BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10239
         (1597 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY085253_1570325 Arabidopsis thaliana clone 141890 mRNA, comp...   400   e-110   
pir|T08924|T08924 hypothetical protein T15N24.30 - Arabidopsis t...   392   e-107   Arabidopsis thaliana [mouse-ear cress]
gb:AP003245_1826151 Oryza sativa (japonica cultivar-group) genom...   325   1e-87   
gb:AB011476_1511384 Arabidopsis thaliana genomic DNA, chromosome...   312   1e-83   
pir|G96835|G96835 probable RING zinc finger protein, 53384-54880...   182   1e-44   Arabidopsis thaliana [mouse-ear cress]
gb:AY074271_1567432 Arabidopsis thaliana unknown protein (At4g32...   175   2e-42   
pir|T04466|T04466 hypothetical protein F4D11.200 - Arabidopsis t...   175   2e-42   Arabidopsis thaliana [mouse-ear cress]
gb:AP002524_1822387 Oryza sativa (japonica cultivar-group) genom...   174   4e-42   
gb:AC130610_1740872 Oryza sativa (japonica cultivar-group) chrom...   174   4e-42   
gb:AP005879_1859549 Oryza sativa (japonica cultivar-group) genom...   166   2e-39   
gb:AP004057_1837039 Oryza sativa (japonica cultivar-group) genom...   150   7e-35   
gb:OSJN00203_1696651 Oryza sativa genomic DNA, chromosome 4, BAC...   123   9e-27   
gb:AP003916_1835174 Oryza sativa (japonica cultivar-group) genom...   119   1e-25   
gb:AY057713_1564125 Arabidopsis thaliana AT4g11680/T5C23_110 mRN...   116   2e-24   
gb:AY168924_1586415 Arabidopsis thaliana RES protein (RES) mRNA,...   114   4e-24   
gb:AY084480_1569569 Arabidopsis thaliana clone 109181 mRNA, comp...   114   7e-24   
pir|H96703|H96703 probable RING zinc finger protein T23K23.8 [im...   113   1e-23   Arabidopsis thaliana [mouse-ear cress]
gb:AP005885_1859667 Oryza sativa (japonica cultivar-group) genom...   112   2e-23   
gb:AY086095_1571153 Arabidopsis thaliana clone 21249 mRNA, compl...   112   3e-23   
gb:AY058092_1564231 Arabidopsis thaliana At1g63170/F16M19_7 mRNA...   112   3e-23   
pir|C96657|C96657 hypothetical protein F16M19.7 [imported] - Ara...   112   3e-23   Arabidopsis thaliana [mouse-ear cress]
gb:AE005172_890286 Arabidopsis thaliana chromosome 1, top arm co...   107   7e-22   
gb:AY224421_1590623 Oryza sativa (japonica cultivar-group) isola...   106   1e-21   
gb:AY059830_1564674 Arabidopsis thaliana putative protein (At3g6...   105   3e-21   
pir|T47910|T47910 hypothetical protein T20K12.80 - Arabidopsis t...   105   3e-21   Arabidopsis thaliana [mouse-ear cress]
pir|T04215|T04215 hypothetical protein T5C23.110 - Arabidopsis t...   102   2e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AP004880_1846517 Oryza sativa (japonica cultivar-group) genom...    92   3e-17   
pir|E85092|E85092 hypothetical protein AT4g09130 [imported] - Ar...    77   8e-13   Arabidopsis thaliana [mouse-ear cress]
pir|D85092|D85092 hypothetical protein AT4g09120 [imported] - Ar...    74   1e-11   Arabidopsis thaliana [mouse-ear cress]
gb:BC080409_2561709 Xenopus laevis MGC86297 protein, mRNA (cDNA ...    71   6e-11   
gb:BC081881_2108127 Rattus norvegicus cDNA clone MGC:93748 IMAGE...    71   6e-11   
gb:BC058182_2103089 Mus musculus ring finger protein 13, mRNA (c...    71   7e-11   
sp|O54965|RN13_MOUSE|RN13_MOUSE RING finger protein 13.>gb:AF037205_2051841...    71   7e-11   Mus musculus [mouse]
sp|Q90972|RN13_CHICK|RN13_CHICK RING finger protein 13 (C-RZF).>gb:GGRINGZN...    70   9e-11   Gallus gallus [bantam]
gb:AY084453_1569543 Arabidopsis thaliana clone 108568 mRNA, comp...    70   2e-10   
gb:AB025631_1516567 Arabidopsis thaliana genomic DNA, chromosome...    70   2e-10   
pir|T19377|T19377 hypothetical protein C18B12.4 - Caenorhabditis...    70   2e-10   Caenorhabditis elegans [roundworm]
pir|C85092|C85092 hypothetical protein AT4g09110 [imported] - Ar...    69   2e-10   Arabidopsis thaliana [mouse-ear cress]
sp|O43567|RN13_HUMAN|RN13_HUMAN RING finger protein 13.>gb:CR858160_1182347...    69   2e-10   Homo sapiens [man]
gb:AP004048_1836914 Oryza sativa (japonica cultivar-group) genom...    69   3e-10   
gb:OSJN00270_1697704 Oryza sativa genomic DNA, chromosome 4, BAC...    69   3e-10   
gb:AP005295_1850046 Oryza sativa (japonica cultivar-group) genom...    69   4e-10   
gb:PFA929354_1393197 Plasmodium falciparum strain 3D7, chromosom...    69   4e-10   
gb:AK029824_1161676 Mus musculus adult male testis cDNA, RIKEN f...    68   5e-10   
pir|T00481|T00481 probable RING zinc finger protein [imported] -...    68   5e-10   Arabidopsis thaliana [mouse-ear cress]
gb:BC056113_2551695 Xenopus laevis hypothetical protein MGC69137...    68   6e-10   
gb:AC121489_1740227 Oryza sativa (japonica cultivar-group) chrom...    68   6e-10   
gb:AB010699_1511248 Arabidopsis thaliana genomic DNA, chromosome...    68   6e-10   
gb:AE014297_1138680 Drosophila melanogaster chromosome 3R, compl...    68   6e-10   
gb:AE014297_1138678 Drosophila melanogaster chromosome 3R, compl...    68   6e-10   
pir|B86175|B86175 protein F19P19.21 [imported] - Arabidopsis tha...    68   6e-10   Arabidopsis thaliana [mouse-ear cress]
pir|D86474|D86474 probable RING zinc finger protein [imported] -...    68   6e-10   Arabidopsis thaliana [mouse-ear cress]
gb:BC065620_2554066 Danio rerio zgc:55660, mRNA (cDNA clone MGC:...    67   1e-09   
gb:BC044449_2548755 Danio rerio zgc:55660, mRNA (cDNA clone MGC:...    67   1e-09   
gb:BT015305_1358382 Drosophila melanogaster AT15166 full insert ...    67   1e-09   
gb:AE014297_1139070 Drosophila melanogaster chromosome 3R, compl...    67   1e-09   
gb:BC080893_2561808 Xenopus tropicalis rnf13-prov protein, mRNA ...    67   1e-09   
gb:BC063734_2553587 Xenopus laevis hypothetical protein MGC68556...    67   1e-09   
gb:CAR299062_1645235 Cicer arietinum partial mRNA for hypothetic...    67   1e-09   
gb:BT004268_1637347 Arabidopsis thaliana clone RAFL15-29-G07 (R5...    67   1e-09   
gb:AY054187_1563009 Arabidopsis thaliana AT4g30400/F17I23_260 mR...    67   1e-09   
gb:AB025638_1516671 Arabidopsis thaliana genomic DNA, chromosome...    67   1e-09   
pir|E85355|E85355 hypothetical protein AT4g30400 [imported] - Ar...    67   1e-09   Arabidopsis thaliana [mouse-ear cress]
pir|E96745|E96745 hypothetical protein T9N14.11 [imported] - Ara...    67   1e-09   Arabidopsis thaliana [mouse-ear cress]
gb:AB114041_2465685 Xenopus laevis XRnf12C mRNA for XRnf12C, com...    66   2e-09   
gb:AB114040_2465684 Xenopus laevis XRnf12B mRNA for XRnf12B, com...    66   2e-09   
gb:AK008329_1154518 Mus musculus adult male small intestine cDNA...    66   2e-09   
sp|Q9D0C1|Z364_MOUSE|Z364_MOUSE Zinc finger protein 364.>gb:AK011584_115648...    66   2e-09   Mus musculus [mouse]
gb:AP005681_1855893 Oryza sativa (japonica cultivar-group) genom...    66   2e-09   
gb:AY207044_1589557 Oryza sativa (indica cultivar-group) zinc-fi...    66   2e-09   
pir|G84678|G84678 probable RING zinc finger protein [imported] -...    66   2e-09   Arabidopsis thaliana [mouse-ear cress]
gb:AP005399_1851144 Oryza sativa (japonica cultivar-group) genom...    65   3e-09   
gb:AP003984_1835933 Oryza sativa (japonica cultivar-group) genom...    65   3e-09   
gb:AY080617_1568361 Arabidopsis thaliana putative RING-H2 zinc f...    65   3e-09   
gb:ATAC009177_1542858 Arabidopsis thaliana chromosome III BAC T1...    65   3e-09   
gb:AC073395_1541019 Arabidopsis thaliana chromosome 3 BAC F11B9 ...    65   3e-09   
gb:CQ834134_1453733 Sequence 5 from Patent WO2004058805.>gb:AF41...    65   3e-09   
pir|T06113|T06113 hypothetical protein T5J17.240 - Arabidopsis t...    65   3e-09   Arabidopsis thaliana [mouse-ear cress]
pir|T06680|T06680 hypothetical protein T17F15.100 - Arabidopsis ...    65   3e-09   Arabidopsis thaliana [mouse-ear cress]
pir|T04066|T04066 hypothetical protein F28M11.80 - Arabidopsis t...    65   3e-09   Arabidopsis thaliana [mouse-ear cress]
pir|T04065|T04065 hypothetical protein F28M11.70 - Arabidopsis t...    65   3e-09   Arabidopsis thaliana [mouse-ear cress]
pir|H85474|H85474 hypothetical protein AT4g40070 [imported] - Ar...    65   3e-09   Arabidopsis thaliana [mouse-ear cress]
sp|Q9Y4L5|Z364_HUMAN|Z364_HUMAN Zinc finger protein 364 (Fragment).>gb:HST0...    65   3e-09   Homo sapiens [man]
gb:BC039833_1982645 Homo sapiens ring finger protein 44, mRNA (c...    65   4e-09   
gb:AB029023_1865879 Homo sapiens mRNA for KIAA1100 protein, part...    65   4e-09   
gb:BT020585_1642979 Arabidopsis thaliana At5g45290 gene, complet...    65   4e-09   
gb:AY069873_1566619 Arabidopsis thaliana AT5g45290/K9E15_7 mRNA,...    65   4e-09   
gb:HSM805597_1187613 Homo sapiens mRNA; cDNA DKFZp434F1431 (from...    65   4e-09   
gb:BC082339_2562576 Xenopus laevis XRnf12 protein, mRNA (cDNA cl...    65   5e-09   
gb:AB114039_2465683 Xenopus laevis XRnf12 mRNA for XRnf12, compl...    65   5e-09   
gb:BC017630_2092524 Mus musculus ring finger protein 44, mRNA (c...    65   5e-09   
gb:AK129290_2069521 Mus musculus mRNA for mKIAA1100 protein.           65   5e-09   
gb:AL161792_1922220 Human DNA sequence from clone RP11-84P7 on c...    65   5e-09   
gb:AL161792_1922219 Human DNA sequence from clone RP11-84P7 on c...    65   5e-09   
gb:AL161792_1922218 Human DNA sequence from clone RP11-84P7 on c...    65   5e-09   
gb:AK024996_1910206 Homo sapiens cDNA: FLJ21343 fis, clone COL02...    65   5e-09   
gb:AF394047_1900586 Homo sapiens RING finger protein 38 (RNF38) ...    65   5e-09   
gb:HSM801785_1186449 Homo sapiens mRNA; cDNA DKFZp434A0926 (from...    65   5e-09   
gb:AP006067_1860833 Oryza sativa (japonica cultivar-group) genom...    64   7e-09   
gb:BT015918_1642536 Arabidopsis thaliana At5g10650 gene, complet...    64   7e-09   
gb:AY099680_1576705 Arabidopsis thaliana Pspzf zinc finger prote...    64   7e-09   
gb:ATTEL3S_1556656 Arabidopsis thaliana DNA chromosome 3, segmen...    64   7e-09   
gb:ATMAJ23_1553714 Arabidopsis thaliana DNA chromosome 5, P1 clo...    64   7e-09   
gb:AE016959_1023878 Oryza sativa (japonica cultivar-group) chrom...    64   7e-09   
gb:BC083548_2108634 Rattus norvegicus ring finger protein 38, mR...    64   9e-09   
gb:BC060730_2104173 Mus musculus ring finger protein 38, mRNA (c...    64   9e-09   
gb:AY039004_2074365 Mus musculus RNF6 protein mRNA, complete cds.      64   9e-09   
gb:AK127467_1916760 Homo sapiens cDNA FLJ45559 fis, clone BRTHA3...    64   9e-09   
gb:AF132016_1770849 Arabidopsis thaliana RING-H2 zinc finger pro...    64   9e-09   
gb:AC105773_1738245 Oryza sativa (japonica cultivar-group) chrom...    64   9e-09   
gb:OSJN00128_1695355 Oryza sativa genomic DNA, chromosome 4, BAC...    64   9e-09   
gb:AK029650_1161590 Mus musculus adult male testis cDNA, RIKEN f...    64   9e-09   
gb:AK004745_1152558 Mus musculus adult male lung cDNA, RIKEN ful...    64   9e-09   
pir|T00428|T00428 hypothetical protein At2g47560 [imported] - Ar...    64   9e-09   Arabidopsis thaliana [mouse-ear cress]
gb:BC023113_2094037 Mus musculus zinc finger protein 364, mRNA (...    64   1e-08   
gb:AP004704_1843704 Oryza sativa (japonica cultivar-group) genom...    64   1e-08   
gb:AY084377_1569468 Arabidopsis thaliana clone 106078 mRNA, comp...    64   1e-08   
gb:AY039551_1560264 Arabidopsis thaliana At1g49200/F27J15_35 mRN...    64   1e-08   
pir|T00480|T00480 probable RING zinc finger protein At2g34990 [i...    64   1e-08   Arabidopsis thaliana [mouse-ear cress]
sp|Q9WTV7|RN12_MOUSE|RN12_MOUSE RING finger protein 12 (LIM domain interact...    64   1e-08   Mus musculus [mouse]
gb:AL596117_2070852 Mouse DNA sequence from clone RP23-326P7 on ...    63   2e-08   
gb:AP005114_1848115 Oryza sativa (japonica cultivar-group) genom...    63   2e-08   
gb:AP004587_1841965 Oryza sativa (japonica cultivar-group) genom...    63   2e-08   
gb:AP004071_1837265 Oryza sativa (japonica cultivar-group) genom...    63   2e-08   
gb:AY136427_1581928 Arabidopsis thaliana RING finger-like protei...    63   2e-08   
gb:BX538350_1358784 Cryptosporidium parvum chromosome 6, complet...    63   2e-08   
pir|C86358|C86358 Similar to zinc finger protein [imported] - Ar...    63   2e-08   Arabidopsis thaliana [mouse-ear cress]
gb:BC083670_2108745 Rattus norvegicus similar to RIKEN cDNA 5730...    63   2e-08   
gb:AF480444_2066797 Rattus norvegicus RING finger protein OIP1 (...    63   2e-08   
gb:AP005425_1851637 Oryza sativa (japonica cultivar-group) genom...    63   2e-08   
gb:BT010323_1640270 Arabidopsis thaliana At1g23980 mRNA, complet...    63   2e-08   
gb:HSM801486_1186198 Homo sapiens mRNA; cDNA DKFZp434F0721 (from...    63   2e-08   
gb:CR749238_1180869 Homo sapiens mRNA; cDNA DKFZp686P0776 (from ...    63   2e-08   
gb:AE016959_1022769 Oryza sativa (japonica cultivar-group) chrom...    63   2e-08   
gb:AE005172_891351 Arabidopsis thaliana chromosome 1, top arm co...    63   2e-08   
pir|T43459|T43459 hypothetical protein DKFZp434F0721.1 - human (...    63   2e-08   Homo sapiens [man]
pir|T04483|T04483 probable ring finger protein - barley>gb:HVCH4...    63   2e-08   Hordeum vulgare [barley]
pir|T08944|T08944 hypothetical protein F25O24.10 - Arabidopsis t...    63   2e-08   Arabidopsis thaliana [mouse-ear cress]
pir|T51464|T51464 RING-H2 zinc finger protein-like - Arabidopsis...    63   2e-08   Arabidopsis thaliana [mouse-ear cress]
pir|H84566|H84566 probable RING zinc finger protein [imported] -...    63   2e-08   Arabidopsis thaliana [mouse-ear cress]
sp|Q9Y252|RNF6_HUMAN|RNF6_HUMAN RING finger protein 6 (RING-H2 protein).>gb...    63   2e-08   Homo sapiens [man]
gb:HSM805319_2017870 Homo sapiens mRNA; cDNA DKFZp566H073 (from ...    62   3e-08   
gb:HSM800147_2017112 Homo sapiens mRNA; cDNA DKFZp566H073 (from ...    62   3e-08   
gb:AP005511_1853146 Oryza sativa (japonica cultivar-group) genom...    62   3e-08   
gb:AP003722_1832391 Oryza sativa (japonica cultivar-group) genom...    62   3e-08   
gb:AF079183_1766305 Arabidopsis thaliana RING-H2 finger protein ...    62   3e-08   
gb:AY095995_1575869 Arabidopsis thaliana AT3g19950/MPN9_19 mRNA,...    62   3e-08   
gb:ATAC009895_1543067 Arabidopsis thaliana chromosome III BAC T2...    62   3e-08   
gb:ATAC009327_1542949 Arabidopsis thaliana chromosome III BAC T1...    62   3e-08   
gb:AB025631_1516571 Arabidopsis thaliana genomic DNA, chromosome...    62   3e-08   
gb:AB018118_1513882 Arabidopsis thaliana genomic DNA, chromosome...    62   3e-08   
gb:AE014297_1138575 Drosophila melanogaster chromosome 3R, compl...    62   3e-08   
pir|T08729|T08729 RING zinc finger protein homolog DKFZp566H073....    62   3e-08   Homo sapiens [man]
pir|T51859|T51859 RING-H2 finger protein RHG1a [imported] - Arab...    62   3e-08   Arabidopsis thaliana [mouse-ear cress]
gb:HSA271670_2001866 Homo sapiens Rnf12 gene for RING zinc finge...    62   3e-08   
gb:AL513007_1928657 Human DNA sequence from clone CTD-2530H13 on...    62   3e-08   
gb:AK025329_1910269 Homo sapiens cDNA: FLJ21676 fis, clone COL09...    62   3e-08   
gb:AF155109_1886621 Homo sapiens putative ring zinc finger prote...    62   3e-08   
gb:AP002543_1822643 Arabidopsis thaliana genomic DNA, chromosome...    62   3e-08   
gb:BT020620_1643014 Arabidopsis thaliana At5g05810 gene, complet...    62   3e-08   
gb:AB045120_1520332 Oryza sativa (japonica cultivar-group) EL5 m...    62   3e-08   
gb:AB005237_1509417 Arabidopsis thaliana genomic DNA, chromosome...    62   3e-08   
gb:AX876522_1476570 Sequence 11427 from Patent EP1074617.>gb:AK0...    62   3e-08   
gb:AY203930_1176298 Homo sapiens LP2254 mRNA, complete cds.            62   3e-08   
gb:AE005173_892663 Arabidopsis thaliana chromosome 1, bottom arm...    62   3e-08   
sp|Q9NVW2|RN12_HUMAN|RN12_HUMAN RING finger protein 12 (LIM domain interact...    62   3e-08   Homo sapiens [man]
gb:BC070590_2555569 Xenopus laevis hypothetical protein MGC81168...    62   4e-08   
gb:BC069835_2106126 Mus musculus ring finger 111, mRNA (cDNA clo...    62   4e-08   
gb:BC050268_2100404 Mus musculus ring finger protein 122, mRNA (...    62   4e-08   
gb:BC012960_2091675 Mus musculus ring finger protein 12, mRNA (c...    62   4e-08   
gb:BC060862_1985760 Homo sapiens ring finger protein 111, mRNA (...    62   4e-08   
gb:AP005511_1853145 Oryza sativa (japonica cultivar-group) genom...    62   4e-08   
gb:AP004777_1844928 Oryza sativa (japonica cultivar-group) genom...    62   4e-08   
gb:AP004564_1841652 Oryza sativa (japonica cultivar-group) genom...    62   4e-08   
gb:AJ586517_1811833 Fagus sylvatica partial zf1 mRNA for zinc fi...    62   4e-08   
gb:AC136217_1743023 Oryza sativa (japonica cultivar-group) chrom...    62   4e-08   
gb:AC124144_1740447 Oryza sativa (japonica cultivar-group) chrom...    62   4e-08   
gb:BT005844_1638766 Arabidopsis thaliana At4g24010 gene, complet...    62   4e-08   
gb:AB011474_1511360 Arabidopsis thaliana genomic DNA, chromosome...    62   4e-08   
gb:AX405832_1467760 Sequence 247 from Patent WO0222660.                62   4e-08   
gb:HSM802460_1186708 Homo sapiens mRNA; cDNA DKFZp761D081 (from ...    62   4e-08   
gb:CR861381_1185379 Pongo pygmaeus mRNA; cDNA DKFZp459A112 (from...    62   4e-08   
gb:AK077856_1172086 Mus musculus 13 days embryo forelimb cDNA, R...    62   4e-08   
gb:AK048110_1168293 Mus musculus 16 days embryo head cDNA, RIKEN...    62   4e-08   
gb:AK036351_1164439 Mus musculus 16 days neonate cerebellum cDNA...    62   4e-08   
gb:AK029295_1161422 Mus musculus 0 day neonate head cDNA, RIKEN ...    62   4e-08   
gb:AK013207_1157388 Mus musculus 10, 11 days embryo whole body c...    62   4e-08   
pir|T46904|T46904 hypothetical protein DKFZp761D081.1 - human>gb...    62   4e-08   Homo sapiens [man]
pir|T51844|T51844 RING-H2 finger protein RHA3a [imported] - Arab...    62   4e-08   Arabidopsis thaliana [mouse-ear cress]
pir|A84853|A84853 probable RING zinc finger protein [imported] -...    62   4e-08   Arabidopsis thaliana [mouse-ear cress]
pir|G96528|G96528 protein F27J15.2 [imported] - Arabidopsis thal...    62   4e-08   Arabidopsis thaliana [mouse-ear cress]
gb:BC081009_2561919 Xenopus laevis MGC81562 protein, mRNA (cDNA ...    61   6e-08   
gb:AF329847_2487920 Xenopus laevis ring finger-H2 protein (arkad...    61   6e-08   
gb:AF171875_2057708 Mus musculus g1-related zinc finger protein ...    61   6e-08   
gb:HSM806331_2018289 Homo sapiens mRNA; cDNA DKFZp686H1966 (from...    61   6e-08   
gb:AP005522_1853405 Oryza sativa (japonica cultivar-group) genom...    61   6e-08   
gb:OSJN00062_1694166 Oryza sativa genomic DNA, chromosome 4, BAC...    61   6e-08   
gb:BT002300_1635903 Arabidopsis thaliana At4g31450/F3L17_20 mRNA...    61   6e-08   
gb:AY647238_1619867 Zea mays unknown mRNA.                             61   6e-08   
gb:AB008264_1510380 Arabidopsis thaliana genomic DNA, chromosome...    61   6e-08   
pir|T10675|T10675 hypothetical protein F3L17.20 - Arabidopsis th...    61   6e-08   Arabidopsis thaliana [mouse-ear cress]
pir|T48058|T48058 RING-H2 zinc finger protein ATL5 - Arabidopsis...    61   6e-08   Arabidopsis thaliana [mouse-ear cress]
gb:BC070603_2555582 Xenopus laevis cDNA clone MGC:81253 IMAGE:66...    61   8e-08   
gb:AP004800_1845299 Oryza sativa (japonica cultivar-group) genom...    61   8e-08   
gb:AP004118_1837832 Oryza sativa (japonica cultivar-group) genom...    61   8e-08   
gb:AP003104_1824714 Oryza sativa (japonica cultivar-group) genom...    61   8e-08   
gb:AF132015_1770848 Arabidopsis thaliana RING-H2 zinc finger pro...    61   8e-08   
gb:AC124142_1740408 Oryza sativa (japonica cultivar-group) chrom...    61   8e-08   
gb:AC105734_1738079 Oryza sativa (japonica cultivar-group) chrom...    61   8e-08   
gb:BT010489_1640435 Arabidopsis thaliana At1g49230 gene, complet...    61   8e-08   
gb:AY090933_1574210 Arabidopsis thaliana putative RING zinc fing...    61   8e-08   
gb:ATAC011708_1543384 Arabidopsis thaliana chromosome III BAC T7...    61   8e-08   
gb:CR859911_1184012 Pongo pygmaeus mRNA; cDNA DKFZp469I142 (from...    61   8e-08   
pir|E84774|E84774 probable RING zinc finger protein [imported] -...    61   8e-08   Arabidopsis thaliana [mouse-ear cress]
pir|F86458|F86458 unknown protein, 73879-71181 [imported] - Arab...    61   8e-08   Arabidopsis thaliana [mouse-ear cress]
gb:BC050161_2550341 Danio rerio zgc:56424, mRNA (cDNA clone MGC:...    60   1e-07   
gb:AL627094_2504167 Zebrafish DNA sequence from clone RP71-PACKT...    60   1e-07   
gb:AF329846_2487919 Gallus gallus ring finger protein (arkadia) ...    60   1e-07   
gb:BC054842_2101871 Mus musculus ring finger 111, mRNA (cDNA clo...    60   1e-07   
gb:AF330197_2063382 Mus musculus Arkadia (Arkadia) mRNA, complet...    60   1e-07   
gb:BC020984_1977329 Homo sapiens ring finger protein 111, mRNA (...    60   1e-07   
gb:AK131488_1918022 Homo sapiens cDNA FLJ16671 fis, clone THYMU3...    60   1e-07   
gb:AK131304_1917860 Homo sapiens cDNA FLJ16278 fis, clone NT2RI3...    60   1e-07   
gb:AK095327_1914343 Homo sapiens cDNA FLJ38008 fis, clone CTONG2...    60   1e-07   
gb:AP005511_1853142 Oryza sativa (japonica cultivar-group) genom...    60   1e-07   
gb:AP004213_1838879 Oryza sativa (japonica cultivar-group) genom...    60   1e-07   
gb:AP003268_1826810 Oryza sativa (japonica cultivar-group) genom...    60   1e-07   
gb:AK117391_1815429 Arabidopsis thaliana At3g47990 mRNA for unkn...    60   1e-07   
gb:OSJN00157_1695846 Oryza sativa genomic DNA, chromosome 4, BAC...    60   1e-07   
gb:OSJN00057_1694040 Oryza sativa genomic DNA, chromosome 4, BAC...    60   1e-07   
gb:BT015731_1642349 Arabidopsis thaliana At4g28890 mRNA, complet...    60   1e-07   
gb:AB026654_1517307 Arabidopsis thaliana genomic DNA, chromosome...    60   1e-07   
gb:AB010692_1511100 Arabidopsis thaliana genomic DNA, chromosome...    60   1e-07   
gb:AX879408_1477810 Sequence 14313 from Patent EP1074617.>gb:AK0...    60   1e-07   
gb:CNS07EGF_1373915 chromosome VIII of strain GB-M1 of Encephali...    60   1e-07   
pir|T06684|T06684 hypothetical protein T17F15.140 - Arabidopsis ...    60   1e-07   Arabidopsis thaliana [mouse-ear cress]
pir|T52407|T52407 RING-H2 zinc finger protein ATL4 [imported] - ...    60   1e-07   Arabidopsis thaliana [mouse-ear cress]
pir|B84584|B84584 probable RING zinc finger protein [imported] -...    60   1e-07   Arabidopsis thaliana [mouse-ear cress]
gb:BC079688_2561227 Xenopus laevis MGC80300 protein, mRNA (cDNA ...    60   1e-07   
gb:AY190520_2078838 Rattus norvegicus Sprague-Dawley liver r-gol...    60   1e-07   
gb:AY155439_2076911 Mus musculus goliath-related E3 ubiquitin li...    60   1e-07   
gb:AL627187_2071579 Mouse DNA sequence from clone RP23-319B15 on...    60   1e-07   
gb:AL627187_2071578 Mouse DNA sequence from clone RP23-319B15 on...    60   1e-07   
gb:CR456397_1992688 Homo sapiens bK175E3.6 full length open read...    60   1e-07   
gb:AB051436_1867948 Homo sapiens mRNA for KIAA1133 protein, part...    60   1e-07   
gb:AP005775_1857666 Oryza sativa (japonica cultivar-group) genom...    60   1e-07   
gb:AF499727_1806156 Cucumis melo BAC clone PIT92-60K17, complete...    60   1e-07   
gb:AF079184_1766306 Arabidopsis thaliana RING-H2 finger protein ...    60   1e-07   
gb:AK085376_1174487 Mus musculus 0 day neonate kidney cDNA, RIKE...    60   1e-07   
pir|T49217|T49217 RING-H2 zinc finger protein ATL4 - Arabidopsis...    60   1e-07   Arabidopsis thaliana [mouse-ear cress]
pir|T02286|T02286 hypothetical protein T13D8.23 - Arabidopsis th...    60   1e-07   Arabidopsis thaliana [mouse-ear cress]
pir|T51855|T51855 RING-H2 finger protein RHX1a [imported] - Arab...    60   1e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AL662853_2072251 Mouse DNA sequence from clone RP23-293J16 on...    60   2e-07   
gb:BC065244_1986777 Homo sapiens ring finger protein 130, mRNA (...    60   2e-07   
gb:BC017100_1975908 Homo sapiens ring finger protein 130, mRNA (...    60   2e-07   
gb:AF155650_1886659 Human mRNA for goliath protein.                    60   2e-07   
gb:AP004159_1838372 Oryza sativa (japonica cultivar-group) genom...    60   2e-07   
gb:AP004096_1837667 Oryza sativa (japonica cultivar-group) genom...    60   2e-07   
gb:AC152974_1745244 Oryza sativa (japonica cultivar-group) chrom...    60   2e-07   
gb:AC134348_1741773 Oryza sativa (japonica cultivar-group) chrom...    60   2e-07   
gb:AC109596_1738739 Oryza sativa (japonica cultivar-group) chrom...    60   2e-07   
gb:AY579411_1616020 Oryza sativa (japonica cultivar-group) RING/...    60   2e-07   
gb:AY088181_1573203 Arabidopsis thaliana clone 426 mRNA, complet...    60   2e-07   
gb:AB020755_1514704 Arabidopsis thaliana genomic DNA, chromosome...    60   2e-07   
gb:AB011474_1511351 Arabidopsis thaliana genomic DNA, chromosome...    60   2e-07   
gb:AX083330_1460809 Sequence 22 from Patent WO0112660.>gb:AY0839...    60   2e-07   
pir|H84852|H84852 probable RING zinc finger protein [imported] -...    60   2e-07   Arabidopsis thaliana [mouse-ear cress]
pir|F85097|F85097 hypothetical protein AT4g09560 [imported] - Ar...    60   2e-07   Arabidopsis thaliana [mouse-ear cress]
gb:BC087570_2565387 Xenopus tropicalis cDNA clone MGC:97679 IMAG...    59   2e-07   
gb:BC073002_2556917 Xenopus laevis MGC82583 protein, mRNA (cDNA ...    59   2e-07   
gb:AP005723_1856570 Oryza sativa (japonica cultivar-group) genom...    59   2e-07   
gb:AP004888_1846658 Oryza sativa (japonica cultivar-group) genom...    59   2e-07   
gb:AP004818_1845639 Oryza sativa (japonica cultivar-group) genom...    59   2e-07   
gb:AP004082_1837425 Oryza sativa (japonica cultivar-group) genom...    59   2e-07   
gb:AP003104_1824705 Oryza sativa (japonica cultivar-group) genom...    59   2e-07   
gb:AK118283_1816270 Arabidopsis thaliana At3g19950 mRNA for unkn...    59   2e-07   
gb:OSJN00048_1693847 Oryza sativa genomic DNA, chromosome 4, BAC...    59   2e-07   
gb:AY780430_1628297 Populus alba x Populus tremula RING-H2 subgr...    59   2e-07   
gb:PFMAL3P5_1394519 Plasmodium falciparum MAL3P5, complete seque...    59   2e-07   
pir|T26069|T26069 hypothetical protein W02A11.3 - Caenorhabditis...    59   2e-07   
pir|B85092|B85092 hypothetical protein AT4g09100 [imported] - Ar...    59   2e-07   
gb:AY533211_2086313 Chinchilla lanigera goliath protein mRNA, pa...    59   3e-07   
gb:AP004654_1842740 Oryza sativa (japonica cultivar-group) genom...    59   3e-07   
gb:AK118593_1816562 Arabidopsis thaliana At2g17730 mRNA for unkn...    59   3e-07   
gb:AC136999_1743328 Oryza sativa (japonica cultivar-group) chrom...    59   3e-07   
gb:AC105734_1738078 Oryza sativa (japonica cultivar-group) chrom...    59   3e-07   
gb:BT006221_1639113 Arabidopsis thaliana At4g35840 gene, complet...    59   3e-07   
gb:AY088232_1573253 Arabidopsis thaliana clone 4581 mRNA, comple...    59   3e-07   
gb:AY081260_1568606 Arabidopsis thaliana unknown protein mRNA, c...    59   3e-07   
gb:AY045983_1561479 Arabidopsis thaliana unknown protein (At3g56...    59   3e-07   
gb:ATH400898_1552527 Arabidopsis thaliana mRNA for NEP1-interact...    59   3e-07   
gb:AC006300_1534031 Arabidopsis thaliana chromosome 2 clone F13B...    59   3e-07   
gb:AB022217_1515076 Arabidopsis thaliana genomic DNA, chromosome...    59   3e-07   
gb:AB095109_1198993 Ciona intestinalis CiGl mRNA, complete cds.        59   3e-07   
gb:AE016959_1023658 Oryza sativa (japonica cultivar-group) chrom...    59   3e-07   
pir|T41745|T41745 RING-H2 finger protein RHA3b [imported] - Arab...    59   3e-07   
pir|T50001|T50001 hypothetical protein F12B17.270 - Arabidopsis ...    59   3e-07   
pir|T52079|T52079 probable zinc finger protein [imported] - Arab...    59   3e-07   
pir|A86406|A86406 probable RING zinc finger protein [imported] -...    59   3e-07   
sp|Q06003|GOLI_DROME|GOLI_DROME Goliath protein (G1 protein).>pir|JC1495|JC...    59   3e-07   
gb:BC056088_2551670 Xenopus laevis hypothetical protein MGC69096...    59   4e-07   
gb:AP004818_1845645 Oryza sativa (japonica cultivar-group) genom...    59   4e-07   
gb:AP004809_1845437 Oryza sativa (japonica cultivar-group) genom...    59   4e-07   
gb:AP003104_1824709 Oryza sativa (japonica cultivar-group) genom...    59   4e-07   
gb:AB010697_1511206 Arabidopsis thaliana genomic DNA, chromosome...    59   4e-07   
pir|T33407|T33407 hypothetical protein H10E21.5 - Caenorhabditis...    59   4e-07   
pir|B85355|B85355 hypothetical protein AT4g30370 [imported] - Ar...    59   4e-07   
gb:AF069993_2471579 Gallus gallus LIM domain interacting RING fi...    58   5e-07   
gb:AL807825_2073073 Mouse DNA sequence from clone RP23-453B22 on...    58   5e-07   
gb:AP004847_1845913 Oryza sativa (japonica cultivar-group) genom...    58   5e-07   
gb:AF391808_1795340 Zea mays chromosome 9S bz genomic region str...    58   5e-07   
gb:AC091787_1735092 Oryza sativa (japonica cultivar-group) chrom...    58   5e-07   
gb:OSJN00182_1696321 Oryza sativa genomic DNA, chromosome 4, BAC...    58   5e-07   
gb:NCB24P11_1689926 Neurospora crassa DNA linkage group II BAC c...    58   5e-07   
gb:AY664416_1620638 Zea mays cultivar Mo17 locus bz, complete se...    58   5e-07   
gb:AY099807_1576832 Arabidopsis thaliana putative protein (At4g2...    58   5e-07   
gb:AK002414_1151184 Mus musculus adult male kidney cDNA, RIKEN f...    58   5e-07   
gb:AE013599_1133914 Drosophila melanogaster chromosome 2R, compl...    58   5e-07   
gb:AE013599_1133913 Drosophila melanogaster chromosome 2R, compl...    58   5e-07   
gb:AE016959_1023948 Oryza sativa (japonica cultivar-group) chrom...    58   5e-07   
pir|T38671|T38671 Zinc finger, C3HC4 type - fission yeast (Schiz...    58   5e-07   
pir|T05064|T05064 hypothetical protein M3E9.170 - Arabidopsis th...    58   5e-07   
gb:BC075492_2558595 Xenopus tropicalis ring finger protein 126, ...    58   6e-07   
gb:AP004657_1842787 Oryza sativa (japonica cultivar-group) genom...    58   6e-07   
gb:AP003771_1833362 Oryza sativa (japonica cultivar-group) genom...    58   6e-07   
gb:AP003508_1830071 Oryza sativa (japonica cultivar-group) genom...    58   6e-07   
gb:OSJN00059_1694085 Oryza sativa genomic DNA, chromosome 4, BAC...    58   6e-07   
gb:AY086760_1571803 Arabidopsis thaliana clone 27464 mRNA, compl...    58   6e-07   
gb:CNS07EGB_1373131 chromosome IV of strain GB-M1 of Encephalito...    58   6e-07   
pir|T48209|T48209 hypothetical protein T20L15.150 - Arabidopsis ...    58   6e-07   
pir|F71425|F71425 hypothetical protein - Arabidopsis thaliana>gb...    58   6e-07   
pir|B84751|B84751 hypothetical protein At2g34000 [imported] - Ar...    58   6e-07   
pir|G96791|G96791 probable RING zinc finger protein, 5217-5774 [...    58   6e-07   
pir|F86340|F86340 protein F2D10.34 [imported] - Arabidopsis thal...    58   6e-07   
gb:BC085525_2564428 Danio rerio zgc:103462, mRNA (cDNA clone MGC...    57   8e-07   
gb:AK000322_1907832 Homo sapiens cDNA FLJ20315 fis, clone HEP07873.    57   8e-07   
gb:AP005511_1853139 Oryza sativa (japonica cultivar-group) genom...    57   8e-07   
gb:AP003252_1826350 Oryza sativa (japonica cultivar-group) genom...    57   8e-07   
gb:AP003104_1824708 Oryza sativa (japonica cultivar-group) genom...    57   8e-07   
gb:AP000370_1819772 Arabidopsis thaliana genomic DNA, chromosome...    57   8e-07   
gb:AF079185_1766307 Arabidopsis thaliana RING-H2 finger protein ...    57   8e-07   
gb:SPAP32A8_1718596 S.pombe chromosome I p1 p32A8.                     57   8e-07   
gb:OSJN00128_1695350 Oryza sativa genomic DNA, chromosome 4, BAC...    57   8e-07   
gb:OSJN00077_1694446 Oryza sativa genomic DNA, chromosome 4, BAC...    57   8e-07   
gb:OSJN00048_1693848 Oryza sativa genomic DNA, chromosome 4, BAC...    57   8e-07   
gb:CR382132_1665163 Yarrowia lipolytica chromosome F of strain C...    57   8e-07   
gb:BT010932_1640878 Arabidopsis thaliana At1g49210 gene, complet...    57   8e-07   
gb:BT004600_1637634 Arabidopsis thaliana At1g49850 gene, complet...    57   8e-07   
gb:AY143948_1583405 Arabidopsis thaliana At3g15070/K15M2_22 mRNA...    57   8e-07   
gb:AY086250_1571305 Arabidopsis thaliana clone 22999 mRNA, compl...    57   8e-07   
gb:AB026654_1517308 Arabidopsis thaliana genomic DNA, chromosome...    57   8e-07   
gb:AX961982_1484483 Sequence 5 from Patent WO03104275.>gb:AB0818...    57   8e-07   
gb:CR749257_1180888 Homo sapiens mRNA; cDNA DKFZp781H02126 (from...    57   8e-07   
gb:CR627423_1180792 Homo sapiens mRNA; cDNA DKFZp781H0392 (from ...    57   8e-07   
gb:AE005173_892860 Arabidopsis thaliana chromosome 1, bottom arm...    57   8e-07   
pir|T05432|T05432 hypothetical protein F28A23.200 - Arabidopsis ...    57   8e-07   
pir|T51856|T51856 RING-H2 finger protein RHY1a [imported] - Arab...    57   8e-07   
pir|B84530|B84530 probable RING zinc finger protein [imported] -...    57   8e-07   
pir|D96535|D96535 RING-H2 finger protein RHY1a, 24780-23662 [imp...    57   8e-07   
gb:BC032328_1980402 Homo sapiens ring finger protein 149, mRNA (...    57   1e-06   
gb:BC021570_1977511 Homo sapiens zinc and ring finger 3, mRNA (c...    57   1e-06   
gb:AK130520_1917626 Homo sapiens cDNA FLJ27010 fis, clone SLV05175.    57   1e-06   
gb:AB033040_1866220 Homo sapiens mRNA for KIAA1214 protein, part...    57   1e-06   
gb:AP002521_1822305 Oryza sativa (japonica cultivar-group) genom...    57   1e-06   
gb:AC152974_1745239 Oryza sativa (japonica cultivar-group) chrom...    57   1e-06   
gb:AY679613_1622042 Fragaria x ananassa zinc finger family prote...    57   1e-06   
gb:AY088712_1573726 Arabidopsis thaliana clone 92525 mRNA, compl...    57   1e-06   
gb:AY070452_1566836 Arabidopsis thaliana putative protein with C...    57   1e-06   
gb:CQ783204_1452350 Sequence 3344 from Patent EP1396543.>gb:AK07...    57   1e-06   
gb:CQ782963_1452235 Sequence 3103 from Patent EP1396543.>gb:AX08...    57   1e-06   
pir|C86290|C86290 hypothetical protein T16N11.13 [imported] - Ar...    57   1e-06   
pir|B84567|B84567 probable RING zinc finger protein [imported] -...    57   1e-06   
gb:AP005883_1859630 Oryza sativa (japonica cultivar-group) genom...    57   1e-06   
gb:AP005399_1851151 Oryza sativa (japonica cultivar-group) genom...    57   1e-06   
gb:AP003104_1824710 Oryza sativa (japonica cultivar-group) genom...    57   1e-06   
gb:AF499720_1806143 Thellungiella halophila putative RING zinc f...    57   1e-06   
gb:AC099323_1737045 Oryza sativa chromosome 3 BAC OSJNBa0065F09 ...    57   1e-06   
gb:OSJN00098_1694868 Oryza sativa genomic DNA, chromosome 4, BAC...    57   1e-06   
gb:AY085027_1570109 Arabidopsis thaliana clone 124835 mRNA, comp...    57   1e-06   
gb:AY084564_1569653 Arabidopsis thaliana clone 112003 mRNA, comp...    57   1e-06   
gb:AK014094_1157779 Mus musculus 13 days embryo head cDNA, RIKEN...    57   1e-06   
pir|T05077|T05077 hypothetical protein T6K21.90 - Arabidopsis th...    57   1e-06   
pir|T47947|T47947 hypothetical protein F2A19.150 - Arabidopsis t...    57   1e-06   
pir|G96745|G96745 hypothetical protein T9N14.22 [imported] - Ara...    57   1e-06   
gb:BC016543_2092361 Mus musculus ring finger protein 126, mRNA (...    56   2e-06   
gb:AP005723_1856567 Oryza sativa (japonica cultivar-group) genom...    56   2e-06   
gb:AP005511_1853144 Oryza sativa (japonica cultivar-group) genom...    56   2e-06   
gb:AP005511_1853132 Oryza sativa (japonica cultivar-group) genom...    56   2e-06   
gb:AF211532_1777392 Nicotiana tabacum Avr9/Cf-9 rapidly elicited...    56   2e-06   
gb:BT012632_1641702 Arabidopsis thaliana At2g35420 mRNA, complet...    56   2e-06   
gb:AC019018_1538508 Arabidopsis thaliana chromosome 1 BAC F14G24...    56   2e-06   
gb:AB045121_1520333 Oryza sativa (japonica cultivar-group) RRF1 ...    56   2e-06   
gb:AB023482_1515599 Oryza sativa (japonica cultivar-group) genom...    56   2e-06   
gb:AE014135_1137634 Drosophila melanogaster chromosome 4, comple...    56   2e-06   
pir|D84899|D84899 hypothetical protein At2g46160 [imported] - Ar...    56   2e-06   
pir|D84768|D84768 hypothetical protein At2g35420 [imported] - Ar...    56   2e-06   
pir|T01585|T01585 probable RING zinc finger protein homolog At2g...    56   2e-06   
gb:BC070697_2555668 Xenopus laevis hypothetical protein MGC83223...    56   2e-06   
gb:BC075707_2106722 Mus musculus RIKEN cDNA 4732452J19 gene, mRN...    56   2e-06   
gb:AL596086_2070783 Mouse DNA sequence from clone RP23-168C20 on...    56   2e-06   
gb:AP005114_1848118 Oryza sativa (japonica cultivar-group) genom...    56   2e-06   
gb:AP003722_1832388 Oryza sativa (japonica cultivar-group) genom...    56   2e-06   
gb:AP000605_1820432 Arabidopsis thaliana genomic DNA, chromosome...    56   2e-06   
gb:AE017345_1757017 Cryptococcus neoformans var. neoformans JEC2...    56   2e-06   
gb:OSJN00044_1693790 Oryza sativa genomic DNA, chromosome 4, BAC...    56   2e-06   
gb:AB022220_1515142 Arabidopsis thaliana genomic DNA, chromosome...    56   2e-06   
gb:AB020742_1514565 Arabidopsis thaliana genomic DNA, chromosome...    56   2e-06   
gb:AK028750_1161140 Mus musculus 10 days neonate skin cDNA, RIKE...    56   2e-06   
pir|H96746|H96746 RING-H2 zinc finger protein (ATL3), 86824-8585...    56   2e-06   
gb:AY155441_2076913 Mus musculus goliath-related E3 ubiquitin li...    55   3e-06   
gb:AB016984_2043938 Mus musculus mRNA for Sperizin, complete cds.      55   3e-06   
gb:IR2259344_2038342 Homo sapiens mRNA full length insert cDNA c...    55   3e-06   
gb:BC001442_1967593 Homo sapiens ring finger protein 126, transc...    55   3e-06   
gb:AK127673_1916846 Homo sapiens cDNA FLJ45771 fis, clone NETRP2...    55   3e-06   
gb:AK000559_1908001 Homo sapiens cDNA FLJ20552 fis, clone KAT117...    55   3e-06   
gb:AP006533_1862349 Oryza sativa (japonica cultivar-group) genom...    55   3e-06   
gb:AP004299_1839761 Oryza sativa (japonica cultivar-group) genom...    55   3e-06   
gb:AP004299_1839760 Oryza sativa (japonica cultivar-group) genom...    55   3e-06   
gb:AP003771_1833365 Oryza sativa (japonica cultivar-group) genom...    55   3e-06   
gb:AF436851_1799891 Cucumis melo RING-H2 zinc finger protein mRN...    55   3e-06   
gb:AF417491_1798287 Medicago sativa RING-H2 protein (RH2-1) gene...    55   3e-06   
gb:AC105259_1737874 Oryza sativa (japonica cultivar-group) chrom...    55   3e-06   
gb:BT014952_1641922 Arabidopsis thaliana At1g24580 gene, complet...    55   3e-06   
gb:AY224527_1590724 Oryza sativa (japonica cultivar-group) isola...    55   3e-06   
gb:AY086415_1571463 Arabidopsis thaliana clone 250127 mRNA, comp...    55   3e-06   
gb:AK028082_1160781 Mus musculus adult male testis cDNA, RIKEN f...    55   3e-06   
gb:AE014297_1138178 Drosophila melanogaster chromosome 3R, compl...    55   3e-06   
gb:AE005172_891555 Arabidopsis thaliana chromosome 1, top arm co...    55   3e-06   
pir|T00747|T00747 RING-H2 finger protein RHC1a [imported] - Arab...    55   3e-06   
pir|B84443|B84443 hypothetical protein At2g03000 [imported] - Ar...    55   3e-06   
pir|D86379|D86379 protein F21J9.24 [imported] - Arabidopsis thal...    55   3e-06   
gb:BC079313_2107436 Rattus norvegicus similar to RIKEN cDNA 2500...    55   4e-06   
gb:AP003912_1835100 Oryza sativa (japonica cultivar-group) genom...    55   4e-06   
gb:AF448416_1800664 Zea mays B73 chromosome 9S bz genomic region.      55   4e-06   
gb:AY664415_1620620 Zea mays cultivar B73 locus 9009, complete s...    55   4e-06   
gb:AY069479_1294209 Drosophila melanogaster LD21637 full length ...    55   4e-06   
gb:AE005172_891580 Arabidopsis thaliana chromosome 1, top arm co...    55   4e-06   
pir|H96764|H96764 protein RING zinc finger protein F25P22.18 [im...    55   4e-06   
pir|T05078|T05078 hypothetical protein T6K21.100 - Arabidopsis t...    55   4e-06   
gb:BC079249_2107374 Rattus norvegicus cDNA clone MGC:94340 IMAGE...    55   5e-06   
gb:AP005823_1858490 Oryza sativa (japonica cultivar-group) genom...    55   5e-06   
gb:AP005511_1853136 Oryza sativa (japonica cultivar-group) genom...    55   5e-06   
gb:AP003514_1830218 Oryza sativa (japonica cultivar-group) genom...    55   5e-06   
gb:AK176482_1818470 Arabidopsis thaliana mRNA, complete cds, clo...    55   5e-06   
gb:AF532623_1809425 Glycine max RING-H2 finger protein mRNA, com...    55   5e-06   
gb:AC144737_1744138 Oryza sativa (japonica cultivar-group) chrom...    55   5e-06   
gb:AY090932_1574209 Arabidopsis thaliana unknown protein (At3g18...    55   5e-06   
gb:AB009049_1510600 Arabidopsis thaliana genomic DNA, chromosome...    55   5e-06   
pir|H86477|H86477 protein F15O4.19 [imported] - Arabidopsis thal...    55   5e-06   
gb:AC097175_1736469 Oryza sativa (japonica cultivar-group) chrom...    54   7e-06   
gb:AY116963_1579123 Arabidopsis thaliana At1g17970/F2H15_16 mRNA...    54   7e-06   
gb:AY087335_1572367 Arabidopsis thaliana clone 34363 mRNA, compl...    54   7e-06   
gb:AY086602_1571649 Arabidopsis thaliana clone 261272 mRNA, comp...    54   7e-06   
gb:AY050433_1562210 Arabidopsis thaliana At1g74410/F1M20_9 mRNA,...    54   7e-06   
gb:AC073556_1541133 Oryza sativa chromosome 3 BAC OSJNBa0091P11 ...    54   7e-06   
gb:AC004684_1532068 Arabidopsis thaliana chromosome 2 clone F13M...    54   7e-06   
gb:AB020744_1514587 Arabidopsis thaliana genomic DNA, chromosome...    54   7e-06   
gb:AE016959_1023690 Oryza sativa (japonica cultivar-group) chrom...    54   7e-06   
pir|T47692|T47692 hypothetical protein T22E16.190 - Arabidopsis ...    54   7e-06   
pir|T02524|T02524 probable RING zinc finger protein [imported] -...    54   7e-06   
pir|A86315|A86315 F2H15.19 protein - Arabidopsis thaliana>gb:AE0...    54   7e-06   
pir|H96772|H96772 probable RING zinc finger protein F1M20.9 [imp...    54   7e-06   
gb:AY155440_2076912 Mus musculus goliath-related E3 ubiquitin li...    54   9e-06   
gb:AB041548_2045418 Mus musculus brain cDNA, clone MNCb-3816, si...    54   9e-06   
gb:BC056677_1985329 Homo sapiens ring finger protein 128, mRNA (...    54   9e-06   
gb:AK126553_1916357 Homo sapiens cDNA FLJ44589 fis, clone BEAST2...    54   9e-06   
gb:AK098524_1915128 Homo sapiens cDNA FLJ25658 fis, clone TST00370.    54   9e-06   
gb:AK074264_1912441 Homo sapiens cDNA FLJ23684 fis, clone HEP098...    54   9e-06   
gb:AF394689_1900599 Homo sapiens GRAIL (GRAIL) mRNA, complete cds.     54   9e-06   
gb:AC006463_1875153 Homo sapiens BAC clone RP11-395G17 from 7, c...    54   9e-06   
gb:AC004449_1874579 Homo sapiens chromosome 19, cosmid R33683, c...    54   9e-06   
gb:AB070023_1870894 Macaca fascicularis testis cDNA clone:QtsA-1...    54   9e-06   
gb:AP003491_1829945 Oryza sativa (japonica cultivar-group) genom...    54   9e-06   
gb:AP002066_1821855 Arabidopsis thaliana genomic DNA, chromosome...    54   9e-06   
gb:CR857287_1181531 Pongo pygmaeus mRNA; cDNA DKFZp469O2321 (fro...    54   9e-06   
gb:AK018582_1159635 Mus musculus adult male cecum cDNA, RIKEN fu...    54   9e-06   
gb:AK017027_1158995 Mus musculus adult male testis cDNA, RIKEN f...    54   9e-06   
gb:AK004847_1152639 Mus musculus adult male liver cDNA, RIKEN fu...    54   9e-06   
pir|T51843|T51843 RING-H2 finger protein RHA2b [imported] - Arab...    54   9e-06   
pir|C84421|C84421 probable RING-H2 finger protein RHA2b [importe...    54   9e-06   
gb:BC017592_1976183 Homo sapiens zinc and ring finger 4, mRNA (c...    54   1e-05   
gb:AC005764_1875038 Homo sapiens chromosome 19, cosmid R31343, c...    54   1e-05   
gb:AP005511_1853133 Oryza sativa (japonica cultivar-group) genom...    54   1e-05   
gb:AP004687_1843386 Oryza sativa (japonica cultivar-group) genom...    54   1e-05   
gb:AP000836_1820660 Oryza sativa (japonica cultivar-group) genom...    54   1e-05   
gb:AY054498_1563152 Arabidopsis thaliana Unknown protein (At1g04...    54   1e-05   
gb:AC068900_1540476 Arabidopsis thaliana chromosome 3 BAC F11A12...    54   1e-05   
gb:AK018849_1159806 Mus musculus adult male testis cDNA, RIKEN f...    54   1e-05   
gb:AK010854_1156031 Mus musculus 13 days embryo liver cDNA, RIKE...    54   1e-05   
pir|T01001|T01001 hypothetical protein At2g39720 [imported] - Ar...    54   1e-05   
gb:BC068671_2555175 Xenopus laevis hypothetical protein MGC81063...    53   2e-05   
gb:AK098654_1915174 Homo sapiens cDNA FLJ25788 fis, clone TST06884.    53   2e-05   
gb:AB070058_1870929 Macaca fascicularis testis cDNA clone:QtsA-1...    53   2e-05   
gb:AP005511_1853134 Oryza sativa (japonica cultivar-group) genom...    53   2e-05   
gb:AP005297_1850085 Oryza sativa (japonica cultivar-group) genom...    53   2e-05   
gb:AP004125_1837961 Oryza sativa (japonica cultivar-group) genom...    53   2e-05   
gb:AP003760_1833063 Oryza sativa (japonica cultivar-group) genom...    53   2e-05   
gb:AP003760_1833062 Oryza sativa (japonica cultivar-group) genom...    53   2e-05   
gb:AE017341_1754213 Cryptococcus neoformans var. neoformans JEC2...    53   2e-05   
gb:AC145811_1744516 Oryza sativa chromosome 3 BAC OSJNBb0088L13 ...    53   2e-05   


>gb:AY085253_1570325 Arabidopsis thaliana clone 141890 mRNA, complete
            sequence.
          Length = 343

 Score =  400 bits (1027), Expect = e-110
 Identities = 194/326 (59%), Positives = 245/326 (75%), Gaps = 9/326 (2%)
 Frame = -1

Query: 1207 NSGAAATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTT 1028
            +S A  +S      S VA    Q R+ PS F +R+AM++SRARWFIFLRRVFHYQNGS  
Sbjct: 21   SSSALLSSSPRGDNSHVAAANGQERS-PSSFYIRLAMKVSRARWFIFLRRVFHYQNGSR- 78

Query: 1027 SDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCXXXXX 848
            SDLGSNPFNS TWMM E + L VQ+    +TLA+SKEERP+WP+R+W++GY  GC     
Sbjct: 79   SDLGSNPFNSSTWMMSELIALLVQLTVITFTLAISKEERPIWPVRLWITGYDVGCLLNLM 138

Query: 847  XLYCRYWVFYLRQRDESSAVSDIEQQRS--LEGSSVQMVEKCRTCVELFFAIWFVMGNVW 674
             LY RY    + Q +    + D+EQQ+    E  S  ++ KCRT +ELFFAIWFV+GNVW
Sbjct: 139  LLYGRYRQLDINQGN-GFVLGDVEQQQRGREETRSSHLMNKCRTSLELFFAIWFVIGNVW 197

Query: 673  VFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSV 494
            VFD+RFGSF  APKLHVLC+SLLAWNA+ YSFPF+LF+ LCC VP++SS LGYNMNMGS 
Sbjct: 198  VFDSRFGSFHHAPKLHVLCVSLLAWNAICYSFPFLLFLFLCCLVPLISSLLGYNMNMGSS 257

Query: 493  ERGASNEQLSSLPTWKYKQV---CNNPDLEN----ENPECCICLAQYRDKEEMRQLPCSH 335
            +R AS++Q+SSLP+WK+K++    ++ D ++    ++PECCICLA+Y+DKEE+R+LPCSH
Sbjct: 258  DRAASDDQISSLPSWKFKRIDDSASDSDSDSATVTDDPECCICLAKYKDKEEVRKLPCSH 317

Query: 334  VFHLNCVDQWLRIISCCPLCKKDLAR 257
             FH  CVDQWLRIISCCPLCK+DL R
Sbjct: 318  KFHSKCVDQWLRIISCCPLCKQDLPR 343



>pir|T08924|T08924 hypothetical protein T15N24.30 - Arabidopsis
            thaliana>gb:ATCHRIV65_1546539 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 65.>gb:ATT15N24_1554546
            Arabidopsis thaliana DNA chromosome 4, BAC clone T15N24
            (ESSA project).
          Length = 464

 Score =  392 bits (1006), Expect = e-107
 Identities = 197/328 (60%), Positives = 242/328 (73%), Gaps = 10/328 (3%)
 Frame = -1

Query: 1216 SFCNSGAAATSGEDTMMSVVARTQSQSRTQPSP-FMVRVAMRISRARWFIFLRRVFHYQN 1040
            S  NS   ++S       +   T +   + PS  F +R+AMR+SRARWFIFLRRVFHYQN
Sbjct: 141  SAINSITVSSSSSFASTQLDDNTHTAPESSPSSSFFMRLAMRVSRARWFIFLRRVFHYQN 200

Query: 1039 GSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCX 860
             S  SDLG+NPFNS+ WM+ E + L +QI     TLA+SK ERPVWPMR+W++GY  GC 
Sbjct: 201  ASR-SDLGTNPFNSIAWMVSELIALLLQITVITSTLALSKNERPVWPMRLWITGYNVGCL 259

Query: 859  XXXXXLYCRYWVFYLRQRDESS----AVSDIEQQ-RSLEGSS--VQMVEKCRTCVELFFA 701
                 LY RY     RQ+D S     +  DIEQQ RS E ++    ++ KCRT +ELFFA
Sbjct: 260  LNLMLLYGRY-----RQQDTSHENAFSFGDIEQQQRSREETTRCSHLMNKCRTSLELFFA 314

Query: 700  IWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFL 521
            IWFV+GNVWVFD+RFGSF  AP LHVLCISLLAWNA+ YSFPF+LF++LCC VP+VSSFL
Sbjct: 315  IWFVIGNVWVFDSRFGSFHYAPILHVLCISLLAWNALCYSFPFLLFLLLCCVVPLVSSFL 374

Query: 520  GYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLE--NENPECCICLAQYRDKEEMRQL 347
            GYNMN+GS E+GAS++Q+SSLP+WKYK +    D    N +PECCICLA+Y++KEE+R+L
Sbjct: 375  GYNMNVGSSEKGASDDQISSLPSWKYKLIDETSDSSQANNDPECCICLAKYKEKEEVRKL 434

Query: 346  PCSHVFHLNCVDQWLRIISCCPLCKKDL 263
            PCSH FHL CVDQWLRIISCCPLCK+DL
Sbjct: 435  PCSHRFHLKCVDQWLRIISCCPLCKQDL 462



>gb:AP003245_1826151 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0421H07.
          Length = 304

 Score =  325 bits (834), Expect = 1e-87
 Identities = 156/295 (52%), Positives = 204/295 (69%), Gaps = 7/295 (2%)
 Frame = -1

Query: 1123 SPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFT 944
            S F +R   R+SRARWFIFLRRV+ YQNG   SDLGSNPFNS  W+ +E   +  Q++ T
Sbjct: 16   SAFTMRAVARMSRARWFIFLRRVYQYQNGPR-SDLGSNPFNSPGWLALELGVIMAQMVVT 74

Query: 943  AYTLAVSKEERPVWPMRIWVSGYAFGCXXXXXXLYCRYWVFYLRQRDESSAVSDIEQQRS 764
               +A S +ERP WP+R+WV+ Y  G       LY R+     R     +    +     
Sbjct: 75   TAVVATSPKERPAWPLRVWVAAYNVGNVLSLPLLYWRH-----RHSSSGARGGTLSDDPE 129

Query: 763  LEGSS------VQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLA 602
            + G++        ++ K R  +ELFFA+WFVMGNVWVFD R GSF RAP+L+ LCI LLA
Sbjct: 130  MHGANDPLRNRSYLMNKARAFLELFFAMWFVMGNVWVFDARLGSFHRAPRLYALCIGLLA 189

Query: 601  WNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNP 422
            WNAV YS PF+LF++LCC VP V   LGYNMN  SV RGAS+EQL++LP W++K+  + P
Sbjct: 190  WNAVVYSLPFLLFLLLCCFVPAVGYALGYNMNSASVGRGASDEQLAALPQWRFKEPADAP 249

Query: 421  -DLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA 260
             D ++++ ECCICLAQY++KEE+RQLPC+H+FHL CVD+WLRIIS CPLCK++L+
Sbjct: 250  RDRDHDDQECCICLAQYKEKEEVRQLPCTHMFHLKCVDRWLRIISSCPLCKQELS 304



>gb:AB011476_1511384 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MDA7.
          Length = 320

 Score =  312 bits (800), Expect = 1e-83
 Identities = 153/260 (58%), Positives = 193/260 (74%), Gaps = 2/260 (0%)
 Frame = -1

Query: 1207 NSGAAATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTT 1028
            +S A  +S      S VA    Q R+ PS F +R+AM++SRARWFIFLRRVFHYQNGS  
Sbjct: 21   SSSALLSSSPRGDNSHVAAANGQERS-PSSFYIRLAMKVSRARWFIFLRRVFHYQNGSR- 78

Query: 1027 SDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCXXXXX 848
            SDLGSNPFNS TWMM E + L VQ+    +TLA+SKEERP+WP+R+W++GY  GC     
Sbjct: 79   SDLGSNPFNSSTWMMSELIALLVQLTVITFTLAISKEERPIWPVRLWITGYDVGCLLNLM 138

Query: 847  XLYCRYWVFYLRQRDESSAVSDIEQQRS--LEGSSVQMVEKCRTCVELFFAIWFVMGNVW 674
             LY RY    + Q +    + D+EQQ+    E  S  ++ KCRT +ELFFAIWFV+GNVW
Sbjct: 139  LLYGRYRQLDINQGN-GFVLGDVEQQQRGREETRSSHLMNKCRTSLELFFAIWFVIGNVW 197

Query: 673  VFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSV 494
            VFD+RFGSF  APKLHVLC+SLLAWNA+ YSFPF+LF+ LCC VP++SS LGYNMNMGS 
Sbjct: 198  VFDSRFGSFHHAPKLHVLCVSLLAWNAICYSFPFLLFLFLCCLVPLISSLLGYNMNMGSS 257

Query: 493  ERGASNEQLSSLPTWKYKQV 434
            +R AS++Q+SSLP+WK+K++
Sbjct: 258  DRAASDDQISSLPSWKFKRI 277



>pir|G96835|G96835 probable RING zinc finger protein, 53384-54880
            [imported] - Arabidopsis thaliana>gb:AE005173_895553
            Arabidopsis thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC018848_1538410 Arabidopsis thaliana
            chromosome 1 BAC F5I6 genomic sequence, complete
            sequence.>gb:AY062845_1565501 Arabidopsis thaliana
            putative RING zinc finger protein (At1g80400; F5I6.15)
            mRNA, complete cds.>gb:BT000070_1634348 Arabidopsis
            thaliana putative RING zinc finger protein (At1g80400)
            mRNA, complete cds.
          Length = 407

 Score =  182 bits (463), Expect = 1e-44
 Identities = 119/362 (32%), Positives = 174/362 (48%), Gaps = 55/362 (15%)
 Frame = -1

Query: 1183 GEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPF 1004
            GE+T++S    TQ Q  T PSP   R               R     NG  T     +P 
Sbjct: 57   GEETVLSSSNATQ-QHPTHPSPPQQRPTSS-----------RRGDNGNGRRTR----SPL 100

Query: 1003 NSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCXXXXXXLYCRYWV 824
            NS  W+ +E V    QI+     + ++K+E P  P+  WV GY  GC      LY R+  
Sbjct: 101  NSGLWISVELVVTVAQIVAAIVVMVLAKDEHPEAPLFTWVIGYTCGCLATLPILYWRFRT 160

Query: 823  FYLRQRDESS------------------AVSDIEQQRSLEGSSV-----QMVEKCRT--- 722
            +      +SS                  +V+    + +  G S      Q+ E  RT   
Sbjct: 161  YNRATGQDSSQRATSSQGNSESTPYTAVSVAQAADEENSTGVSAAPRNNQVGESLRTRLN 220

Query: 721  --------CVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFIL 566
                     ++ FFA+WFV+GNVW+F     S   +PKL+ LCI+ L ++ + Y+ PFIL
Sbjct: 221  GLVDHFKMAIDCFFAVWFVVGNVWIFGGH-SSPSDSPKLYRLCIAFLTFSCIGYAMPFIL 279

Query: 565  FVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLE--------- 413
               +CCC+P + S LG+  N  S  RGA+ E +++LP +++K    N DLE         
Sbjct: 280  CATICCCLPCLISVLGFRENF-SQTRGATAEAINALPVYRFKSKSRN-DLEFSEEGEGGF 337

Query: 412  ------------NENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKK 269
                         E+  CCICL +Y D E++R+LPCSHVFH++CVD+WL+I + CPLCK 
Sbjct: 338  LLLGSQKKRLISGEDASCCICLTRYGDDEQVRELPCSHVFHVDCVDKWLKINATCPLCKN 397

Query: 268  DL 263
            ++
Sbjct: 398  EV 399



>gb:AY074271_1567432 Arabidopsis thaliana unknown protein (At4g32600)
            mRNA, complete cds.>gb:AY081300_1568646 Arabidopsis
            thaliana putative protein (At4g32600) mRNA, complete
            cds.>gb:AY096655_1576191 Arabidopsis thaliana unknown
            protein (At4g32600) mRNA, complete cds.
          Length = 453

 Score =  175 bits (444), Expect = 2e-42
 Identities = 117/402 (29%), Positives = 180/402 (44%), Gaps = 64/402 (15%)
 Frame = -1

Query: 1276 RFLVDRANMNMNNRGLLTTDSFCNSGAAATSGEDTMMSVVARTQSQSRTQPSPFMVRVAM 1097
            RF+      N++    +  D   N+  A++S     +S V         +PS      A 
Sbjct: 21   RFMERSPENNLSRNEHIIIDIPRNAAIASSSSSHDRISNVLEPLQHEEERPSTVSPMAAP 80

Query: 1096 RISRARWFIFLRRVFHYQNGSTTSDLGSNP---------FNSLTWMMMECVTLSVQIMFT 944
            + + A               S++S + SNP          NS  W+ +E      QI+  
Sbjct: 81   QPATA-------------TASSSSSMRSNPRSVRRRRSPLNSGLWISIELFLTVGQIIAA 127

Query: 943  AYTLAVSKEERPVWPMRIWVSGYAFGCXXXXXXLYCRYWVFYLRQRDES----------- 797
               L++SK E P  P+  W+ GYA GC      LY RY+        +S           
Sbjct: 128  IVVLSLSKHEHPRAPLFTWIVGYACGCVATLPLLYWRYYHSNQASEQDSGQHRPNLNVAA 187

Query: 796  -------SAVSDIEQQRSLEGSS--------------VQMVEKCRTCVELFFAIWFVMGN 680
                   S  S+ + +++   SS                +VE  +  ++ FFA+WFV+GN
Sbjct: 188  GPFAFSISRTSEADGRQTNTTSSRGSRYPGFISAARLKVIVEYFKMALDCFFAVWFVVGN 247

Query: 679  VWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMG 500
            VW+F     S   AP L+ LC+  L ++ + Y+ PFIL   +CCC+P + S LGY  ++ 
Sbjct: 248  VWIFGGH-SSAAEAPNLYRLCLVFLTFSCIGYAMPFILCTTICCCLPCIISILGYREDL- 305

Query: 499  SVERGASNEQLSSLPTWKYKQ-----------------------VCNNPDLENENPECCI 389
            +  RGA+ E +++LPT K+K                          N   +  E+  CCI
Sbjct: 306  TQPRGATPESINALPTHKFKLKKSRSNGDDNGSSTSEGGVVAAGTDNERAISGEDAVCCI 365

Query: 388  CLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
            CLA+Y + EE+R+LPCSH FH  CVD+WL+I + CPLCK ++
Sbjct: 366  CLAKYANNEELRELPCSHFFHKECVDKWLKINASCPLCKSEV 407



>pir|T04466|T04466 hypothetical protein F4D11.200 - Arabidopsis
            thaliana>gb:ATCHRIV77_1547180 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 77.>gb:ATF4D11_1550652
            Arabidopsis thaliana DNA chromosome 4, BAC clone F4D11
            (ESSAII project).
          Length = 495

 Score =  175 bits (444), Expect = 2e-42
 Identities = 117/402 (29%), Positives = 180/402 (44%), Gaps = 64/402 (15%)
 Frame = -1

Query: 1276 RFLVDRANMNMNNRGLLTTDSFCNSGAAATSGEDTMMSVVARTQSQSRTQPSPFMVRVAM 1097
            RF+      N++    +  D   N+  A++S     +S V         +PS      A 
Sbjct: 21   RFMERSPENNLSRNEHIIIDIPRNAAIASSSSSHDRISNVLEPLQHEEERPSTVSPMAAP 80

Query: 1096 RISRARWFIFLRRVFHYQNGSTTSDLGSNP---------FNSLTWMMMECVTLSVQIMFT 944
            + + A               S++S + SNP          NS  W+ +E      QI+  
Sbjct: 81   QPATA-------------TASSSSSMRSNPRSVRRRRSPLNSGLWISIELFLTVGQIIAA 127

Query: 943  AYTLAVSKEERPVWPMRIWVSGYAFGCXXXXXXLYCRYWVFYLRQRDES----------- 797
               L++SK E P  P+  W+ GYA GC      LY RY+        +S           
Sbjct: 128  IVVLSLSKHEHPRAPLFTWIVGYACGCVATLPLLYWRYYHSNQASEQDSGQHRPNLNVAA 187

Query: 796  -------SAVSDIEQQRSLEGSS--------------VQMVEKCRTCVELFFAIWFVMGN 680
                   S  S+ + +++   SS                +VE  +  ++ FFA+WFV+GN
Sbjct: 188  GPFAFSISRTSEADGRQTNTTSSRGSRYPGFISAARLKVIVEYFKMALDCFFAVWFVVGN 247

Query: 679  VWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMG 500
            VW+F     S   AP L+ LC+  L ++ + Y+ PFIL   +CCC+P + S LGY  ++ 
Sbjct: 248  VWIFGGH-SSAAEAPNLYRLCLVFLTFSCIGYAMPFILCTTICCCLPCIISILGYREDL- 305

Query: 499  SVERGASNEQLSSLPTWKYKQ-----------------------VCNNPDLENENPECCI 389
            +  RGA+ E +++LPT K+K                          N   +  E+  CCI
Sbjct: 306  TQPRGATPESINALPTHKFKLKKSRSNGDDNGSSTSEGGVVAAGTDNERAISGEDAVCCI 365

Query: 388  CLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
            CLA+Y + EE+R+LPCSH FH  CVD+WL+I + CPLCK ++
Sbjct: 366  CLAKYANNEELRELPCSHFFHKECVDKWLKINASCPLCKSEV 407



>gb:AP002524_1822387 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC
            clone:P0406H10.>gb:AP002903_1823791 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 1, PAC
            clone:P0509B06.
          Length = 405

 Score =  174 bits (442), Expect = 4e-42
 Identities = 100/299 (33%), Positives = 152/299 (50%), Gaps = 49/299 (16%)
 Frame = -1

Query: 1012 NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCXXXXXXLYCR 833
            NP NS  W+ +E +    QI+     L+VS+ E P  P+  W+ GY  GC      LY R
Sbjct: 80   NPLNSGFWISIELIVSLSQIIAAITVLSVSRNEHPHAPLAQWLIGYTIGCVATLPHLYWR 139

Query: 832  YWVFYLRQRDESSAVSDIEQQR------------SLEGSSV------------------Q 743
            + +   RQ  E  + + +  +R            S  GS V                   
Sbjct: 140  F-LHRNRQNTEQESTNQVSSERDVYEPNSYVVVSSAHGSEVVDSGNNGGVARIASPRVYA 198

Query: 742  MVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF 563
            +V   +  ++ FFA+WFV+GNVW+F  R  S   AP L+ LCI  LA+  + Y+ PFIL 
Sbjct: 199  LVACFKLALDCFFAVWFVVGNVWIFGGRT-SLHDAPNLYRLCIVFLAFGFIGYALPFILC 257

Query: 562  VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQ---------------VCN 428
             ++CCC+P + S +G + ++    RGA+ E + +L  +K++                +  
Sbjct: 258  TMICCCLPCIISMMGIHEDL-DFNRGATAEAIDALVAYKFQSKKFQDGEAGEDNGGVLAA 316

Query: 427  NPDLEN----ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
              D E     E+  CCICL+++ + E++R+LPC+HVFHL CVD+WL+I + CPLCK DL
Sbjct: 317  GTDKERTISAEDAVCCICLSKFSNNEDLRELPCNHVFHLECVDKWLKINALCPLCKADL 375



>gb:AC130610_1740872 Oryza sativa (japonica cultivar-group) chromosome
            5 clone P0478F09, complete sequence.
          Length = 407

 Score =  174 bits (442), Expect = 4e-42
 Identities = 100/290 (34%), Positives = 147/290 (50%), Gaps = 40/290 (13%)
 Frame = -1

Query: 1012 NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCXXXXXXLYCR 833
            +P NS  W+ +E V    QI+     L+VS+ E P  P+  WV GY  GC      LY R
Sbjct: 91   SPLNSGCWISVELVVNVSQIIAAICVLSVSRNEHPHSPLFEWVIGYTVGCTATLPHLYWR 150

Query: 832  YWVFYLRQRDESSAVSDIEQQRSLEGSSVQMV---------------------EKCRTCV 716
            Y    L    +   V +I    + E +S  +                      +  +  +
Sbjct: 151  YLHRNLPTTGQEPTVQNIPPNNTPEANSYGVTGTNGVSRNNEATVNPRFQAFADHFKMAL 210

Query: 715  ELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPM 536
            + FFA+WFV+GNVWVF     S   AP L+ LCI+ L ++ + Y+ PFIL  ++CCC+P 
Sbjct: 211  DCFFAVWFVVGNVWVFGGH-SSAHDAPNLYRLCIAFLTFSCIGYAMPFILCALICCCLPC 269

Query: 535  VSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENE----------NPE---- 398
            + S LG+  ++    RGAS E +++L T K+K         NE          N E    
Sbjct: 270  IISILGFREDLNQ-NRGASAETINALGTCKFKSKKTRDGDGNEVGVGVVAAGTNKERVIS 328

Query: 397  -----CCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
                 CCICLA+Y D +++R+LPC+H FH +CVD+WL+I + CPLCK ++
Sbjct: 329  AEDAVCCICLARYVDNDDLRELPCAHFFHKDCVDKWLKINALCPLCKAEI 378



>gb:AP005879_1859549 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, BAC clone:OSJNBb0024J13.
          Length = 414

 Score =  166 bits (419), Expect = 2e-39
 Identities = 96/309 (31%), Positives = 153/309 (49%), Gaps = 51/309 (16%)
 Frame = -1

Query: 1018 GSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCXXXXXXLY 839
            G + +NS  W+  E V   VQI+   + L  S++E P  P+  W+ GY  GC      + 
Sbjct: 81   GRSIWNSGLWISFELVIYVVQIVAAIFVLVFSRDEHPHAPLFAWIIGYTIGCIASIPLIC 140

Query: 838  --CRYWVFYLRQRDES--SAVSDIEQQRSLEGSSVQ--------------------MVEK 731
              C +      Q  E   +A  ++   +S EG + +                    +   
Sbjct: 141  WRCAHRNRPSEQEPEQPPAAYPNLTSSQSSEGRNQRSSGTVLHFGCITISCPRPSILAYH 200

Query: 730  CRTCVELFFAIWFVMGNVWVFD--TRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILFVV 557
             +T V+ FFA+WFV+GNVW+F   +     + AP ++ LC++ LA + V Y+ PF++   
Sbjct: 201  FKTAVDCFFAVWFVVGNVWIFGGHSTLSDSQEAPNMYRLCLAFLALSCVGYAIPFVMCAA 260

Query: 556  LCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQ------VCNNPDLEN----- 410
            +CCC P + S L    ++G   RGA+ E + +LPT+K+K       V +    EN     
Sbjct: 261  ICCCFPCLISLLRLQEDLGHT-RGATQELIDALPTYKFKPKRSKMWVDHASSSENLSEGG 319

Query: 409  --------------ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK 272
                          E+  CCICL +Y D +E+R+LPC+H FH+ CVD+WL+I + CPLCK
Sbjct: 320  ILGPGTKKERIVSAEDAVCCICLTKYGDDDELRELPCTHFFHVQCVDKWLKINAVCPLCK 379

Query: 271  KDLAR*MKS 245
             ++   ++S
Sbjct: 380  TEIGGVVRS 388



>gb:AP004057_1837039 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1316_E06.>gb:AP005535_1853669 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0054K20.
          Length = 199

 Score =  150 bits (379), Expect = 7e-35
 Identities = 72/175 (41%), Positives = 107/175 (61%), Gaps = 22/175 (12%)
 Frame = -1

Query: 718 VELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILFVVLCCCVP 539
           ++ FFA+WFV+GNVW+F  R  S   AP L+ LCI  L ++ + Y+ PFIL  ++CCC+P
Sbjct: 3   LDCFFAVWFVVGNVWIFGGR-SSAADAPNLYRLCIVFLTFSCIGYAMPFILCAMICCCLP 61

Query: 538 MVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQ------------------VCNNPDLE 413
            + S +G+  +  +  RGA++E ++SLPT+K+K                   V    D E
Sbjct: 62  CIISVMGFREDTNNT-RGATSESINSLPTYKFKTKKRRHSSGNEAEGQDGGIVAAGTDKE 120

Query: 412 N----ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA 260
                E+  CCICLA+Y   +E+R+LPC+H FH  CVD+WL+I + CPLCK ++A
Sbjct: 121 RSLSAEDAVCCICLAKYAHNDELRELPCTHCFHKECVDKWLKINALCPLCKSEIA 175



>gb:OSJN00203_1696651 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0032E06, complete sequence.
          Length = 324

 Score =  123 bits (309), Expect = 9e-27
 Identities = 81/281 (28%), Positives = 128/281 (45%), Gaps = 48/281 (17%)
 Frame = -1

Query: 955 IMFTAYTLAVSKEERPVWPMRIWVSGYAFGCXXXXXXLYCRYWVFYLRQRDESSAVSDIE 776
           I   A  L +S+ E    P+R WV+GYA  C        C    + +R+     A +  +
Sbjct: 41  ITVAAVVLVLSRGEDSPMPLRTWVAGYALQCVVHMV---CVAIEYRMRRGQRDRAPASAD 97

Query: 775 QQRSLEGSSVQMVE---------KCRTCVEL----------FFAIWFVMGNVWVFDTRFG 653
           ++R  +GSS    +          C  CV +          F  IW+++G  W+      
Sbjct: 98  EERGSDGSSSSSDDDVTEDDRRGSCTDCVSIAKHLESANTMFSFIWWIIGFYWISAGGED 157

Query: 652 SFRRAPKLHVLCISLLAWNAVTYSF----PFILFVVLCCCVPMVSSFLGYNMNMGSVERG 485
             R AP+L+ LCI  LA++     F      I+ + +CCC+P + + L Y +   S + G
Sbjct: 158 VIRDAPQLYWLCIVFLAFDVFFVVFCVALACIIGIAVCCCLPCIIAIL-YAV---SDQEG 213

Query: 484 ASNEQLSSLPTWKYKQV----------------------CNNPD---LENENPECCICLA 380
           AS + +  +P +K+++                        N P    L  E+ ECCICL+
Sbjct: 214 ASEDDIRQIPRYKFRRTDEPEKQTADETGPFGGIMTECGTNQPIEKVLAPEDAECCICLS 273

Query: 379 QYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLAR 257
            Y D  E+R+LPC H FH  C+D+WL I + CPLCK ++ +
Sbjct: 274 AYDDGAELRELPCGHHFHCACIDKWLHINATCPLCKFNIRK 314



>gb:AP003916_1835174 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1634_H04.
          Length = 361

 Score =  119 bits (299), Expect = 1e-25
 Identities = 74/263 (28%), Positives = 128/263 (48%), Gaps = 30/263 (11%)
 Frame = -1

Query: 955 IMFTAYTLAVSKEERPVWPMRIWVSGYAFGCXXXXXXLYCRYWVFYLRQRDESSAVSDIE 776
           +   A  LA S  E P  P+R+W++GY   C      +     V Y R+R+        +
Sbjct: 99  VAVAAAVLAASLPESPSVPLRVWLAGYVLQCLFHVLCVT----VEYRRRREARGGGFGAD 154

Query: 775 QQRSLEGS-SVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAW 599
           Q  + +G   + +V+   +   +F  IW+++G  W+          AP+L+ L I  LA+
Sbjct: 155 QGAAADGDFKLSIVKHLESANTMFSFIWWIIGFYWISAGGQALSHDAPQLYWLSIVFLAF 214

Query: 598 NAVTYSF----PFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVC 431
           +     F      ++ + +CCC+P + + L Y +   + + GAS E +++L  +K++ + 
Sbjct: 215 DVFFVVFCVALACVIGIAVCCCLPCIIAIL-YAV---TDQEGASEEDINNLSKFKFRTMG 270

Query: 430 N---------------------NPDLEN----ENPECCICLAQYRDKEEMRQLPCSHVFH 326
           +                     NP +E+    E+ ECCICL  Y D  E+R+LPC+H FH
Sbjct: 271 DADKLVAGIAAPVGGVMTECGTNPPVEHFLSAEDAECCICLCPYEDGAELRELPCNHHFH 330

Query: 325 LNCVDQWLRIISCCPLCKKDLAR 257
             C+D+WL I + CPLCK ++ +
Sbjct: 331 CTCIDKWLHINATCPLCKFNIIK 353



>gb:AY057713_1564125 Arabidopsis thaliana AT4g11680/T5C23_110 mRNA,
           complete cds.>gb:BT010750_1640696 Arabidopsis thaliana
           At4g11680/T5C23_110 gene, complete cds.
          Length = 390

 Score =  116 bits (290), Expect = 2e-24
 Identities = 73/261 (27%), Positives = 118/261 (45%), Gaps = 35/261 (13%)
 Frame = -1

Query: 934 LAVSKEERPVWPMRIWVSGYAFGCXXXXXXLYCRYWVFYLRQRDESSAVSDIEQQRSLEG 755
           L +S++E+P  P+R+WV GY   C      +   Y     R+  E    S +    S + 
Sbjct: 128 LILSRDEKPNMPLRVWVVGYGIQCWLHMACVCVEYRRRRRRRHPEDGGGSGLTNSSSQQY 187

Query: 754 SSVQMVEK----------CRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLL 605
            S+  +E             +   +F  IW+++G  WV          +P+L+ LCI  L
Sbjct: 188 VSLAQLEDRGETSNPAKHLESANTMFSFIWWIIGFYWVSAGGQTLSSDSPQLYWLCIIFL 247

Query: 604 AWNAVTYSFPFILFVVL----CCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQ 437
            ++     F   L  V+    CCC+P + + L Y +   + + GAS   +  +P +++ +
Sbjct: 248 GFDVFFVVFCVALACVIGLAVCCCLPCIIAIL-YAV---ADQEGASKNDIDQMPKFRFTK 303

Query: 436 VCN---------------------NPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLN 320
             N                        L  E+ ECCICL +Y D  E+R+LPC+H FH  
Sbjct: 304 TGNVEKLSGKARGIMTECGTDSPIERSLSPEDAECCICLCEYEDGVELRELPCNHHFHCT 363

Query: 319 CVDQWLRIISCCPLCKKDLAR 257
           C+D+WL I S CPLCK ++ +
Sbjct: 364 CIDKWLHINSRCPLCKFNILK 384



>gb:AY168924_1586415 Arabidopsis thaliana RES protein (RES) mRNA,
           complete cds.
          Length = 359

 Score =  114 bits (286), Expect = 4e-24
 Identities = 71/269 (26%), Positives = 120/269 (44%), Gaps = 36/269 (13%)
 Frame = -1

Query: 955 IMFTAYTLAVSKEERPVWPMRIWVSGYAFGCXXXXXXLYCRYWVFYLRQR---------D 803
           ++ +A  L  + EERP  P+R+W+  Y   C      ++  YW     +R         +
Sbjct: 89  VLASAVMLVGTVEERPNEPIRVWICVYGLQCLFHVVLVWSEYWRRNSTRRARDLESYDHE 148

Query: 802 ESSAVSDIEQQRSLEGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHV 623
           + +   D EQ      ++   V++C +   +   IW+++G  WV +        AP L+ 
Sbjct: 149 DYNIEYDYEQDSDDNSTTYSFVKRCESINTVISFIWWIIGFYWVVEGGDKLLGEAPNLYW 208

Query: 622 LCISLLAWNAVTYSFPFILF----VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLP 455
           L +  LA +     F  +L     + LCCC+P + + L     +   E G S  +L  LP
Sbjct: 209 LSVIFLAIDVFFAVFCVVLACLVGIALCCCLPCIIALL---YAVAGTE-GVSEAELGVLP 264

Query: 454 TWKYKQVCNNPD-----------------------LENENPECCICLAQYRDKEEMRQLP 344
            +K+K   +N                         L  E+ +CCICL+ Y D  E+  LP
Sbjct: 265 LYKFKAFHSNEKNITGPGKMVPIPINGLCLATERTLLAEDADCCICLSSYEDGAELHALP 324

Query: 343 CSHVFHLNCVDQWLRIISCCPLCKKDLAR 257
           C+H FH  C+ +WL++ + CPLCK ++ +
Sbjct: 325 CNHHFHSTCIVKWLKMRATCPLCKYNILK 353



>gb:AY084480_1569569 Arabidopsis thaliana clone 109181 mRNA, complete
            sequence.
          Length = 343

 Score =  114 bits (284), Expect = 7e-24
 Identities = 91/356 (25%), Positives = 155/356 (43%), Gaps = 40/356 (11%)
 Frame = -1

Query: 1204 SGAAATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARW----FIFLRRVFHYQNG 1037
            S   + SG D+   ++   QS  R QP      +A+ ++RA       + +R     +  
Sbjct: 2    SSPESPSGSDSSTPLIRSRQSSPRRQPV-----IAVLLNRASGRRGASMVVRETAAQELE 56

Query: 1036 STTSDLG-SNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCX 860
               +D G S P  +L  +      L   +M     L V KEE+P  P+RIW+ GYA  C 
Sbjct: 57   ERRADWGYSKPVVALDMLWNTAFVLVAIVM-----LLVFKEEKPNVPIRIWICGYAIQCL 111

Query: 859  XXXXXLYCRYWVFYLRQRDESSAVSDIEQQRSLEGSSVQ--------MVEKCRTCVELFF 704
                 ++  +     R+R+  S   D+E  ++    S            + C +   +  
Sbjct: 112  VHVVLVWLEF-----RKRNARSRPGDLEAAQATNQDSEDEDNDERFLSTKTCESMNTIIS 166

Query: 703  AIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF----VVLCCCVPM 536
             +W+++G  W+        + A  L+ L    LA++     F  +L     + LCCC+P 
Sbjct: 167  FVWWIVGFYWLVSGGDILLQNATHLYWLTFVFLAFDVFFAIFCVVLACLIGIALCCCLPC 226

Query: 535  VSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNP------------DLENEN---- 404
            + + L Y +   + + GAS   LS LP +++  + N+             D  +EN    
Sbjct: 227  IIALL-YAV---AGQEGASEADLSILPKYRFHTMNNDEKQSDGGGKMIPVDAASENLGNE 282

Query: 403  -------PECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLAR 257
                    +CCICL+ Y D  E+  LPC+H FH  C+ +WL++ + CPLCK ++ +
Sbjct: 283  RVLLPEDADCCICLSSYEDGAELVSLPCNHHFHSTCIVKWLKMNATCPLCKFNILK 338



>pir|H96703|H96703 probable RING zinc finger protein T23K23.8
            [imported] - Arabidopsis thaliana>gb:AE005173_894429
            Arabidopsis thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC012563_1537747 Arabidopsis thaliana
            chromosome 1 BAC T23K23 genomic sequence, complete
            sequence.
          Length = 343

 Score =  113 bits (282), Expect = 1e-23
 Identities = 91/356 (25%), Positives = 155/356 (43%), Gaps = 40/356 (11%)
 Frame = -1

Query: 1204 SGAAATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARW----FIFLRRVFHYQNG 1037
            S   + SG D+   ++   QS  R QP      +A+ ++RA       + +R     +  
Sbjct: 2    SSPESPSGSDSSTPLLRSRQSSPRRQPV-----IAVLLNRASGRRGASMVVRETAAQELE 56

Query: 1036 STTSDLG-SNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCX 860
               +D G S P  +L  +      L   +M     L V KEE+P  P+RIW+ GYA  C 
Sbjct: 57   ERRADWGYSKPVVALDMLWNTAFVLVAIVM-----LLVFKEEKPNVPIRIWICGYAIQCL 111

Query: 859  XXXXXLYCRYWVFYLRQRDESSAVSDIEQQRSLEGSSVQ--------MVEKCRTCVELFF 704
                 ++  +     R+R+  S   D+E  ++    S            + C +   +  
Sbjct: 112  VHVVLVWLEF-----RKRNARSRPGDLEAAQATNQDSEDEDNDERFLSTKTCESMNTIIS 166

Query: 703  AIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILF----VVLCCCVPM 536
             +W+++G  W+        + A  L+ L    LA++     F  +L     + LCCC+P 
Sbjct: 167  FVWWIVGFYWLVSGGDILLQNATHLYWLTFVFLAFDVFFAIFCVVLACLIGIALCCCLPC 226

Query: 535  VSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNP------------DLENEN---- 404
            + + L Y +   + + GAS   LS LP +++  + N+             D  +EN    
Sbjct: 227  IIALL-YAV---AGQEGASEADLSILPKYRFHTMNNDEKQSDGGGKMIPVDAASENLGNE 282

Query: 403  -------PECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLAR 257
                    +CCICL+ Y D  E+  LPC+H FH  C+ +WL++ + CPLCK ++ +
Sbjct: 283  RVLLPEDADCCICLSSYEDGAELVSLPCNHHFHSTCIVKWLKMNATCPLCKFNILK 338



>gb:AP005885_1859667 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0657H12.
          Length = 399

 Score =  112 bits (281), Expect = 2e-23
 Identities = 81/293 (27%), Positives = 128/293 (43%), Gaps = 65/293 (22%)
 Frame = -1

Query: 955 IMFTAYTLAVSKEERPVWPMRIWVSGYAFGCXXXXXXLYCRYWVFYLRQ----------- 809
           I+  A  LA+S+EE P  P+R+W+ GYA  C      +   Y +   +            
Sbjct: 96  ILVAAAVLALSREESPSMPLRLWIVGYAVQCVLHMACVAIEYRMRRGQSGESPMAADEET 155

Query: 808 -RDESSAVSDIEQQR------------------------SLEGSSVQMVEKCRTCVELFF 704
             D SS+ SD +                           S+  S+  + +   +   +F 
Sbjct: 156 GTDGSSSSSDEDAGERAPRGRNGDYVRSVGHHIFYPDNFSVHKSACSIAKHLESANTMFS 215

Query: 703 AIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSF----PFILFVVLCCCVPM 536
            IW+++G  WV          AP+L+ LCI  LA++     F      I+ + +CCC+P 
Sbjct: 216 FIWWIIGFYWVSAGGQVLTHDAPQLYWLCIVFLAFDVFFVVFCVALACIIGIAVCCCLPC 275

Query: 535 VSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQV----------------------CNNP 422
           + + L Y +   S + GAS + +  +P +K++++                       N P
Sbjct: 276 IIAIL-YAV---SDQEGASEDDIRQIPRYKFRRMDEPEKQSVNMTGSSGGIMIECGTNQP 331

Query: 421 D---LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK 272
               L  E+ ECCICL+ Y D  E+R+LPC H FH  C+D+WL I + CPLCK
Sbjct: 332 IEKVLAAEDAECCICLSAYDDGAELRELPCGHHFHCVCIDKWLHINATCPLCK 384



>gb:AY086095_1571153 Arabidopsis thaliana clone 21249 mRNA, complete
           sequence.
          Length = 381

 Score =  112 bits (279), Expect = 3e-23
 Identities = 76/293 (25%), Positives = 128/293 (43%), Gaps = 60/293 (20%)
 Frame = -1

Query: 955 IMFTAYTLAVSKEERPVWPMRIWVSGYAFGCXXXXXXLYCRYWVFYLRQRDE-------- 800
           ++     L +S +E P  P+R+W+ GY   C      +   Y     R+R +        
Sbjct: 86  VVVATAVLVLSSDENPNMPLRVWIIGYGLQCMMHMVCVCVEYRRRNSRRRRDLSPRSSSS 145

Query: 799 -SSAVSDIEQQRSL-------------------EGSSVQMVEKCRTCVELFFAIWFVMGN 680
            SS+ S ++++  L                     S  + +E   T +     IW+V+G 
Sbjct: 146 SSSSSSSMDEEEGLGLSRNSDERYLELGQLENENNSFAKHLESANTMISF---IWWVIGF 202

Query: 679 VWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSF----PFILFVVLCCCVPMVSSFLGYN 512
            WV        + +P+L+ LCI  L ++     F      ++ + +CCC+P + + L Y 
Sbjct: 203 YWVSSGGQELAQGSPQLYWLCIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVL-YA 261

Query: 511 MNMGSVERGASNEQLSSLPTWKYKQV-----------------------CNNPD-----L 416
           +   + + GAS E +  L  +K+++V                       C         L
Sbjct: 262 V---AEQEGASKEDIDQLTKFKFRKVGDTMKHTVDEEQGEGDSGGVMTECGTDSPVEHAL 318

Query: 415 ENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLAR 257
            +E+ ECCICL+ Y D+ E+R+LPC H FH  CVD+WL I + CPLCK ++ +
Sbjct: 319 PHEDAECCICLSAYEDETELRELPCGHHFHCGCVDKWLYINATCPLCKYNILK 371



>gb:AY058092_1564231 Arabidopsis thaliana At1g63170/F16M19_7 mRNA,
           complete cds.
          Length = 381

 Score =  112 bits (279), Expect = 3e-23
 Identities = 76/293 (25%), Positives = 128/293 (43%), Gaps = 60/293 (20%)
 Frame = -1

Query: 955 IMFTAYTLAVSKEERPVWPMRIWVSGYAFGCXXXXXXLYCRYWVFYLRQRDE-------- 800
           ++     L +S +E P  P+R+W+ GY   C      +   Y     R+R +        
Sbjct: 86  VVVATAVLVLSSDENPNMPLRVWIIGYGLQCMMHMVCVCVEYRRRNSRRRRDLSPRSSSS 145

Query: 799 -SSAVSDIEQQRSL-------------------EGSSVQMVEKCRTCVELFFAIWFVMGN 680
            SS+ S ++++  L                     S  + +E   T +     IW+V+G 
Sbjct: 146 SSSSSSSMDEEEGLGLSRNSDERYLELGQLENENNSFAKHLESANTMISF---IWWVIGF 202

Query: 679 VWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSF----PFILFVVLCCCVPMVSSFLGYN 512
            WV        + +P+L+ LCI  L ++     F      ++ + +CCC+P + + L Y 
Sbjct: 203 YWVSSGGQELAQGSPQLYWLCIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVL-YA 261

Query: 511 MNMGSVERGASNEQLSSLPTWKYKQV-----------------------CNNPD-----L 416
           +   + + GAS E +  L  +K+++V                       C         L
Sbjct: 262 V---AEQEGASKEDIDQLTKFKFRKVGDTMKHTVDEEQGQGDSGGVMTECGTDSPVEHAL 318

Query: 415 ENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLAR 257
            +E+ ECCICL+ Y D+ E+R+LPC H FH  CVD+WL I + CPLCK ++ +
Sbjct: 319 PHEDAECCICLSAYEDETELRELPCGHHFHCGCVDKWLYINATCPLCKYNILK 371



>pir|C96657|C96657 hypothetical protein F16M19.7 [imported] -
           Arabidopsis thaliana>gb:AE005173_893985 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010795_1537097 Arabidopsis thaliana
           chromosome 1 BAC F16M19 genomic sequence, complete
           sequence.
          Length = 381

 Score =  112 bits (279), Expect = 3e-23
 Identities = 76/293 (25%), Positives = 128/293 (43%), Gaps = 60/293 (20%)
 Frame = -1

Query: 955 IMFTAYTLAVSKEERPVWPMRIWVSGYAFGCXXXXXXLYCRYWVFYLRQRDE-------- 800
           ++     L +S +E P  P+R+W+ GY   C      +   Y     R+R +        
Sbjct: 86  VVVATAVLVLSSDENPNMPLRVWIIGYGLQCMMHMVCVCVEYRRRNSRRRRDLSPRSSSS 145

Query: 799 -SSAVSDIEQQRSL-------------------EGSSVQMVEKCRTCVELFFAIWFVMGN 680
            SS+ S ++++  L                     S  + +E   T +     IW+V+G 
Sbjct: 146 SSSSSSSMDEEEGLGLSRNSDERYLELGQLENENNSFAKHLESANTMISF---IWWVIGF 202

Query: 679 VWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSF----PFILFVVLCCCVPMVSSFLGYN 512
            WV        + +P+L+ LCI  L ++     F      ++ + +CCC+P + + L Y 
Sbjct: 203 YWVSSGGQELAQGSPQLYWLCIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVL-YA 261

Query: 511 MNMGSVERGASNEQLSSLPTWKYKQV-----------------------CNNPD-----L 416
           +   + + GAS E +  L  +K+++V                       C         L
Sbjct: 262 V---AEQEGASKEDIDQLTKFKFRKVGDTMKHTVDEEQGQGDSGGVMTECGTDSPVEHAL 318

Query: 415 ENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLAR 257
            +E+ ECCICL+ Y D+ E+R+LPC H FH  CVD+WL I + CPLCK ++ +
Sbjct: 319 PHEDAECCICLSAYEDETELRELPCGHHFHCGCVDKWLYINATCPLCKYNILK 371



>gb:AE005172_890286 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC025417_1539511 Genomic sequence
           for Arabidopsis thaliana BAC T12C24 from chromosome I,
           complete sequence.>gb:AY136370_1581871 Arabidopsis
           thaliana unknown protein (At3g13380:At1g12760) mRNA,
           complete cds.>gb:BT000279_1634557 Arabidopsis thaliana
           unknown protein (At3g13380At1g12760) mRNA, complete cds.
          Length = 408

 Score =  107 bits (267), Expect = 7e-22
 Identities = 72/285 (25%), Positives = 127/285 (44%), Gaps = 59/285 (20%)
 Frame = -1

Query: 934 LAVSKEERPVWPMRIWVSGYAFGCXXXXXXLYCRYWVFYLRQRDE--------------S 797
           L +S++E P+ P+R+W+ GYA  C      +   Y     R+ +               S
Sbjct: 119 LVMSRKEHPIMPLRVWLLGYALQCVLHMVCVCVEYRRRNRRRTNRTTTTTPPRSRSSSSS 178

Query: 796 SAVSDIEQQR---------------SLEGSSVQMVEKCRTCVELFFAIWFVMGNVWVFDT 662
           S+ S +E++                 L+  S  + +   +   +F  IW+++G  WV   
Sbjct: 179 SSSSSLEEEALGSRRNSGVQDLSLGHLDTESSSVAKHLESANTMFSFIWWIIGFYWVSAG 238

Query: 661 RFGSFRRAPKLHVLCISLLAWNAVTYSF----PFILFVVLCCCVPMVSSFLGYNMNMGSV 494
                + +P+++ L I  L ++     F      ++ + +CCC+P + + L Y +   + 
Sbjct: 239 GQELAQESPRIYWLSIVFLGFDVFFVVFCVALACVIGIAVCCCLPCIIAVL-YAV---AD 294

Query: 493 ERGASNEQLSSLPTWKYKQV---------------------CNNPD-----LENENPECC 392
           + GAS E +  L  +K++++                     C         L  E+ ECC
Sbjct: 295 QEGASKEDIEQLTKFKFRKLGDANKHTNDEAQGTTEGIMTECGTDSPIEHTLLQEDAECC 354

Query: 391 ICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLAR 257
           ICL+ Y D  E+R+LPC H FH +CVD+WL I + CPLCK ++ +
Sbjct: 355 ICLSAYEDGTELRELPCGHHFHCSCVDKWLYINATCPLCKYNILK 399



>gb:AY224421_1590623 Oryza sativa (japonica cultivar-group) isolate
           20115 ring zinc finger protein-like protein mRNA,
           complete cds.
          Length = 250

 Score =  106 bits (265), Expect = 1e-21
 Identities = 70/233 (30%), Positives = 110/233 (47%), Gaps = 48/233 (20%)
 Frame = -1

Query: 811 QRDESSAVSDIEQQRSLEGSSVQMVE---------KCRTCVEL----------FFAIWFV 689
           QRD + A +D  ++R  +GSS    +          C  CV +          F  IW++
Sbjct: 14  QRDRAPASAD--EERGSDGSSSSSDDDVTEDDRRGSCTDCVSIAKHLESANTMFSFIWWI 71

Query: 688 MGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSF----PFILFVVLCCCVPMVSSFL 521
           +G  W+        R AP+L+ LCI  LA++     F      I+ + +CCC+P + + L
Sbjct: 72  IGFYWISAGGEDVIRDAPQLYWLCIVFLAFDVFFVVFCVALACIIGIAVCCCLPCIIAIL 131

Query: 520 GYNMNMGSVERGASNEQLSSLPTWKYKQV----------------------CNNPD---L 416
            Y +   S + GAS + +  +P +K+++                        N P    L
Sbjct: 132 -YAV---SDQEGASEDDIRQIPRYKFRRTDEPEKQTADETGPFGGIMTECGTNQPIEKVL 187

Query: 415 ENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLAR 257
             E+ ECCICL+ Y D  E+R+LPC H FH  C+D+WL I + CPLCK ++ +
Sbjct: 188 APEDAECCICLSAYDDGAELRELPCGHHFHCACIDKWLHINATCPLCKFNIRK 240



>gb:AY059830_1564674 Arabidopsis thaliana putative protein
           (At3g61180; T20K12.80) mRNA, complete
           cds.>gb:AY064638_1566089 Arabidopsis thaliana putative
           protein (At3g61180; T20K12.80) mRNA, complete cds.
          Length = 379

 Score =  105 bits (262), Expect = 3e-21
 Identities = 71/275 (25%), Positives = 122/275 (44%), Gaps = 49/275 (17%)
 Frame = -1

Query: 934 LAVSKEERPVWPMRIWVSGYAFGCXXXXXXLYCRYWVFYLRQRDESS---AVSDIEQQRS 764
           L  S +E P  P+R+W+ GY   C      +   Y     R+R  +S   +  D     S
Sbjct: 103 LGFSSDEDPDVPLRLWIIGYNVQCLFHVGCVIAEY----KRRRVANSPPPSGEDSSNHES 158

Query: 763 LEGSS-----------------VQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP 635
           L GS                      +   +   +F  +W+++G  WV        + +P
Sbjct: 159 LSGSEDESDGYSINNTDDDDHGTSFTKHLESANTMFSFVWWIIGFYWVTADTEALAQSSP 218

Query: 634 KLHVLCISLLAWNA----VTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQL 467
           +L+ LC++ LA++     +  +   ++ + +CCC+P + + L Y +   + + GA +E++
Sbjct: 219 QLYWLCVAFLAFDVMFVVICVAVASLIGIAVCCCLPCIIAIL-YAL---ADQEGAPDEEI 274

Query: 466 SSLPTWKYKQVCNNPDLE-------------------------NENPECCICLAQYRDKE 362
             L  +K+  V N+  +                          +E+ EC ICL  Y D  
Sbjct: 275 ERLLKFKFLTVKNSEKVNGEIRETQGGIMTGLDTESQTERMLLSEDAECSICLCAYEDGV 334

Query: 361 EMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLAR 257
           E+R+LPC H FH  CVD+WLRI + CPLCK ++ +
Sbjct: 335 ELRELPCRHHFHSLCVDKWLRINATCPLCKFNILK 369



>pir|T47910|T47910 hypothetical protein T20K12.80 - Arabidopsis
           thaliana>gb:ATT20K12_1554957 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T20K12.
          Length = 362

 Score =  105 bits (262), Expect = 3e-21
 Identities = 71/275 (25%), Positives = 122/275 (44%), Gaps = 49/275 (17%)
 Frame = -1

Query: 934 LAVSKEERPVWPMRIWVSGYAFGCXXXXXXLYCRYWVFYLRQRDESS---AVSDIEQQRS 764
           L  S +E P  P+R+W+ GY   C      +   Y     R+R  +S   +  D     S
Sbjct: 86  LGFSSDEDPDVPLRLWIIGYNVQCLFHVGCVIAEY----KRRRVANSPPPSGEDSSNHES 141

Query: 763 LEGSS-----------------VQMVEKCRTCVELFFAIWFVMGNVWVFDTRFGSFRRAP 635
           L GS                      +   +   +F  +W+++G  WV        + +P
Sbjct: 142 LSGSEDESDGYSINNTDDDDHGTSFTKHLESANTMFSFVWWIIGFYWVTADTEALAQSSP 201

Query: 634 KLHVLCISLLAWNA----VTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQL 467
           +L+ LC++ LA++     +  +   ++ + +CCC+P + + L Y +   + + GA +E++
Sbjct: 202 QLYWLCVAFLAFDVMFVVICVAVASLIGIAVCCCLPCIIAIL-YAL---ADQEGAPDEEI 257

Query: 466 SSLPTWKYKQVCNNPDLE-------------------------NENPECCICLAQYRDKE 362
             L  +K+  V N+  +                          +E+ EC ICL  Y D  
Sbjct: 258 ERLLKFKFLTVKNSEKVNGEIRETQGGIMTGLDTESQTERMLLSEDAECSICLCAYEDGV 317

Query: 361 EMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLAR 257
           E+R+LPC H FH  CVD+WLRI + CPLCK ++ +
Sbjct: 318 ELRELPCRHHFHSLCVDKWLRINATCPLCKFNILK 352



>pir|T04215|T04215 hypothetical protein T5C23.110 - Arabidopsis
           thaliana>gb:ATCHRIV32_1544933 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 32.>gb:ATT5C23_1556104
           Arabidopsis thaliana DNA chromosome 4, BAC clone T5C23
           (ESSA project).
          Length = 419

 Score =  102 bits (254), Expect = 2e-20
 Identities = 73/290 (25%), Positives = 119/290 (41%), Gaps = 64/290 (22%)
 Frame = -1

Query: 934 LAVSKEERPVWPMRIWVSGYAFGCXXXXXXLYCRYWVFYLRQRDESSAVSDIEQQRSLEG 755
           L +S++E+P  P+R+WV GY   C      +   Y     R+  E    S +    S + 
Sbjct: 128 LILSRDEKPNMPLRVWVVGYGIQCWLHMACVCVEYRRRRRRRHPEDGGGSGLTNSSSQQY 187

Query: 754 SSVQMVEK----------CRTCVELFFAIWFVMGNVWVFDTRFGSFRRAPKLHVLCISLL 605
            S+  +E             +   +F  IW+++G  WV          +P+L+ LCI  L
Sbjct: 188 VSLAQLEDRGETSNPAKHLESANTMFSFIWWIIGFYWVSAGGQTLSSDSPQLYWLCIIFL 247

Query: 604 AWNAVTYSFPFILFVVL----CCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQ 437
            ++     F   L  V+    CCC+P + + L Y +   + + GAS   +  +P +++ +
Sbjct: 248 GFDVFFVVFCVALACVIGLAVCCCLPCIIAIL-YAV---ADQEGASKNDIDQMPKFRFTK 303

Query: 436 VCNNPDLEN-----------ENP------------------------------------- 401
             N   L             ++P                                     
Sbjct: 304 TGNVEKLSGKARGIMTECGTDSPIERSLSPEDAVQSHFHILIKLYILKVCKIDNAWLLMI 363

Query: 400 --ECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLAR 257
             ECCICL +Y D  E+R+LPC+H FH  C+D+WL I S CPLCK ++ +
Sbjct: 364 LQECCICLCEYEDGVELRELPCNHHFHCTCIDKWLHINSRCPLCKFNILK 413



>gb:AP004880_1846517 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0487D09.
          Length = 180

 Score = 92.0 bits (227), Expect = 3e-17
 Identities = 54/175 (30%), Positives = 87/175 (49%), Gaps = 27/175 (15%)
 Frame = -1

Query: 700 IWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSF----PFILFVVLCCCVPMV 533
           +W+++G  WV        + AP+L+ L +  LA++     F       + + LCCC+P V
Sbjct: 5   LWWIIGFYWVVSGGDVLEQDAPRLYWLSVVFLAFDVFFAVFCVAMACFIGIALCCCLPCV 64

Query: 532 SSFLGYNMNMGSVERGASNEQLSSLPTWKYKQ----------------VCNNPD------ 419
            + L Y +   + + GAS+  +  LP ++Y                  V NN        
Sbjct: 65  IAIL-YAL---AGQEGASDADIGFLPRYRYSDPSEDGQKGTDEGVMIPVLNNSGTSTSER 120

Query: 418 -LENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLAR 257
            L +E+ ECCICL+ Y D  E+  LPC+H FH  C+ +WLR+ + CPLCK ++ +
Sbjct: 121 ILLHEDAECCICLSSYEDGAELSALPCNHHFHWTCITKWLRMHATCPLCKYNILK 175



>pir|E85092|E85092 hypothetical protein AT4g09130 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV26_1544628 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No. 26.
          Length = 357

 Score = 77.4 bits (189), Expect = 8e-13
 Identities = 41/116 (35%), Positives = 62/116 (53%), Gaps = 5/116 (4%)
 Frame = -1

Query: 592 VTYSFPFILFVVLC----CCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNN 425
           V  S   +L VV C    CC+    +  G+ +    V RG   + + S P + Y +V   
Sbjct: 53  VLLSLFLLLLVVYCLNYGCCIEENETG-GHEVLHSRVRRGIDKDVIESFPAFLYSEV-KA 110

Query: 424 PDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWLRIISCCPLCKKDLA 260
             + N   EC ICL ++ D+E +R +P CSH FH NC+D+WL   S CP+C+ +L+
Sbjct: 111 FKIGNGGVECAICLCEFEDEEPLRWMPPCSHTFHANCIDEWLSSRSTCPVCRANLS 166



>pir|D85092|D85092 hypothetical protein AT4g09120 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV26_1544627 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No. 26.
          Length = 345

 Score = 73.6 bits (179), Expect = 1e-11
 Identities = 37/111 (33%), Positives = 58/111 (52%), Gaps = 6/111 (5%)
 Frame = -1

Query: 574 FILFVVLCCCVPMVS-----SFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLEN 410
           FI   ++ CC+  +         G ++      RG   E + S PT+ Y +V     +  
Sbjct: 60  FISLGMVSCCLHCIFYREEIGAAGQDVLHSRARRGLEKEVIESFPTFLYSEV-KGLKIGK 118

Query: 409 ENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWLRIISCCPLCKKDLA 260
              EC ICL+++ D+E +R +P CSH FH NC+D WL   S CP+C+ +L+
Sbjct: 119 GGVECAICLSEFEDQETLRWMPPCSHTFHANCIDVWLSSWSTCPVCRANLS 169



>gb:BC080409_2561709 Xenopus laevis MGC86297 protein, mRNA (cDNA
           clone MGC:86297 IMAGE:7020633), complete cds.
          Length = 341

 Score = 71.2 bits (173), Expect = 6e-11
 Identities = 39/114 (34%), Positives = 60/114 (52%), Gaps = 4/114 (3%)
 Frame = -1

Query: 586 YSFPFILFV---VLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDL 416
           Y  PFI+ V   ++  C+ MV   + Y   M       S EQL+ +P  K+K+       
Sbjct: 175 YLIPFIVVVSAFIIIMCIVMVVRCVQYRKRMR--RNRLSKEQLNKIPIHKFKK------- 225

Query: 415 ENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL-RIISCCPLCKKDLAR 257
            ++   C ICL +Y + +++R LPCSH +H +CVD WL +    CP+CK  + R
Sbjct: 226 GDDYDVCAICLEEYEEGDKLRVLPCSHAYHSSCVDPWLTKTKKSCPVCKNRVFR 279



>gb:BC081881_2108127 Rattus norvegicus cDNA clone MGC:93748
           IMAGE:7108181, complete cds.
          Length = 380

 Score = 71.2 bits (173), Expect = 6e-11
 Identities = 38/122 (31%), Positives = 61/122 (50%), Gaps = 2/122 (1%)
 Frame = -1

Query: 628 HVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGA-SNEQLSSLPT 452
           HV+ +  L+     Y  PF++ V +C  + ++     +  +     R     +QL  LP 
Sbjct: 169 HVILVPELSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRNRRNRLRKDQLKKLPV 228

Query: 451 WKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL-RIISCCPLC 275
            K+K+        +E   C ICL +Y D +++R LPCSH +H  CVD WL +    CP+C
Sbjct: 229 HKFKK-------GDEYDVCAICLEEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVC 281

Query: 274 KK 269
           K+
Sbjct: 282 KQ 283



>gb:BC058182_2103089 Mus musculus ring finger protein 13, mRNA (cDNA
           clone MGC:68150 IMAGE:5324040), complete cds.
          Length = 381

 Score = 70.9 bits (172), Expect = 7e-11
 Identities = 37/122 (30%), Positives = 61/122 (50%), Gaps = 2/122 (1%)
 Frame = -1

Query: 628 HVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGA-SNEQLSSLPT 452
           H++ +  L+     Y  PF++ V +C  + ++     +  +     R     +QL  LP 
Sbjct: 169 HIILVPELSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRNRRNRLRKDQLKKLPV 228

Query: 451 WKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL-RIISCCPLC 275
            K+K+        +E   C ICL +Y D +++R LPCSH +H  CVD WL +    CP+C
Sbjct: 229 HKFKK-------GDEYDVCAICLEEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVC 281

Query: 274 KK 269
           K+
Sbjct: 282 KQ 283



>sp|O54965|RN13_MOUSE RING finger protein 13.>gb:AF037205_2051841
           Mus musculus RING zinc finger protein (Rzf) mRNA,
           complete cds.
          Length = 381

 Score = 70.9 bits (172), Expect = 7e-11
 Identities = 37/122 (30%), Positives = 61/122 (50%), Gaps = 2/122 (1%)
 Frame = -1

Query: 628 HVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGA-SNEQLSSLPT 452
           H++ +  L+     Y  PF++ V +C  + ++     +  +     R     +QL  LP 
Sbjct: 169 HIILVPELSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRNRRNRLRKDQLKKLPV 228

Query: 451 WKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL-RIISCCPLC 275
            K+K+        +E   C ICL +Y D +++R LPCSH +H  CVD WL +    CP+C
Sbjct: 229 HKFKK-------GDEYDVCAICLEEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVC 281

Query: 274 KK 269
           K+
Sbjct: 282 KQ 283



>sp|Q90972|RN13_CHICK RING finger protein 13
           (C-RZF).>gb:GGRINGZNF_2573380 G.gallus mRNA for RING
           zinc finger.
          Length = 381

 Score = 70.5 bits (171), Expect = 9e-11
 Identities = 38/122 (31%), Positives = 60/122 (49%), Gaps = 2/122 (1%)
 Frame = -1

Query: 628 HVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGA-SNEQLSSLPT 452
           HV+ I   +     Y  PF++ V +C  + ++     +  +     R     +QL  LP 
Sbjct: 169 HVVLIPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRKDQLKKLPV 228

Query: 451 WKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL-RIISCCPLC 275
            K+K+        +E   C ICL +Y D +++R LPCSH +H  CVD WL +    CP+C
Sbjct: 229 HKFKK-------GDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVC 281

Query: 274 KK 269
           K+
Sbjct: 282 KQ 283



>gb:AY084453_1569543 Arabidopsis thaliana clone 108568 mRNA,
           complete sequence.
          Length = 340

 Score = 69.7 bits (169), Expect = 2e-10
 Identities = 29/82 (35%), Positives = 47/82 (57%)
 Frame = -1

Query: 505 MGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFH 326
           +G+  RG S + ++SLP+ +YK+  N       N  C IC   Y D E++  LPC H +H
Sbjct: 255 VGTESRGLSADTIASLPSKRYKEGDNQ---NGTNESCVICRLDYEDDEDLILLPCKHSYH 311

Query: 325 LNCVDQWLRIISCCPLCKKDLA 260
             C++ WL+I   CP+C  +++
Sbjct: 312 SECINNWLKINKVCPVCSAEVS 333



>gb:AB025631_1516567 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MPN9.>gb:AY045590_1561181 Arabidopsis thaliana
           AT3g19910/MPN9_15 mRNA, complete
           cds.>gb:AY045984_1561480 Arabidopsis thaliana unknown
           protein (At3g19910) mRNA, complete
           cds.>gb:AY079353_1568243 Arabidopsis thaliana unknown
           protein (At3g19910) mRNA, complete cds.
          Length = 340

 Score = 69.7 bits (169), Expect = 2e-10
 Identities = 29/82 (35%), Positives = 47/82 (57%)
 Frame = -1

Query: 505 MGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFH 326
           +G+  RG S + ++SLP+ +YK+  N       N  C IC   Y D E++  LPC H +H
Sbjct: 255 VGTESRGLSADTIASLPSKRYKEGDNQ---NGTNESCVICRLDYEDDEDLILLPCKHSYH 311

Query: 325 LNCVDQWLRIISCCPLCKKDLA 260
             C++ WL+I   CP+C  +++
Sbjct: 312 SECINNWLKINKVCPVCSAEVS 333



>pir|T19377|T19377 hypothetical protein C18B12.4 - Caenorhabditis
           elegans>gb:CEC18B12_1360563 Caenorhabditis elegans
           cosmid C18B12, complete sequence.
          Length = 456

 Score = 69.7 bits (169), Expect = 2e-10
 Identities = 38/115 (33%), Positives = 59/115 (51%), Gaps = 7/115 (6%)
 Frame = -1

Query: 586 YSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQ------LSSLPTWKYKQVCNN 425
           Y  PF++ +V C  + +++  +      G VER   N++      L  +P  KY+     
Sbjct: 190 YLIPFLVVIVFCFALFLITLCV-----RGCVERRKLNKRRLSKRNLKKIPVKKYR----- 239

Query: 424 PDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL-RIISCCPLCKKDL 263
             L ++   C ICL  +   E++R LPC HVFH NC+D WL +    CPLCK+ +
Sbjct: 240 --LGDDPDTCAICLESFASGEKLRHLPCRHVFHCNCIDVWLTQTRKICPLCKRKI 292



>pir|C85092|C85092 hypothetical protein AT4g09110 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV26_1544626 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No. 26.
          Length = 302

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 39/117 (33%), Positives = 57/117 (48%), Gaps = 13/117 (11%)
 Frame = -1

Query: 571 ILFVVLCCCVPMVSSFLGYNMNMGSVE------------RGASNEQLSSLPTWKYKQVCN 428
           I+ + +   + MV+ FL        VE            RG   E + S P + Y +V  
Sbjct: 54  IIVLAIFISLSMVACFLHKTFYRAEVEAASQEVFHSRARRGLEKELVESFPIFLYSEV-K 112

Query: 427 NPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWLRIISCCPLCKKDLA 260
              +     EC ICL+++ DKE +R +P CSH FH NC+D WL   S CP C+ +L+
Sbjct: 113 GLKIGKGGVECAICLSEFVDKETLRWMPPCSHTFHANCIDVWLSSQSTCPACRANLS 169



>sp|O43567|RN13_HUMAN RING finger protein 13.>gb:CR858160_1182347
           Pongo pygmaeus mRNA; cDNA DKFZp468B0312 (from clone
           DKFZp468B0312).>gb:AF037204_1878066 Homo sapiens RING
           zinc finger protein (RZF) mRNA, complete
           cds.>gb:AF070558_1880740 Homo sapiens clone 24450 RING
           zinc finger protein RZF mRNA, complete
           cds.>gb:BC009781_1972253 Homo sapiens ring finger
           protein 13, transcript variant 4, mRNA (cDNA clone
           MGC:13487 IMAGE:3683407), complete
           cds.>gb:BC009803_1972272 Homo sapiens ring finger
           protein 13, transcript variant 1, mRNA (cDNA clone
           MGC:13689 IMAGE:4274992), complete
           cds.>gb:CR456804_1993011 Homo sapiens full open reading
           frame cDNA clone RZPDo834C1118D for gene RNF13, ring
           finger protein 13; complete cds, incl. stopcodon.
          Length = 381

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 36/122 (29%), Positives = 60/122 (49%), Gaps = 2/122 (1%)
 Frame = -1

Query: 628 HVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGA-SNEQLSSLPT 452
           H++ +   +     Y  PF++ V +C  + ++     +  +     R     +QL  LP 
Sbjct: 169 HLILVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRKDQLKKLPV 228

Query: 451 WKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL-RIISCCPLC 275
            K+K+        +E   C ICL +Y D +++R LPCSH +H  CVD WL +    CP+C
Sbjct: 229 HKFKK-------GDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVC 281

Query: 274 KK 269
           K+
Sbjct: 282 KQ 283



>gb:AP004048_1836914 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1202_E07.>gb:AP004878_1846457 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0474F11.
          Length = 320

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 28/78 (35%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCV 314
           RG     + SLP ++Y++     D   ++ EC +C+++++++E +R LP C HVFH++C+
Sbjct: 113 RGLEEAAIQSLPAFRYRKAIK--DTTADSSECAVCISEFQEEERVRLLPSCLHVFHVDCI 170

Query: 313 DQWLRIISCCPLCKKDLA 260
           D WL+  + CPLC+  +A
Sbjct: 171 DTWLQGNANCPLCRAAIA 188



>gb:OSJN00270_1697704 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0003A12, complete sequence.
          Length = 684

 Score = 68.9 bits (167), Expect = 3e-10
 Identities = 33/86 (38%), Positives = 46/86 (53%), Gaps = 1/86 (1%)
 Frame = -1

Query: 523 LGYNMNMGSVERGASNEQL-SSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQL 347
           L     +G V  G S +++ + L  WKY  +     L    P CCIC  +Y + E+M +L
Sbjct: 595 LALGERIGYVNTGLSEDKIRTGLKQWKYVSIPIEEPLTGVEP-CCICQEEYAEGEDMGRL 653

Query: 346 PCSHVFHLNCVDQWLRIISCCPLCKK 269
            C H FH  C+ QWL I + CP+CKK
Sbjct: 654 DCGHDFHTACIKQWLVIKNLCPICKK 679



>gb:AP005295_1850046 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1695_D07.
          Length = 389

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 31/85 (36%), Positives = 50/85 (58%), Gaps = 1/85 (1%)
 Frame = -1

Query: 514 NMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSH 335
           ++++  V   A    ++SLP   YK+        ++  +C ICL +Y D +++R LPC H
Sbjct: 302 SLSLSMVSAQAPESVVNSLPCKSYKK--QTAQCSDDMEQCHICLTEYEDGDQIRSLPCKH 359

Query: 334 VFHLNCVDQWLR-IISCCPLCKKDL 263
            FHL CVD+WL+ +   CPLC+ D+
Sbjct: 360 EFHLLCVDKWLKEVHRVCPLCRGDV 384



>gb:PFA929354_1393197 Plasmodium falciparum strain 3D7, chromosome
           5, segment 4/4.
          Length = 284

 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 41/148 (27%), Positives = 70/148 (47%)
 Frame = -1

Query: 700 IWFVMGNVWVFDTRFGSFRRAPKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFL 521
           +WF+ G V +  TR    +     ++  IS   W  +      + F ++  C      F 
Sbjct: 152 LWFITGTVVMVVTR----KHTKNFYLWFIS---WTIILSCIFRVFFTIIWFCF-----FF 199

Query: 520 GYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPC 341
            Y+ N+   ++G      S + T+KY        L+NE+  C ICL+ + +K+E+ +L C
Sbjct: 200 PYHQNIPKKKKGVPKTFFSEITTFKYTLTRK---LKNES--CSICLSDFVEKDEIMELNC 254

Query: 340 SHVFHLNCVDQWLRIISCCPLCKKDLAR 257
            H FH  C  +WL     CPLC++D+ +
Sbjct: 255 LHNFHTKCAKKWLSQKRHCPLCQRDVMK 282



>gb:AK029824_1161676 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4930595M18
           product:hypothetical RNA-binding region RNP-1 (RNA
           recognition motif)/RING finger containing protein, full
           insert sequence.
          Length = 829

 Score = 68.2 bits (165), Expect = 5e-10
 Identities = 31/93 (33%), Positives = 52/93 (55%)
 Frame = -1

Query: 541 PMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKE 362
           P++  F  +N    +  +G + EQ+++LP   +   C N ++ +    C ICL QY    
Sbjct: 734 PVLPDFSNFNDIHNNHPKGLTEEQINNLPVIYF---CENDEISH----CSICLTQYIKNS 786

Query: 361 EMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
           ++R LPC H +H  C+D+WL   S CP+C+K +
Sbjct: 787 KIRVLPCFHEYHDKCIDRWLSDNSTCPICRKHI 819



>pir|T00481|T00481 probable RING zinc finger protein [imported] -
           Arabidopsis thaliana>gb:AC004238_1531571 Arabidopsis
           thaliana chromosome 2 clone F19I3 map ve016, complete
           sequence.>gb:BT015733_1642351 Arabidopsis thaliana
           At2g35000 mRNA, complete cds.>gb:BT020192_1642587
           Arabidopsis thaliana At2g35000 mRNA, complete cds.
          Length = 378

 Score = 68.2 bits (165), Expect = 5e-10
 Identities = 32/77 (41%), Positives = 44/77 (57%), Gaps = 1/77 (1%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCV 314
           RG   E + + PT+ Y +V     +     EC +CL ++ D E +R +P C HVFH +CV
Sbjct: 105 RGLDAEAIETFPTFLYSEV-KAVRIGKGGVECAVCLCEFEDDETLRLMPPCCHVFHADCV 163

Query: 313 DQWLRIISCCPLCKKDL 263
           D WL   S CPLC+ DL
Sbjct: 164 DVWLSEHSTCPLCRADL 180



>gb:BC056113_2551695 Xenopus laevis hypothetical protein MGC69137,
           mRNA (cDNA clone MGC:69137 IMAGE:5048403), complete cds.
          Length = 336

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 38/123 (30%), Positives = 62/123 (50%), Gaps = 4/123 (3%)
 Frame = -1

Query: 628 HVLCISLLAWNAVTYSFPFIL---FVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSL 458
           H+  +   +++   Y  PFI+    V++  C+ MV   + Y   +       S EQL  +
Sbjct: 164 HIYLMPDYSFSLGYYIIPFIVVVSLVIVVMCIIMVVRCVQYRKRIR--RNRLSKEQLKKI 221

Query: 457 PTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL-RIISCCP 281
           P  K+K+        +    C ICL +Y + +++R LPCSH +H +CVD WL +    CP
Sbjct: 222 PIHKFKK-------GDHYDVCAICLEEYEEGDKLRVLPCSHAYHSSCVDPWLTKTKKSCP 274

Query: 280 LCK 272
           +CK
Sbjct: 275 VCK 277



>gb:AC121489_1740227 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1217B09, complete sequence.
          Length = 353

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 1/77 (1%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCV 314
           RG   E + + PT  Y  V      ++   EC +CLA++ D +E+R LP C HVFH +C+
Sbjct: 102 RGLDKEVVEAFPTAVYGDVKARMAAKSGPLECAVCLAEFADSDELRVLPACCHVFHPDCI 161

Query: 313 DQWLRIISCCPLCKKDL 263
           D WL     CPLC+ +L
Sbjct: 162 DPWLAAAVTCPLCRANL 178



>gb:AB010699_1511248 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MSN9.>gb:AK176313_1818301 Arabidopsis thaliana
           mRNA for RING finger -like protein, complete cds, clone:
           RAFL23-27-L12.
          Length = 376

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 30/84 (35%), Positives = 48/84 (57%), Gaps = 7/84 (8%)
 Frame = -1

Query: 493 ERGASNEQLSSLPTWKYKQVCNNPD------LENENPECCICLAQYRDKEEMRQLP-CSH 335
           + G     + +LP + YK++  +           E  +C +CL ++ +K+++R LP CSH
Sbjct: 105 DSGLDQAFIDALPVFHYKEIVGSAGGGGGNGAAQEPFDCAVCLCEFSEKDKLRLLPMCSH 164

Query: 334 VFHLNCVDQWLRIISCCPLCKKDL 263
            FHLNC+D WL+  S CPLC+  L
Sbjct: 165 AFHLNCIDTWLQSNSTCPLCRGTL 188



>gb:AE014297_1138680 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003683_1220673 Drosophila melanogaster
            chromosome 3R, section 21 of 118 of the complete
            sequence.
          Length = 1173

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 27/74 (36%), Positives = 45/74 (60%), Gaps = 1/74 (1%)
 Frame = -1

Query: 490  RGASNEQLSSLPTWKYKQVCNNPDLEN-ENPECCICLAQYRDKEEMRQLPCSHVFHLNCV 314
            RG +  ++  LP++K+     NP++ N +   C +C+  +  ++ +R LPCSH FH  CV
Sbjct: 1050 RGLTRNEIDQLPSYKF-----NPEVHNGDQSSCVVCMCDFELRQLLRVLPCSHEFHAKCV 1104

Query: 313  DQWLRIISCCPLCK 272
            D+WLR    CP+C+
Sbjct: 1105 DKWLRSNRTCPICR 1118



>gb:AE014297_1138678 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE014297_1138679 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE003683_1220671
           Drosophila melanogaster chromosome 3R, section 21 of 118
           of the complete sequence.>gb:AE003683_1220672 Drosophila
           melanogaster chromosome 3R, section 21 of 118 of the
           complete sequence.>gb:AY094811_1297985 Drosophila
           melanogaster LD30050 full insert cDNA.
          Length = 868

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 27/74 (36%), Positives = 45/74 (60%), Gaps = 1/74 (1%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLEN-ENPECCICLAQYRDKEEMRQLPCSHVFHLNCV 314
           RG +  ++  LP++K+     NP++ N +   C +C+  +  ++ +R LPCSH FH  CV
Sbjct: 745 RGLTRNEIDQLPSYKF-----NPEVHNGDQSSCVVCMCDFELRQLLRVLPCSHEFHAKCV 799

Query: 313 DQWLRIISCCPLCK 272
           D+WLR    CP+C+
Sbjct: 800 DKWLRSNRTCPICR 813



>pir|B86175|B86175 protein F19P19.21 [imported] - Arabidopsis
           thaliana>gb:AE005172_889452 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:BT004287_1637365 Arabidopsis thaliana clone
           RAFL16-01-M16 (R50141) unknown protein (At1g04360) mRNA,
           complete cds.>gb:BT006138_1639032 Arabidopsis thaliana
           clone U50141 unknown protein (At1g04360) mRNA, complete
           cds.>gb:F19P19_1677727 Sequence of BAC F19P19 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 381

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 28/83 (33%), Positives = 51/83 (61%), Gaps = 4/83 (4%)
 Frame = -1

Query: 496 VERGASNEQLSSLPTWKYKQ---VCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVF 329
           V RG     + ++P +K+K+   V    D    + EC +CL ++++ E++R +P C HVF
Sbjct: 98  VNRGLDESAIRAIPVFKFKKRDVVAGEEDQSKNSQECSVCLNEFQEDEKLRIIPNCCHVF 157

Query: 328 HLNCVDQWLRIISCCPLCKKDLA 260
           H++C+D WL+  + CPLC+  ++
Sbjct: 158 HIDCIDIWLQGNANCPLCRTSVS 180



>pir|D86474|D86474 probable RING zinc finger protein [imported] -
           Arabidopsis thaliana>gb:AE005172_892298 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC069160_1540707 Arabidopsis thaliana
           chromosome 1 BAC T9I1 genomic sequence, complete
           sequence.
          Length = 327

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 40/118 (33%), Positives = 58/118 (49%), Gaps = 15/118 (12%)
 Frame = -1

Query: 571 ILFVVLCCCV--------PMVSSFLGYNMNMGSV------ERGASNEQLSSLPTWKYKQV 434
           +LF +L CCV        P  +S        G V       RG   + ++S P++ Y QV
Sbjct: 57  LLFSMLACCVCYKYTNTSPHGTSSDTEEGGHGEVAFTRRTSRGLGKDVINSFPSFLYSQV 116

Query: 433 CNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWLRIISCCPLCKKDL 263
                +     EC ICL ++ D+E +R +P CSH FH +C+D WL   S CP+C+  L
Sbjct: 117 -KGLKIGKGGVECAICLNEFEDEETLRLMPPCSHAFHASCIDVWLSSRSTCPVCRASL 173



>gb:BC065620_2554066 Danio rerio zgc:55660, mRNA (cDNA clone
           MGC:77194 IMAGE:6961887), complete cds.
          Length = 377

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 37/122 (30%), Positives = 58/122 (47%), Gaps = 2/122 (1%)
 Frame = -1

Query: 628 HVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGA-SNEQLSSLPT 452
           HV+ +   +     Y  PF++ V +C  + +V     +  +     R     +QL  LP 
Sbjct: 169 HVILMPDFSLPLEYYLIPFLIIVGICLILIVVFMITKFVQDRHRARRSRLRKDQLKKLPI 228

Query: 451 WKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL-RIISCCPLC 275
            K+K+        +    C ICL +Y + E +R LPCSH +H  CVD WL +    CP+C
Sbjct: 229 HKFKK-------GDSYDVCAICLDEYEEGERLRVLPCSHAYHCKCVDPWLTKTKKTCPVC 281

Query: 274 KK 269
           K+
Sbjct: 282 KQ 283



>gb:BC044449_2548755 Danio rerio zgc:55660, mRNA (cDNA clone
           MGC:55660 IMAGE:3815403), complete cds.
          Length = 377

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 37/122 (30%), Positives = 58/122 (47%), Gaps = 2/122 (1%)
 Frame = -1

Query: 628 HVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGA-SNEQLSSLPT 452
           HV+ +   +     Y  PF++ V +C  + +V     +  +     R     +QL  LP 
Sbjct: 169 HVILMPDFSLPLEYYLIPFLIIVGICLILIVVFMITKFVQDRHRARRSRLRKDQLKKLPI 228

Query: 451 WKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL-RIISCCPLC 275
            K+K+        +    C ICL +Y + E +R LPCSH +H  CVD WL +    CP+C
Sbjct: 229 HKFKK-------GDSYDVCAICLDEYEEGERLRVLPCSHAYHCKCVDPWLTKTKKTCPVC 281

Query: 274 KK 269
           K+
Sbjct: 282 KQ 283



>gb:BT015305_1358382 Drosophila melanogaster AT15166 full insert cDNA.
          Length = 1256

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 31/78 (39%), Positives = 50/78 (64%), Gaps = 2/78 (2%)
 Frame = -1

Query: 490  RGASNEQL--SSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNC 317
            RGA+ E +  ++LP  KY++V    + + +  +C ICL  +  + E+R+LPC H+FH +C
Sbjct: 1155 RGATLETIERNTLPH-KYRRVRRPSETDEDAEKCAICLNLFEIENEVRRLPCMHLFHTDC 1213

Query: 316  VDQWLRIISCCPLCKKDL 263
            VDQWL     CP+C+ D+
Sbjct: 1214 VDQWLVTNKHCPICRVDI 1231



>gb:AE014297_1139070 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE014297_1139071 Drosophila melanogaster
            chromosome 3R, complete sequence.>gb:AE003692_1221063
            Drosophila melanogaster chromosome 3R, section 30 of 118
            of the complete sequence.>gb:AE003692_1221064 Drosophila
            melanogaster chromosome 3R, section 30 of 118 of the
            complete sequence.>gb:AY058520_1291674 Drosophila
            melanogaster LD22771 full length cDNA.
          Length = 1256

 Score = 67.0 bits (162), Expect = 1e-09
 Identities = 31/78 (39%), Positives = 50/78 (64%), Gaps = 2/78 (2%)
 Frame = -1

Query: 490  RGASNEQL--SSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNC 317
            RGA+ E +  ++LP  KY++V    + + +  +C ICL  +  + E+R+LPC H+FH +C
Sbjct: 1155 RGATLETIERNTLPH-KYRRVRRPSETDEDAEKCAICLNLFEIENEVRRLPCMHLFHTDC 1213

Query: 316  VDQWLRIISCCPLCKKDL 263
            VDQWL     CP+C+ D+
Sbjct: 1214 VDQWLVTNKHCPICRVDI 1231



>gb:BC080893_2561808 Xenopus tropicalis rnf13-prov protein, mRNA
           (cDNA clone MGC:79504 IMAGE:6977064), complete cds.
          Length = 383

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 33/108 (30%), Positives = 55/108 (50%), Gaps = 2/108 (1%)
 Frame = -1

Query: 586 YSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGA-SNEQLSSLPTWKYKQVCNNPDLEN 410
           Y  PF++ V +C  + ++     +  +     R     +QL  LP  K+K+        +
Sbjct: 184 YLIPFLIIVGICLVLIVIFMITKFVQDRHRARRNRLRKDQLKKLPIHKFKK-------GD 236

Query: 409 ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL-RIISCCPLCKK 269
           E   C +CL +Y + +++R LPCSH +H  CVD WL +    CP+CK+
Sbjct: 237 EYDVCAVCLDEYEEGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQ 284



>gb:BC063734_2553587 Xenopus laevis hypothetical protein MGC68556,
           mRNA (cDNA clone MGC:68556 IMAGE:4031366), complete cds.
          Length = 381

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 33/108 (30%), Positives = 55/108 (50%), Gaps = 2/108 (1%)
 Frame = -1

Query: 586 YSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGA-SNEQLSSLPTWKYKQVCNNPDLEN 410
           Y  PF++ V +C  + ++     +  +     R     +QL  LP  K+K+        +
Sbjct: 183 YLIPFLIIVGICLVLIVIFMITKFVQDRHRARRNRLRKDQLKKLPIHKFKK-------GD 235

Query: 409 ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL-RIISCCPLCKK 269
           E   C +CL +Y + +++R LPCSH +H  CVD WL +    CP+CK+
Sbjct: 236 EYDVCAVCLDEYEEGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQ 283



>gb:CAR299062_1645235 Cicer arietinum partial mRNA for hypothetical
           protein (ORF1), clone Can183.
          Length = 233

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 27/82 (32%), Positives = 43/82 (52%)
 Frame = -1

Query: 505 MGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFH 326
           +G+  RG S + ++ LP+  YK      D    N  C IC   Y D E +  L C H++H
Sbjct: 148 VGTESRGLSTDTIACLPSVNYK---TGSDQHGSNDSCVICRVDYEDDESLTVLSCKHLYH 204

Query: 325 LNCVDQWLRIISCCPLCKKDLA 260
             C++ WL+I   CP+C  +++
Sbjct: 205 PECINNWLKINKVCPVCSTEVS 226



>gb:BT004268_1637347 Arabidopsis thaliana clone RAFL15-29-G07
           (R50085) putative RING-H2 zinc finger protein ATL3
           (At1g72200) mRNA, complete cds.
          Length = 404

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 1/77 (1%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCV 314
           RG     + + PT++Y  V     +  E  EC +CL ++ D E +R +P C HVFH  C+
Sbjct: 114 RGLDASIIETFPTFQYSTV-KTLRIGKEALECSVCLNEFEDDETLRLIPKCCHVFHPGCI 172

Query: 313 DQWLRIISCCPLCKKDL 263
           D WLR  + CPLC+ DL
Sbjct: 173 DAWLRSHTTCPLCRADL 189



>gb:AY054187_1563009 Arabidopsis thaliana AT4g30400/F17I23_260 mRNA,
           complete cds.>gb:AY103309_1578137 Arabidopsis thaliana
           AT4g30400/F17I23_260 mRNA, complete cds.
          Length = 472

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 28/78 (35%), Positives = 46/78 (58%), Gaps = 1/78 (1%)
 Frame = -1

Query: 493 ERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNC 317
           + G     + +LP + YK +     L+N   +C +CL ++  ++++R LP CSH FH++C
Sbjct: 105 DSGVDQSFIDTLPVFHYKSIIG---LKNYPFDCAVCLCEFETEDKLRLLPKCSHAFHMDC 161

Query: 316 VDQWLRIISCCPLCKKDL 263
           +D WL   S CPLC+  L
Sbjct: 162 IDTWLLSHSTCPLCRSSL 179



>gb:AB025638_1516671 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MWF20.>gb:BT008334_1639551 Arabidopsis thaliana
           At5g43420 gene, complete cds.
          Length = 375

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 42/150 (28%), Positives = 77/150 (51%), Gaps = 28/150 (18%)
 Frame = -1

Query: 637 PKLHVLCISLLAWNAVTYSFPFILFVVLCCC----VPMVSSF-------------LGYNM 509
           P L V  I +LA   +  S+   +FV+ CC     + ++  F             + Y+ 
Sbjct: 35  PILAVAVIGILATAFLLVSY--YVFVIKCCLNWHRIDILGRFSLSRRRRNDQDPLMVYSP 92

Query: 508 NMGSVERGASNEQLSSLPTWKYKQVCNNPD----------LENENPECCICLAQYRDKEE 359
            + S  RG     + ++P +K+K+  +  D           E  + EC +CL++++D+E+
Sbjct: 93  ELRS--RGLDESVIRAIPIFKFKKRYDQNDGVFTGEGEEEEEKRSQECSVCLSEFQDEEK 150

Query: 358 MRQLP-CSHVFHLNCVDQWLRIISCCPLCK 272
           +R +P CSH+FH++C+D WL+  + CPLC+
Sbjct: 151 LRIIPNCSHLFHIDCIDVWLQNNANCPLCR 180



>pir|E85355|E85355 hypothetical protein AT4g30400 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV73_1546961 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No. 73.
          Length = 465

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 28/78 (35%), Positives = 46/78 (58%), Gaps = 1/78 (1%)
 Frame = -1

Query: 493 ERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNC 317
           + G     + +LP + YK +     L+N   +C +CL ++  ++++R LP CSH FH++C
Sbjct: 98  DSGVDQSFIDTLPVFHYKSIIG---LKNYPFDCAVCLCEFETEDKLRLLPKCSHAFHMDC 154

Query: 316 VDQWLRIISCCPLCKKDL 263
           +D WL   S CPLC+  L
Sbjct: 155 IDTWLLSHSTCPLCRSSL 172



>pir|E96745|E96745 hypothetical protein T9N14.11 [imported] -
           Arabidopsis thaliana>gb:AE005173_894767 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC067754_1540319 Arabidopsis thaliana
           chromosome 1 BAC T9N14 genomic sequence, complete
           sequence.>gb:BT020487_1642881 Arabidopsis thaliana
           At1g72200 gene, complete cds.
          Length = 404

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 1/77 (1%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCV 314
           RG     + + PT++Y  V     +  E  EC +CL ++ D E +R +P C HVFH  C+
Sbjct: 114 RGLDASIIETFPTFQYSTV-KTLRIGKEALECSVCLNEFEDDETLRLIPKCCHVFHPGCI 172

Query: 313 DQWLRIISCCPLCKKDL 263
           D WLR  + CPLC+ DL
Sbjct: 173 DAWLRSHTTCPLCRADL 189



>gb:AB114041_2465685 Xenopus laevis XRnf12C mRNA for XRnf12C,
           complete cds.
          Length = 825

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 29/89 (32%), Positives = 52/89 (58%)
 Frame = -1

Query: 535 VSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEM 356
           ++ F   N +     RG + EQ+ +L T  Y +   N  L+     C +C+ +Y +  ++
Sbjct: 732 LAQFFLLNEDDDDQPRGLTKEQIDNLSTRNYGE---NDALKT----CSVCITEYTEGNKL 784

Query: 355 RQLPCSHVFHLNCVDQWLRIISCCPLCKK 269
           R+LPCSH +H++C+D+WL   S CP+C++
Sbjct: 785 RKLPCSHEYHIHCIDRWLSENSTCPICRR 813



>gb:AB114040_2465684 Xenopus laevis XRnf12B mRNA for XRnf12B,
           complete cds.
          Length = 757

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 29/89 (32%), Positives = 52/89 (58%)
 Frame = -1

Query: 535 VSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEM 356
           ++ F   N +     RG + EQ+ +L T  Y +   N  L+     C +C+ +Y +  ++
Sbjct: 664 LAQFFLLNEDDDDQPRGLTKEQIDNLSTRNYGE---NDALKT----CSVCITEYTEGNKL 716

Query: 355 RQLPCSHVFHLNCVDQWLRIISCCPLCKK 269
           R+LPCSH +H++C+D+WL   S CP+C++
Sbjct: 717 RKLPCSHEYHIHCIDRWLSENSTCPICRR 745



>gb:AK008329_1154518 Mus musculus adult male small intestine cDNA,
           RIKEN full-length enriched library, clone:2010107A21
           product:hypothetical RING finger containing protein,
           full insert sequence.
          Length = 305

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 35/92 (38%), Positives = 50/92 (54%)
 Frame = -1

Query: 538 MVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEE 359
           +V+  LG   N G     A  E+++SLPT    Q   N  LE     C +C   Y  +E+
Sbjct: 189 IVTQLLGQLENTGPPP--ADKEKITSLPTVTVTQEQVNTGLE-----CPVCKEDYTVEEK 241

Query: 358 MRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
           +RQLPC+H FH +C+  WL +   CP+C+K L
Sbjct: 242 VRQLPCNHFFHSSCIVPWLELHDTCPVCRKSL 273



>sp|Q9D0C1|Z364_MOUSE Zinc finger protein 364.>gb:AK011584_1156488
           Mus musculus 10 days embryo whole body cDNA, RIKEN
           full-length enriched library, clone:2610028E05
           product:hypothetical RING finger containing protein,
           full insert sequence.
          Length = 305

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 35/92 (38%), Positives = 50/92 (54%)
 Frame = -1

Query: 538 MVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEE 359
           +V+  LG   N G     A  E+++SLPT    Q   N  LE     C +C   Y  +E+
Sbjct: 189 IVTQLLGQLENTGPPP--ADKEKITSLPTVTVTQEQVNTGLE-----CPVCKEDYTVEEK 241

Query: 358 MRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
           +RQLPC+H FH +C+  WL +   CP+C+K L
Sbjct: 242 VRQLPCNHFFHSSCIVPWLELHDTCPVCRKSL 273



>gb:AP005681_1855893 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC
           clone:OJ1439_F07.>gb:AP005864_1859244 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OSJNBa0047P18.
          Length = 174

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 26/81 (32%), Positives = 51/81 (62%)
 Frame = -1

Query: 505 MGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFH 326
           +G+  RG S++ +  L  +K K  C+    +  + EC IC + Y+ ++++ +LPCSH +H
Sbjct: 94  VGNQSRGLSDDLICYLVPFKNK--CSFFSRKKNDEECVICKSTYKSRQKLIRLPCSHCYH 151

Query: 325 LNCVDQWLRIISCCPLCKKDL 263
            +C+ +WL+I   CP+C +++
Sbjct: 152 ADCITRWLKINKACPVCNEEV 172



>gb:AY207044_1589557 Oryza sativa (indica cultivar-group)
           zinc-finger protein mRNA, complete
           cds.>gb:AY225189_1590891 Oryza sativa (indica
           cultivar-group) zinc finger protein mRNA, complete
           cds.>gb:AP001168_1820874 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 6,
           clone:P0425F02.
          Length = 261

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 30/82 (36%), Positives = 48/82 (58%)
 Frame = -1

Query: 508 NMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVF 329
           ++G+  RG S+  +S L TWKYK         ++N  C ICL+ +R +E +  L C H +
Sbjct: 178 SVGNENRGLSDLLISYLETWKYKSGFFPRKANHDN--CPICLSAFRRRETLITLACKHSY 235

Query: 328 HLNCVDQWLRIISCCPLCKKDL 263
           H  C+ +WL+I   CP+CK ++
Sbjct: 236 HEGCIARWLKIDKACPVCKYEV 257



>pir|G84678|G84678 probable RING zinc finger protein [imported] -
           Arabidopsis thaliana>gb:AC006929_1534802 Arabidopsis
           thaliana chromosome 2 clone T1E2 map mi54, complete
           sequence.>gb:BT005256_1638196 Arabidopsis thaliana
           At2g27940 mRNA, complete cds.>gb:AK118539_1816511
           Arabidopsis thaliana At2g27940 mRNA for putative RING
           finger protein, complete cds, clone: RAFL19-76-M12.
          Length = 237

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = -1

Query: 499 SVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHL 323
           S  RG  ++ + SLP ++Y +       +  N +C ICL+ + + E ++ +P C HVFH+
Sbjct: 111 SFRRGLDSQAVRSLPVYRYTKAA-----KQRNEDCVICLSDFEEGETVKVIPHCGHVFHV 165

Query: 322 NCVDQWLRIISCCPLCKKD 266
           +CVD WL     CPLC+ +
Sbjct: 166 DCVDTWLSSYVTCPLCRSN 184



>gb:AP005399_1851144 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0676H02.
          Length = 392

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 1/78 (1%)
 Frame = -1

Query: 493 ERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNC 317
           +RG     L++ PT  Y  V  +  ++    EC +C++++ D E +R LP CSHVFH +C
Sbjct: 94  QRGLDQSVLATFPTMAYADVKAHKSVKGAL-ECAVCISEFDDDETLRLLPKCSHVFHQDC 152

Query: 316 VDQWLRIISCCPLCKKDL 263
           +D WL   + CP+C+ +L
Sbjct: 153 IDTWLASHATCPVCRANL 170



>gb:AP003984_1835933 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1046_F07.
          Length = 428

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 2/79 (2%)
 Frame = -1

Query: 493 ERGASNEQLSSLPTWKYKQVCNNPDLENENP-ECCICLAQYRDKEEMRQLP-CSHVFHLN 320
           + G     + +LP + Y+ V      + ++P +C +CL ++   +++R LP CSH FHL 
Sbjct: 90  DAGVDQAFIDALPVFLYRNVVGVGGEDGKDPFDCAVCLCEFAADDQLRLLPKCSHAFHLE 149

Query: 319 CVDQWLRIISCCPLCKKDL 263
           C+D WL   S CPLC++ L
Sbjct: 150 CIDTWLLSHSTCPLCRRSL 168



>gb:AY080617_1568361 Arabidopsis thaliana putative RING-H2 zinc
           finger protein ATL6 (At3g05200) mRNA, partial cds.
          Length = 388

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 44/134 (32%), Positives = 66/134 (49%), Gaps = 5/134 (3%)
 Frame = -1

Query: 646 RRAPKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPM--VSSFLGYNMN--MGSVERGAS 479
           R +P + V+ + L+A  A+ +   F ++   C  VP   VS   G      + +  RG  
Sbjct: 44  RLSPAMAVIVVILIA--ALFFMGFFSIYFRHCSGVPDAGVSPAGGARSRATVNAAARGLD 101

Query: 478 NEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWL 302
              + + PT+ Y  V     L     EC ICL ++ D E +R LP C HVFH +C+D WL
Sbjct: 102 VSVVETFPTFLYSDV-KTQKLGKGELECAICLNEFEDDETLRLLPKCDHVFHPHCIDAWL 160

Query: 301 RIISCCPLCKKDLA 260
                CP+C+ +LA
Sbjct: 161 EAHVTCPVCRANLA 174



>gb:ATAC009177_1542858 Arabidopsis thaliana chromosome III BAC T12H1
           genomic sequence, complete sequence.
          Length = 392

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 44/134 (32%), Positives = 66/134 (49%), Gaps = 5/134 (3%)
 Frame = -1

Query: 646 RRAPKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPM--VSSFLGYNMN--MGSVERGAS 479
           R +P + V+ + L+A  A+ +   F ++   C  VP   VS   G      + +  RG  
Sbjct: 38  RLSPAMAVIVVILIA--ALFFMGFFSIYFRHCSGVPDAGVSPAGGARSRATVNAAARGLD 95

Query: 478 NEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWL 302
              + + PT+ Y  V     L     EC ICL ++ D E +R LP C HVFH +C+D WL
Sbjct: 96  VSVVETFPTFLYSDV-KTQKLGKGELECAICLNEFEDDETLRLLPKCDHVFHPHCIDAWL 154

Query: 301 RIISCCPLCKKDLA 260
                CP+C+ +LA
Sbjct: 155 EAHVTCPVCRANLA 168



>gb:AC073395_1541019 Arabidopsis thaliana chromosome 3 BAC F11B9
           genomic sequence, complete
           sequence.>gb:ATAC009991_1543111 Arabidopsis thaliana
           chromosome III BAC F9F8 genomic sequence, complete
           sequence.
          Length = 158

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 41/121 (33%), Positives = 59/121 (48%), Gaps = 9/121 (7%)
 Frame = -1

Query: 607 LAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVER-------GASNEQLSSLPTW 449
           LA  +V   F  +   +   C+P  S     N++  S +R       G    ++ SLP  
Sbjct: 37  LALFSVVLFFALLTLYIHRNCLPRDS----INLHASSPDRLTRCRSGGLDPAEIRSLPV- 91

Query: 448 KYKQVCNNPDLENENP-ECCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWLRIISCCPLC 275
               +C     E E   ECCICL  + + E+M+ LP CSH +H  CVD+WL+  S CPLC
Sbjct: 92  ---VLCRRERAEEEEEKECCICLGGFEEGEKMKVLPPCSHCYHCECVDRWLKTESSCPLC 148

Query: 274 K 272
           +
Sbjct: 149 R 149



>gb:CQ834134_1453733 Sequence 5 from Patent
           WO2004058805.>gb:AF419857_1901708 Homo sapiens
           hypothetical protein mRNA, complete
           cds.>gb:AF542552_1906483 Homo sapiens zinc finger
           protein 364 (ZNF364) mRNA, complete
           cds.>gb:AL390725_1926619 Human DNA sequence from clone
           RP11-373C9 on chromosome 1 Contains the 3' end of the
           ZNF364 gene for zinc finger protein 364, the CD160 gene
           for CD160 antigen, the PDZK1 gene for PDZ domain
           containing 1, the 3' end of the gene for putative
           G-protein coupled receptor SH120 and a CpG island,
           complete sequence.>gb:BC054049_1985161 Homo sapiens zinc
           finger protein 364, mRNA (cDNA clone MGC:65162
           IMAGE:6157275), complete cds.>gb:BC064903_1986647 Homo
           sapiens zinc finger protein 364, mRNA (cDNA clone
           MGC:70861 IMAGE:6020168), complete cds.
          Length = 304

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 35/92 (38%), Positives = 50/92 (54%)
 Frame = -1

Query: 538 MVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEE 359
           +V+  LG   N G     A  E+++SLPT    Q   +  LE     C +C   Y  +EE
Sbjct: 188 IVTQLLGQLENTGPPP--ADKEKITSLPTVTVTQEQVDMGLE-----CPVCKEDYTVEEE 240

Query: 358 MRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
           +RQLPC+H FH +C+  WL +   CP+C+K L
Sbjct: 241 VRQLPCNHFFHSSCIVPWLELHDTCPVCRKSL 272



>pir|T06113|T06113 hypothetical protein T5J17.240 - Arabidopsis
           thaliana  (fragment)
          Length = 253

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 32/84 (38%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = -1

Query: 508 NMGSVERGA-SNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSH 335
           N GS  RG   N  + S P + Y  V     + +++ EC ICL +  D E +R LP C+H
Sbjct: 86  NDGSSRRGGLDNAVVESFPVFAYSSV-KESKIGSKDLECAICLNELEDHETVRLLPICNH 144

Query: 334 VFHLNCVDQWLRIISCCPLCKKDL 263
           +FH++C+D WL   + CP+C+ +L
Sbjct: 145 LFHIDCIDTWLYSHATCPVCRSNL 168



>pir|T06680|T06680 hypothetical protein T17F15.100 - Arabidopsis
           thaliana>gb:AB099346_1526135 Arabidopsis thaliana mRNA
           for YGHL1-C3HC4 RING fusion protein, complete
           cds.>gb:ATT17F15_1554701 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T17F15.
          Length = 349

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 30/80 (37%), Positives = 47/80 (58%), Gaps = 2/80 (2%)
 Frame = -1

Query: 493 ERGASNEQLSSLPTWKYKQVCNNPDLENENP-ECCICLAQYRDKEEMRQLP-CSHVFHLN 320
           + G     + +LP + Y     N  +  E P +C +CL ++ D +++R LP CSH FHL+
Sbjct: 178 DSGLDQTAIDALPVFLY----GNVTISLEQPFDCAVCLNEFSDTDKLRLLPVCSHAFHLH 233

Query: 319 CVDQWLRIISCCPLCKKDLA 260
           C+D WL   S CPLC++ L+
Sbjct: 234 CIDTWLLSNSTCPLCRRSLS 253



>pir|T04066|T04066 hypothetical protein F28M11.80 - Arabidopsis
           thaliana>gb:ATCHRIV28_1544730 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           28.>gb:ATF28M11_1550340 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F28M11 (ESSA
           project).>gb:AY122915_1579793 Arabidopsis thaliana
           unknown protein (At4g10160) mRNA, complete cds.
          Length = 225

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 31/92 (33%), Positives = 49/92 (53%), Gaps = 1/92 (1%)
 Frame = -1

Query: 535 VSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEM 356
           +  F+  N N+ + E G S +    LP   YK+     D +     C +CL  Y+ +E++
Sbjct: 56  LGGFVPTNNNLSTAELGLSKDIREMLPIVIYKESFTVNDTQ-----CSVCLGDYQAEEKL 110

Query: 355 RQLP-CSHVFHLNCVDQWLRIISCCPLCKKDL 263
           +Q+P C H FH+ C+D WL   + CPLC+  L
Sbjct: 111 QQMPSCGHTFHMECIDLWLTSHTTCPLCRLSL 142



>pir|T04065|T04065 hypothetical protein F28M11.70 - Arabidopsis
           thaliana>gb:ATCHRIV28_1544729 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           28.>gb:ATF28M11_1550339 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F28M11 (ESSA
           project).>gb:AY122914_1579792 Arabidopsis thaliana
           unknown protein (At4g10150) mRNA, complete cds.
          Length = 236

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 30/90 (33%), Positives = 50/90 (55%), Gaps = 1/90 (1%)
 Frame = -1

Query: 529 SFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQ 350
           +F+  N N+ + E G S +    LP   YK+         ++ +C +CL  Y+ +E+++Q
Sbjct: 72  TFVPTNNNLSTAELGLSKDIREMLPVVIYKE-----SFIVKDSQCSVCLGDYQAEEKLQQ 126

Query: 349 LP-CSHVFHLNCVDQWLRIISCCPLCKKDL 263
           +P C H FH+ C+D WL   + CPLC+  L
Sbjct: 127 MPSCGHTFHMECIDLWLTSHTTCPLCRLSL 156



>pir|H85474|H85474 hypothetical protein AT4g40070 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV92_1547991 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           92.>gb:ATT5J17_1556170 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T5J17 (ESSA project).
          Length = 322

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 32/84 (38%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = -1

Query: 508 NMGSVERGA-SNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSH 335
           N GS  RG   N  + S P + Y  V     + +++ EC ICL +  D E +R LP C+H
Sbjct: 86  NDGSSRRGGLDNAVVESFPVFAYSSV-KESKIGSKDLECAICLNELEDHETVRLLPICNH 144

Query: 334 VFHLNCVDQWLRIISCCPLCKKDL 263
           +FH++C+D WL   + CP+C+ +L
Sbjct: 145 LFHIDCIDTWLYSHATCPVCRSNL 168



>sp|Q9Y4L5|Z364_HUMAN Zinc finger protein 364
           (Fragment).>gb:HST000018_2020608 Homo sapiens mRNA full
           length insert cDNA clone EUROIMAGE 469780.
          Length = 232

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 35/92 (38%), Positives = 50/92 (54%)
 Frame = -1

Query: 538 MVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEE 359
           +V+  LG   N G     A  E+++SLPT    Q   +  LE     C +C   Y  +EE
Sbjct: 116 IVTQLLGQLENTGPPP--ADKEKITSLPTVTVTQEQVDMGLE-----CPVCKEDYTVEEE 168

Query: 358 MRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
           +RQLPC+H FH +C+  WL +   CP+C+K L
Sbjct: 169 VRQLPCNHFFHSSCIVPWLELHDTCPVCRKSL 200



>gb:BC039833_1982645 Homo sapiens ring finger protein 44, mRNA (cDNA
           clone MGC:48792 IMAGE:5535911), complete
           cds.>gb:BC063297_1986138 Homo sapiens ring finger
           protein 44, mRNA (cDNA clone MGC:71656 IMAGE:30349418),
           complete cds.
          Length = 432

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 26/76 (34%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDL-ENENPECCICLAQYRDKEEMRQLPCSHVFHLNCV 314
           RG +   +  LP++++     NPD  ++E   C +C + +  ++ +R LPC+H FH  CV
Sbjct: 353 RGLTKADIEQLPSYRF-----NPDSHQSEQTLCVVCFSDFEARQLLRVLPCNHEFHTKCV 407

Query: 313 DQWLRIISCCPLCKKD 266
           D+WL+    CP+C+ D
Sbjct: 408 DKWLKANRTCPICRAD 423



>gb:AB029023_1865879 Homo sapiens mRNA for KIAA1100 protein, partial
           cds.
          Length = 444

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 26/76 (34%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDL-ENENPECCICLAQYRDKEEMRQLPCSHVFHLNCV 314
           RG +   +  LP++++     NPD  ++E   C +C + +  ++ +R LPC+H FH  CV
Sbjct: 365 RGLTKADIEQLPSYRF-----NPDSHQSEQTLCVVCFSDFEARQLLRVLPCNHEFHTKCV 419

Query: 313 DQWLRIISCCPLCKKD 266
           D+WL+    CP+C+ D
Sbjct: 420 DKWLKANRTCPICRAD 435



>gb:BT020585_1642979 Arabidopsis thaliana At5g45290 gene, complete
           cds.>gb:BT020597_1642991 Arabidopsis thaliana At5g45290
           gene, complete cds.
          Length = 545

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 41/104 (39%), Positives = 57/104 (54%), Gaps = 2/104 (1%)
 Frame = -1

Query: 562 VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENP-ECCIC 386
           VVL    P VSS       +GSV   A N+ +  LP   Y +       ++E+P +C IC
Sbjct: 449 VVLSSQQPSVSS-------IGSVP--APNDVVDLLPIKLYTKS------QSEDPSQCYIC 493

Query: 385 LAQYRDKEEMRQLPCSHVFHLNCVDQWLR-IISCCPLCKKDLAR 257
           L +Y + + +R LPC H FH  CVD+WL+ I   CPLC+ D+ R
Sbjct: 494 LVEYEEADSIRTLPCHHEFHKTCVDKWLKEIHRVCPLCRGDICR 537



>gb:AY069873_1566619 Arabidopsis thaliana AT5g45290/K9E15_7 mRNA,
           complete cds.
          Length = 545

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 41/104 (39%), Positives = 57/104 (54%), Gaps = 2/104 (1%)
 Frame = -1

Query: 562 VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENP-ECCIC 386
           VVL    P VSS       +GSV   A N+ +  LP   Y +       ++E+P +C IC
Sbjct: 449 VVLSSQQPSVSS-------IGSVP--APNDVVDLLPIKLYTKS------QSEDPSQCYIC 493

Query: 385 LAQYRDKEEMRQLPCSHVFHLNCVDQWLR-IISCCPLCKKDLAR 257
           L +Y + + +R LPC H FH  CVD+WL+ I   CPLC+ D+ R
Sbjct: 494 LVEYEEADSIRALPCHHEFHKTCVDKWLKEIHRVCPLCRGDICR 537



>gb:HSM805597_1187613 Homo sapiens mRNA; cDNA DKFZp434F1431 (from
           clone DKFZp434F1431).
          Length = 354

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 26/76 (34%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDL-ENENPECCICLAQYRDKEEMRQLPCSHVFHLNCV 314
           RG +   +  LP++++     NPD  ++E   C +C + +  ++ +R LPC+H FH  CV
Sbjct: 275 RGLTKADIEQLPSYRF-----NPDSHQSEQTLCVVCFSDFEARQLLRVLPCNHEFHTKCV 329

Query: 313 DQWLRIISCCPLCKKD 266
           D+WL+    CP+C+ D
Sbjct: 330 DKWLKANRTCPICRAD 345



>gb:BC082339_2562576 Xenopus laevis XRnf12 protein, mRNA (cDNA clone
           MGC:78888 IMAGE:4174178), complete cds.
          Length = 622

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 28/89 (31%), Positives = 52/89 (58%)
 Frame = -1

Query: 535 VSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEM 356
           ++ F   N +     RG + EQ+ +L T  + +   N  L+     C +C+ +Y +  ++
Sbjct: 529 LAQFFLLNEDDDDQPRGLTKEQIDNLSTRNFGE---NDALKT----CSVCITEYTEGNKL 581

Query: 355 RQLPCSHVFHLNCVDQWLRIISCCPLCKK 269
           R+LPCSH +H++C+D+WL   S CP+C++
Sbjct: 582 RKLPCSHEYHIHCIDRWLSENSTCPICRR 610



>gb:AB114039_2465683 Xenopus laevis XRnf12 mRNA for XRnf12, complete
           cds.
          Length = 616

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 28/89 (31%), Positives = 52/89 (58%)
 Frame = -1

Query: 535 VSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEM 356
           ++ F   N +     RG + EQ+ +L T  + +   N  L+     C +C+ +Y +  ++
Sbjct: 523 LAQFFLLNEDDDDQPRGLTKEQIDNLSTRNFGE---NDALKT----CSVCITEYTEGNKL 575

Query: 355 RQLPCSHVFHLNCVDQWLRIISCCPLCKK 269
           R+LPCSH +H++C+D+WL   S CP+C++
Sbjct: 576 RKLPCSHEYHIHCIDRWLSENSTCPICRR 604



>gb:BC017630_2092524 Mus musculus ring finger protein 44, mRNA (cDNA
           clone MGC:28849 IMAGE:4507289), complete
           cds.>gb:BC035548_2097840 Mus musculus ring finger
           protein 44, mRNA (cDNA clone MGC:40655 IMAGE:4221284),
           complete cds.
          Length = 339

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 26/76 (34%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDL-ENENPECCICLAQYRDKEEMRQLPCSHVFHLNCV 314
           RG +   +  LP++++     NPD  ++E   C +C + +  ++ +R LPC+H FH  CV
Sbjct: 260 RGLTKADIEQLPSYRF-----NPDSHQSEQTLCVVCFSDFEVRQLLRVLPCNHEFHAKCV 314

Query: 313 DQWLRIISCCPLCKKD 266
           D+WL+    CP+C+ D
Sbjct: 315 DKWLKANRTCPICRAD 330



>gb:AK129290_2069521 Mus musculus mRNA for mKIAA1100 protein.
          Length = 384

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 26/76 (34%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDL-ENENPECCICLAQYRDKEEMRQLPCSHVFHLNCV 314
           RG +   +  LP++++     NPD  ++E   C +C + +  ++ +R LPC+H FH  CV
Sbjct: 305 RGLTKADIEQLPSYRF-----NPDSHQSEQTLCVVCFSDFEVRQLLRVLPCNHEFHAKCV 359

Query: 313 DQWLRIISCCPLCKKD 266
           D+WL+    CP+C+ D
Sbjct: 360 DKWLKANRTCPICRAD 375



>gb:AL161792_1922220 Human DNA sequence from clone RP11-84P7 on
           chromosome 9 Contains a high-mobility group box
           pseudogene, two novel gene and the 3' end of the RNF38
           gene for ring finger protein 38, complete
           sequence.>gb:AL354935_1923569 Human DNA sequence from
           clone RP11-117L14 on chromosome 9 Contains the 5' end of
           the RNF38 gene for ring finger protein 38 and a CpG
           island, complete sequence.>gb:BC033786_1981055 Homo
           sapiens ring finger protein 38, transcript variant 3,
           mRNA (cDNA clone MGC:44972 IMAGE:5166325), complete cds.
          Length = 465

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 24/75 (32%), Positives = 44/75 (58%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVD 311
           RG +   +  LP++++    N  + ++E   C +C+  +  ++ +R LPC+H FH  CVD
Sbjct: 386 RGLTKADIEQLPSYRF----NPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVD 441

Query: 310 QWLRIISCCPLCKKD 266
           +WL+    CP+C+ D
Sbjct: 442 KWLKANRTCPICRAD 456



>gb:AL161792_1922219 Human DNA sequence from clone RP11-84P7 on
           chromosome 9 Contains a high-mobility group box
           pseudogene, two novel gene and the 3' end of the RNF38
           gene for ring finger protein 38, complete
           sequence.>gb:AL354935_1923570 Human DNA sequence from
           clone RP11-117L14 on chromosome 9 Contains the 5' end of
           the RNF38 gene for ring finger protein 38 and a CpG
           island, complete sequence.
          Length = 515

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 24/75 (32%), Positives = 44/75 (58%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVD 311
           RG +   +  LP++++    N  + ++E   C +C+  +  ++ +R LPC+H FH  CVD
Sbjct: 436 RGLTKADIEQLPSYRF----NPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVD 491

Query: 310 QWLRIISCCPLCKKD 266
           +WL+    CP+C+ D
Sbjct: 492 KWLKANRTCPICRAD 506



>gb:AL161792_1922218 Human DNA sequence from clone RP11-84P7 on
           chromosome 9 Contains a high-mobility group box
           pseudogene, two novel gene and the 3' end of the RNF38
           gene for ring finger protein 38, complete
           sequence.>gb:AL354935_1923571 Human DNA sequence from
           clone RP11-117L14 on chromosome 9 Contains the 5' end of
           the RNF38 gene for ring finger protein 38 and a CpG
           island, complete sequence.
          Length = 439

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 24/75 (32%), Positives = 44/75 (58%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVD 311
           RG +   +  LP++++    N  + ++E   C +C+  +  ++ +R LPC+H FH  CVD
Sbjct: 360 RGLTKADIEQLPSYRF----NPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVD 415

Query: 310 QWLRIISCCPLCKKD 266
           +WL+    CP+C+ D
Sbjct: 416 KWLKANRTCPICRAD 430



>gb:AK024996_1910206 Homo sapiens cDNA: FLJ21343 fis, clone
           COL02679.
          Length = 332

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 24/75 (32%), Positives = 44/75 (58%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVD 311
           RG +   +  LP++++    N  + ++E   C +C+  +  ++ +R LPC+H FH  CVD
Sbjct: 253 RGLTKADIEQLPSYRF----NPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVD 308

Query: 310 QWLRIISCCPLCKKD 266
           +WL+    CP+C+ D
Sbjct: 309 KWLKANRTCPICRAD 323



>gb:AF394047_1900586 Homo sapiens RING finger protein 38 (RNF38)
           mRNA, complete cds.
          Length = 432

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 24/75 (32%), Positives = 44/75 (58%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVD 311
           RG +   +  LP++++    N  + ++E   C +C+  +  ++ +R LPC+H FH  CVD
Sbjct: 353 RGLTKADIEQLPSYRF----NPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVD 408

Query: 310 QWLRIISCCPLCKKD 266
           +WL+    CP+C+ D
Sbjct: 409 KWLKANRTCPICRAD 423



>gb:HSM801785_1186449 Homo sapiens mRNA; cDNA DKFZp434A0926 (from
           clone DKFZp434A0926).
          Length = 515

 Score = 64.7 bits (156), Expect = 5e-09
 Identities = 24/75 (32%), Positives = 44/75 (58%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVD 311
           RG +   +  LP++++    N  + ++E   C +C+  +  ++ +R LPC+H FH  CVD
Sbjct: 436 RGLTKADIEQLPSYRF----NPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVD 491

Query: 310 QWLRIISCCPLCKKD 266
           +WL+    CP+C+ D
Sbjct: 492 KWLKANRTCPICRAD 506



>gb:AP006067_1860833 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0569E11.
          Length = 325

 Score = 64.3 bits (155), Expect = 7e-09
 Identities = 30/83 (36%), Positives = 48/83 (57%), Gaps = 1/83 (1%)
 Frame = -1

Query: 505 MGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPE-CCICLAQYRDKEEMRQLPCSHVF 329
           +G+  RG S   L+SLP+  YK       +++ N E C IC  ++ D E +  LPC H +
Sbjct: 240 VGTGHRGLSAATLASLPSVTYKA----EGVQDGNTEQCVICRVEFEDGESLIALPCKHSY 295

Query: 328 HLNCVDQWLRIISCCPLCKKDLA 260
           H  C++QWL+I   CP+C  +++
Sbjct: 296 HPECINQWLQINKVCPMCSAEVS 318



>gb:BT015918_1642536 Arabidopsis thaliana At5g10650 gene, complete
           cds.>gb:BT020582_1642976 Arabidopsis thaliana At5g10650
           gene, complete cds.
          Length = 525

 Score = 64.3 bits (155), Expect = 7e-09
 Identities = 30/82 (36%), Positives = 50/82 (60%), Gaps = 4/82 (4%)
 Frame = -1

Query: 505 MGSVERGASNEQLS-SLPTWKYKQVCNNPDL---ENENPECCICLAQYRDKEEMRQLPCS 338
           MG+V    S E LS SL    Y++      +   ++++ +C IC  +Y D +E+  +PC 
Sbjct: 435 MGTVSTALSEEALSRSLKQSIYQETDETGSISLYKDDDIKCSICQEEYVDGDELGTIPCQ 494

Query: 337 HVFHLNCVDQWLRIISCCPLCK 272
           H++H++CV QWLR+ + CP+CK
Sbjct: 495 HMYHVSCVQQWLRMKNWCPICK 516



>gb:AY099680_1576705 Arabidopsis thaliana Pspzf zinc finger
           protein-like (At5g10650) mRNA, complete cds.
          Length = 525

 Score = 64.3 bits (155), Expect = 7e-09
 Identities = 30/82 (36%), Positives = 50/82 (60%), Gaps = 4/82 (4%)
 Frame = -1

Query: 505 MGSVERGASNEQLS-SLPTWKYKQVCNNPDL---ENENPECCICLAQYRDKEEMRQLPCS 338
           MG+V    S E LS SL    Y++      +   ++++ +C IC  +Y D +E+  +PC 
Sbjct: 435 MGTVSTALSEEALSRSLKQSIYQETDETGSISLYKDDDIKCSICQEEYVDGDELGTIPCQ 494

Query: 337 HVFHLNCVDQWLRIISCCPLCK 272
           H++H++CV QWLR+ + CP+CK
Sbjct: 495 HMYHVSCVQQWLRMKNWCPICK 516



>gb:ATTEL3S_1556656 Arabidopsis thaliana DNA chromosome 3, segment
           TEL3S.>gb:BT010197_1640263 Arabidopsis thaliana
           At3g63530 gene, complete cds.
          Length = 248

 Score = 64.3 bits (155), Expect = 7e-09
 Identities = 29/81 (35%), Positives = 43/81 (53%)
 Frame = -1

Query: 505 MGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFH 326
           +G+  RG S E + +LPT KYK   +    +     C IC  +Y+  E    LPC HV+H
Sbjct: 162 VGTESRGLSQELIETLPTKKYK-FGSIFSRKRAGERCVICQLKYKIGERQMNLPCKHVYH 220

Query: 325 LNCVDQWLRIISCCPLCKKDL 263
             C+ +WL I   CP+C  ++
Sbjct: 221 SECISKWLSINKVCPVCNSEV 241



>gb:ATMAJ23_1553714 Arabidopsis thaliana DNA chromosome 5, P1 clone
           MAJ23 (ESSA project).
          Length = 498

 Score = 64.3 bits (155), Expect = 7e-09
 Identities = 30/82 (36%), Positives = 50/82 (60%), Gaps = 4/82 (4%)
 Frame = -1

Query: 505 MGSVERGASNEQLS-SLPTWKYKQVCNNPDL---ENENPECCICLAQYRDKEEMRQLPCS 338
           MG+V    S E LS SL    Y++      +   ++++ +C IC  +Y D +E+  +PC 
Sbjct: 408 MGTVSTALSEEALSRSLKQSIYQETDETGSISLYKDDDIKCSICQEEYVDGDELGTIPCQ 467

Query: 337 HVFHLNCVDQWLRIISCCPLCK 272
           H++H++CV QWLR+ + CP+CK
Sbjct: 468 HMYHVSCVQQWLRMKNWCPICK 489



>gb:AE016959_1023878 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC087599_1734141
           Oryza sativa chromosome 10 BAC OSJNBa0057L21 genomic
           sequence, complete sequence.>gb:AE017120_1753697 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           74 of 77 of the complete sequence.
          Length = 354

 Score = 64.3 bits (155), Expect = 7e-09
 Identities = 44/124 (35%), Positives = 61/124 (49%), Gaps = 3/124 (2%)
 Frame = -1

Query: 622 LCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNM-NMGSVERGASNEQL-SSLPTW 449
           LC    A  A + S P +  VV     P  S+ +G  +    S ER A  E+L S LP  
Sbjct: 58  LCRRSSASAAASSSAPVLPVVVR----PASSAAVGEQVVGKASAERAAEMERLISRLPL- 112

Query: 448 KYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWLRIISCCPLCK 272
            +    +   L   + +C +C + +RD +E+R LP C H FH  CVD WLR    CPLC+
Sbjct: 113 -FTLASSLAALPKSSRDCAVCQSAFRDDDELRLLPACRHAFHSRCVDPWLRANPSCPLCR 171

Query: 271 KDLA 260
             +A
Sbjct: 172 ASIA 175



>gb:BC083548_2108634 Rattus norvegicus ring finger protein 38, mRNA
           (cDNA clone MGC:93195 IMAGE:7134112), complete cds.
          Length = 432

 Score = 63.9 bits (154), Expect = 9e-09
 Identities = 24/75 (32%), Positives = 44/75 (58%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVD 311
           RG +   +  LP++++    N  + ++E   C +C+  +  ++ +R LPC+H FH  CVD
Sbjct: 353 RGLTKADIEQLPSYRF----NPSNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVD 408

Query: 310 QWLRIISCCPLCKKD 266
           +WL+    CP+C+ D
Sbjct: 409 KWLKGNRTCPICRAD 423



>gb:BC060730_2104173 Mus musculus ring finger protein 38, mRNA (cDNA
           clone MGC:67600 IMAGE:6408623), complete
           cds.>gb:BC062976_2105116 Mus musculus ring finger
           protein 38, mRNA (cDNA clone MGC:86160 IMAGE:6848803),
           complete cds.
          Length = 464

 Score = 63.9 bits (154), Expect = 9e-09
 Identities = 24/75 (32%), Positives = 44/75 (58%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVD 311
           RG +   +  LP++++    N  + ++E   C +C+  +  ++ +R LPC+H FH  CVD
Sbjct: 385 RGLTKADIEQLPSYRF----NPSNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVD 440

Query: 310 QWLRIISCCPLCKKD 266
           +WL+    CP+C+ D
Sbjct: 441 KWLKGNRTCPICRAD 455



>gb:AY039004_2074365 Mus musculus RNF6 protein mRNA, complete cds.
          Length = 667

 Score = 63.9 bits (154), Expect = 9e-09
 Identities = 27/74 (36%), Positives = 45/74 (60%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVD 311
           RG + EQ+ +L T  Y+Q   + +L      C +C++ Y    ++RQLPC H FH++C+D
Sbjct: 586 RGLTKEQIDNLSTRSYEQDGVDSEL---GKVCSVCISDYVAGNKLRQLPCLHEFHIHCID 642

Query: 310 QWLRIISCCPLCKK 269
           +WL     CP+C++
Sbjct: 643 RWLSENCTCPVCRR 656



>gb:AK127467_1916760 Homo sapiens cDNA FLJ45559 fis, clone
           BRTHA3003225.
          Length = 346

 Score = 63.9 bits (154), Expect = 9e-09
 Identities = 31/91 (34%), Positives = 49/91 (53%), Gaps = 10/91 (10%)
 Frame = -1

Query: 505 MGSVERGASNEQLSSLPTWKYKQVCNNP----------DLENENPECCICLAQYRDKEEM 356
           +G+V RGA    +    T+ +K     P          +  + + +C ICL+   D E++
Sbjct: 249 LGNVTRGAVQNTIERF-TFPHKYKKRRPQDGKGKKDEGEESDTDEKCTICLSMLEDGEDV 307

Query: 355 RQLPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
           R+LPC H+FH  CVDQWL +   CP+C+ D+
Sbjct: 308 RRLPCMHLFHQLCVDQWLAMSKKCPICRVDI 338



>gb:AF132016_1770849 Arabidopsis thaliana RING-H2 zinc finger
           protein ATL6 (ATL6) mRNA, complete cds.
          Length = 398

 Score = 63.9 bits (154), Expect = 9e-09
 Identities = 31/83 (37%), Positives = 44/83 (53%), Gaps = 1/83 (1%)
 Frame = -1

Query: 505 MGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVF 329
           + +  RG     + + PT+ Y  V     L     EC ICL ++ D E +R LP C HVF
Sbjct: 93  VNAAARGLDVSVVETFPTFLYSDV-KTQKLGKGELECAICLNEFEDDETLRLLPKCDHVF 151

Query: 328 HLNCVDQWLRIISCCPLCKKDLA 260
           H +C+D WL     CP+C+ +LA
Sbjct: 152 HPHCIDAWLEAHVTCPVCRANLA 174



>gb:AC105773_1738245 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1562_H01, complete sequence.
          Length = 549

 Score = 63.9 bits (154), Expect = 9e-09
 Identities = 34/85 (40%), Positives = 50/85 (58%), Gaps = 1/85 (1%)
 Frame = -1

Query: 508 NMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVF 329
           ++GSV   A  E +  LP   Y++   +     E  +C ICL +Y + + +R LPC+H F
Sbjct: 459 SIGSVP--APKEVVERLPVKVYRRSLKHQT--EEAAQCYICLVEYAEGDCVRILPCNHEF 514

Query: 328 HLNCVDQWLR-IISCCPLCKKDLAR 257
           HL CVD+WL+ I   CPLC+ D+ R
Sbjct: 515 HLTCVDKWLKEIHRVCPLCRGDVCR 539



>gb:OSJN00128_1695355 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0088I22, complete sequence.
          Length = 298

 Score = 63.9 bits (154), Expect = 9e-09
 Identities = 26/81 (32%), Positives = 47/81 (58%)
 Frame = -1

Query: 505 MGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFH 326
           +G+  +G   + ++ LPT  YK        + ++ EC IC   Y++++ + +LPC H +H
Sbjct: 215 IGTESKGLPEDVIALLPTSTYK--IRIFSRKEKHDECVICCMTYKNRDRLTKLPCEHQYH 272

Query: 325 LNCVDQWLRIISCCPLCKKDL 263
             CV +WL+I   CP+C K++
Sbjct: 273 QTCVTKWLKINKVCPVCNKEV 293



>gb:AK029650_1161590 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4930426I11
           product:HYPOTHETICAL 43.9 KDA PROTEIN homolog [Homo
           sapiens], full insert sequence.
          Length = 518

 Score = 63.9 bits (154), Expect = 9e-09
 Identities = 24/75 (32%), Positives = 44/75 (58%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVD 311
           RG +   +  LP++++    N  + ++E   C +C+  +  ++ +R LPC+H FH  CVD
Sbjct: 439 RGLTKADIEQLPSYRF----NPSNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVD 494

Query: 310 QWLRIISCCPLCKKD 266
           +WL+    CP+C+ D
Sbjct: 495 KWLKGNRTCPICRAD 509



>gb:AK004745_1152558 Mus musculus adult male lung cDNA, RIKEN
           full-length enriched library, clone:1200013I08
           product:similar to RING FINGER PROTEIN 6 [Homo sapiens],
           full insert sequence.
          Length = 667

 Score = 63.9 bits (154), Expect = 9e-09
 Identities = 27/74 (36%), Positives = 45/74 (60%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVD 311
           RG + EQ+ +L T  Y+Q   + +L      C +C++ Y    ++RQLPC H FH++C+D
Sbjct: 586 RGLTKEQIDNLSTRSYEQDGVDSEL---GKVCSVCISDYVAGNKLRQLPCLHEFHIHCID 642

Query: 310 QWLRIISCCPLCKK 269
           +WL     CP+C++
Sbjct: 643 RWLSENCTCPVCRR 656



>pir|T00428|T00428 hypothetical protein At2g47560 [imported] -
           Arabidopsis thaliana>gb:AC002535_1530834 Arabidopsis
           thaliana chromosome 2 clone T30B22 map CIC06C03,
           complete sequence.>gb:BT003983_1637101 Arabidopsis
           thaliana clone RAFL15-24-N06 (R20695) unknown protein
           (At2g47560) mRNA, complete cds.>gb:BT005009_1637955
           Arabidopsis thaliana clone U20695 unknown protein
           (At2g47560) mRNA, complete cds.
          Length = 227

 Score = 63.9 bits (154), Expect = 9e-09
 Identities = 27/67 (40%), Positives = 40/67 (59%), Gaps = 1/67 (1%)
 Frame = -1

Query: 469 LSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWLRII 293
           L  +P + Y     NP    E  EC +CL+++ +++E R LP C H FH++C+D W R  
Sbjct: 86  LDKIPIFVYSS--KNPPPPEEKEECSVCLSEFEEEDEGRLLPKCGHSFHVDCIDTWFRSR 143

Query: 292 SCCPLCK 272
           S CPLC+
Sbjct: 144 STCPLCR 150



>gb:BC023113_2094037 Mus musculus zinc finger protein 364, mRNA
           (cDNA clone MGC:28329 IMAGE:4015975), complete cds.
          Length = 305

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 34/92 (36%), Positives = 49/92 (53%)
 Frame = -1

Query: 538 MVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEE 359
           +V+  LG   N G     A  E+++SLPT    Q   N  LE     C +C   Y  + +
Sbjct: 189 IVTQLLGQLENTGPPP--ADKEKITSLPTVTVTQEQVNTGLE-----CPVCKEDYTVEGK 241

Query: 358 MRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
           +RQLPC+H FH +C+  WL +   CP+C+K L
Sbjct: 242 VRQLPCNHFFHSSCIVPWLELHDTCPVCRKSL 273



>gb:AP004704_1843704 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0544G09.>gb:AP006265_1861533 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1112_E06.
          Length = 305

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 28/82 (34%), Positives = 48/82 (58%), Gaps = 1/82 (1%)
 Frame = -1

Query: 505 MGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPE-CCICLAQYRDKEEMRQLPCSHVF 329
           +G+  RG S + L+SLP+  Y+      D ++ N E C IC  ++ + E +  LPC H +
Sbjct: 220 VGTESRGLSADTLASLPSITYRA----QDKQDGNMEQCVICRVEFEEGESLVALPCKHSY 275

Query: 328 HLNCVDQWLRIISCCPLCKKDL 263
           H  C++QWL++   CP+C  ++
Sbjct: 276 HSECINQWLQLNKVCPMCSAEV 297



>gb:AY084377_1569468 Arabidopsis thaliana clone 106078 mRNA,
           complete sequence.
          Length = 368

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 31/81 (38%), Positives = 46/81 (56%), Gaps = 1/81 (1%)
 Frame = -1

Query: 499 SVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHL 323
           +V RG   E + + PT+ Y +V     +     EC ICL ++ D E +R LP C HVFH 
Sbjct: 91  TVARGLDVETIETFPTFVYSEV-KTQKIGKGALECAICLNEFEDDETLRLLPKCDHVFHP 149

Query: 322 NCVDQWLRIISCCPLCKKDLA 260
           +C+  WL+    CP+C+ +LA
Sbjct: 150 HCIGAWLQGHVTCPVCRTNLA 170



>gb:AY039551_1560264 Arabidopsis thaliana At1g49200/F27J15_35 mRNA,
           complete cds.>gb:AY093753_1575413 Arabidopsis thaliana
           At1g49200/F27J15_35 mRNA, complete cds.
          Length = 226

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 35/106 (33%), Positives = 51/106 (48%), Gaps = 7/106 (6%)
 Frame = -1

Query: 568 LFVVLCCCVPMVSSFL------GYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENE 407
           L  ++ C     SSF+      G +   GS  +G + + L   P   Y    N P L   
Sbjct: 76  LHYIIRCAFRRTSSFMISEPIAGLSTPCGSSNKGINKKALRMFPVVSYSPEMNLPGL--- 132

Query: 406 NPECCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWLRIISCCPLCK 272
             EC ICL+ +   E++R LP C H FH+ C+D+WL+    CP C+
Sbjct: 133 GEECVICLSDFVSGEQIRMLPKCHHGFHVRCIDKWLQQHLTCPKCR 178



>pir|T00480|T00480 probable RING zinc finger protein At2g34990
           [imported] - Arabidopsis thaliana>gb:AC004238_1531570
           Arabidopsis thaliana chromosome 2 clone F19I3 map ve016,
           complete sequence.
          Length = 302

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 30/77 (38%), Positives = 43/77 (55%), Gaps = 1/77 (1%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCV 314
           RG     ++S PT+ Y +V     +     EC +C+ ++ D E +R +P C HVFH +CV
Sbjct: 66  RGLDEAIINSFPTFLYSEV-KERRIGIGGVECAVCICEFEDHETLRLMPECCHVFHADCV 124

Query: 313 DQWLRIISCCPLCKKDL 263
             WL   S CPLC+ DL
Sbjct: 125 SVWLSDHSTCPLCRVDL 141



>sp|Q9WTV7|RN12_MOUSE RING finger protein 12 (LIM domain interacting
           RING finger protein) (RING finger LIM domain-binding
           protein) (R-LIM).>gb:AF069992_2053283 Mus musculus LIM
           domain interacting RING finger protein (R-lim) mRNA,
           complete cds.
          Length = 600

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 26/74 (35%), Positives = 47/74 (63%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVD 311
           RG + EQ+ +L    + +   N  L+     C +C+ +Y + +++R+LPCSH FH++C+D
Sbjct: 522 RGLTKEQIDNLAMRSFGE---NDALKT----CSVCITEYTEGDKLRKLPCSHEFHVHCID 574

Query: 310 QWLRIISCCPLCKK 269
           +WL   S CP+C++
Sbjct: 575 RWLSENSTCPICRR 588



>gb:AL596117_2070852 Mouse DNA sequence from clone RP23-326P7 on
           chromosome 11 Contains the Gp1ba gene for glycoprotein
           1b alpha polypeptide, the Slc25a11 gene for solute
           carrier family 25 (mitochondrial carrier; oxoglutarate
           carrier) member 11, the gene for a novel PA domain and
           C3HC4 type zinc finger (RING finger) containing protein,
           the Pfn1 gene for profilin 1, five novel genes, the Eno3
           gene for muscle enolase 3 beta, the Spag7 gene for sperm
           associated antigen 7, the Kif1c gene for kinesin family
           member 1C, a ribosomal protein 37A (Rpl37a) pseudogene,
           the gene for a novel zinc finger protein and six CpG
           islands, complete sequence.>gb:BC010777_2091109 Mus
           musculus ring finger protein 167, mRNA (cDNA clone
           MGC:18686 IMAGE:4241357), complete cds.
          Length = 347

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 29/76 (38%), Positives = 44/76 (57%), Gaps = 1/76 (1%)
 Frame = -1

Query: 481 SNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL 302
           + EQL  +PT  Y++        +E   C ICL +Y D +++R LPC+H +H  CVD WL
Sbjct: 209 TKEQLKQIPTHDYQK-------GDEYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPWL 261

Query: 301 -RIISCCPLCKKDLAR 257
            +    CP+CK+ + R
Sbjct: 262 TQTRKTCPICKQPVHR 277



>gb:AP005114_1848115 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0689H05.
          Length = 349

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 35/116 (30%), Positives = 55/116 (47%), Gaps = 4/116 (3%)
 Frame = -1

Query: 592 VTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSV---ERGASNEQLSSLPTWKYKQVCNNP 422
           V +   F+  +V  CC    S+  G      S     RG     ++++P   Y +V  + 
Sbjct: 55  VFFVLVFVCVIVNQCCDCDSSAGAGAGQGQSSAARRRRGLDPAAVAAIPVVPYAEVRKHR 114

Query: 421 DLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWLRIISCCPLCKKDLAR 257
                  EC +CL  + D +++R LP CSH FH +C+D WL     CPLC+ +L +
Sbjct: 115 SGGGGALECAVCLTVFDDGDDLRLLPQCSHAFHPDCIDPWLEGHVTCPLCRANLEK 170



>gb:AP004587_1841965 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0543D10.>gb:AP004623_1842252 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0705A05.
          Length = 241

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 30/91 (32%), Positives = 49/91 (53%), Gaps = 1/91 (1%)
 Frame = -1

Query: 541 PMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKE 362
           P+ S FL  +     +  G     +  +PT +Y+Q        N+  +C +CL ++R+ E
Sbjct: 54  PLPSFFLAADQPRRGL--GLEEAAIRRIPTLRYQQ----QQQHNKQQQCGVCLGEFREGE 107

Query: 361 EMRQLP-CSHVFHLNCVDQWLRIISCCPLCK 272
            +R+LP C H FH++C+D WL     CPLC+
Sbjct: 108 RLRRLPPCLHSFHIDCIDAWLATALTCPLCR 138



>gb:AP004071_1837265 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1717_A09.
          Length = 189

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 32/80 (40%), Positives = 42/80 (52%), Gaps = 1/80 (1%)
 Frame = -1

Query: 499 SVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHL 323
           +  +G   E L SLPT  Y       + E    EC ICL ++ D + +R LP C H FH 
Sbjct: 70  AANKGVKKEVLRSLPTVTYVSDGGGGEAE----ECAICLVEFEDGQAVRVLPQCDHRFHA 125

Query: 322 NCVDQWLRIISCCPLCKKDL 263
            C+D WLR  S CP C++ L
Sbjct: 126 ACIDTWLRAHSSCPSCRRVL 145



>gb:AY136427_1581928 Arabidopsis thaliana RING finger-like protein
           (At5g24870) mRNA, complete cds.>gb:BT014966_1641936
           Arabidopsis thaliana At5g24870 gene, complete cds.
          Length = 520

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 33/91 (36%), Positives = 49/91 (53%), Gaps = 7/91 (7%)
 Frame = -1

Query: 523 LGYNMNMGSVERGASNEQL-----SSL--PTWKYKQVCNNPDLENENPECCICLAQYRDK 365
           L     MG+V    S E L     SS+  P  +   +C N D   ++ +C IC  +Y D 
Sbjct: 422 LALEEKMGTVSTALSEEALLKSLKSSIYRPNDESDDICLNKD---DDVKCSICQEEYVDG 478

Query: 364 EEMRQLPCSHVFHLNCVDQWLRIISCCPLCK 272
           +E+  LPC H +H++C  QWLR+ + CP+CK
Sbjct: 479 DEVGTLPCQHKYHVSCAQQWLRMKNWCPICK 509



>gb:BX538350_1358784 Cryptosporidium parvum chromosome 6, complete
           sequence; segment 1/4.
          Length = 207

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 33/102 (32%), Positives = 49/102 (48%), Gaps = 24/102 (23%)
 Frame = -1

Query: 496 VERGASNEQLSSL-PTWKYKQVCN-----------------------NPDLENENPECCI 389
           V +  SNE+LS + P  KY  + N                       +      N  C I
Sbjct: 53  VSQTISNEELSKIAPVKKYSSLSNKHYRREYNIYNKSSSFSGYLSSGSTHKSKNNYSCVI 112

Query: 388 CLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
           CL    D++ +R+LPC H++H NC+D+W++I S CPLC  +L
Sbjct: 113 CLNNICDEDLVRKLPCKHIYHFNCIDEWVKIKSNCPLCNINL 154



>pir|C86358|C86358 Similar to zinc finger protein [imported] -
           Arabidopsis thaliana>gb:AE005172_891204 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC006551_1534442 Arabidopsis thaliana
           chromosome I BAC F12K8 genomic sequence, complete
           sequence.>gb:BT011235_1640985 Arabidopsis thaliana
           At1g22500 gene, complete cds.>gb:BT012542_1641612
           Arabidopsis thaliana At1g22500 gene, complete cds.
          Length = 381

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 30/80 (37%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = -1

Query: 499 SVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHL 323
           + E G     + + PT+ Y  V     +  E  EC +CL ++ D E +R +P C HVFH 
Sbjct: 85  TTEPGLDASVIETFPTFPYSTV-KTLRIGKEALECPVCLNEFEDDETLRLIPQCCHVFHP 143

Query: 322 NCVDQWLRIISCCPLCKKDL 263
            C+D WLR  + CPLC+ +L
Sbjct: 144 GCIDAWLRSQTTCPLCRANL 163



>gb:BC083670_2108745 Rattus norvegicus similar to RIKEN cDNA
           5730408C10 (predicted), mRNA (cDNA clone MGC:94514
           IMAGE:7135651), complete cds.
          Length = 349

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 29/76 (38%), Positives = 44/76 (57%), Gaps = 1/76 (1%)
 Frame = -1

Query: 481 SNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL 302
           + EQL  +PT  Y++        +E   C ICL +Y D +++R LPC+H +H  CVD WL
Sbjct: 209 TKEQLKQIPTHDYQK-------GDEYDVCAICLDEYEDGDKLRILPCAHAYHSRCVDPWL 261

Query: 301 -RIISCCPLCKKDLAR 257
            +    CP+CK+ + R
Sbjct: 262 TQTRKTCPICKQPVHR 277



>gb:AF480444_2066797 Rattus norvegicus RING finger protein OIP1
           (Oip1) mRNA, complete cds.
          Length = 432

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 24/75 (32%), Positives = 43/75 (57%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVD 311
           RG +   +  LP +++    N  + ++E   C +C+  +  ++ +R LPC+H FH  CVD
Sbjct: 353 RGLTKADIEQLPFYRF----NPSNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVD 408

Query: 310 QWLRIISCCPLCKKD 266
           +WL+    CP+C+ D
Sbjct: 409 KWLKGNRTCPICRAD 423



>gb:AP005425_1851637 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0644A02.
          Length = 442

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 31/80 (38%), Positives = 46/80 (57%), Gaps = 2/80 (2%)
 Frame = -1

Query: 493 ERGASNEQLSSLPTWKYKQVCNNPDLENENP-ECCICLAQYRDKEEMRQLP-CSHVFHLN 320
           +RG     + S PT KY +     D   +   EC +CL+++ D EE+R LP CSH FH +
Sbjct: 121 QRGLDPAVVESFPTMKYAEARELRDGGKDAVLECAVCLSEFDDDEELRLLPKCSHAFHPD 180

Query: 319 CVDQWLRIISCCPLCKKDLA 260
           C+ +WL     CP+C+ +LA
Sbjct: 181 CIGEWLAGHVTCPVCRCNLA 200



>gb:BT010323_1640270 Arabidopsis thaliana At1g23980 mRNA, complete
           cds.>gb:AK119101_1817043 Arabidopsis thaliana At1g23980
           mRNA for unknown protein, complete cds, clone:
           RAFL21-45-G23.
          Length = 369

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 27/78 (34%), Positives = 45/78 (57%), Gaps = 1/78 (1%)
 Frame = -1

Query: 493 ERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNC 317
           + G     + +LP + YK++        E  +C +CL ++ + +++R LP CSH FH++C
Sbjct: 116 DSGLDQALIDALPVFLYKEIKGT----KEPFDCAVCLCEFSEDDKLRLLPNCSHAFHIDC 171

Query: 316 VDQWLRIISCCPLCKKDL 263
           +D WL   S CPLC+  L
Sbjct: 172 IDTWLLSNSTCPLCRGTL 189



>gb:HSM801486_1186198 Homo sapiens mRNA; cDNA DKFZp434F0721 (from
           clone DKFZp434F0721).
          Length = 366

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 26/74 (35%), Positives = 44/74 (59%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVD 311
           RG + EQ+ +L T  Y+    + +L      C +C++ Y    ++RQLPC H FH++C+D
Sbjct: 285 RGLTKEQIDNLSTRHYEHNSIDSEL---GKICSVCISDYVTGNKLRQLPCMHEFHIHCID 341

Query: 310 QWLRIISCCPLCKK 269
           +WL     CP+C++
Sbjct: 342 RWLSENCTCPICRQ 355



>gb:CR749238_1180869 Homo sapiens mRNA; cDNA DKFZp686P0776 (from
           clone DKFZp686P0776).
          Length = 685

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 26/74 (35%), Positives = 44/74 (59%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVD 311
           RG + EQ+ +L T  Y+    + +L      C +C++ Y    ++RQLPC H FH++C+D
Sbjct: 604 RGLTKEQIDNLSTRHYEHNSIDSEL---GKICSVCISDYVTGNKLRQLPCMHEFHIHCID 660

Query: 310 QWLRIISCCPLCKK 269
           +WL     CP+C++
Sbjct: 661 RWLSENCTCPICRQ 674



>gb:AE016959_1022769 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017098_1752588
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 52 of 77 of the complete sequence.
          Length = 133

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 23/45 (51%), Positives = 33/45 (73%), Gaps = 3/45 (6%)
 Frame = -1

Query: 397 CCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRII---SCCPLCK 272
           CC+C++ +RD EE+R+LPC H FH +CVD+WL +      CPLC+
Sbjct: 53  CCVCISGFRDGEEVRRLPCGHAFHRDCVDRWLALYCRRRTCPLCR 97



>gb:AE005172_891351 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC002423_1530732 Genomic sequence
           for Arabidopsis thaliana BAC T23E23, complete sequence.
          Length = 406

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 27/78 (34%), Positives = 45/78 (57%), Gaps = 1/78 (1%)
 Frame = -1

Query: 493 ERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNC 317
           + G     + +LP + YK++        E  +C +CL ++ + +++R LP CSH FH++C
Sbjct: 153 DSGLDQALIDALPVFLYKEIKGT----KEPFDCAVCLCEFSEDDKLRLLPNCSHAFHIDC 208

Query: 316 VDQWLRIISCCPLCKKDL 263
           +D WL   S CPLC+  L
Sbjct: 209 IDTWLLSNSTCPLCRGTL 226



>pir|T43459|T43459 hypothetical protein DKFZp434F0721.1 - human
           (fragment)
          Length = 366

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 26/74 (35%), Positives = 44/74 (59%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVD 311
           RG + EQ+ +L T  Y+    + +L      C +C++ Y    ++RQLPC H FH++C+D
Sbjct: 285 RGLTKEQIDNLSTRHYEHNSIDSEL---GKICSVCISDYVTGNKLRQLPCMHEFHIHCID 341

Query: 310 QWLRIISCCPLCKK 269
           +WL     CP+C++
Sbjct: 342 RWLSENCTCPICRQ 355



>pir|T04483|T04483 probable ring finger protein -
           barley>gb:HVCH4H_1682309 Hordeum vulgare DNA for
           chromosome 4H.
          Length = 295

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 26/45 (57%), Positives = 33/45 (73%), Gaps = 1/45 (2%)
 Frame = -1

Query: 400 ECCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWLRIISCCPLCKK 269
           EC ICL+++ DKEE+R LP C H FH+ CVD WLR  S CP C++
Sbjct: 208 ECAICLSEFADKEEIRVLPQCGHGFHVACVDAWLRAHSSCPSCRR 252



>pir|T08944|T08944 hypothetical protein F25O24.10 - Arabidopsis
           thaliana>gb:ATCHRIV69_1546769 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           69.>gb:ATF25O24_1550071 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F25O24 (ESSA project).
          Length = 432

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 35/125 (28%), Positives = 60/125 (48%), Gaps = 17/125 (13%)
 Frame = -1

Query: 595 AVTYSFPFILFVVLCCCVPMVSSFLG--------------YNMNMGSVER--GASNEQLS 464
           A+ ++  F+L V   CC   + S  G              +N +  S +R  G     + 
Sbjct: 45  AIMFALTFVLLVYAKCCHIDLRSGSGDRRRHDRRLRQGIFFNRSTASSDRFSGLDKTAIE 104

Query: 463 SLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWLRIISC 287
           SLP +++  +  +     +  +C +CL+++   E +R LP C H FH+ C+DQWL   + 
Sbjct: 105 SLPLFRFSALKGS----KQGLDCSVCLSKFESVEILRLLPKCRHAFHIGCIDQWLEQHAT 160

Query: 286 CPLCK 272
           CPLC+
Sbjct: 161 CPLCR 165



>pir|T51464|T51464 RING-H2 zinc finger protein-like - Arabidopsis
           thaliana>gb:ATK10A8_1553511 Arabidopsis thaliana DNA
           chromosome 5, BAC clone K10A8 (ESSA project).
          Length = 362

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 27/73 (36%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = -1

Query: 487 GASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVD 311
           G +   + S+  +KYK    + D   +  +C +CL+++ + E +R LP C+H FHL C+D
Sbjct: 116 GLNESMIKSITVYKYK----SGDGFVDGSDCSVCLSEFEENESLRLLPKCNHAFHLPCID 171

Query: 310 QWLRIISCCPLCK 272
            WL+  S CPLC+
Sbjct: 172 TWLKSHSNCPLCR 184



>pir|H84566|H84566 probable RING zinc finger protein [imported] -
           Arabidopsis thaliana>gb:AC005724_1532943 Arabidopsis
           thaliana chromosome 2 clone MSF3 map CIC06E08, complete
           sequence.
          Length = 423

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 27/78 (34%), Positives = 45/78 (57%), Gaps = 1/78 (1%)
 Frame = -1

Query: 493 ERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNC 317
           + G     + +LP + YK +     L+    +C +CL ++  ++++R LP CSH FH+ C
Sbjct: 97  DSGVDQSLIDTLPVFHYKSIVG---LKISPFDCPVCLCEFETEDKLRLLPKCSHAFHVEC 153

Query: 316 VDQWLRIISCCPLCKKDL 263
           +D WL   S CPLC+ +L
Sbjct: 154 IDTWLLSHSTCPLCRSNL 171



>sp|Q9Y252|RNF6_HUMAN RING finger protein 6 (RING-H2
           protein).>gb:AL138966_1920156 Human DNA sequence from
           clone RP11-380N8 on chromosome 13 Contains the RNF6 gene
           for ring finger protein (C3H2C3 type) 6, a
           protein-kinase, interferon-inducible double stranded RNA
           dependent inhibitor, repressor of (P58
           repressor)(inhibitor of protein kinase PKR) (PRKRIR)
           pseudogene, a TcD37 homolog (HTCD37) pseudogene, a
           pseudogene similar to part of ATPase, aminophospholipid
           transporter (APLT), Class I, type 8A, member 1 (ATPase
           II aminophospholipid translocase) (ATP8A1)(ATPIA, ATPP2,
           ATPASEII) and 2 CpG islands, complete
           sequence.>gb:AY009109_1934135 Homo sapiens ring-H2
           protein mRNA, complete cds.>gb:BC034688_1981350 Homo
           sapiens ring finger protein (C3H2C3 type) 6, transcript
           variant 1, mRNA (cDNA clone MGC:21246 IMAGE:4508997),
           complete cds.>gb:HSA010346_1999964 Homo sapiens mRNA for
           RING-H2 protein RNF6, alternative exon
           1a.>gb:HSA010347_1999965 Homo sapiens mRNA for RING-H2
           protein RNF6, alternative exon 1b.
          Length = 685

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 26/74 (35%), Positives = 44/74 (59%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVD 311
           RG + EQ+ +L T  Y+    + +L      C +C++ Y    ++RQLPC H FH++C+D
Sbjct: 604 RGLTKEQIDNLSTRHYEHNSIDSEL---GKICSVCISDYVTGNKLRQLPCMHEFHIHCID 660

Query: 310 QWLRIISCCPLCKK 269
           +WL     CP+C++
Sbjct: 661 RWLSENCTCPICRQ 674



>gb:HSM805319_2017870 Homo sapiens mRNA; cDNA DKFZp566H073 (from
           clone DKFZp566H073).
          Length = 349

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 28/76 (36%), Positives = 44/76 (57%), Gaps = 1/76 (1%)
 Frame = -1

Query: 481 SNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL 302
           + EQL  +PT  Y++        ++   C ICL +Y D +++R LPC+H +H  CVD WL
Sbjct: 209 TKEQLKQIPTHDYQK--------DQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPWL 260

Query: 301 -RIISCCPLCKKDLAR 257
            +    CP+CK+ + R
Sbjct: 261 TQTRKTCPICKQPVHR 276



>gb:HSM800147_2017112 Homo sapiens mRNA; cDNA DKFZp566H073 (from
           clone DKFZp566H073); partial cds.
          Length = 324

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 28/76 (36%), Positives = 44/76 (57%), Gaps = 1/76 (1%)
 Frame = -1

Query: 481 SNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL 302
           + EQL  +PT  Y++        ++   C ICL +Y D +++R LPC+H +H  CVD WL
Sbjct: 184 TKEQLKQIPTHDYQK--------DQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPWL 235

Query: 301 -RIISCCPLCKKDLAR 257
            +    CP+CK+ + R
Sbjct: 236 TQTRKTCPICKQPVHR 251



>gb:AP005511_1853146 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0011N12.
          Length = 317

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 26/73 (35%), Positives = 40/73 (54%), Gaps = 1/73 (1%)
 Frame = -1

Query: 487 GASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVD 311
           G     L+++P +++K   +   L     EC +CL+  +D + +R LP C H FH  CVD
Sbjct: 90  GLDKAALAAIPVFRFKASASAAALGGGEAECAVCLSGMQDGDAVRALPGCGHAFHAGCVD 149

Query: 310 QWLRIISCCPLCK 272
            WLR    CP+C+
Sbjct: 150 AWLRAHGTCPVCR 162



>gb:AP003722_1832391 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:B1011A07.>gb:AP003934_1835486 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0551A11.
          Length = 198

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = -1

Query: 478 NEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWL 302
           ++ L+SLP +  +   +  +      EC +C+A+ RD +E R LP C H FH +CVD WL
Sbjct: 101 DDVLASLPVFVVRS--SGGEKAEAEAECAVCIAELRDGDECRALPRCGHRFHASCVDGWL 158

Query: 301 RIISCCPLCK 272
           R+ + CPLC+
Sbjct: 159 RLHTTCPLCR 168



>gb:AF079183_1766305 Arabidopsis thaliana RING-H2 finger protein
           RHG1a mRNA, partial cds.
          Length = 190

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 29/85 (34%), Positives = 45/85 (52%), Gaps = 1/85 (1%)
 Frame = -1

Query: 523 LGYNMNMGSVERGASNEQLSS-LPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQL 347
           L     +G V  G + E +S+ L   KYK    +P    +   CC+C  +Y + E+M  L
Sbjct: 96  LALEERIGDVCTGVNEETISNRLKQRKYKSNTKSPQ---DAEPCCVCQEEYTEGEDMGTL 152

Query: 346 PCSHVFHLNCVDQWLRIISCCPLCK 272
            C H FH  C+++WL+  + CP+CK
Sbjct: 153 ECGHEFHSQCIEEWLKQKNLCPICK 177



>gb:AY095995_1575869 Arabidopsis thaliana AT3g19950/MPN9_19 mRNA,
           complete cds.>gb:BT000583_1634861 Arabidopsis thaliana
           unknown protein (At3g19950/MPN9_19) mRNA, complete cds.
          Length = 328

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 25/74 (33%), Positives = 46/74 (62%)
 Frame = -1

Query: 484 ASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQW 305
           AS   + +LPT K  +      L++E  +C +C+ ++ D  +++Q+PC HVFH +C+  W
Sbjct: 191 ASKSAIDALPTVKVTKDM----LKSEMNQCAVCMDEFEDGSDVKQMPCKHVFHQDCLLPW 246

Query: 304 LRIISCCPLCKKDL 263
           L + + CP+C+ +L
Sbjct: 247 LELHNSCPVCRFEL 260



>gb:ATAC009895_1543067 Arabidopsis thaliana chromosome III BAC T21P5
           genomic sequence, complete sequence.
          Length = 291

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 26/73 (35%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = -1

Query: 487 GASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVD 311
           G     + S+  +KY+++    D   E+ +C +CL+++++ E +R LP C+H FH+ C+D
Sbjct: 133 GLDESLIKSITVYKYRKM----DGFVESSDCSVCLSEFQENESLRLLPKCNHAFHVPCID 188

Query: 310 QWLRIISCCPLCK 272
            WL+  S CPLC+
Sbjct: 189 TWLKSHSNCPLCR 201



>gb:ATAC009327_1542949 Arabidopsis thaliana chromosome III BAC
           T12J13 genomic sequence, complete
           sequence.>gb:AY085462_1570531 Arabidopsis thaliana clone
           152633 mRNA, complete sequence.>gb:BT006433_1639320
           Arabidopsis thaliana At3g03550 gene, complete cds.
          Length = 356

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 26/73 (35%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = -1

Query: 487 GASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVD 311
           G     + S+  +KY+++    D   E+ +C +CL+++++ E +R LP C+H FH+ C+D
Sbjct: 133 GLDESLIKSITVYKYRKM----DGFVESSDCSVCLSEFQENESLRLLPKCNHAFHVPCID 188

Query: 310 QWLRIISCCPLCK 272
            WL+  S CPLC+
Sbjct: 189 TWLKSHSNCPLCR 201



>gb:AB025631_1516571 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MPN9.
          Length = 386

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 25/74 (33%), Positives = 46/74 (62%)
 Frame = -1

Query: 484 ASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQW 305
           AS   + +LPT K  +      L++E  +C +C+ ++ D  +++Q+PC HVFH +C+  W
Sbjct: 249 ASKSAIDALPTVKVTKDM----LKSEMNQCAVCMDEFEDGSDVKQMPCKHVFHQDCLLPW 304

Query: 304 LRIISCCPLCKKDL 263
           L + + CP+C+ +L
Sbjct: 305 LELHNSCPVCRFEL 318



>gb:AB018118_1513882 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MRI1.
          Length = 210

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 27/70 (38%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = -1

Query: 469 LSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWLRII 293
           + +LP   YK +     L ++  +C +CL ++  ++E+R LP CSH FH+ C+D WL   
Sbjct: 101 IDALPLLHYKTMIG---LRHDLSDCAVCLREFTAEDELRLLPKCSHAFHVECIDTWLLTN 157

Query: 292 SCCPLCKKDL 263
           S CPLC+ +L
Sbjct: 158 STCPLCRDNL 167



>gb:AE014297_1138575 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003681_1220568 Drosophila melanogaster
           chromosome 3R, section 19 of 118 of the complete
           sequence.>gb:AY052007_1290601 Drosophila melanogaster
           LD47007 full length cDNA.
          Length = 380

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 24/56 (42%), Positives = 36/56 (64%)
 Frame = -1

Query: 427 NPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA 260
           N +  N   +C IC   ++  E +R+LPCSH++H NC+  WL + S CP+C+K LA
Sbjct: 243 NAEEVNRKIQCSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHSTCPICRKSLA 298



>pir|T08729|T08729 RING zinc finger protein homolog DKFZp566H073.1 -
           human  (fragment)
          Length = 324

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 28/76 (36%), Positives = 44/76 (57%), Gaps = 1/76 (1%)
 Frame = -1

Query: 481 SNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL 302
           + EQL  +PT  Y++        ++   C ICL +Y D +++R LPC+H +H  CVD WL
Sbjct: 184 TKEQLKQIPTHDYQK--------DQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPWL 235

Query: 301 -RIISCCPLCKKDLAR 257
            +    CP+CK+ + R
Sbjct: 236 TQTRKTCPICKQPVHR 251



>pir|T51859|T51859 RING-H2 finger protein RHG1a [imported] -
           Arabidopsis thaliana (fragment)
          Length = 190

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 29/85 (34%), Positives = 45/85 (52%), Gaps = 1/85 (1%)
 Frame = -1

Query: 523 LGYNMNMGSVERGASNEQLSS-LPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQL 347
           L     +G V  G + E +S+ L   KYK    +P    +   CC+C  +Y + E+M  L
Sbjct: 96  LALEERIGDVCTGVNEETISNRLKQRKYKSNTKSPQ---DAEPCCVCQEEYTEGEDMGTL 152

Query: 346 PCSHVFHLNCVDQWLRIISCCPLCK 272
            C H FH  C+++WL+  + CP+CK
Sbjct: 153 ECGHEFHSQCIEEWLKQKNLCPICK 177



>gb:HSA271670_2001866 Homo sapiens Rnf12 gene for RING zinc finger
           LIM domani binding protein.
          Length = 624

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 27/89 (30%), Positives = 51/89 (57%)
 Frame = -1

Query: 535 VSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEM 356
           ++ F   N +     RG + EQ+ +L    + +   N  L+     C +C+ +Y +  ++
Sbjct: 531 LAQFFLLNEDDDDQPRGLTKEQIDNLAMRSFGE---NDALKT----CSVCITEYTEGNKL 583

Query: 355 RQLPCSHVFHLNCVDQWLRIISCCPLCKK 269
           R+LPCSH +H++C+D+WL   S CP+C++
Sbjct: 584 RKLPCSHEYHVHCIDRWLSENSTCPICRR 612



>gb:AL513007_1928657 Human DNA sequence from clone CTD-2530H13 on
           chromosome X Contains the RNF12 gene for ring finger
           protein 12, a cytoplasmic poly(A) binding protein
           (PABPC) pseudogene and a CpG island, complete
           sequence.>gb:BC013357_1974064 Homo sapiens ring finger
           protein 12, transcript variant 1, mRNA (cDNA clone
           MGC:15161 IMAGE:3834870), complete cds.
          Length = 624

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 27/89 (30%), Positives = 51/89 (57%)
 Frame = -1

Query: 535 VSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEM 356
           ++ F   N +     RG + EQ+ +L    + +   N  L+     C +C+ +Y +  ++
Sbjct: 531 LAQFFLLNEDDDDQPRGLTKEQIDNLAMRSFGE---NDALKT----CSVCITEYTEGNKL 583

Query: 355 RQLPCSHVFHLNCVDQWLRIISCCPLCKK 269
           R+LPCSH +H++C+D+WL   S CP+C++
Sbjct: 584 RKLPCSHEYHVHCIDRWLSENSTCPICRR 612



>gb:AK025329_1910269 Homo sapiens cDNA: FLJ21676 fis, clone
           COL09164.>gb:BC010139_1972512 Homo sapiens ring finger
           protein 167, mRNA (cDNA clone MGC:19468 IMAGE:4128232),
           complete cds.>gb:CR457340_1993547 Homo sapiens full open
           reading frame cDNA clone RZPDo834B0918D for gene
           DKFZP566H073, DKFZP566H073 protein; complete cds, incl.
           stopcodon.
          Length = 350

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 28/76 (36%), Positives = 44/76 (57%), Gaps = 1/76 (1%)
 Frame = -1

Query: 481 SNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL 302
           + EQL  +PT  Y++        ++   C ICL +Y D +++R LPC+H +H  CVD WL
Sbjct: 209 TKEQLKQIPTHDYQK-------GDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPWL 261

Query: 301 -RIISCCPLCKKDLAR 257
            +    CP+CK+ + R
Sbjct: 262 TQTRKTCPICKQPVHR 277



>gb:AF155109_1886621 Homo sapiens putative ring zinc finger protein
           NY-REN-43 antigen mRNA, complete cds.
          Length = 483

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 27/89 (30%), Positives = 51/89 (57%)
 Frame = -1

Query: 535 VSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEM 356
           ++ F   N +     RG + EQ+ +L    + +   N  L+     C +C+ +Y +  ++
Sbjct: 390 LAQFFLLNEDDDDQPRGLTKEQIDNLAMRSFGE---NDALKT----CSVCITEYTEGNKL 442

Query: 355 RQLPCSHVFHLNCVDQWLRIISCCPLCKK 269
           R+LPCSH +H++C+D+WL   S CP+C++
Sbjct: 443 RKLPCSHEYHVHCIDRWLSENSTCPICRR 471



>gb:AP002543_1822643 Arabidopsis thaliana genomic DNA, chromosome 5,
           BAC clone:F15M7.
          Length = 197

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 29/76 (38%), Positives = 44/76 (57%), Gaps = 4/76 (5%)
 Frame = -1

Query: 487 GASNEQLSSLPTWKYKQVCNNPDLENENPE---CCICLAQYRDKEEMRQLP-CSHVFHLN 320
           G + E +   P   Y++   +  L+ E+     C ICLA Y+  + +R LP C+H+FH N
Sbjct: 96  GLTEEVIKGFPKLPYEEARVSYSLQKESSTTSCCSICLADYKKMDMIRVLPDCNHLFHDN 155

Query: 319 CVDQWLRIISCCPLCK 272
           CVD WLR+   CP+C+
Sbjct: 156 CVDPWLRLHPTCPVCR 171



>gb:BT020620_1643014 Arabidopsis thaliana At5g05810 gene, complete
           cds.
          Length = 353

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 29/78 (37%), Positives = 41/78 (52%), Gaps = 1/78 (1%)
 Frame = -1

Query: 502 GSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFH 326
           G    G     + SLP +++  +  + D      EC +CLA++   E +R LP C H FH
Sbjct: 61  GRKNSGIDRSVIESLPVFRFGALSGHKD----GLECAVCLARFEPTEVLRLLPKCKHAFH 116

Query: 325 LNCVDQWLRIISCCPLCK 272
           + CVD WL   S CPLC+
Sbjct: 117 VECVDTWLDAHSTCPLCR 134



>gb:AB045120_1520332 Oryza sativa (japonica cultivar-group) EL5
           mRNA, complete cds.>gb:AP005883_1859609 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0435E12.>gb:AP005883_1859613 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0435E12.>gb:AP005883_1859617 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0435E12.>gb:AP005883_1859621 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0435E12.>gb:AP005883_1859624 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0435E12.>gb:AP005883_1859629 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0435E12.
          Length = 325

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 33/84 (39%), Positives = 41/84 (48%), Gaps = 7/84 (8%)
 Frame = -1

Query: 502 GSVERGASNEQLSSLPTWKYKQVC------NNPDLENENPECCICLAQYRDKEEMRQLP- 344
           G    G   E L SLP   Y +           + +++  EC +CLA+  D EE R LP 
Sbjct: 93  GGTGGGVDPEVLRSLPVTVYSRSTAAAAAKEEEEEDDDGVECAVCLAELEDGEEARFLPR 152

Query: 343 CSHVFHLNCVDQWLRIISCCPLCK 272
           C H FH  CVD WL   S CPLC+
Sbjct: 153 CGHGFHAECVDMWLGSHSTCPLCR 176



>gb:AB005237_1509417 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MJJ3.
          Length = 407

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 29/78 (37%), Positives = 41/78 (52%), Gaps = 1/78 (1%)
 Frame = -1

Query: 502 GSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFH 326
           G    G     + SLP +++  +  + D      EC +CLA++   E +R LP C H FH
Sbjct: 115 GRKNSGIDRSVIESLPVFRFGALSGHKD----GLECAVCLARFEPTEVLRLLPKCKHAFH 170

Query: 325 LNCVDQWLRIISCCPLCK 272
           + CVD WL   S CPLC+
Sbjct: 171 VECVDTWLDAHSTCPLCR 188



>gb:AX876522_1476570 Sequence 11427 from Patent
           EP1074617.>gb:AK001334_1908378 Homo sapiens cDNA
           FLJ10472 fis, clone NT2RP2000054.
          Length = 624

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 27/89 (30%), Positives = 51/89 (57%)
 Frame = -1

Query: 535 VSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEM 356
           ++ F   N +     RG + EQ+ +L    + +   N  L+     C +C+ +Y +  ++
Sbjct: 531 LAQFFLLNEDDDDQPRGLTKEQIDNLAMRSFGE---NDALKT----CSVCITEYTEGNKL 583

Query: 355 RQLPCSHVFHLNCVDQWLRIISCCPLCKK 269
           R+LPCSH +H++C+D+WL   S CP+C++
Sbjct: 584 RKLPCSHEYHVHCIDRWLSENSTCPICRR 612



>gb:AY203930_1176298 Homo sapiens LP2254 mRNA, complete cds.
          Length = 229

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 28/76 (36%), Positives = 44/76 (57%), Gaps = 1/76 (1%)
 Frame = -1

Query: 481 SNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL 302
           + EQL  +PT  Y++        ++   C ICL +Y D +++R LPC+H +H  CVD WL
Sbjct: 88  TKEQLKQIPTHDYQK-------GDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPWL 140

Query: 301 -RIISCCPLCKKDLAR 257
            +    CP+CK+ + R
Sbjct: 141 TQTRKTCPICKQPVHR 156



>gb:AE005173_892663 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC007915_1536353 Genomic sequence
           for Arabidopsis thaliana BAC F27F5 from chromosome I,
           complete sequence.
          Length = 645

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = -1

Query: 523 LGYNMNMGSVERGASNEQLSS-LPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQL 347
           L     +G V  G + E +S+ L   KYK    +     E   CC+C  +Y+++EE+ +L
Sbjct: 552 LSLEERIGDVCTGLNEETISNRLKQQKYKSSTRS---SQEVEPCCVCQEEYKEEEEIGRL 608

Query: 346 PCSHVFHLNCVDQWLRIISCCPLCK 272
            C H FH  C+ +WL+  + CP+CK
Sbjct: 609 ECGHDFHSQCIKEWLKQKNLCPICK 633



>sp|Q9NVW2|RN12_HUMAN RING finger protein 12 (LIM domain interacting
           RING finger protein) (RING finger LIM domain-binding
           protein) (R-LIM) (NY-REN-43 antigen).
          Length = 624

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 27/89 (30%), Positives = 51/89 (57%)
 Frame = -1

Query: 535 VSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEM 356
           ++ F   N +     RG + EQ+ +L    + +   N  L+     C +C+ +Y +  ++
Sbjct: 531 LAQFFLLNEDDDDQPRGLTKEQIDNLAMRSFGE---NDALKT----CSVCITEYTEGNKL 583

Query: 355 RQLPCSHVFHLNCVDQWLRIISCCPLCKK 269
           R+LPCSH +H++C+D+WL   S CP+C++
Sbjct: 584 RKLPCSHEYHVHCIDRWLSENSTCPICRR 612



>gb:BC070590_2555569 Xenopus laevis hypothetical protein MGC81168,
           mRNA (cDNA clone MGC:81168 IMAGE:6318089), complete cds.
          Length = 397

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 27/78 (34%), Positives = 44/78 (56%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVD 311
           R  + + +S L   + K+     D++ EN  C +C+  Y+ K+ +R LPC H+FH  C+D
Sbjct: 235 RKETKKAISQLQLHRVKKGEKGIDIDAEN--CAVCIENYKTKDLVRILPCKHIFHRLCID 292

Query: 310 QWLRIISCCPLCKKDLAR 257
            WL     CP+CK D+ +
Sbjct: 293 PWLIEHRTCPMCKLDVIK 310



>gb:BC069835_2106126 Mus musculus ring finger 111, mRNA (cDNA clone
            MGC:76599 IMAGE:30094289), complete cds.
          Length = 981

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 8/89 (8%)
 Frame = -1

Query: 505  MGSVERGASN---EQLSSLPTWKYKQVCNNPDLENENPE-----CCICLAQYRDKEEMRQ 350
            +G+V RGAS    E+ +    +K +++    D E    E     C ICL+   + E++R+
Sbjct: 885  LGNVNRGASQGTIERCTYPHKYKKRKLHCKQDGEEGTEEDTEEKCTICLSILEEGEDVRR 944

Query: 349  LPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
            LPC H+FH  CVDQWL     CP+C+ D+
Sbjct: 945  LPCMHLFHQVCVDQWLITNKKCPICRVDI 973



>gb:BC050268_2100404 Mus musculus ring finger protein 122, mRNA
           (cDNA clone IMAGE:3990350), partial cds.
          Length = 151

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 33/110 (30%), Positives = 50/110 (45%), Gaps = 3/110 (2%)
 Frame = -1

Query: 580 FPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPD---LEN 410
           F F+L ++ CC       F+    N    ER            + YK+V    D   L+ 
Sbjct: 43  FVFMLSLIFCCY------FISKLRNQAQSER------------YGYKEVVLKGDAKKLQL 84

Query: 409 ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA 260
               C +CL  ++ K+E+  LPC H FH  C+ +WL +   CP+C K +A
Sbjct: 85  YGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIA 134



>gb:BC012960_2091675 Mus musculus ring finger protein 12, mRNA (cDNA
           clone MGC:13712 IMAGE:4193003), complete cds.
          Length = 600

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 25/74 (33%), Positives = 46/74 (62%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVD 311
           RG + EQ+ +L    + +   N  L+     C +C+ +Y +  ++R+LPCSH +H++C+D
Sbjct: 522 RGLTKEQIDNLAMRSFGE---NDALKT----CSVCITEYTEGNKLRKLPCSHEYHVHCID 574

Query: 310 QWLRIISCCPLCKK 269
           +WL   S CP+C++
Sbjct: 575 RWLSENSTCPICRR 588



>gb:BC060862_1985760 Homo sapiens ring finger protein 111, mRNA (cDNA
            clone MGC:71797 IMAGE:30336202), complete cds.
          Length = 985

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 8/89 (8%)
 Frame = -1

Query: 505  MGSVERGASN---EQLSSLPTWKYKQVCNNPDLENENPE-----CCICLAQYRDKEEMRQ 350
            +G+V RGAS    E+ +    +K +++    D E    E     C ICL+   + E++R+
Sbjct: 889  LGNVNRGASQGTIERCTYPHKYKKRKLHCKQDGEEGTEEDTEEKCTICLSILEEGEDVRR 948

Query: 349  LPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
            LPC H+FH  CVDQWL     CP+C+ D+
Sbjct: 949  LPCMHLFHQVCVDQWLITNKKCPICRVDI 977



>gb:AP005511_1853145 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0011N12.
          Length = 166

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 29/77 (37%), Positives = 45/77 (58%), Gaps = 1/77 (1%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCV 314
           RG +   L+++P + Y++            +C ICL   RD E +R+LP C H+FH+ CV
Sbjct: 81  RGLAPSALAAIPKFAYRRGAAGGG--GGWAQCAICLGVVRDGEAVRRLPECKHLFHVECV 138

Query: 313 DQWLRIISCCPLCKKDL 263
           D WL   + CPLC++D+
Sbjct: 139 DMWLYSHATCPLCRRDV 155



>gb:AP004777_1844928 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0458B05.>gb:AP004879_1846490 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0475F05.
          Length = 258

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 33/85 (38%), Positives = 47/85 (55%), Gaps = 6/85 (7%)
 Frame = -1

Query: 499 SVERGASNEQ---LSSLPTWKYKQVCNNPDLEN--ENPECCICLAQYRDKEEMRQLP-CS 338
           SVERG    +   ++S PT K+    + P      E  +C +CL +Y  K+ +R LP C 
Sbjct: 68  SVERGIRGLEPAVVTSFPTAKFGDGGSRPRAAAALEESQCPVCLEEYEAKDVVRVLPSCG 127

Query: 337 HVFHLNCVDQWLRIISCCPLCKKDL 263
           H FH+ C+D WLR  S CP+C+  L
Sbjct: 128 HAFHVACIDAWLRQHSTCPVCRASL 152



>gb:AP004564_1841652 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0479C12.>gb:AP004764_1844656 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0708B04.
          Length = 501

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 28/79 (35%), Positives = 45/79 (56%), Gaps = 2/79 (2%)
 Frame = -1

Query: 493 ERGASNEQLSSLPTWKYKQVCNNPDLENENP-ECCICLAQYRDKEEMRQLP-CSHVFHLN 320
           + G     + +LP + Y  V        ++P +C +CL ++ D + +R LP CSH FH++
Sbjct: 123 DAGVDQSFIDTLPVFLYGAVVG---AGRKDPFDCAVCLCEFADDDRLRLLPKCSHAFHVD 179

Query: 319 CVDQWLRIISCCPLCKKDL 263
           C+D WL   S CPLC++ L
Sbjct: 180 CIDTWLLSHSTCPLCRRSL 198



>gb:AJ586517_1811833 Fagus sylvatica partial zf1 mRNA for zinc
           finger protein.
          Length = 123

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 25/57 (43%), Positives = 35/57 (61%), Gaps = 1/57 (1%)
 Frame = -1

Query: 430 NNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWLRIISCCPLCKKDL 263
           NN D   +   C +CL  ++  E +R LP C H+FHL C+D+WL     CPLC++DL
Sbjct: 67  NNVDASGDRVSCSVCLQDFQLGETVRSLPHCHHIFHLPCIDKWLLRHGSCPLCRRDL 123



>gb:AC136217_1743023 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0030I14, complete
           sequence.>gb:AC144455_1744106 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBb0086G17,
           complete sequence.
          Length = 385

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 33/108 (30%), Positives = 57/108 (52%), Gaps = 3/108 (2%)
 Frame = -1

Query: 586 YSFPFILFVVLCCCVPM--VSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLE 413
           +S  F+L +    C P   V++     +   + + G +   + SLP +++  +       
Sbjct: 63  FSLTFLLLMYAKFCHPSSPVAAPAPTVVPAAAADDGVAKPVIESLPFFRFAALRG----A 118

Query: 412 NENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWLRIISCCPLCK 272
            +  EC +CLA++ D + +R LP C H FHL+CVD+WL   + CPLC+
Sbjct: 119 RQGLECAVCLARFDDADLLRLLPRCRHAFHLDCVDRWLESKASCPLCR 166



>gb:AC124144_1740447 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0099P06, complete sequence.
          Length = 533

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 27/86 (31%), Positives = 49/86 (56%), Gaps = 2/86 (2%)
 Frame = -1

Query: 523 LGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENE--NPECCICLAQYRDKEEMRQ 350
           L     +G V  G ++E++S          C++  L+++  N  C ICL +Y+ ++ + +
Sbjct: 442 LALEERIGHVNTGLADEKISGCVM--EVACCSSSHLQDDQDNERCVICLEEYKHEDTLGR 499

Query: 349 LPCSHVFHLNCVDQWLRIISCCPLCK 272
           L C H FH NC+ +WL++ + CP+CK
Sbjct: 500 LKCGHGFHCNCIKKWLQVKNTCPVCK 525



>gb:BT005844_1638766 Arabidopsis thaliana At4g24010 gene, complete
           cds.
          Length = 174

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 39/147 (26%), Positives = 67/147 (45%), Gaps = 21/147 (14%)
 Frame = -1

Query: 637 PKLHVLCISLLAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGS---------VERG 485
           P L+   I L  + A  +S P +  ++L      +  +L Y     S         +   
Sbjct: 10  PHLYPQAIQLKLYQAFIFSIPILFSIIL-----FLLFYLFYLKRRASSLSSPSPMILPVS 64

Query: 484 ASNEQLSSLPTW-----------KYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-C 341
           +S++  S LP+            K   V  N +L   +  CC+CL ++  KEE+ ++P C
Sbjct: 65  SSHQTSSHLPSVCLLDVKVELKDKLHVVLFNEELGTRDSLCCVCLGEFELKEELVEMPLC 124

Query: 340 SHVFHLNCVDQWLRIISCCPLCKKDLA 260
            H+FHL+C+  WL   + CPLC+  ++
Sbjct: 125 KHIFHLDCIHLWLYSHNTCPLCRSSVS 151



>gb:AB011474_1511360 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K2A18.>gb:AY035089_1559861 Arabidopsis
           thaliana putative ReMembR-H2 protein JR700 (At5g66160)
           mRNA, complete cds.>gb:AY051036_1562512 Arabidopsis
           thaliana putative ReMembR-H2 protein JR700 (At5g66160)
           mRNA, complete cds.>gb:AF218807_1778208 Arabidopsis
           thaliana ReMembR-H2 protein JR700 mRNA, complete cds.
          Length = 310

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 25/46 (54%), Positives = 31/46 (67%), Gaps = 1/46 (2%)
 Frame = -1

Query: 397 CCICLAQYRDKEEMRQLPCSHVFHLNCVDQWL-RIISCCPLCKKDL 263
           C ICL  YR  E +R LPC H FHLNC+D WL +  + CP+CK D+
Sbjct: 232 CAICLEDYRFGESLRLLPCQHAFHLNCIDSWLTKWGTSCPVCKHDI 277



>gb:AX405832_1467760 Sequence 247 from Patent WO0222660.
          Length = 371

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 8/89 (8%)
 Frame = -1

Query: 505 MGSVERGASN---EQLSSLPTWKYKQVCNNPDLENENPE-----CCICLAQYRDKEEMRQ 350
           +G+V RGAS    E+ +    +K +++    D E    E     C ICL+   + E++R+
Sbjct: 275 LGNVNRGASQGTIERCTYPHKYKKRKLHCKQDGEEGTEEDTEEKCTICLSILEEGEDVRR 334

Query: 349 LPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
           LPC H+FH  CVDQWL     CP+C+ D+
Sbjct: 335 LPCMHLFHQVCVDQWLITNKKCPICRVDI 363



>gb:HSM802460_1186708 Homo sapiens mRNA; cDNA DKFZp761D081 (from
           clone DKFZp761D081).
          Length = 178

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 8/89 (8%)
 Frame = -1

Query: 505 MGSVERGASN---EQLSSLPTWKYKQVCNNPDLENENPE-----CCICLAQYRDKEEMRQ 350
           +G+V RGAS    E+ +    +K +++    D E    E     C ICL+   + E++R+
Sbjct: 82  LGNVNRGASQGTIERCTYPHKYKKRKLHCKQDGEEGTEEDTEEKCTICLSILEEGEDVRR 141

Query: 349 LPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
           LPC H+FH  CVDQWL     CP+C+ D+
Sbjct: 142 LPCMHLFHQVCVDQWLITNKKCPICRVDI 170



>gb:CR861381_1185379 Pongo pygmaeus mRNA; cDNA DKFZp459A112 (from
            clone DKFZp459A112).
          Length = 986

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 8/89 (8%)
 Frame = -1

Query: 505  MGSVERGASN---EQLSSLPTWKYKQVCNNPDLENENPE-----CCICLAQYRDKEEMRQ 350
            +G+V RGAS    E+ +    +K +++    D E    E     C ICL+   + E++R+
Sbjct: 890  LGNVNRGASQGTIERCTYPHKYKKRKLHCKQDGEEGTEEDTEEKCTICLSILEEGEDVRR 949

Query: 349  LPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
            LPC H+FH  CVDQWL     CP+C+ D+
Sbjct: 950  LPCMHLFHQVCVDQWLITNKKCPICRVDI 978



>gb:AK077856_1172086 Mus musculus 13 days embryo forelimb cDNA,
           RIKEN full-length enriched library, clone:5930422F08
           product:unknown EST, full insert sequence.
          Length = 155

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 33/110 (30%), Positives = 50/110 (45%), Gaps = 3/110 (2%)
 Frame = -1

Query: 580 FPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPD---LEN 410
           F F+L ++ CC       F+    N    ER            + YK+V    D   L+ 
Sbjct: 47  FVFMLSLIFCCY------FISKLRNQAQSER------------YGYKEVVLKGDAKKLQL 88

Query: 409 ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA 260
               C +CL  ++ K+E+  LPC H FH  C+ +WL +   CP+C K +A
Sbjct: 89  YGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIA 138



>gb:AK048110_1168293 Mus musculus 16 days embryo head cDNA, RIKEN
            full-length enriched library, clone:C130035E22
            product:arkadia, full insert sequence.
          Length = 981

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 8/89 (8%)
 Frame = -1

Query: 505  MGSVERGASN---EQLSSLPTWKYKQVCNNPDLENENPE-----CCICLAQYRDKEEMRQ 350
            +G+V RGAS    E+ +    +K +++    D E    E     C ICL+   + E++R+
Sbjct: 885  LGNVNRGASQGTIERCTYPHKYKKRKLHCKQDGEEGTEEDTEEKCTICLSILEEGEDVRR 944

Query: 349  LPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
            LPC H+FH  CVDQWL     CP+C+ D+
Sbjct: 945  LPCMHLFHQVCVDQWLITNKKCPICRVDI 973



>gb:AK036351_1164439 Mus musculus 16 days neonate cerebellum cDNA,
            RIKEN full-length enriched library, clone:9630060A01
            product:arkadia, full insert sequence.
          Length = 981

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 8/89 (8%)
 Frame = -1

Query: 505  MGSVERGASN---EQLSSLPTWKYKQVCNNPDLENENPE-----CCICLAQYRDKEEMRQ 350
            +G+V RGAS    E+ +    +K +++    D E    E     C ICL+   + E++R+
Sbjct: 885  LGNVNRGASQGTIERCTYPHKYKKRKLHCKQDGEEGTEEDTEEKCTICLSILEEGEDVRR 944

Query: 349  LPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
            LPC H+FH  CVDQWL     CP+C+ D+
Sbjct: 945  LPCMHLFHQVCVDQWLITNKKCPICRVDI 973



>gb:AK029295_1161422 Mus musculus 0 day neonate head cDNA, RIKEN
           full-length enriched library, clone:4832416C16
           product:Hoxa1 regulated gene, full insert sequence.
          Length = 600

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 25/74 (33%), Positives = 46/74 (62%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVD 311
           RG + EQ+ +L    + +   N  L+     C +C+ +Y +  ++R+LPCSH +H++C+D
Sbjct: 522 RGLTKEQIDNLAMRSFGE---NDALKT----CSVCITEYTEGNKLRKLPCSHEYHVHCID 574

Query: 310 QWLRIISCCPLCKK 269
           +WL   S CP+C++
Sbjct: 575 RWLSENSTCPICRR 588



>gb:AK013207_1157388 Mus musculus 10, 11 days embryo whole body
           cDNA, RIKEN full-length enriched library,
           clone:2810430O10 product:Hoxa1 regulated gene, full
           insert sequence.
          Length = 600

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 25/74 (33%), Positives = 46/74 (62%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVD 311
           RG + EQ+ +L    + +   N  L+     C +C+ +Y +  ++R+LPCSH +H++C+D
Sbjct: 522 RGLTKEQIDNLAMRSFGE---NDALKT----CSVCITEYTEGNKLRKLPCSHEYHVHCID 574

Query: 310 QWLRIISCCPLCKK 269
           +WL   S CP+C++
Sbjct: 575 RWLSENSTCPICRR 588



>pir|T46904|T46904 hypothetical protein DKFZp761D081.1 -
           human>gb:BC010369_1972594 Homo sapiens ring finger
           protein 111, mRNA (cDNA clone IMAGE:4049734), complete
           cds.
          Length = 137

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 8/89 (8%)
 Frame = -1

Query: 505 MGSVERGASN---EQLSSLPTWKYKQVCNNPDLENENPE-----CCICLAQYRDKEEMRQ 350
           +G+V RGAS    E+ +    +K +++    D E    E     C ICL+   + E++R+
Sbjct: 41  LGNVNRGASQGTIERCTYPHKYKKRKLHCKQDGEEGTEEDTEEKCTICLSILEEGEDVRR 100

Query: 349 LPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
           LPC H+FH  CVDQWL     CP+C+ D+
Sbjct: 101 LPCMHLFHQVCVDQWLITNKKCPICRVDI 129



>pir|T51844|T51844 RING-H2 finger protein RHA3a [imported] -
           Arabidopsis thaliana>gb:AC007584_1535964 Arabidopsis
           thaliana chromosome 2 clone MJB20 map mi398, complete
           sequence.>gb:AY062961_1565551 Arabidopsis thaliana
           putative RING zinc finger protein (At2g17450) mRNA,
           complete cds.>gb:AF078824_1766279 Arabidopsis thaliana
           RING-H2 finger protein RHA3a mRNA, complete
           cds.>gb:AF370239_1792124 Arabidopsis thaliana putative
           RING zinc finger protein (At2g17450) mRNA, complete cds.
          Length = 185

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 31/83 (37%), Positives = 44/83 (53%), Gaps = 4/83 (4%)
 Frame = -1

Query: 499 SVERGASNEQLSSLPTWKYKQVCNNPDL---ENENPECCICLAQYRDKEEMRQLP-CSHV 332
           S  +G   + L SLP   +    +       E ++ EC ICL  + D EE+R LP C H 
Sbjct: 65  SPNKGLKKKALQSLPRSTFTAAESTSGAAAEEGDSTECAICLTDFADGEEIRVLPLCGHS 124

Query: 331 FHLNCVDQWLRIISCCPLCKKDL 263
           FH+ C+D+WL   S CP C++ L
Sbjct: 125 FHVECIDKWLVSRSSCPSCRRIL 147



>pir|A84853|A84853 probable RING zinc finger protein [imported] -
           Arabidopsis thaliana>gb:AC005956_1533234 Arabidopsis
           thaliana chromosome 2 clone MHK10 map EG05C12, complete
           sequence.>gb:AY074652_1567654 Arabidopsis thaliana
           At2g42360/MHK10.8 mRNA, complete cds.
          Length = 236

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 27/78 (34%), Positives = 48/78 (61%), Gaps = 1/78 (1%)
 Frame = -1

Query: 493 ERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNC 317
           +RG +   ++SLPT+    V     +     EC +CL+  +++++ R+LP C H+FH++C
Sbjct: 79  KRGLNPTVIASLPTFT---VGATDGVAASATECAVCLSVLKEQDKARELPNCKHIFHVDC 135

Query: 316 VDQWLRIISCCPLCKKDL 263
           VD WL   S CP+C+ ++
Sbjct: 136 VDTWLTTCSTCPVCRTEV 153



>pir|G96528|G96528 protein F27J15.2 [imported] - Arabidopsis
           thaliana>gb:AE005173_892861 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC016041_1538065 Genomic sequence for
           Arabidopsis thaliana BAC F27J15 from chromosome I,
           complete sequence.
          Length = 426

 Score = 61.6 bits (148), Expect = 4e-08
 Identities = 34/95 (35%), Positives = 48/95 (50%), Gaps = 1/95 (1%)
 Frame = -1

Query: 544 VPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDK 365
           VP +SS        GS  +G   + L   P   Y    N P L+ E   C ICL+ +   
Sbjct: 95  VPSLSS------TRGSSNKGIKKKALRMFPVVSYSPEMNLPGLDEE---CVICLSDFVSG 145

Query: 364 EEMRQLP-CSHVFHLNCVDQWLRIISCCPLCKKDL 263
           E++R LP C+H FH+ C+D+WL+    CP C+  L
Sbjct: 146 EQLRLLPKCNHGFHVRCIDKWLQQHLTCPKCRNCL 180



 Score = 48.5 bits (114), Expect = 4e-04
 Identities = 30/96 (31%), Positives = 45/96 (46%), Gaps = 1/96 (1%)
 Frame = -1

Query: 571 ILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECC 392
           I+   L C   + S   G N  +     G   + L S  T  Y    N P L+ E   C 
Sbjct: 295 IIRCALRCSNLVPSEAGGDNYPVRLTNTGVKRKALKSFQTVSYSTELNLPGLDTE---CA 351

Query: 391 ICLAQYRDKEEMRQLP-CSHVFHLNCVDQWLRIISC 287
           ICL+++  +E ++ LP C H FH+ C+D+   I +C
Sbjct: 352 ICLSEFVAEERVKLLPTCHHGFHVRCIDKHCLIQTC 387



>gb:BC081009_2561919 Xenopus laevis MGC81562 protein, mRNA (cDNA clone
            MGC:81562 IMAGE:6863030), complete cds.
          Length = 967

 Score = 61.2 bits (147), Expect = 6e-08
 Identities = 34/98 (34%), Positives = 51/98 (52%), Gaps = 17/98 (17%)
 Frame = -1

Query: 505  MGSVERGASNEQLSSLP-TWKYKQVCNN----------------PDLENENPECCICLAQ 377
            +G+V RGAS   +       KYK+V  +                P+ + E  +C ICL+ 
Sbjct: 863  LGNVNRGASQGTIERCTYPHKYKKVSTDWFSQRKLHSKQDGEEAPEEDTEE-KCTICLSI 921

Query: 376  YRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
              + E++R+LPC H+FH  CVDQWL     CP+C+ D+
Sbjct: 922  LEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDI 959



>gb:AF329847_2487920 Xenopus laevis ring finger-H2 protein (arkadia)
            mRNA, partial cds.
          Length = 923

 Score = 61.2 bits (147), Expect = 6e-08
 Identities = 34/98 (34%), Positives = 51/98 (52%), Gaps = 17/98 (17%)
 Frame = -1

Query: 505  MGSVERGASNEQLSSLP-TWKYKQVCNN----------------PDLENENPECCICLAQ 377
            +G+V RGAS   +       KYK+V  +                P+ + E  +C ICL+ 
Sbjct: 819  LGNVNRGASQGTIERCTYPHKYKKVSTDWFSQRKLHSKQDGEEAPEEDTEE-KCTICLSI 877

Query: 376  YRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
              + E++R+LPC H+FH  CVDQWL     CP+C+ D+
Sbjct: 878  LEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDI 915



>gb:AF171875_2057708 Mus musculus g1-related zinc finger protein
           (G1rp) mRNA, complete cds.
          Length = 419

 Score = 61.2 bits (147), Expect = 6e-08
 Identities = 26/76 (34%), Positives = 43/76 (56%)
 Frame = -1

Query: 484 ASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQW 305
           A+ + +S L T   K+   + + + +   C +C+  Y+  + +R LPC HVFH +CVD W
Sbjct: 237 AAKKAISKLTTRTVKK--GDKETDPDFDHCAVCIESYKQNDVVRVLPCKHVFHKSCVDPW 294

Query: 304 LRIISCCPLCKKDLAR 257
           L     CP+CK ++ R
Sbjct: 295 LSEHCTCPMCKLNILR 310



>gb:HSM806331_2018289 Homo sapiens mRNA; cDNA DKFZp686H1966 (from
            clone DKFZp686H1966); complete cds.
          Length = 986

 Score = 61.2 bits (147), Expect = 6e-08
 Identities = 33/89 (37%), Positives = 47/89 (52%), Gaps = 8/89 (8%)
 Frame = -1

Query: 505  MGSVERGASNEQLSSLP-TWKYK-------QVCNNPDLENENPECCICLAQYRDKEEMRQ 350
            +G+V RGAS   +       KYK       Q       E+   +C ICL+   + E++R+
Sbjct: 890  LGNVNRGASQGTIERCTYPHKYKKRKLHCKQDGGEGTEEDTEEKCTICLSILEEGEDVRR 949

Query: 349  LPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
            LPC H+FH  CVDQWL     CP+C+ D+
Sbjct: 950  LPCMHLFHQVCVDQWLITNKKCPICRVDI 978



>gb:AP005522_1853405 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0479H10.
          Length = 436

 Score = 61.2 bits (147), Expect = 6e-08
 Identities = 26/77 (33%), Positives = 44/77 (57%), Gaps = 3/77 (3%)
 Frame = -1

Query: 493 ERGASNEQLSSLPTWKYKQVC--NNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHL 323
           + G     + +LP + Y+++      D + E  +C +CL ++  ++ +R LP C H FHL
Sbjct: 156 DSGLDQAFIDALPVFAYREIVVGGGGDGDKEPFDCAVCLCEFDAEDRLRLLPLCGHAFHL 215

Query: 322 NCVDQWLRIISCCPLCK 272
           +C+D WL   S CPLC+
Sbjct: 216 HCIDTWLLSNSTCPLCR 232



>gb:OSJN00062_1694166 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0108J11, complete sequence.
          Length = 431

 Score = 61.2 bits (147), Expect = 6e-08
 Identities = 29/78 (37%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = -1

Query: 493 ERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNC 317
           + G   + L S+P   Y        L   +P C ICL+ + D E +R LP C+H FH+ C
Sbjct: 208 QSGLRRKALRSMPILLYS---TGLKLNTVSPMCAICLSDFEDGEHVRVLPKCNHGFHVRC 264

Query: 316 VDQWLRIISCCPLCKKDL 263
           +D+WL   S CP C++ L
Sbjct: 265 IDRWLLARSTCPTCRQSL 282



>gb:BT002300_1635903 Arabidopsis thaliana At4g31450/F3L17_20 mRNA,
           complete cds.>gb:AF424605_1798944 Arabidopsis thaliana
           AT4g31450/F3L17_20 mRNA, complete cds.
          Length = 497

 Score = 61.2 bits (147), Expect = 6e-08
 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 8/92 (8%)
 Frame = -1

Query: 523 LGYNMNMGSVERGASNEQLSS--------LPTWKYKQVCNNPDLENENPECCICLAQYRD 368
           L     +G+V    + E +S         +    Y  +  +P    E+ +C IC  +Y  
Sbjct: 398 LALEERIGTVSTALTEEAISKCLKTSIYQMKPLSYGSITKSPSDNKEDAKCSICQEEYTI 457

Query: 367 KEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK 272
            +E+ +L C H +H+ CV +WLRI S CP+CK
Sbjct: 458 GDEVGRLHCEHTYHVKCVQEWLRIKSWCPICK 489



>gb:AY647238_1619867 Zea mays unknown mRNA.
          Length = 68

 Score = 61.2 bits (147), Expect = 6e-08
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 1/52 (1%)
 Frame = -1

Query: 409 ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLR-IISCCPLCKKDLAR 257
           E  +C ICL +Y + + +R LPC H FHL CVD+WL+ I   CPLC+ D+ R
Sbjct: 8   EAAQCYICLVEYEEGDCLRILPCHHEFHLTCVDKWLKEIHRVCPLCRGDVCR 59



>gb:AB008264_1510380 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MBD2.>gb:BT004548_1637582 Arabidopsis thaliana
           At5g42940/MBD2_14 gene, complete
           cds.>gb:AF462851_1801961 Arabidopsis thaliana
           AT5g42940/MBD2_14 mRNA, complete cds.
          Length = 691

 Score = 61.2 bits (147), Expect = 6e-08
 Identities = 29/85 (34%), Positives = 44/85 (51%), Gaps = 1/85 (1%)
 Frame = -1

Query: 523 LGYNMNMGSVERGASNEQLSS-LPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQL 347
           L     +G V  G + E +S+ L   KYK    +P    +   CC+C  +Y + E+M  L
Sbjct: 597 LALEERIGDVCTGVNEETISNRLKQRKYKSNTKSPQ---DAEPCCVCQEEYTEGEDMGTL 653

Query: 346 PCSHVFHLNCVDQWLRIISCCPLCK 272
            C H FH  C+ +WL+  + CP+CK
Sbjct: 654 ECGHEFHSQCIKEWLKQKNLCPICK 678



>pir|T10675|T10675 hypothetical protein F3L17.20 - Arabidopsis
           thaliana>gb:ATCHRIV75_1547066 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 75.>gb:ATF3L17_1550601
           Arabidopsis thaliana DNA chromosome 4, BAC clone F3L17
           (ESSA project).
          Length = 488

 Score = 61.2 bits (147), Expect = 6e-08
 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 8/92 (8%)
 Frame = -1

Query: 523 LGYNMNMGSVERGASNEQLSS--------LPTWKYKQVCNNPDLENENPECCICLAQYRD 368
           L     +G+V    + E +S         +    Y  +  +P    E+ +C IC  +Y  
Sbjct: 389 LALEERIGTVSTALTEEAISKCLKTSIYQMKPLSYGSITKSPSDNKEDAKCSICQEEYTI 448

Query: 367 KEEMRQLPCSHVFHLNCVDQWLRIISCCPLCK 272
            +E+ +L C H +H+ CV +WLRI S CP+CK
Sbjct: 449 GDEVGRLHCEHTYHVKCVQEWLRIKSWCPICK 480



>pir|T48058|T48058 RING-H2 zinc finger protein ATL5 - Arabidopsis
           thaliana>gb:ATF26K9_1550116 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F26K9.>gb:BT009649_1640110
           Arabidopsis thaliana At3g62690 mRNA, complete cds.
          Length = 257

 Score = 61.2 bits (147), Expect = 6e-08
 Identities = 27/67 (40%), Positives = 40/67 (59%), Gaps = 1/67 (1%)
 Frame = -1

Query: 469 LSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWLRII 293
           L  +P + Y    +   LE    EC +CL+++ + +E R LP C HVFH++C+D W R  
Sbjct: 93  LEKIPIFVYSVKTHESPLE----ECSVCLSEFEEDDEGRVLPKCGHVFHVDCIDTWFRSR 148

Query: 292 SCCPLCK 272
           S CPLC+
Sbjct: 149 SSCPLCR 155



>gb:BC070603_2555582 Xenopus laevis cDNA clone MGC:81253
            IMAGE:6631223, complete cds.
          Length = 959

 Score = 60.8 bits (146), Expect = 8e-08
 Identities = 33/97 (34%), Positives = 49/97 (50%), Gaps = 16/97 (16%)
 Frame = -1

Query: 505  MGSVERGASNEQLSSLP-TWKYKQVCNN---------------PDLENENPECCICLAQY 374
            +G+V RGAS   +       KYK+V  +                  E+   +C ICL+  
Sbjct: 855  LGNVNRGASQGTIERCTYPHKYKKVSTDWFSQRKLHSKQDGEEATEEDTEEKCTICLSIL 914

Query: 373  RDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
             + E++R+LPC H+FH  CVDQWL     CP+C+ D+
Sbjct: 915  EEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDI 951



>gb:AP004800_1845299 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0585G03.>gb:AP005297_1850076 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ1734_E02.
          Length = 396

 Score = 60.8 bits (146), Expect = 8e-08
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 1/78 (1%)
 Frame = -1

Query: 493 ERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNC 317
           + G     + +LP + Y+ +      + E  +C +CL ++  ++ +R LP C H FHL+C
Sbjct: 123 DSGLDQAFIDALPVFAYRDIVGG---DKEPFDCAVCLCEFDGEDRLRLLPVCGHAFHLHC 179

Query: 316 VDQWLRIISCCPLCKKDL 263
           +D WL   S CPLC+  L
Sbjct: 180 IDTWLLSNSTCPLCRGTL 197



>gb:AP004118_1837832 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1148_D05.>gb:AP004786_1845049 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0017H11.
          Length = 389

 Score = 60.8 bits (146), Expect = 8e-08
 Identities = 23/51 (45%), Positives = 37/51 (72%), Gaps = 1/51 (1%)
 Frame = -1

Query: 409 ENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWLRIISCCPLCKKDLA 260
           ++ +C +CL ++R+ E +R LP CSH FH+ C+D WL+  S CPLC+ ++A
Sbjct: 160 DSTDCSVCLGEFREGESLRLLPKCSHAFHVPCIDTWLKSHSNCPLCRCNIA 210



>gb:AP003104_1824714 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBa0038J17.
          Length = 237

 Score = 60.8 bits (146), Expect = 8e-08
 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 10/88 (11%)
 Frame = -1

Query: 499 SVERGASNEQLSSLPTWKYK---------QVCNNPDLENENPECCICLAQYRDKEEMRQL 347
           S  RG     L++LP   Y+         +  N         +C +CL++  D E++R+L
Sbjct: 86  SGRRGLDASALAALPVTAYRKNGGGGGGGEGSNRGGPGATAADCAVCLSELADGEKVREL 145

Query: 346 P-CSHVFHLNCVDQWLRIISCCPLCKKD 266
           P C HVFH+ CVD WLR  + CPLC+ +
Sbjct: 146 PNCRHVFHVECVDAWLRSRTTCPLCRAE 173



>gb:AF132015_1770848 Arabidopsis thaliana RING-H2 zinc finger
           protein ATL5 (ATL5) mRNA, complete cds.
          Length = 257

 Score = 60.8 bits (146), Expect = 8e-08
 Identities = 27/67 (40%), Positives = 40/67 (59%), Gaps = 1/67 (1%)
 Frame = -1

Query: 469 LSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWLRII 293
           L  +P + Y    +   LE    EC +CL+++ + +E R LP C HVFH++C+D W R  
Sbjct: 93  LEKIPIFVYSVKTHESPLE----ECSVCLSEFEEDDEGRVLPKCCHVFHVDCIDTWFRSR 148

Query: 292 SCCPLCK 272
           S CPLC+
Sbjct: 149 SSCPLCR 155



>gb:AC124142_1740408 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0015A05, complete sequence.
          Length = 386

 Score = 60.8 bits (146), Expect = 8e-08
 Identities = 28/76 (36%), Positives = 42/76 (55%)
 Frame = -1

Query: 499 SVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLN 320
           + +R A    +  LP ++ K V        +  EC ICL ++    E+R LPC+H FH+ 
Sbjct: 206 AAQREAVEALIQELPKFRLKAV------PTDCSECPICLEEFHVGNEVRGLPCAHNFHVE 259

Query: 319 CVDQWLRIISCCPLCK 272
           C+DQWLR+   CP C+
Sbjct: 260 CIDQWLRLNVKCPRCR 275



>gb:AC105734_1738079 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBb0050N02, complete sequence.
          Length = 290

 Score = 60.8 bits (146), Expect = 8e-08
 Identities = 28/86 (32%), Positives = 47/86 (54%), Gaps = 1/86 (1%)
 Frame = -1

Query: 526 FLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQL 347
           F  Y   +G    G   + +++LP  KY++  +      +  EC +CL+++   E ++ L
Sbjct: 74  FTDYEAEVGG---GLDPDVVAALPVVKYRRAASGKSASPQ--ECAVCLSEFVRDERLKLL 128

Query: 346 P-CSHVFHLNCVDQWLRIISCCPLCK 272
           P CSH FH++C+D WL     CPLC+
Sbjct: 129 PSCSHAFHIDCIDTWLHHNVSCPLCR 154



>gb:BT010489_1640435 Arabidopsis thaliana At1g49230 gene, complete
           cds.>gb:AK176235_1818223 Arabidopsis thaliana mRNA for
           putative RING zinc finger protein, complete cds, clone:
           RAFL23-12-E01.>gb:AK176512_1818500 Arabidopsis thaliana
           mRNA for putative RING zinc finger protein, complete
           cds, clone: RAFL25-03-A22.
          Length = 219

 Score = 60.8 bits (146), Expect = 8e-08
 Identities = 34/101 (33%), Positives = 49/101 (48%), Gaps = 1/101 (0%)
 Frame = -1

Query: 571 ILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECC 392
           I+   L C   + S   G N  +     G   + L S  T  Y    N P L+ E   C 
Sbjct: 76  IIRCALRCSNLVPSEAGGDNYPVRLTNTGVKRKALKSFQTVSYSTELNLPGLDTE---CA 132

Query: 391 ICLAQYRDKEEMRQLP-CSHVFHLNCVDQWLRIISCCPLCK 272
           ICL+++  +E ++ LP C H FH+ C+D+WL   S CP C+
Sbjct: 133 ICLSEFVAEERVKLLPTCHHGFHVRCIDKWLSSHSSCPTCR 173



>gb:AY090933_1574210 Arabidopsis thaliana putative RING zinc finger
           protein (At2g35910) mRNA, complete
           cds.>gb:AY122973_1579851 Arabidopsis thaliana putative
           RING zinc finger protein (At2g35910) mRNA, complete cds.
          Length = 217

 Score = 60.8 bits (146), Expect = 8e-08
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 1/43 (2%)
 Frame = -1

Query: 397 CCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWLRIISCCPLCK 272
           C ICL  Y+ K  +RQLP C+H+FHL C+D WLR+   CP+C+
Sbjct: 147 CAICLGDYKGKHLLRQLPDCNHLFHLKCIDTWLRLNPTCPVCR 189



>gb:ATAC011708_1543384 Arabidopsis thaliana chromosome III BAC T7M13
           genomic sequence, complete sequence.>gb:BT004771_1637805
           Arabidopsis thaliana At3g10910 gene, complete cds.
          Length = 181

 Score = 60.8 bits (146), Expect = 8e-08
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 3/94 (3%)
 Frame = -1

Query: 535 VSSFLGYNMNMG--SVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKE 362
           VS+    N N+G  +   G   + L  +P   Y     +  ++ +  EC ICL  + D E
Sbjct: 70  VSNASNANANLGRLAAATGLKKQALKQIPVGLY----GSGIIDMKATECLICLGDFEDGE 125

Query: 361 EMRQLP-CSHVFHLNCVDQWLRIISCCPLCKKDL 263
           ++R LP C+H FH+ C+D WL   S CP C++ L
Sbjct: 126 KVRVLPKCNHGFHVRCIDTWLLSRSSCPTCRQSL 159



>gb:CR859911_1184012 Pongo pygmaeus mRNA; cDNA DKFZp469I142 (from
           clone DKFZp469I142).
          Length = 685

 Score = 60.8 bits (146), Expect = 8e-08
 Identities = 25/74 (33%), Positives = 44/74 (59%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVD 311
           RG + EQ+ +L T  Y+    + +L      C +C++ +    ++RQLPC H FH++C+D
Sbjct: 604 RGLTKEQIDNLSTRHYEHNSIDSEL---GKICSVCISDHVTGNKLRQLPCMHEFHIHCID 660

Query: 310 QWLRIISCCPLCKK 269
           +WL     CP+C++
Sbjct: 661 RWLSENCTCPICRQ 674



>pir|E84774|E84774 probable RING zinc finger protein [imported] -
           Arabidopsis thaliana>gb:AC007017_1534962 Arabidopsis
           thaliana chromosome 2 clone F11F19 map g6825, complete
           sequence.
          Length = 180

 Score = 60.8 bits (146), Expect = 8e-08
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 1/43 (2%)
 Frame = -1

Query: 397 CCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWLRIISCCPLCK 272
           C ICL  Y+ K  +RQLP C+H+FHL C+D WLR+   CP+C+
Sbjct: 110 CAICLGDYKGKHLLRQLPDCNHLFHLKCIDTWLRLNPTCPVCR 152



>pir|F86458|F86458 unknown protein, 73879-71181 [imported] -
           Arabidopsis thaliana>gb:AE005172_892162 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC051630_1540100 Arabidopsis thaliana
           chromosome 1 BAC F10C21 genomic sequence, complete
           sequence.
          Length = 508

 Score = 60.8 bits (146), Expect = 8e-08
 Identities = 29/90 (32%), Positives = 51/90 (56%), Gaps = 1/90 (1%)
 Frame = -1

Query: 538 MVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEE 359
           M ++F+  N ++ ++E G S E    LP   +K+     D      +C +CL  Y+  ++
Sbjct: 59  MRTTFIPGN-SLSTIELGLSKELREMLPIVVFKESFTVMD-----SQCSVCLGDYQPNDK 112

Query: 358 MRQLP-CSHVFHLNCVDQWLRIISCCPLCK 272
           ++Q+P C H FH++C+D WL   + CPLC+
Sbjct: 113 LQQIPVCKHTFHMDCIDLWLTSHTTCPLCR 142



>gb:BC050161_2550341 Danio rerio zgc:56424, mRNA (cDNA clone
           MGC:56424 IMAGE:5611887), complete cds.
          Length = 156

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 24/74 (32%), Positives = 44/74 (59%)
 Frame = -1

Query: 484 ASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQW 305
           A+   + SLP      V  +P+  ++  +C +CL ++ ++E +R++PC H+FH  C+  W
Sbjct: 55  AAKAVVQSLPV-----VIISPEQADKGVKCPVCLLEFEEQESVREMPCKHLFHTGCILPW 109

Query: 304 LRIISCCPLCKKDL 263
           L   + CPLC+ +L
Sbjct: 110 LNKTNSCPLCRLEL 123



>gb:AL627094_2504167 Zebrafish DNA sequence from clone RP71-PACKTRZ
           in linkage group 7 Contains a novel gene similar to
           PKD2L1 (polycystic kidney disease 2-like 1), the atoh7
           gene for atonal homolog 7, a putative novel gene and two
           novel genes, complete sequence.
          Length = 81

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 21/47 (44%), Positives = 31/47 (65%)
 Frame = -1

Query: 397 CCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLAR 257
           C +CL ++R ++E+   PCSH FH  C+ +WL I S CP+C K + R
Sbjct: 17  CAVCLEEFRSRDELGVCPCSHAFHKKCLVKWLEIRSVCPMCNKPICR 63



>gb:AF329846_2487919 Gallus gallus ring finger protein (arkadia) mRNA,
            partial cds.
          Length = 879

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 32/89 (35%), Positives = 50/89 (56%), Gaps = 8/89 (8%)
 Frame = -1

Query: 505  MGSVERGASN---EQLSSLPTWKYKQVCNNPDLENENPE-----CCICLAQYRDKEEMRQ 350
            +G+V RGA+    E+ +    +K +++    D E    E     C ICL+   + E++R+
Sbjct: 783  LGNVNRGATQGTIERCTYPHKYKKRKLHCKQDGEEGTEEDTEEKCTICLSILEEGEDVRR 842

Query: 349  LPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
            LPC H+FH  CVDQWL     CP+C+ D+
Sbjct: 843  LPCMHLFHQVCVDQWLITNKKCPICRVDI 871



>gb:BC054842_2101871 Mus musculus ring finger 111, mRNA (cDNA clone
           IMAGE:6485999), partial cds.
          Length = 185

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 33/97 (34%), Positives = 49/97 (50%), Gaps = 16/97 (16%)
 Frame = -1

Query: 505 MGSVERGASNEQLSSLP-TWKYKQVCNN---------------PDLENENPECCICLAQY 374
           +G+V RGAS   +       KYK+V  +                  E+   +C ICL+  
Sbjct: 81  LGNVNRGASQGTIERCTYPHKYKKVTTDWFSQRKLHCKQDGEEGTEEDTEEKCTICLSIL 140

Query: 373 RDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
            + E++R+LPC H+FH  CVDQWL     CP+C+ D+
Sbjct: 141 EEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDI 177



>gb:AF330197_2063382 Mus musculus Arkadia (Arkadia) mRNA, complete
            cds.
          Length = 989

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 33/97 (34%), Positives = 49/97 (50%), Gaps = 16/97 (16%)
 Frame = -1

Query: 505  MGSVERGASNEQLSSLP-TWKYKQVCNN---------------PDLENENPECCICLAQY 374
            +G+V RGAS   +       KYK+V  +                  E+   +C ICL+  
Sbjct: 885  LGNVNRGASQGTIERCTYPHKYKKVTTDWFSQRKLHCKQDGEEGTEEDTEEKCTICLSIL 944

Query: 373  RDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
             + E++R+LPC H+FH  CVDQWL     CP+C+ D+
Sbjct: 945  EEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDI 981



>gb:BC020984_1977329 Homo sapiens ring finger protein 111, mRNA
           (cDNA clone IMAGE:3851753), partial cds.
          Length = 441

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 33/97 (34%), Positives = 49/97 (50%), Gaps = 16/97 (16%)
 Frame = -1

Query: 505 MGSVERGASNEQLSSLP-TWKYKQVCNN---------------PDLENENPECCICLAQY 374
           +G+V RGAS   +       KYK+V  +                  E+   +C ICL+  
Sbjct: 337 LGNVNRGASQGTIERCTYPHKYKKVTTDWFSQRKLHCKQDGEEGTEEDTEEKCTICLSIL 396

Query: 373 RDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
            + E++R+LPC H+FH  CVDQWL     CP+C+ D+
Sbjct: 397 EEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDI 433



>gb:AK131488_1918022 Homo sapiens cDNA FLJ16671 fis, clone
           THYMU3001428.
          Length = 602

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 33/97 (34%), Positives = 49/97 (50%), Gaps = 16/97 (16%)
 Frame = -1

Query: 505 MGSVERGASNEQLSSLP-TWKYKQVCNN---------------PDLENENPECCICLAQY 374
           +G+V RGAS   +       KYK+V  +                  E+   +C ICL+  
Sbjct: 498 LGNVNRGASQGTIERCTYPHKYKKVTTDWFSQRKLHCKQDGEEGTEEDTEEKCTICLSIL 557

Query: 373 RDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
            + E++R+LPC H+FH  CVDQWL     CP+C+ D+
Sbjct: 558 EEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDI 594



>gb:AK131304_1917860 Homo sapiens cDNA FLJ16278 fis, clone
            NT2RI3001132, highly similar to Mus musculus Arkadia
            (Arkadia) mRNA.
          Length = 994

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 33/97 (34%), Positives = 49/97 (50%), Gaps = 16/97 (16%)
 Frame = -1

Query: 505  MGSVERGASNEQLSSLP-TWKYKQVCNN---------------PDLENENPECCICLAQY 374
            +G+V RGAS   +       KYK+V  +                  E+   +C ICL+  
Sbjct: 890  LGNVNRGASQGTIERCTYPHKYKKVTTDWFSQRKLHCKQDGEEGTEEDTEEKCTICLSIL 949

Query: 373  RDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
             + E++R+LPC H+FH  CVDQWL     CP+C+ D+
Sbjct: 950  EEGEDVRRLPCMHLFHQVCVDQWLVTNKKCPICRVDI 986



>gb:AK095327_1914343 Homo sapiens cDNA FLJ38008 fis, clone
           CTONG2012452, highly similar to Mus musculus Arkadia
           (Arkadia) mRNA.
          Length = 370

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 33/97 (34%), Positives = 49/97 (50%), Gaps = 16/97 (16%)
 Frame = -1

Query: 505 MGSVERGASNEQLSSLP-TWKYKQVCNN---------------PDLENENPECCICLAQY 374
           +G+V RGAS   +       KYK+V  +                  E+   +C ICL+  
Sbjct: 266 LGNVNRGASQGTIERCTYPHKYKKVTTDWFSQRKLHCKQDGEEGTEEDTEEKCTICLSIL 325

Query: 373 RDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
            + E++R+LPC H+FH  CVDQWL     CP+C+ D+
Sbjct: 326 EEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDI 362



>gb:AP005511_1853142 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0011N12.
          Length = 195

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 29/79 (36%), Positives = 44/79 (55%), Gaps = 1/79 (1%)
 Frame = -1

Query: 493 ERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNC 317
           E G +   + +LP  +Y++    P     +P C +CL   R  E +R LP C H++H  C
Sbjct: 93  ECGLTAAAIDALPASEYER----PRGGGGDPACSVCLEDVRGGETVRWLPACGHLYHAAC 148

Query: 316 VDQWLRIISCCPLCKKDLA 260
           +D WLR  + CPLC+ DL+
Sbjct: 149 IDAWLRSRTTCPLCRSDLS 167



>gb:AP004213_1838879 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1111_H02.>gb:AP005918_1860105 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0419H09.
          Length = 413

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 1/78 (1%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCV 314
           RG     L + PT  Y  V  +   +    EC +CL+++ D E +R LP CSH FH +C+
Sbjct: 115 RGLDPAVLGAFPTMAYADVKAHKAGKGAL-ECAVCLSEFDDDETLRLLPRCSHAFHADCI 173

Query: 313 DQWLRIISCCPLCKKDLA 260
           D WL     CP+C+ +LA
Sbjct: 174 DAWLASHVTCPVCRANLA 191



>gb:AP003268_1826810 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0503C12.
          Length = 238

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = -1

Query: 487 GASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVD 311
           G     +++LPT  Y +V    D      EC ICL   ++ + +R LP C HVFH+ C+D
Sbjct: 88  GLDPSAIAALPTAAYGKVAGG-DAAGGTTECAICLGAMQEADAVRVLPACRHVFHVACID 146

Query: 310 QWLRIISCCPLCK 272
           +WL   S CP+C+
Sbjct: 147 KWLASSSSCPVCR 159



>gb:AK117391_1815429 Arabidopsis thaliana At3g47990 mRNA for unknown
           protein, complete cds, clone: RAFL16-97-K12.
          Length = 358

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 28/66 (42%), Positives = 40/66 (60%)
 Frame = -1

Query: 469 LSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIIS 290
           +  LP ++ K V   PD   +  EC ICL ++    E+R LPC+H FH+ C+DQWLR+  
Sbjct: 217 IQELPKFRLKAV---PD---DCGECLICLEEFHIGHEVRGLPCAHNFHVECIDQWLRLNV 270

Query: 289 CCPLCK 272
            CP C+
Sbjct: 271 KCPRCR 276



>gb:OSJN00157_1695846 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0013K16, complete sequence.
          Length = 192

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 10/110 (9%)
 Frame = -1

Query: 562 VVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKY---------KQVCNNPDLEN 410
           V  C C    S   G   +  +  +G     L ++PT +Y         K+       E 
Sbjct: 48  VARCAC----SRRGGGGPDAAAANKGVKKSVLRAIPTVEYVSPGGGGKGKEEEEAAAEEG 103

Query: 409 ENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWLRIISCCPLCKKDL 263
           E  EC ICL+ +   + MR LP C H FH  C+D+WLR  S CP C++ L
Sbjct: 104 EQSECAICLSDFEHGDAMRVLPQCGHAFHAACIDKWLRGHSSCPSCRRIL 153



>gb:OSJN00057_1694040 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0010D21, complete sequence.
          Length = 667

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 29/90 (32%), Positives = 45/90 (50%), Gaps = 6/90 (6%)
 Frame = -1

Query: 523 LGYNMNMGSVERGASNEQLSSL------PTWKYKQVCNNPDLENENPECCICLAQYRDKE 362
           L     +G+V  G S E+++ L       +W+        +   E   CCIC  +Y D +
Sbjct: 579 LALEERIGNVSTGLSEEEVTKLLKQRKFSSWRL-------EASVEEEPCCICQEEYVDGD 631

Query: 361 EMRQLPCSHVFHLNCVDQWLRIISCCPLCK 272
           ++  L C H FH+ CV QWL + + CP+CK
Sbjct: 632 DLGTLDCGHDFHVGCVRQWLVVKNTCPICK 661



>gb:BT015731_1642349 Arabidopsis thaliana At4g28890 mRNA, complete
           cds.>gb:BT020178_1642573 Arabidopsis thaliana At4g28890
           mRNA, complete cds.
          Length = 386

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 34/122 (27%), Positives = 58/122 (47%), Gaps = 17/122 (13%)
 Frame = -1

Query: 586 YSFPFILFVVLCCCVPMVSSFLG--------------YNMNMGSVER--GASNEQLSSLP 455
           ++  F+L V   CC   + S  G              +N +  S +R  G     + SLP
Sbjct: 2   FALTFVLLVYAKCCHIDLRSGSGDRRRHDRRLRQGIFFNRSTASSDRFSGLDKTAIESLP 61

Query: 454 TWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWLRIISCCPL 278
            +++  +  +     +  +C +CL+++   E +R LP C H FH+ C+DQWL   + CPL
Sbjct: 62  LFRFSALKGS----KQGLDCSVCLSKFESVEILRLLPKCRHAFHIGCIDQWLEQHATCPL 117

Query: 277 CK 272
           C+
Sbjct: 118 CR 119



>gb:AB026654_1517307 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MVE11.>gb:AY086917_1571955 Arabidopsis
           thaliana clone 29464 mRNA, complete sequence.
          Length = 220

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 30/77 (38%), Positives = 41/77 (53%), Gaps = 1/77 (1%)
 Frame = -1

Query: 499 SVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHL 323
           SV +G   + L  LP   Y    N P +     EC ICL+ +   E++R LP C+H FHL
Sbjct: 99  SVNKGIKKKALKMLPVVNYSPEINLPGV---GEECVICLSDFVAGEQLRVLPKCNHGFHL 155

Query: 322 NCVDQWLRIISCCPLCK 272
            C+D+WL     CP C+
Sbjct: 156 RCIDKWLTQHMTCPKCR 172



>gb:AB010692_1511100 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K18I23.
          Length = 176

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = -1

Query: 499 SVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHL 323
           +V +G     L  +P   Y     +P+L+ +  EC ICL  + + E +R LP C+H FH+
Sbjct: 84  NVAKGIKKRALKVIPVDSY-----SPELKMKATECLICLGDFVEGETVRVLPKCNHGFHV 138

Query: 322 NCVDQWLRIISCCPLCKKDL 263
            C+D WL   S CP C++ L
Sbjct: 139 KCIDTWLLSHSSCPTCRQSL 158



>gb:AX879408_1477810 Sequence 14313 from Patent
           EP1074617.>gb:AK022588_1909182 Homo sapiens cDNA
           FLJ12526 fis, clone NT2RM4000046, weakly similar to
           GOLIATH PROTEIN.
          Length = 155

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 3/110 (2%)
 Frame = -1

Query: 580 FPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPD---LEN 410
           F F+L ++ CC       F+    N    +R            + YK+V    D   L+ 
Sbjct: 47  FVFMLSLIFCCY------FISKLRNQAQSDR------------YGYKEVVLKGDAKKLQL 88

Query: 409 ENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA 260
               C +CL  ++ K+E+  LPC H FH  C+ +WL +   CP+C K +A
Sbjct: 89  YGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIA 138



>gb:CNS07EGF_1373915 chromosome VIII of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 252

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 30/85 (35%), Positives = 44/85 (51%), Gaps = 1/85 (1%)
 Frame = -1

Query: 511 MNMGSVERGA-SNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSH 335
           ++ G  ERG  S++++  +P      +C     E  N  C ICL  + D   +R L C H
Sbjct: 158 LSFGIEERGGLSDKEIEKIP------LCPYSGQEFINKGCIICLEDFEDGGYVRSLDCGH 211

Query: 334 VFHLNCVDQWLRIISCCPLCKKDLA 260
            FH  CVD+WLR    CP+C+  +A
Sbjct: 212 AFHKECVDRWLRKNFVCPICRSKMA 236



>pir|T06684|T06684 hypothetical protein T17F15.140 - Arabidopsis
           thaliana>gb:ATT17F15_1554705 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T17F15.
          Length = 292

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 28/66 (42%), Positives = 40/66 (60%)
 Frame = -1

Query: 469 LSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIIS 290
           +  LP ++ K V   PD   +  EC ICL ++    E+R LPC+H FH+ C+DQWLR+  
Sbjct: 151 IQELPKFRLKAV---PD---DCGECLICLEEFHIGHEVRGLPCAHNFHVECIDQWLRLNV 204

Query: 289 CCPLCK 272
            CP C+
Sbjct: 205 KCPRCR 210



>pir|T52407|T52407 RING-H2 zinc finger protein ATL4 [imported] -
           Arabidopsis thaliana>gb:AF132014_1770847 Arabidopsis
           thaliana RING-H2 zinc finger protein ATL4 (ATL4) mRNA,
           complete cds.
          Length = 326

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 26/70 (37%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = -1

Query: 469 LSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWLRII 293
           L SLP +K+  V       N   +C +CL+++  ++++R LP C H FH +C+D WL   
Sbjct: 86  LDSLPIFKFSSVTRRSSSMNSG-DCAVCLSKFESEDQLRLLPLCCHAFHADCIDIWLVSN 144

Query: 292 SCCPLCKKDL 263
             CPLC+  L
Sbjct: 145 QTCPLCRSPL 154



>pir|B84584|B84584 probable RING zinc finger protein [imported] -
           Arabidopsis thaliana>gb:AC006081_1533438 Arabidopsis
           thaliana chromosome 2 clone T2G17 map mi148, complete
           sequence.
          Length = 390

 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = -1

Query: 508 NMGSVERGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHV 332
           N  S   G   + + SLP +++  +        +  EC +CL+++ D E +R LP C H 
Sbjct: 91  NRSSRFSGLDKKAIESLPFFRFSALKGL----KQGLECSVCLSKFEDVEILRLLPKCRHA 146

Query: 331 FHLNCVDQWLRIISCCPLCK 272
           FH+ C+DQWL   + CPLC+
Sbjct: 147 FHIGCIDQWLEQHATCPLCR 166



>gb:BC079688_2561227 Xenopus laevis MGC80300 protein, mRNA (cDNA
           clone MGC:80300 IMAGE:5073686), complete cds.
          Length = 295

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 36/115 (31%), Positives = 56/115 (48%)
 Frame = -1

Query: 607 LAWNAVTYSFPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCN 428
           L+W+ + +S P            +V+  LG   N G     A  +++ SLPT     V  
Sbjct: 158 LSWSGMLHSNPGDYAWGQSGLDSIVTQLLGQLENSGPPP--ADKDKIVSLPT-----VTV 210

Query: 427 NPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
             +      EC +C   Y  +E++RQLPC+H FH +C+  WL +   CP+C+K L
Sbjct: 211 TREQVAMGLECPVCKEDYTVEEQVRQLPCNHFFHGDCIVPWLELHDTCPVCRKSL 265



>gb:AY190520_2078838 Rattus norvegicus Sprague-Dawley liver
           r-goliath mRNA, complete cds; nuclear gene for
           mitochondrial product.
          Length = 419

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 25/76 (32%), Positives = 43/76 (56%)
 Frame = -1

Query: 484 ASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQW 305
           A+ + +S L T   K+   + + + +   C +C+  Y+  + +R LPC HVFH +CVD W
Sbjct: 237 AAKKAISKLTTRTVKK--GDKETDPDFDHCAVCIESYKQNDVVRVLPCKHVFHKSCVDPW 294

Query: 304 LRIISCCPLCKKDLAR 257
           L     CP+CK ++ +
Sbjct: 295 LSEHCTCPMCKLNILK 310



>gb:AY155439_2076911 Mus musculus goliath-related E3 ubiquitin
           ligase 4 (Greul4) mRNA, partial cds.
          Length = 282

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 30/94 (31%), Positives = 47/94 (50%), Gaps = 1/94 (1%)
 Frame = -1

Query: 535 VSSFLGYNMNMGSVE-RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEE 359
           +  FL      GS   R  + + +  LP    K      D++ EN  C +C+  ++ K+ 
Sbjct: 108 IQRFLYTGSQFGSQNHRKETKKVIGQLPLHTVKHGEKGIDVDAEN--CAVCIENFKVKDV 165

Query: 358 MRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLAR 257
           +R LPC H+FH  C+D WL     CP+CK D+ +
Sbjct: 166 IRILPCKHIFHRICIDPWLLDHRTCPMCKLDVIK 199



>gb:AL627187_2071579 Mouse DNA sequence from clone RP23-319B15 on
           chromosome 11 Contains the 3' end of the Rnf130 gene for
           ring finger protein 130, a heterogeneous nuclear
           ribonucleoprotein A family pseudogene, a novel gene,
           genes 2700008N14Rik and 3010026O09Rik, the Sqstm1 gene
           for sequestosome 1, the Mgat4b gene for mannoside
           acetylglucosaminyltransferase 4 isoenzyme B, the Ltc4s
           gene for leukotriene C4 synthase and four CpG islands,
           complete sequence.>gb:AL645913_2072011 Mouse DNA
           sequence from clone RP23-194G14 on chromosome 11
           Contains the 3' end of gene 9130006A14Rik, the 5' end of
           the Rnf130 gene for ring finger protein 130 and a CpG
           island, complete sequence.
          Length = 384

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 25/76 (32%), Positives = 43/76 (56%)
 Frame = -1

Query: 484 ASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQW 305
           A+ + +S L T   K+   + + + +   C +C+  Y+  + +R LPC HVFH +CVD W
Sbjct: 237 AAKKAISKLTTRTVKK--GDKETDPDFDHCAVCIESYKQNDVVRVLPCKHVFHKSCVDPW 294

Query: 304 LRIISCCPLCKKDLAR 257
           L     CP+CK ++ +
Sbjct: 295 LSEHCTCPMCKLNILK 310



>gb:AL627187_2071578 Mouse DNA sequence from clone RP23-319B15 on
           chromosome 11 Contains the 3' end of the Rnf130 gene for
           ring finger protein 130, a heterogeneous nuclear
           ribonucleoprotein A family pseudogene, a novel gene,
           genes 2700008N14Rik and 3010026O09Rik, the Sqstm1 gene
           for sequestosome 1, the Mgat4b gene for mannoside
           acetylglucosaminyltransferase 4 isoenzyme B, the Ltc4s
           gene for leukotriene C4 synthase and four CpG islands,
           complete sequence.>gb:AL645913_2072012 Mouse DNA
           sequence from clone RP23-194G14 on chromosome 11
           Contains the 3' end of gene 9130006A14Rik, the 5' end of
           the Rnf130 gene for ring finger protein 130 and a CpG
           island, complete sequence.>gb:BC018199_2092578 Mus
           musculus ring finger protein 130, mRNA (cDNA clone
           MGC:25596 IMAGE:4017435), complete
           cds.>gb:BC048901_2099861 Mus musculus ring finger
           protein 130, mRNA (cDNA clone MGC:56732 IMAGE:6390079),
           complete cds.
          Length = 419

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 25/76 (32%), Positives = 43/76 (56%)
 Frame = -1

Query: 484 ASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQW 305
           A+ + +S L T   K+   + + + +   C +C+  Y+  + +R LPC HVFH +CVD W
Sbjct: 237 AAKKAISKLTTRTVKK--GDKETDPDFDHCAVCIESYKQNDVVRVLPCKHVFHKSCVDPW 294

Query: 304 LRIISCCPLCKKDLAR 257
           L     CP+CK ++ +
Sbjct: 295 LSEHCTCPMCKLNILK 310



>gb:CR456397_1992688 Homo sapiens bK175E3.6 full length open reading
           frame (ORF) cDNA clone (cDNA clone
           C22ORF:pGEM.bK175E3.6.V4).>gb:HS175E3_1997293 Human DNA
           sequence from clone CTA-175E3 on chromosome 22q12.1,
           complete sequence.>gb:HS747E2_1999421 Human DNA sequence
           from clone CTA-747E2 on chromosome 22q12.1, complete
           sequence.
          Length = 836

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 36/114 (31%), Positives = 53/114 (46%), Gaps = 10/114 (8%)
 Frame = -1

Query: 574 FILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQV--------CNNPD 419
           F + V L C + +V   L    +  S+ R A  + L  + T K+           C   D
Sbjct: 125 FFVVVSLVCLILLVKIKLKQRRSQNSMNRLAV-QALEKMETRKFNSKSKGRREGSCGALD 183

Query: 418 L--ENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
               +   +C ICL +Y D EE+R +PC+H FH  CVD WL     CP C+ ++
Sbjct: 184 TLSSSSTSDCAICLEKYIDGEELRVIPCTHRFHRKCVDPWLLQHHTCPHCRHNI 237



>gb:AB051436_1867948 Homo sapiens mRNA for KIAA1133 protein, partial
           cds.
          Length = 891

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 36/114 (31%), Positives = 53/114 (46%), Gaps = 10/114 (8%)
 Frame = -1

Query: 574 FILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQV--------CNNPD 419
           F + V L C + +V   L    +  S+ R A  + L  + T K+           C   D
Sbjct: 180 FFVVVSLVCLILLVKIKLKQRRSQNSMNRLAV-QALEKMETRKFNSKSKGRREGSCGALD 238

Query: 418 L--ENENPECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDL 263
               +   +C ICL +Y D EE+R +PC+H FH  CVD WL     CP C+ ++
Sbjct: 239 TLSSSSTSDCAICLEKYIDGEELRVIPCTHRFHRKCVDPWLLQHHTCPHCRHNI 292



>gb:AP005775_1857666 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OSJNBb0005A04.>gb:AP006060_1860696 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0135D07.
          Length = 210

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = -1

Query: 469 LSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWLRII 293
           ++++PT KY           ++ +C ICL +Y +KE +R +P C H FHL+C+D WL+  
Sbjct: 88  VAAIPTMKYSYEAFQ---SKDDAQCSICLGEYNEKEILRIMPKCRHNFHLSCIDVWLQKQ 144

Query: 292 SCCPLCKKDL 263
           + CP+C+  L
Sbjct: 145 TTCPICRISL 154



>gb:AF499727_1806156 Cucumis melo BAC clone PIT92-60K17, complete
           sequence.
          Length = 379

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 28/78 (35%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = -1

Query: 490 RGASNEQLSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCV 314
           RG     + + PT  Y  V  +  +     EC +CL ++ D E +R +P C HVFH  C+
Sbjct: 94  RGLDPAVIETFPTLIYSDVKEHK-IGKSALECAVCLNEFEDDETLRLIPKCDHVFHPECI 152

Query: 313 DQWLRIISCCPLCKKDLA 260
           D WL   S CP+C+ +L+
Sbjct: 153 DAWLASHSTCPVCRANLS 170



>gb:AF079184_1766306 Arabidopsis thaliana RING-H2 finger protein
           RHX1a mRNA, partial cds.
          Length = 273

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 26/70 (37%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = -1

Query: 469 LSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWLRII 293
           L SLP +K+  V       N   +C +CL+++  ++++R LP C H FH +C+D WL   
Sbjct: 33  LDSLPIFKFSSVTRRSSSMNSG-DCAVCLSKFEPEDQLRLLPLCCHAFHADCIDIWLVSN 91

Query: 292 SCCPLCKKDL 263
             CPLC+  L
Sbjct: 92  QTCPLCRSPL 101



>gb:AK085376_1174487 Mus musculus 0 day neonate kidney cDNA, RIKEN
           full-length enriched library, clone:D630018F07
           product:unknown EST, full insert
           sequence.>gb:BC038399_2098263 Mus musculus ring finger
           protein 122, mRNA (cDNA clone MGC:36976 IMAGE:4947596),
           complete cds.
          Length = 154

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 32/109 (29%), Positives = 49/109 (44%), Gaps = 2/109 (1%)
 Frame = -1

Query: 580 FPFILFVVLCCCVPMVSSFLGYNMNMGSVERGASNEQLSSLPTWKYKQVCNNPDLENEN- 404
           F F+L ++ CC       F+    N    ER            + YK+V    D +    
Sbjct: 47  FVFMLSLIFCCY------FISKLRNQAQSER------------YGYKEVVLKGDAKKLQL 88

Query: 403 -PECCICLAQYRDKEEMRQLPCSHVFHLNCVDQWLRIISCCPLCKKDLA 260
              C +CL  ++ K+E+  LPC H FH  C+ +WL +   CP+C K +A
Sbjct: 89  YGTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIA 137



>pir|T49217|T49217 RING-H2 zinc finger protein ATL4 - Arabidopsis
           thaliana>gb:ATF27H5_1550215 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F27H5.
          Length = 334

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 26/70 (37%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = -1

Query: 469 LSSLPTWKYKQVCNNPDLENENPECCICLAQYRDKEEMRQLP-CSHVFHLNCVDQWLRII 293
           L SLP +K+  V       N   +C +CL+++  ++++R LP C H FH +C+D WL   
Sbjct: 94  LDSLPIFKFSSVTRRSSSMNSG-DCAVCLSKFEPEDQLRLLPLCCHAFHADCIDIWLVSN 152

Query: 292 SCCPLCKKDL 263
             CPLC+  L
Sbjct: 153 QTCPLCRSPL 162


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,780,821,653
Number of Sequences: 1806583
Number of extensions: 39390063
Number of successful extensions: 107110
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 98110
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 106648
length of database: 581,917,975
effective HSP length: 129
effective length of database: 348,868,768
effective search space used: 140245244736
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)