNNAIPIKSWFSDPMDTALLSLLPMLDAL--RFT 127

Query: 475 GDIRAVLS 452
            D+R+VLS
Sbjct: 128 NDVRSVLS 135



>gb:AE014298_1126688 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003568_1215889 Drosophila melanogaster
           chromosome X, section 71 of 74 of the complete
           sequence.>gb:AY094776_1297950 Drosophila melanogaster
           LD04380 full insert cDNA.
          Length = 243

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 42/128 (32%), Positives = 69/128 (53%), Gaps = 1/128 (0%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDP-KNCIRYRLSRGATKYLNGKHY 656
           KRP VD FL+ ++Q++++VV++    +Y   V ++LD  +N +R R  R       G + 
Sbjct: 109 KRPHVDYFLDVVSQWYDLVVFTASMEIYGAAVADKLDNGRNILRRRYYRQHCTPDYGSYT 168

Query: 655 RDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRP 476
           +DLS +  D +++  I          P N + IK W  +  DTALL L+P L+ +     
Sbjct: 169 KDLSAICSDLNRIFIIDNSPGAYRCFPNNAIPIKSWFSDPMDTALLSLLPMLDAL--RFT 226

Query: 475 GDIRAVLS 452
            D+R+VLS
Sbjct: 227 NDVRSVLS 234



>gb:BC025650_2095128 Mus musculus CTD (carboxy-terminal domain, RNA
           polymerase II, polypeptide A) small phosphatase 2, mRNA
           (cDNA clone MGC:38258 IMAGE:5324816), complete cds.
          Length = 119

 Score = 66.2 bits (160), Expect = 7e-10
 Identities = 34/101 (33%), Positives = 51/101 (50%)
 Frame = -1

Query: 799 LAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYRDLSMLNRDPSK 620
           + + FE V+++   + Y DPV + LD     R RL R A  +  G + +DLS L RD  K
Sbjct: 1   MGELFECVLFTASLAKYADPVTDLLDRCGVFRARLFREACVFHQGCYVKDLSRLGRDLRK 60

Query: 619 VIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
            + +          PEN + ++ W  +  DT LL+LIP  E
Sbjct: 61  TVILDNSPASYIFHPENAVPVQSWFDDMADTELLNLIPVFE 101



>pir|T16371|T16371 hypothetical protein F45E12.1 - Caenorhabditis
           elegans>gb:U29536_1402832 Caenorhabditis elegans cosmid
           F45E12, complete sequence.
          Length = 246

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 40/128 (31%), Positives = 67/128 (52%), Gaps = 1/128 (0%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDP-KNCIRYRLSRGATKYLNGKHY 656
           +RP VD FL  ++Q++E+VV++    +Y   V +RLD  +  ++ R  R       G + 
Sbjct: 106 ERPHVDYFLSVVSQWYELVVFTASMEVYGTSVADRLDRGRGILKRRYFRQHCTMEVGGYT 165

Query: 655 RDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRP 476
           +DLS ++ D S +  +          P N + I  W  +  DT LL+L+PFL+ +     
Sbjct: 166 KDLSAIHPDLSSICILDNSPGAYRKFPHNAIPIPSWFSDPNDTCLLNLLPFLDAL--RFT 223

Query: 475 GDIRAVLS 452
            D+R+VLS
Sbjct: 224 SDVRSVLS 231



>gb:AE017344_1756260 Cryptococcus neoformans var. neoformans JEC21
           chromosome 4, complete sequence.
          Length = 1305

 Score = 64.3 bits (155), Expect = 3e-09
 Identities = 45/153 (29%), Positives = 76/153 (49%), Gaps = 19/153 (12%)
 Frame = -1

Query: 856 RDRGWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLD-PKNCIRYRLSR-GA 683
           R   +  +KRP VD FL+ +A ++ +V+++     Y DPV++ LD  +N    +L R   
Sbjct: 356 RSTMYHVYKRPYVDHFLKKVASWYTLVIFTASMPEYADPVIDWLDGGRNLFARKLYRENC 415

Query: 682 TKYLNGKHYRDLSMLNRDPSKVIYISGHALE------------SSLQPE-----NCLEIK 554
               NG + +DL+++ +D S+V ++    +              SL+P+     N L I+
Sbjct: 416 HVQPNGSYIKDLTLVEKDLSRVCFMDNSPVSYSWNKGRLFSTWRSLEPDRMGTANALPIE 475

Query: 553 PWTGESEDTALLDLIPFLEYVGKHRPGDIRAVL 455
            WT +  D ALL  IP L+ +      D+R VL
Sbjct: 476 GWTSDPNDEALLHSIPVLDSL--RFVNDVRRVL 506



>gb:AP004366_1840845 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0460C04.
          Length = 312

 Score = 63.9 bits (154), Expect = 4e-09
 Identities = 38/130 (29%), Positives = 74/130 (56%), Gaps = 3/130 (2%)
 Frame = -1

Query: 835 FKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLN-GKH 659
           F+RPG+  FL+  ++F ++++++     Y  P+V+R+D  N  + RL R +T      +H
Sbjct: 163 FERPGLHEFLQKTSEFADLILFTAGLEGYARPLVDRIDVHNRFKLRLYRPSTVTTEYREH 222

Query: 658 YRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWT-GESEDTALLDLI-PFLEYVGK 485
            +DLS +++D  +V+ +  +     LQP N +   P++ G+  D  L+++I P L+++  
Sbjct: 223 VKDLSCVSKDFCRVVIVDNNPFSFILQPLNGIPCVPFSAGQHNDNQLMEVIFPLLKHLSI 282

Query: 484 HRPGDIRAVL 455
            R  D+R  L
Sbjct: 283 QR--DVRPAL 290



>gb:AK117371_1815410 Arabidopsis thaliana At5g46410 mRNA for unknown
           protein, complete cds, clone: RAFL16-94-C23.
          Length = 453

 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 36/113 (31%), Positives = 60/113 (53%), Gaps = 1/113 (0%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKN-CIRYRLSRGATKYLNGKHY 656
           +RP +  FLE + + F +V+++   S+Y   +++ LDP    I  R  R +   L+G + 
Sbjct: 321 QRPHLYRFLERVGELFHVVIFTASHSIYASQLLDILDPDGKFISQRFYRDSCILLDGIYT 380

Query: 655 RDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           +DL++L  D +KV  I        LQ  N + IK W  +  D  L+ ++PFLE
Sbjct: 381 KDLTVLGLDLAKVAIIDNCPQVYRLQINNGIPIKSWYDDPTDDGLITILPFLE 433



>gb:AY074261_1567423 Arabidopsis thaliana unknown protein
           (At5g46410) mRNA, complete cds.>gb:AY096737_1576273
           Arabidopsis thaliana unknown protein (At5g46410) mRNA,
           complete cds.
          Length = 453

 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 36/113 (31%), Positives = 60/113 (53%), Gaps = 1/113 (0%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKN-CIRYRLSRGATKYLNGKHY 656
           +RP +  FLE + + F +V+++   S+Y   +++ LDP    I  R  R +   L+G + 
Sbjct: 321 QRPHLYRFLERVGELFHVVIFTASHSIYASQLLDILDPDGKFISQRFYRDSCILLDGIYT 380

Query: 655 RDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLE 497
           +DL++L  D +KV  I        LQ  N + IK W  +  D  L+ ++PFLE
Sbjct: 381 KDLTVLGLDLAKVAIIDNCPQVYRLQINNGIPIKSWYDDPTDDGLITILPFLE 433



>pir|T49208|T49208 hypothetical protein F27K19.140 - Arabidopsis
           thaliana>gb:ATF27K19_1550241 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F27K19.>gb:AY085070_1570152
           Arabidopsis thaliana clone 12627 mRNA, complete
           sequence.>gb:AY099806_1576831 Arabidopsis thaliana
           putative protein (At3g55960) mRNA, complete
           cds.>gb:BT000304_1634582 Arabidopsis thaliana putative
           protein (At3g55960) mRNA, complete cds.
          Length = 305

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 38/132 (28%), Positives = 70/132 (53%), Gaps = 5/132 (3%)
 Frame = -1

Query: 835 FKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGK-H 659
           F+RPG+  FLE L++F ++++++     Y  P+V+R+D +  +  RL R +T     + H
Sbjct: 156 FERPGLHEFLEQLSEFADLILFTAGLEGYARPLVDRIDTRKVLTNRLYRPSTVSTQYRDH 215

Query: 658 YRDLSMLNRDPSKVIYISGHALESSLQPEN---CLEIKPWTGESEDTALLDLI-PFLEYV 491
            +DL   +++  + + +  +     LQP N   C+      G+  DT LLD+I P L+ +
Sbjct: 216 VKDLLSTSKNMCRTVIVDNNPFSFLLQPSNGIPCIAFS--AGQPNDTQLLDVILPLLKQL 273

Query: 490 GKHRPGDIRAVL 455
            +    D+R  L
Sbjct: 274 SEE--DDVRPTL 283



>pir|T18721|T18721 hypothetical protein B0379.4 - Caenorhabditis
           elegans
          Length = 288

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 39/152 (25%), Positives = 62/152 (40%), Gaps = 38/152 (25%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYR 653
           KRP VD FL  + + FE ++++   + Y DPV + LD K   R RL R A  +  G + +
Sbjct: 111 KRPYVDEFLAKVGEHFECILFTASLAKYADPVADLLDKKRVFRGRLFREACVFHKGNYRK 170

Query: 652 D--------------------------------------LSMLNRDPSKVIYISGHALES 587
                                                  LS L R+ ++ + I       
Sbjct: 171 SNISDSFIFFSEIFGEIDYRKMKNLHFSSYFPEKIEKYYLSRLGRNLNQTLIIDNSPASY 230

Query: 586 SLQPENCLEIKPWTGESEDTALLDLIPFLEYV 491
           +  PEN + +  W  +  DT LLD++P LE++
Sbjct: 231 AFHPENAVPVTTWFDDPSDTELLDILPSLEHL 262



>pir|T40330|T40330 hypothetical protein SPBC3B8.10c - fission yeast 
           (Schizosaccharomyces pombe)>gb:SPBC3B8_1720028 S.pombe
           chromosome II cosmid c3B8.
          Length = 476

 Score = 59.7 bits (143), Expect = 7e-08
 Identities = 30/112 (26%), Positives = 58/112 (51%), Gaps = 1/112 (0%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLD-PKNCIRYRLSRGATKYLNGKHY 656
           KRP +D FL +++Q+F +++++     Y DP+++ L+  K     R  R     ++    
Sbjct: 346 KRPHLDYFLSNVSQWFRLILFTASVQPYADPIIDYLERDKKIFAKRYYRQHCALVDSSFV 405

Query: 655 RDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFL 500
           +D+S+ N   S+++ I       +   EN + I+ W  +  D  LL+L+ FL
Sbjct: 406 KDISICNIHLSRIMIIDNSPASYNAHKENAIPIEGWISDPSDVDLLNLLSFL 457



>gb:CNS07EGG_1374043 chromosome X of strain GB-M1 of Encephalitozoon
           cuniculi (Microspora).
          Length = 309

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 45/151 (29%), Positives = 71/151 (47%), Gaps = 3/151 (1%)
 Frame = -1

Query: 829 RPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYRD 650
           R   D FL H A  +E+V  S     +   ++ R+DP  CI Y++     K  + +H   
Sbjct: 107 RAFADLFLFHAAHIYELVHVSGSPGSFSRLLLHRIDPYGCISYKVYCKDKKTFSSEH--- 163

Query: 649 LSMLNRDPSKVIYISGHALESSLQPE-NCLEIKPWTGESEDTALLDLIPFLEYVGKHRPG 473
              LNR   +V+ +S    E     + N ++++ W+G+ E   LLDL+ FL  +      
Sbjct: 164 ---LNRPLQRVVVVSTRENEYHKDFDGNTIKLERWSGDPEH-GLLDLLNFLHSLHFMGIK 219

Query: 472 DIRAVLSSYEGRDVSKEF--IERSKEHQRRM 386
           D R  L SY G+D    F  +++S   QR M
Sbjct: 220 DFRGTLRSYLGKDFCSAFEKVQKSIFVQRNM 250



>gb:AE014296_1134522 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003477_1211821 Drosophila melanogaster
           chromosome 3L, section 11 of 83 of the complete
           sequence.
          Length = 236

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 35/128 (27%), Positives = 70/128 (54%), Gaps = 1/128 (0%)
 Frame = -1

Query: 835 FKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDP-KNCIRYRLSRGATKYLNGKH 659
           +KRP +D FL+ +++++++ V++    +Y  P+++ LD  +  +  RL R       GK 
Sbjct: 100 YKRPYLDHFLDRVSKWYDLTVFTSGAEIYASPILDFLDRGRGILNSRLYRQHCIEQFGKW 159

Query: 658 YRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHR 479
            + + +   D S V+ +   + E S   EN + IK +     D AL++L+PFL+ +   +
Sbjct: 160 SKSVLLACPDLSNVVLLDNSSTECSFNAENAILIKSYEIGCRDEALINLLPFLDALRFMK 219

Query: 478 PGDIRAVL 455
             D+R++L
Sbjct: 220 --DVRSML 225



>gb:AY751580_1626707 Phytophthora sojae putative nuclear LIM
           interactor-interacting protein (NIF5) gene, complete
           cds.
          Length = 237

 Score = 57.8 bits (138), Expect = 3e-07
 Identities = 33/109 (30%), Positives = 58/109 (53%), Gaps = 2/109 (1%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPK-NCIRYRLSRGATKYLNGKHY 656
           KRPG+D FLE  A+ +++ V++     Y  P+++ LDPK N    R  R + +   G   
Sbjct: 93  KRPGLDRFLEEAAKHYDVYVFTAGLEAYGKPILDALDPKGNLFAGRFFRESCQQRKGMFL 152

Query: 655 RDLSML-NRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDL 512
           +DLS++   D S+VI +  + +   +QP N + +  +  ++ D  L  L
Sbjct: 153 KDLSVVRGGDLSRVILVDNNPVSFLMQPSNGIPVPSFYDDANDRTLESL 201



>gb:CR382129_1661429 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 465

 Score = 56.6 bits (135), Expect = 6e-07
 Identities = 34/114 (29%), Positives = 61/114 (53%), Gaps = 3/114 (2%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCI---RYRLSRGATKYLNGK 662
           KRP  D FL+ + +++ +VV++     Y DPV++ L+ +      RY   +  TK  NG 
Sbjct: 331 KRPFCDDFLKLVCKWYNVVVFTASVQEYADPVIDWLEQEQRFFSKRY-YRQHCTKVGNG- 388

Query: 661 HYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFL 500
           + +DL+ +++D SK++ I    +   +   N + I+ W  +  D  LL L+P L
Sbjct: 389 YVKDLTCVDKDLSKLLIIDNSPISYMMHENNAIAIEGWINDPTDVDLLCLLPVL 442



>gb:CR382125_1658055 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 374

 Score = 56.6 bits (135), Expect = 6e-07
 Identities = 37/141 (26%), Positives = 68/141 (48%), Gaps = 9/141 (6%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIR--YRLSRGATKYLNGKH 659
           KRP  D FL+  +Q+++I +++     Y DPV++ L     ++  YR  R       G  
Sbjct: 231 KRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLRPGVG 290

Query: 658 Y-RDLSML------NRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFL 500
           Y +D+  +      +RD S++I I    +  ++  +N +++  W  +  D+ LL L+P L
Sbjct: 291 YVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSELLHLLPLL 350

Query: 499 EYVGKHRPGDIRAVLSSYEGR 437
           +        D R +L+   GR
Sbjct: 351 K--AMRHVTDSRCILALKSGR 369



>gb:AY751573_1626700 Phytophthora infestans putative nuclear LIM
           factor interactor-interacting protein hyphal form
           (NIFH1) mRNA, complete cds.
          Length = 237

 Score = 56.6 bits (135), Expect = 6e-07
 Identities = 32/109 (29%), Positives = 58/109 (53%), Gaps = 2/109 (1%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPK-NCIRYRLSRGATKYLNGKHY 656
           KRPG+D FLE  A+ +++ V++     Y  P+++ LDPK N    R  R + +   G   
Sbjct: 93  KRPGLDRFLEEAAKHYDVYVFTAGLEAYGKPILDALDPKGNLFAGRFFRESCQQRKGMFL 152

Query: 655 RDLSML-NRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDL 512
           +DL+++   D S+VI +  + +   +QP N + +  +  ++ D  L  L
Sbjct: 153 KDLNVVRGGDLSRVILVDNNPVSFLMQPSNGIPVPSFYDDANDRTLESL 201



>gb:AP003256_1826473 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0460E08.>gb:AP003274_1826986 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0512C01.
          Length = 54

 Score = 56.2 bits (134), Expect = 8e-07
 Identities = 26/38 (68%), Positives = 30/38 (78%)
 Frame = -1

Query: 505 FLEYVGKHRPGDIRAVLSSYEGRDVSKEFIERSKEHQR 392
           F + V   RP DIRAVL+SY+GRD+  EFIERSKEHQR
Sbjct: 17  FADNVAMARPSDIRAVLASYQGRDIPAEFIERSKEHQR 54



>gb:CR380957_1652640 Candida glabrata strain CBS138 chromosome K
           complete sequence.
          Length = 464

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 36/138 (26%), Positives = 67/138 (48%), Gaps = 11/138 (7%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPK--NCIRYRLSRGATKYLNGKH 659
           KRP  D FL  + +++ +++++     Y DPV++ L+         R+ R      +G  
Sbjct: 318 KRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVG 377

Query: 658 Y-RDLSMLNRDPSK--------VIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIP 506
           Y +DL  +    SK        V+ I    +  ++  +N ++++ W  +  DT LL+L+P
Sbjct: 378 YIKDLGNIKDPYSKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTELLNLLP 437

Query: 505 FLEYVGKHRPGDIRAVLS 452
           FLE +      D+R VL+
Sbjct: 438 FLEAL--RYTTDVRNVLA 453



>sp|P38757|YHG4_YEAST Hypothetical 50.6 kDa protein in RPL14B-GPA1
           intergenic region.>pir|S46802|S46802 hypothetical
           protein YHR004c - yeast (Saccharomyces
           cerevisiae)>gb:AY692950_1622997 Saccharomyces cerevisiae
           clone FLH113409.01X YHR004C gene, complete
           cds.>gb:YSCH9780_1729247 Saccharomyces cerevisiae
           chromosome VIII cosmid 9780.
          Length = 446

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 36/144 (25%), Positives = 69/144 (47%), Gaps = 13/144 (9%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPK--NCIRYRLSRGATKYLNGKH 659
           KRP  D FL  +++++++++++     Y DPV++ L+    +    R  R      +G  
Sbjct: 298 KRPYCDLFLTKVSKWYDLIIFTASMKEYADPVIDWLESSFPSSFSKRYYRSDCVLRDGVG 357

Query: 658 Y-RDLSMLNRDPSK----------VIYISGHALESSLQPENCLEIKPWTGESEDTALLDL 512
           Y +DLS++                VI I    +  ++  +N ++++ W  +  DT LL+L
Sbjct: 358 YIKDLSIVKDSEENGKGSSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNL 417

Query: 511 IPFLEYVGKHRPGDIRAVLSSYEG 440
           +PFLE        D+R +L+   G
Sbjct: 418 LPFLE--AMRYSTDVRNILALKHG 439



>gb:CR382134_1667075 Debaryomyces hansenii chromosome B of strain
           CBS767 of Debaryomyces hansenii.
          Length = 375

 Score = 49.3 bits (116), Expect = 9e-05
 Identities = 37/155 (23%), Positives = 70/155 (45%), Gaps = 21/155 (13%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLD----PKNCIRYRLSRGATKYLNG 665
           KRP  D FL+ +A++F++ +++     Y DP+++ L+    P     +   +G ++ +  
Sbjct: 220 KRPYCDFFLKEVAKWFDLQIFTASVKEYADPIIDWLESDISPYLTSNHDRQQGISRQVFT 279

Query: 664 KHY--------------RDLSML---NRDPSKVIYISGHALESSLQPENCLEIKPWTGES 536
           K Y              +DLS     + D   VI +    +  +L  +N + I+ W  + 
Sbjct: 280 KRYYRTDCSYRPGVGYIKDLSKFFPRDDDLKNVIILDNSPISYALHEDNAVMIEGWINDQ 339

Query: 535 EDTALLDLIPFLEYVGKHRPGDIRAVLSSYEGRDV 431
            D  LL+L+P L  +      D+R +L+   G  V
Sbjct: 340 NDRDLLNLLPMLHSLSLCI--DVRFILALRSGEKV 372



>gb:AY118321_1300043 Drosophila melanogaster LD08201 full insert
           cDNA.
          Length = 111

 Score = 46.2 bits (108), Expect = 8e-04
 Identities = 32/102 (31%), Positives = 50/102 (49%), Gaps = 1/102 (0%)
 Frame = -1

Query: 754 MYVDPVVERLDP-KNCIRYRLSRGATKYLNGKHYRDLSMLNRDPSKVIYISGHALESSLQ 578
           +Y   V ++LD  +N +R R  R       G + +DLS +  D +++  I          
Sbjct: 3   IYGAAVADKLDNGRNILRRRYYRQHCTPDYGSYTKDLSAICSDLNRIFIIDNSPGAYRCF 62

Query: 577 PENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPGDIRAVLS 452
           P N + IK W  +  DTALL L+P L+ +      D+R+VLS
Sbjct: 63  PNNAIPIKSWFSDPMDTALLSLLPMLDAL--RFTNDVRSVLS 102



>gb:AC108503_1738533 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1387_F08, complete
           sequence.>gb:AC121361_1740126 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBa0009E21,
           complete sequence.
          Length = 278

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 36/118 (30%), Positives = 61/118 (51%), Gaps = 7/118 (5%)
 Frame = -1

Query: 787 FEIVVYSDQQSMYVDPVVERLDPKN--CIR-YRLSRGATKYLNGKHYRDLSMLNRDPSKV 617
           F++   S +++ Y  P+V+R+D  N  C R YR S   T+Y   +H +DLS L++D  ++
Sbjct: 145 FDMECISAEKARYAKPLVDRIDAHNRFCHRLYRPSTVTTEY--REHVKDLSCLSKDFHRI 202

Query: 616 IYISGHALESSLQPEN---CLEIKPWTGESEDTALLDLI-PFLEYVGKHRPGDIRAVL 455
           + +  +     LQP N   CL      G+  D  L+ +I P L+++      D+R  L
Sbjct: 203 VLVDNNPYSFLLQPLNGIPCLTFS--AGQPVDDQLMGVIFPLLKHLSLQ--NDVRPAL 256



>gb:AB010698_1511232 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MPL12.
          Length = 293

 Score = 42.0 bits (97), Expect = 0.015
 Identities = 27/78 (34%), Positives = 39/78 (50%), Gaps = 1/78 (1%)
 Frame = -1

Query: 727 LDPKN-CIRYRLSRGATKYLNGKHYRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKP 551
           LDP    I  R  R +   L+G + +DL++L  D +KV  I        LQ  N + IK 
Sbjct: 196 LDPDGKFISQRFYRDSCILLDGIYTKDLTVLGLDLAKVAIIDNCPQVYRLQINNGIPIKS 255

Query: 550 WTGESEDTALLDLIPFLE 497
           W  +  D  L+ ++PFLE
Sbjct: 256 WYDDPTDDGLITILPFLE 273



>pir|T14814|T14814 hypothetical protein F15J5.110 - Arabidopsis
           thaliana>gb:ATCHRIV48_1545615 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 48.>gb:ATF15J5_1548726
           Arabidopsis thaliana DNA chromosome 4, BAC clone F15J5
           (ESSA project).
          Length = 307

 Score = 42.0 bits (97), Expect = 0.015
 Identities = 29/101 (28%), Positives = 49/101 (48%), Gaps = 1/101 (0%)
 Frame = -1

Query: 739 VVERLDPKN-CIRYRLSRGATKYLNGKHYRDLSMLNRDPSKVIYISGHALESSLQPENCL 563
           +++ LDP    +  R  R +    +G + +DL++L  D +KV  +        LQ  N +
Sbjct: 206 LLDILDPDGKFVSQRFYRDSCILSDGIYTKDLTVLGLDLAKVAIVDNCPQVYRLQINNGI 265

Query: 562 EIKPWTGESEDTALLDLIPFLEYVGKHRPGDIRAVLSSYEG 440
            IK W  +  D  L+ L+PFLE +      D+R V++   G
Sbjct: 266 PIKSWYDDPTDDGLITLLPFLETLAD--ANDVRPVIAKRFG 304



>gb:AC125735_1208147 Leishmania major strain Friedlin chromosome 3,
           complete sequence.
          Length = 738

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 15/52 (28%), Positives = 29/52 (55%)
 Frame = -1

Query: 844 WRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSR 689
           +  ++RP    FL   A+ F +V+++     Y D +++R+DP   ++YR  R
Sbjct: 350 FHVWERPYARLFLSTAAKLFNLVLFTSASKPYADTILQRIDPDRLLKYRYYR 401



>gb:AE017349_1758926 Cryptococcus neoformans var. neoformans JEC21
           chromosome 9, complete sequence.
          Length = 955

 Score = 36.2 bits (82), Expect = 0.82
 Identities = 16/44 (36%), Positives = 26/44 (59%)
 Frame = -1

Query: 850 RGWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDP 719
           R + T  RPG+  FL+ + Q +E+ VY+     Y D +V+ +DP
Sbjct: 304 RWYFTKPRPGLQRFLDEMCQLYEMHVYTMGTRTYADAIVKVIDP 347



>gb:PFMAL7P1_1191988 Plasmodium falciparum 3D7 chromosome 7, ***
           SEQUENCING IN PROGRESS ***, 12 ordered pieces.
          Length = 329

 Score = 35.0 bits (79), Expect = 1.8
 Identities = 36/139 (25%), Positives = 62/139 (44%), Gaps = 12/139 (8%)
 Frame = -1

Query: 781 IVVYSDQQSMYVDPVVERLDPKNCIR--YRLSRG-----ATKYLNGKHYRDLSMLNRDPS 623
           +V+  D Q  Y+D    R+ PK+ I+   + S+        +++  +H   +  LN    
Sbjct: 79  LVLRVDSQKGYIDLSKRRVSPKDIIKCEEKFSKSKKVHQTVRHVAKEHGITVEELNEKAI 138

Query: 622 KVIYIS-GHAL----ESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHRPGDIRAV 458
             +Y   GHAL    E+++ PEN  +    + E +++ L D+   L        G I   
Sbjct: 139 WPLYERYGHALDALKEATMNPENVFKGLDISEEIKNSLLKDIKLRLTPQALKLRGRIDVW 198

Query: 457 LSSYEGRDVSKEFIERSKE 401
              YEG D  KE +++ KE
Sbjct: 199 CFGYEGIDAVKEALKKGKE 217



>gb:AF486633_1804176 Arabidopsis thaliana CTD phosphatase-like 3
            (CPL3) mRNA, complete cds.
          Length = 1241

 Score = 34.3 bits (77), Expect = 3.1
 Identities = 16/47 (34%), Positives = 27/47 (57%)
 Frame = -1

Query: 847  GWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCI 707
            G  T  RPG+  FLE  ++ +E+ +Y+    +YV  + + LDPK  +
Sbjct: 977  GMWTKLRPGIWNFLEKASKLYELHLYTMGNKLYVTEMAKLLDPKGVL 1023



>gb:GGBBMI_2572940 Chicken mRNA for brush border myosin I (BBMI),
           partial cds.
          Length = 1000

 Score = 33.9 bits (76), Expect = 4.1
 Identities = 35/140 (25%), Positives = 58/140 (41%), Gaps = 15/140 (10%)
 Frame = -1

Query: 829 RPGV---DAFLEHLAQFFEIVV-YSDQQSMYVDPVVERLDPKNCIRYRLSRGATKY-LNG 665
           RPG    D F+  L Q F     Y  ++++    V +   P  C R     G   Y + G
Sbjct: 417 RPGTVNEDTFITKLNQIFASHKRYESKETLNAKHVTDVSLPLRCFRIHHYAGKVTYNVTG 476

Query: 664 KHYRDLSMLNRDPSKVIYISGHALESSLQPEN-----CLEIKPWTGESEDTALLDLIPFL 500
              ++  +L RD S+ ++ + H L  SL PE       L++ P TG     ++  L+  L
Sbjct: 477 FIEKNNDLLFRDLSQAMWAARHTLLRSLFPEGDPQRPSLKLPPTTGSQFKASVATLMKNL 536

Query: 499 -----EYVGKHRPGDIRAVL 455
                 Y+   +P D +  +
Sbjct: 537 YSKNPNYIRCIKPNDTKTAM 556



>pir|A33620|A33620 myosin heavy chain I, brush border - chicken
           (fragment)
          Length = 1000

 Score = 33.9 bits (76), Expect = 4.1
 Identities = 35/140 (25%), Positives = 58/140 (41%), Gaps = 15/140 (10%)
 Frame = -1

Query: 829 RPGV---DAFLEHLAQFFEIVV-YSDQQSMYVDPVVERLDPKNCIRYRLSRGATKY-LNG 665
           RPG    D F+  L Q F     Y  ++++    V +   P  C R     G   Y + G
Sbjct: 417 RPGTVNEDTFITKLNQIFASHKRYESKETLNAKHVTDVSLPLRCFRIHHYAGKVTYNVTG 476

Query: 664 KHYRDLSMLNRDPSKVIYISGHALESSLQPEN-----CLEIKPWTGESEDTALLDLIPFL 500
              ++  +L RD S+ ++ + H L  SL PE       L++ P TG     ++  L+  L
Sbjct: 477 FIEKNNDLLFRDLSQAMWAARHTLLRSLFPEGDPQRPSLKLPPTTGSQFKASVATLMKNL 536

Query: 499 -----EYVGKHRPGDIRAVL 455
                 Y+   +P D +  +
Sbjct: 537 YSKNPNYIRCIKPNDTKTAM 556



>sp|P47807|MY1A_CHICK Myosin Ia (Brush border myosin I) (BBM-I)
           (BBMI) (Myosin I heavy chain)
           (MIHC).>gb:GDU04049_2572605 Gallus domesticus brush
           border myosin I heavy chain mRNA, complete cds.
          Length = 1045

 Score = 33.9 bits (76), Expect = 4.1
 Identities = 35/140 (25%), Positives = 58/140 (41%), Gaps = 15/140 (10%)
 Frame = -1

Query: 829 RPGV---DAFLEHLAQFFEIVV-YSDQQSMYVDPVVERLDPKNCIRYRLSRGATKY-LNG 665
           RPG    D F+  L Q F     Y  ++++    V +   P  C R     G   Y + G
Sbjct: 462 RPGTVNEDTFITKLNQIFASHKRYESKETLNAKHVTDVSLPLRCFRIHHYAGKVTYNVTG 521

Query: 664 KHYRDLSMLNRDPSKVIYISGHALESSLQPEN-----CLEIKPWTGESEDTALLDLIPFL 500
              ++  +L RD S+ ++ + H L  SL PE       L++ P TG     ++  L+  L
Sbjct: 522 FIEKNNDLLFRDLSQAMWAARHTLLRSLFPEGDPQRPSLKLPPTTGSQFKASVATLMKNL 581

Query: 499 -----EYVGKHRPGDIRAVL 455
                 Y+   +P D +  +
Sbjct: 582 YSKNPNYIRCIKPNDTKTAM 601



>gb:AY380826_2339230 Lymphocystis disease virus - isolate China,
           complete genome.
          Length = 182

 Score = 33.5 bits (75), Expect = 5.3
 Identities = 32/122 (26%), Positives = 52/122 (42%), Gaps = 7/122 (5%)
 Frame = -1

Query: 829 RPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCIRYRLSRGATKYLNGKHYRD 650
           RP ++ FL  +   + + V++   + Y   +++ L  K    +   +   K L   +   
Sbjct: 66  RPYLEVFLNAVMDRYNVGVWTAASARYAIQIIKNLKFKKLGLFLYDKHWPKDLKKLNNLG 125

Query: 649 LSMLNRDPSKVIYISGHALE-SSLQPENCLEIKPWTG---ESEDTALLDLIP---FLEYV 491
            SM N       YI     E   LQP NCL IKP+     +++D  LL ++     LEY 
Sbjct: 126 YSMYNT------YIIDDLEEVEELQPNNCLRIKPFKAGIDQTDDYELLKILTKLINLEYT 179

Query: 490 GK 485
            K
Sbjct: 180 SK 181



>gb:PFMAL13_1191605 Plasmodium falciparum 3D7 chromosome 13, ***
            SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 1288

 Score = 33.5 bits (75), Expect = 5.3
 Identities = 15/41 (36%), Positives = 24/41 (58%)
 Frame = -1

Query: 829  RPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCI 707
            RP V  FL+ L+ ++E+ +Y++    Y D V+  LDP   I
Sbjct: 902  RPYVRQFLQILSLYYELAIYTNATREYADVVIAILDPDRTI 942



>gb:BX908798_830602 Parachlamydia-related symbiont UWE25, complete
           genome.
          Length = 256

 Score = 33.5 bits (75), Expect = 5.3
 Identities = 18/53 (33%), Positives = 28/53 (52%)
 Frame = -1

Query: 541 ESEDTALLDLIPFLEYVGKHRPGDIRAVLSSYEGRDVSKEFIERSKEHQRRMQ 383
           + E  +LLDL      + +H P  I     SY G D++K+ I  +++H RR Q
Sbjct: 44  DQEQASLLDLACGQGVLSRHLPSQI-----SYTGIDLAKQLITAARQHNRRAQ 91



>gb:BC082811_2108465 Mus musculus cDNA clone IMAGE:5694507, partial
           cds.
          Length = 510

 Score = 33.1 bits (74), Expect = 6.9
 Identities = 16/59 (27%), Positives = 35/59 (59%), Gaps = 6/59 (10%)
 Frame = -1

Query: 445 EGRDVSKEFIER------SKEHQRRMQEQKQQGRIWRR*IQGLANCRIVYLFETMNNNN 287
           E ++ +K+F+ER      +++ Q++ Q+Q+QQ  +W     G+ +  +  +F+T  +NN
Sbjct: 408 EAKEFAKQFLERRAKQKVNQQRQQQQQQQQQQDSVW-----GMNHSTLHSVFQTNQSNN 461



>gb:BC030845_2096875 Mus musculus trinucleotide repeat containing
           15, mRNA (cDNA clone IMAGE:4038229), partial cds.
          Length = 172

 Score = 33.1 bits (74), Expect = 6.9
 Identities = 16/59 (27%), Positives = 35/59 (59%), Gaps = 6/59 (10%)
 Frame = -1

Query: 445 EGRDVSKEFIER------SKEHQRRMQEQKQQGRIWRR*IQGLANCRIVYLFETMNNNN 287
           E ++ +K+F+ER      +++ Q++ Q+Q+QQ  +W     G+ +  +  +F+T  +NN
Sbjct: 70  EAKEFAKQFLERRAKQKVNQQRQQQQQQQQQQDSVW-----GMNHSTLHSVFQTNQSNN 123



>gb:BC027137_2095776 Mus musculus trinucleotide repeat containing
           15, mRNA (cDNA clone IMAGE:5357184), complete cds.
          Length = 423

 Score = 33.1 bits (74), Expect = 6.9
 Identities = 16/59 (27%), Positives = 35/59 (59%), Gaps = 6/59 (10%)
 Frame = -1

Query: 445 EGRDVSKEFIER------SKEHQRRMQEQKQQGRIWRR*IQGLANCRIVYLFETMNNNN 287
           E ++ +K+F+ER      +++ Q++ Q+Q+QQ  +W     G+ +  +  +F+T  +NN
Sbjct: 321 EAKEFAKQFLERRAKQKVNQQRQQQQQQQQQQDSVW-----GMNHSTLHSVFQTNQSNN 374



>gb:AY176043_2078129 Mus musculus Grb10 interacting GYF protein 2
            mRNA, complete cds.
          Length = 1291

 Score = 33.1 bits (74), Expect = 6.9
 Identities = 16/59 (27%), Positives = 35/59 (59%), Gaps = 6/59 (10%)
 Frame = -1

Query: 445  EGRDVSKEFIER------SKEHQRRMQEQKQQGRIWRR*IQGLANCRIVYLFETMNNNN 287
            E ++ +K+F+ER      +++ Q++ Q+Q+QQ  +W     G+ +  +  +F+T  +NN
Sbjct: 1189 EAKEFAKQFLERRAKQKVNQQRQQQQQQQQQQDSVW-----GMNHSTLHSVFQTNQSNN 1242



>gb:AK122337_2069002 Mus musculus mRNA for mKIAA0642 protein.
          Length = 1048

 Score = 33.1 bits (74), Expect = 6.9
 Identities = 16/59 (27%), Positives = 35/59 (59%), Gaps = 6/59 (10%)
 Frame = -1

Query: 445  EGRDVSKEFIER------SKEHQRRMQEQKQQGRIWRR*IQGLANCRIVYLFETMNNNN 287
            E ++ +K+F+ER      +++ Q++ Q+Q+QQ  +W     G+ +  +  +F+T  +NN
Sbjct: 946  EAKEFAKQFLERRAKQKVNQQRQQQQQQQQQQDSVW-----GMNHSTLHSVFQTNQSNN 999



>gb:AY850394_1630828 Lycopersicon esculentum cultivar Heinz1706
            chromosome 12 centromeric region.
          Length = 1227

 Score = 33.1 bits (74), Expect = 6.9
 Identities = 16/44 (36%), Positives = 24/44 (54%)
 Frame = -1

Query: 847  GWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPK 716
            G  T  RPG+  FLE  +  FE+ +Y+    +Y   + + LDPK
Sbjct: 963  GMWTKLRPGIWNFLEKASNLFELHLYTMGNKLYATEMAKLLDPK 1006



>gb:AC117072_1207654 Dictyostelium discoideum chromosome 2 map
           3879572-4071762 strain AX4, complete sequence.
          Length = 782

 Score = 32.7 bits (73), Expect = 9.0
 Identities = 31/157 (19%), Positives = 69/157 (43%), Gaps = 2/157 (1%)
 Frame = -1

Query: 832 KRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCI--RYRLSRGATKYLNGKH 659
           KRP +  FL  + + +E+ +Y+     Y + + + +DP++ I     LSR      NG +
Sbjct: 186 KRPHLVKFLTEVNKIYELHIYTMGTRNYANEIAKLIDPESSIFKERILSRDDG---NGIN 242

Query: 658 YRDLSMLNRDPSKVIYISGHALESSLQPENCLEIKPWTGESEDTALLDLIPFLEYVGKHR 479
           ++ L  L      ++ I     +   + +N ++I P+          D++  L       
Sbjct: 243 FKSLQRLFPCDDSMVLIVDDRSDVWKKSKNLIQISPY------VYFTDVVDSLH------ 290

Query: 478 PGDIRAVLSSYEGRDVSKEFIERSKEHQRRMQEQKQQ 368
                     +E + + ++ ++  +E Q++ Q+Q+QQ
Sbjct: 291 ----------HEKQPLLQQKLKEQQEQQQQQQQQQQQ 317



>pir|G84746|G84746 hypothetical protein At2g33540 [imported] -
            Arabidopsis thaliana>gb:AC002332_1530326 Arabidopsis
            thaliana chromosome 2 clone F4P9 map ve015, complete
            sequence.
          Length = 1066

 Score = 32.7 bits (73), Expect = 9.0
 Identities = 15/47 (31%), Positives = 26/47 (55%)
 Frame = -1

Query: 847  GWRTFKRPGVDAFLEHLAQFFEIVVYSDQQSMYVDPVVERLDPKNCI 707
            G  T  RPG+  FLE  ++ +E+ +Y+    +Y   + + LDPK  +
Sbjct: 954  GMWTKLRPGIWNFLEKASKLYELHLYTMGNKLYATEMAKLLDPKGVL 1000


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 835,455,454
Number of Sequences: 1806583
Number of extensions: 16689436
Number of successful extensions: 46556
Number of sequences better than 10.0: 162
Number of HSP's better than 10.0 without gapping: 44728
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46450
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 57913030826
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)