BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10220
         (1304 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AK117402_1815438 Arabidopsis thaliana At3g13700 mRNA for unkn...   321   2e-86   
gb:AP004806_1845408 Oryza sativa (japonica cultivar-group) genom...   240   5e-62   
gb:AP001307_1821107 Arabidopsis thaliana genomic DNA, chromosome...   219   1e-55   
gb:AY219128_1590335 Arabidopsis thaliana hypothetical protein (A...   156   1e-36   
gb:AY219130_1590337 Arabidopsis thaliana hypothetical protein (A...   149   2e-34   
gb:AP005395_1851053 Oryza sativa (japonica cultivar-group) genom...   101   3e-20   
pir|T00933|T00933 RNA-binding protein homolog At2g42240 - Arabid...   100   5e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AY219129_1590336 Arabidopsis thaliana hypothetical protein (A...    96   2e-18   
sp|Q9W6I1|RBMS_CHICK|RBMS_CHICK RNA-binding protein with multiple splicing ...    85   3e-15   Gallus gallus [bantam]
gb:BC081153_2562056 Xenopus laevis MGC84222 protein, mRNA (cDNA ...    84   8e-15   
sp|Q9YGP5|RBMS_XENLA|RBMS_XENLA RNA-binding protein with multiple splicing ...    84   8e-15   Xenopus laevis [clawed frog]
gb:CERNAMEC8_1366927 C.elegans mRNA for Mec-8 protein.                 83   1e-14   
pir|T19360|T19360 hypothetical protein F46A9.6 - Caenorhabditis ...    83   1e-14   Caenorhabditis elegans [roundworm]
gb:AB080736_2463617 Danio rerio hermes mRNA for RNA binding prot...    82   2e-14   
gb:BC076171_2559044 Danio rerio zgc:92689, mRNA (cDNA clone MGC:...    80   7e-14   
gb:AP005495_1852862 Oryza sativa (japonica cultivar-group) genom...    80   1e-13   
sp|Q9WVB0|RBMS_MOUSE|RBMS_MOUSE RNA-binding protein with multiple splicing ...    79   2e-13   Mus musculus [mouse]
gb:AY143892_1583349 Arabidopsis thaliana At3g21211/At3g21211 mRN...    79   2e-13   
gb:BC021788_2093636 Mus musculus RNA binding protein with multip...    79   3e-13   
gb:D84108_1995009 Homo sapiens mRNA for RBP-MS/type 2, complete ...    79   3e-13   
gb:BC003608_1968920 Homo sapiens RNA binding protein with multip...    79   3e-13   
gb:AK127873_1916940 Homo sapiens cDNA FLJ45977 fis, clone PROST2...    79   3e-13   
gb:AK079238_1172636 Mus musculus adult male urinary bladder cDNA...    79   3e-13   
gb:AK041118_1165872 Mus musculus adult male aorta and vein cDNA,...    79   3e-13   
gb:AK012265_1156863 Mus musculus 11 days embryo whole body cDNA,...    79   3e-13   
gb:AK010301_1155661 Mus musculus ES cells cDNA, RIKEN full-lengt...    79   3e-13   
sp|Q93062|RBMS_HUMAN|RBMS_HUMAN RNA-binding protein with multiple splicing ...    79   3e-13   Homo sapiens [man]
gb:AB023045_1515512 Arabidopsis thaliana genomic DNA, chromosome...    78   3e-13   
gb:BC060391_2552860 Xenopus laevis hypothetical protein MGC68512...    78   5e-13   
gb:DMCPO611G_1378571 D.melanogaster Cpo 61.1 gene for couch pota...    77   8e-13   
gb:AE014297_1140105 Drosophila melanogaster chromosome 3R, compl...    77   8e-13   
gb:AE014297_1140103 Drosophila melanogaster chromosome 3R, compl...    77   8e-13   
pir|S24761|S24761 Cpo 61.1 protein - fruit fly (Drosophila melan...    77   8e-13   Drosophila melanogaster
sp|Q01617|CPO_DROME|CPO_DROME Couch potato protein.>gb:AE014297_1140102 Dr...    77   8e-13   Drosophila melanogaster
gb:CAR489610_1645345 Cicer arietinum partial mRNA for proline ri...    76   2e-12   
gb:BT001569_1356342 Drosophila melanogaster RE20544 full insert ...    72   2e-11   
sp|O74452|SCW1_SCHPO|SCW1_SCHPO Cell wall integrity protein scw1 (Strong ce...    67   1e-09   Schizosaccharomyces pombe
gb:CR382132_1665459 Yarrowia lipolytica chromosome F of strain C...    65   4e-09   
pir|A46230|A46230 RNA-binding protein homolog Cpo (clone 61.1) -...    64   5e-09   Drosophila melanogaster
pir|S67787|S67787 hypothetical protein YDL224c - yeast (Saccharo...    63   2e-08   Saccharomyces cerevisiae [brewer's yeast]
gb:CR380953_1650853 Candida glabrata strain CBS138 chromosome G ...    62   3e-08   
gb:AE016815_1746077 Ashbya gossypii (= Eremothecium gossypii) AT...    61   4e-08   
gb:CR382126_1659279 Kluyveromyces lactis strain NRRL Y-1140 chro...    61   4e-08   
pir|T41304|T41304 probable rna-binding protein - fission yeast  ...    60   1e-07   Schizosaccharomyces pombe
gb:CR382138_1671573 Debaryomyces hansenii chromosome F of strain...    58   5e-07   
gb:CR380953_1650848 Candida glabrata strain CBS138 chromosome G ...    57   8e-07   
sp|P34761|WHI3_YEAST|WHI3_YEAST WHI3 protein.>pir|S50734|S50734 WHI3 protei...    56   1e-06   Saccharomyces cerevisiae [brewer's yeast]
gb:AE017348_1758196 Cryptococcus neoformans var. neoformans JEC2...    53   2e-05   
gb:DMCPO612G_1378572 Drosophila melanogaster Cpo 61.2 gene for c...    52   2e-05   
pir|B46230|B46230 RNA-binding protein homolog Cpo (clone 61.2) -...    52   2e-05   Drosophila melanogaster
gb:AP005681_1855909 Oryza sativa (japonica cultivar-group) genom...    49   2e-04   
gb:D84111_1995012 Homo sapiens mRNA for RBP-MS/type 5, partial cds.    48   4e-04   
gb:AY129455_1302206 Drosophila melanogaster RE30936 full insert ...    48   4e-04   
gb:MTR508392_1687658 Medicago truncatula mRNA for RNA-binding pr...    47   9e-04   
gb:AK117533_1815563 Arabidopsis thaliana At1g76940 mRNA for unkn...    45   0.002   
gb:AP004300_1839814 Oryza sativa (japonica cultivar-group) genom...    45   0.004   
gb:AF173640_1774450 Arabidopsis thaliana splicing factor SR1, al...    44   0.006   
gb:AF173640_1774449 Arabidopsis thaliana splicing factor SR1, al...    44   0.006   
gb:AF173640_1774448 Arabidopsis thaliana splicing factor SR1, al...    44   0.006   
gb:AF173640_1774447 Arabidopsis thaliana splicing factor SR1, al...    44   0.006   
gb:AF173640_1774446 Arabidopsis thaliana splicing factor SR1, al...    44   0.006   
gb:AF001035_1760520 Arabidopsis thaliana ASF/SF2 homolog (SF2) g...    44   0.006   
gb:AY128338_1580637 Arabidopsis thaliana SF2/ASF-like splicing m...    44   0.006   
gb:S55886_1396626 Drosophila melanogaster RRM9 (rbp9) gene, comp...    44   0.006   
gb:AE014134_1127271 Drosophila melanogaster chromosome 2L, compl...    44   0.006   
gb:AE014134_1127269 Drosophila melanogaster chromosome 2L, compl...    44   0.006   
gb:AE014134_1127268 Drosophila melanogaster chromosome 2L, compl...    44   0.006   
gb:AE014134_1127267 Drosophila melanogaster chromosome 2L, compl...    44   0.006   
pir|S71185|S71185 splicing factor SF-2 homolog - Arabidopsis tha...    44   0.006   Arabidopsis thaliana [mouse-ear cress]
sp|O22315|SFR1_ARATH|SFR1_ARATH Pre-mRNA splicing factor SF2 (SR1 protein)....    44   0.006   Arabidopsis thaliana [mouse-ear cress]
gb:AK118074_1816074 Arabidopsis thaliana At4g02430 mRNA for unkn...    44   0.007   
pir|T01307|T01307 alternative splicing factor ASF-2 homolog T14P...    44   0.007   Arabidopsis thaliana [mouse-ear cress]
pir|S34448|S34448 small nuclear ribonucleoprotein U2B'' - potato...    44   0.009   Solanum tuberosum [potatoes]
gb:CEY111B2A_1369308 Caenorhabditis elegans YAC Y111B2A, complet...    43   0.012   
gb:BC072799_2556726 Xenopus laevis MGC80122 protein, mRNA (cDNA ...    42   0.021   
gb:BC064164_2553717 Xenopus tropicalis hypothetical protein MGC7...    42   0.021   
gb:AP006068_1860883 Oryza sativa (japonica cultivar-group) genom...    42   0.021   
gb:AP005755_1857270 Oryza sativa (japonica cultivar-group) genom...    42   0.028   
gb:AC135928_1742918 Oryza sativa (japonica cultivar-group) chrom...    42   0.028   
gb:AC135927_1742897 Oryza sativa (japonica cultivar-group) chrom...    42   0.028   
gb:D89144_1675262 Schizosaccharomyces pombe mRNA, partial cds, c...    42   0.028   
gb:AY536125_1612327 Zea mays MEG5 (meg5) mRNA, complete cds.           42   0.028   
gb:AY094463_1575760 Arabidopsis thaliana At2g43410/T1O24.15 mRNA...    42   0.028   
gb:AB011823_1511585 Schizosaccharomyces pombe mRNA for translati...    42   0.028   
gb:AX420420_1468201 Sequence 2 from Patent WO0212518.                  42   0.028   
gb:AF242767_1254874 Caenorhabditis elegans SF2 mRNA, complete cds.     42   0.028   
sp|P78795|IF34_SCHPO|IF34_SCHPO Probable eukaryotic translation initiation ...    42   0.028   Schizosaccharomyces pombe
gb:AF324983_1786437 Arabidopsis thaliana AT5g54900 (AT5g54900/MB...    42   0.036   
gb:AE017349_1758512 Cryptococcus neoformans var. neoformans JEC2...    42   0.036   
gb:AB005232_1509295 Arabidopsis thaliana genomic DNA, chromosome...    42   0.036   
gb:AY542999_1334455 Bigelowiella natans small nuclear ribonucleo...    42   0.036   
sp|P31483|TIA1_HUMAN|TIA1_HUMAN Nucleolysin TIA-1 (RNA-binding protein TIA-...    42   0.036   Homo sapiens [man]
gb:XLA416632_2582569 Xenopus laevis partial mRNA for TIA-1 protein.    41   0.047   
gb:BC084519_2563890 Xenopus tropicalis hypothetical LOC496533, m...    41   0.047   
gb:BC077169_2559887 Xenopus laevis cDNA clone MGC:78766 IMAGE:33...    41   0.047   
gb:BC015944_1975402 Homo sapiens TIA1 cytotoxic granule-associat...    41   0.047   
gb:AP005735_1856854 Oryza sativa (japonica cultivar-group) genom...    41   0.047   
gb:AP004163_1838449 Oryza sativa (japonica cultivar-group) genom...    41   0.047   
gb:AE016818_1748493 Ashbya gossypii (= Eremothecium gossypii) AT...    41   0.047   
gb:NCB7A16_1690126 Neurospora crassa DNA linkage group V BAC clo...    41   0.047   
gb:AY579889_1616031 Solanum tuberosum AML1 mRNA, complete cds.         41   0.047   
gb:AY579887_1616029 Citrus unshiu AML1 mRNA, complete cds.             41   0.047   
gb:AY579881_1616023 Medicago truncatula AML1 mRNA, complete cds.       41   0.047   
sp|P52912|TIA1_MOUSE|TIA1_MOUSE Nucleolysin TIA-1 (RNA-binding protein TIA-...    41   0.047   Mus musculus [mouse]
gb:BC080105_2561537 Xenopus laevis MGC84540 protein, mRNA (cDNA ...    41   0.062   
gb:MMU2SNRP1_2120527 M.musculus mRNA for U2-snRNP b'' (pRNP11).        41   0.062   
gb:AY579882_1616024 Medicago truncatula AML5 mRNA, complete cds.       41   0.062   
gb:BC087064_2109960 Rattus norvegicus cytotoxic granule-associat...    40   0.080   
gb:BC023813_2094268 Mus musculus cytotoxic granule-associated RN...    40   0.080   
gb:AY649843_1620131 Zea mays ASF/SF2-like pre-mRNA splicing fact...    40   0.080   
gb:AY649843_1620130 Zea mays ASF/SF2-like pre-mRNA splicing fact...    40   0.080   
gb:AY649843_1620129 Zea mays ASF/SF2-like pre-mRNA splicing fact...    40   0.080   
gb:AY649842_1620127 Zea mays ASF/SF2-like pre-mRNA splicing fact...    40   0.080   
gb:AY649842_1620126 Zea mays ASF/SF2-like pre-mRNA splicing fact...    40   0.080   
pir|A39293|A39293 cytotoxic granule-associated RNA-binding prote...    40   0.080   Homo sapiens [man]
pir|S59117|S59117 small nuclear ribonucleoprotein U1A - potato>g...    40   0.080   Solanum tuberosum [potatoes]
gb:AY189903_2517958 Gallus gallus TIA-1 mRNA, complete cds.            40   0.10    
gb:AY080742_1568456 Arabidopsis thaliana putative spliceosomal p...    40   0.10    
gb:ATH131214_1551981 Arabidopsis thaliana srp30 gene, exons 1-12.      40   0.10    
gb:ATH131214_1551980 Arabidopsis thaliana srp30 gene, exons 1-12...    40   0.10    
pir|E86223|E86223 hypothetical protein [imported] - Arabidopsis ...    40   0.10    Arabidopsis thaliana [mouse-ear cress]
gb:BC084107_2563513 Xenopus laevis hypothetical LOC495019, mRNA ...    40   0.14    
gb:BC045368_2549210 Danio rerio zgc:55520, mRNA (cDNA clone MGC:...    40   0.14    
gb:BC049125_2099939 Mus musculus ELAV (embryonic lethal, abnorma...    40   0.14    
gb:BC046598_2099302 Mus musculus ELAV (embryonic lethal, abnorma...    40   0.14    
gb:AY035379_2074233 Mus musculus ELAV-like neuronal protein-2 mR...    40   0.14    
gb:AY035378_2074232 Mus musculus ELAV-like neuronal protein-3 mR...    40   0.14    
gb:AL161628_1922056 Human DNA sequence from clone RP11-31K16 on ...    40   0.14    
gb:AL161628_1922055 Human DNA sequence from clone RP11-31K16 on ...    40   0.14    
gb:AL161628_1922053 Human DNA sequence from clone RP11-31K16 on ...    40   0.14    
gb:AP004040_1836737 Oryza sativa (japonica cultivar-group) genom...    40   0.14    
gb:AY649843_1620128 Zea mays ASF/SF2-like pre-mRNA splicing fact...    40   0.14    
gb:CR860401_1184472 Pongo pygmaeus mRNA; cDNA DKFZp459N111 (from...    40   0.14    
gb:CR859234_1183359 Pongo pygmaeus mRNA; cDNA DKFZp459M0124 (fro...    40   0.14    
pir|I51676|I51676 ribonucleoprotein - African clawed frog>gb:XLU...    40   0.14    Xenopus laevis [clawed frog]
pir|I39077|I39077 RNA-binding protein Hel-N2 - human>gb:HSU29943...    40   0.14    Homo sapiens [man]
sp|Q60899|ELV2_MOUSE|ELV2_MOUSE ELAV-like protein 2 (Hu-antigen B) (HuB) (E...    40   0.14    Mus musculus [mouse]
sp|Q12926|ELV2_HUMAN|ELV2_HUMAN ELAV-like protein 2 (Hu-antigen B) (HuB) (E...    40   0.14    Homo sapiens [man]
gb:MMU2SNRP2_2120528 M.musculus mRNA for U2-snRNP b'' (pRNP31).        39   0.18    
gb:CR382134_1667540 Debaryomyces hansenii chromosome B of strain...    39   0.18    
gb:CR382130_1663279 Yarrowia lipolytica chromosome D of strain C...    39   0.18    
gb:AY649841_1620125 Zea mays ASF/SF2-like pre-mRNA splicing fact...    39   0.18    
gb:AY649841_1620124 Zea mays ASF/SF2-like pre-mRNA splicing fact...    39   0.18    
gb:AY649841_1620123 Zea mays ASF/SF2-like pre-mRNA splicing fact...    39   0.18    
gb:AX884240_1479693 Sequence 103 from Patent EP1033401.                39   0.18    
gb:AY615399_1340766 Toxoplasma gondii splice factor gene, comple...    39   0.18    
gb:CR860918_1184962 Pongo pygmaeus mRNA; cDNA DKFZp469G2231 (fro...    39   0.18    
gb:AK011274_1156298 Mus musculus 10 days embryo whole body cDNA,...    39   0.18    
pir|I51677|I51677 ribonucleoprotein - African clawed frog>gb:XLU...    39   0.18    Xenopus laevis [clawed frog]
pir|S54857|S54857 small nuclear ribonucleoprotein U2B'' - mouse ...    39   0.18    Mus musculus [mouse]
sp|P08579|RU2B_HUMAN|RU2B_HUMAN U2 small nuclear ribonucleoprotein B".>pir|...    39   0.18    Homo sapiens [man]
gb:BC064308_2553857 Danio rerio small nuclear ribonucleoprotein ...    39   0.23    
gb:BC045485_2549321 Danio rerio zgc:76917, mRNA (cDNA clone MGC:...    39   0.23    
gb:AY398424_2531954 Danio rerio clone RK068A2A06 TIA1 cytotoxic ...    39   0.23    
gb:AE017343_1755858 Cryptococcus neoformans var. neoformans JEC2...    39   0.23    
gb:AY579886_1616028 Triticum aestivum AML15 mRNA, complete cds.        39   0.23    
gb:AY579883_1616025 Aegilops speltoides AML1 mRNA, complete cds.       39   0.23    
gb:AY387676_1429976 Oryctolagus cuniculus nuclear ribonucleoprot...    39   0.23    
gb:AF067616_1238030 Caenorhabditis elegans cosmid F29C4, complet...    39   0.23    
gb:AF067616_1238028 Caenorhabditis elegans cosmid F29C4, complet...    39   0.23    
pir|T33146|T33146 hypothetical protein F29C4.7 - Caenorhabditis ...    39   0.23    Caenorhabditis elegans [roundworm]
gb:XLXEL1_2583600 X.laevis mRNA for XEL-1.                             39   0.31    
gb:AY016023_2508358 Sphoeroides nephelus alpha globin gene clust...    39   0.31    
gb:AY579879_1616021 Pinus taeda Mei2-like protein mRNA, partial ...    39   0.31    
gb:AY142487_1582916 Arabidopsis thaliana putative spliceosomal p...    39   0.31    
gb:AY087401_1572432 Arabidopsis thaliana clone 34995 mRNA, compl...    39   0.31    
gb:AY062613_1565269 Arabidopsis thaliana RNA-binding protein MEI...    39   0.31    
gb:CEY46G5A_1370129 Caenorhabditis elegans YAC Y46G5A, complete ...    39   0.31    
pir|F86416|F86416 probable RNA-binding protein MEI2, 36123-32976...    39   0.31    Arabidopsis thaliana [mouse-ear cress]
pir|C84706|C84706 probable small nuclear ribonucleoprotein U2B [...    39   0.31    Arabidopsis thaliana [mouse-ear cress]
pir|C86204|C86204 hypothetical protein [imported] - Arabidopsis ...    39   0.31    Arabidopsis thaliana [mouse-ear cress]
gb:TCA309135_2580480 Triturus carnifex partial mRNA for putative...    38   0.40    
gb:BC071118_2555980 Xenopus laevis MGC81363 protein, mRNA (cDNA ...    38   0.40    
gb:AF357912_2489186 Labeo rohita ribonucleoprotein mRNA, complet...    38   0.40    
gb:BC086331_2109525 Rattus norvegicus small nuclear ribonucleopr...    38   0.40    
gb:BC052062_2100945 Mus musculus RIKEN cDNA D230005D02 gene, mRN...    38   0.40    
gb:BC024178_1978252 Homo sapiens hypothetical protein FLJ10094, ...    38   0.40    
gb:AL138823_1919985 Human DNA sequence from clone RP11-64J21 on ...    38   0.40    
gb:AX875747_1476229 Sequence 10652 from Patent EP1074617.>gb:AK0...    38   0.40    
gb:AK051821_1169830 Mus musculus 12 days embryo eyeball cDNA, RI...    38   0.40    
gb:AK013886_1157677 Mus musculus 12 days embryo head cDNA, RIKEN...    38   0.40    
gb:AK012944_1157244 Mus musculus 10, 11 days embryo whole body c...    38   0.40    
sp|Q62189|RU1A_MOUSE|RU1A_MOUSE U1 small nuclear ribonucleoprotein A (U1 sn...    38   0.40    Mus musculus [mouse]
sp|P09012|RU1A_HUMAN|RU1A_HUMAN U1 small nuclear ribonucleoprotein A (U1 sn...    38   0.40    Homo sapiens [man]
gb:BC055501_2551372 Danio rerio TIA1 cytotoxic granule-associate...    38   0.52    
gb:BC044979_2548938 Xenopus laevis sans fille, mRNA (cDNA clone ...    38   0.52    
gb:BC010496_2091006 Mus musculus Tial1 cytotoxic granule-associa...    38   0.52    
gb:AF190655_1775438 Nicotiana tabacum poly(A)-binding protein (P...    38   0.52    
pir|H90083|H90083 polyadenylate-binding protein [imported] - Gui...    38   0.52    Guillardia theta
sp|Q01085|TIAR_HUMAN|TIAR_HUMAN Nucleolysin TIAR (TIA-1 related protein).>p...    38   0.52    Homo sapiens [man]
sp|P45429|RU1A_XENLA|RU1A_XENLA U1 small nuclear ribonucleoprotein A (U1 sn...    38   0.52    Xenopus laevis [clawed frog]
gb:DRU62018_2571346 Danio rerio zHuC mRNA, complete cds.               37   0.68    
gb:BC065965_2554219 Danio rerio ELAV (embryonic lethal, abnormal...    37   0.68    
gb:BC065343_2553961 Danio rerio ELAV (embryonic lethal, abnormal...    37   0.68    
gb:BC046812_2099388 Mus musculus cytotoxic granule-associated RN...    37   0.68    
gb:BC004289_1969145 Homo sapiens RNA binding motif protein 19, m...    37   0.68    
gb:AB014582_1864611 Homo sapiens mRNA for KIAA0682 protein, part...    37   0.68    
pir|T17297|T17297 hypothetical protein DKFZp586F1023.1 - human>g...    37   0.68    Homo sapiens [man]
pir|I50513|I50513 ribonucleoprotein - zebra fish>gb:DRU17602_257...    37   0.68    Danio rerio [leopard danio]
sp|Q9Y4C8|K682_HUMAN|K682_HUMAN Probable RNA-binding protein KIAA0682.            37   0.68    Homo sapiens [man]
gb:BC080020_2561457 Xenopus laevis embryonic poly(A) binding pro...    37   0.89    
gb:BC059527_2552504 Danio rerio hypothetical protein LOC402896, ...    37   0.89    
gb:AF338225_2488347 Xenopus laevis embryonic poly(A) binding pro...    37   0.89    
gb:AB098713_2048260 Rattus norvegicus mRNA for RNA binding prote...    37   0.89    
gb:AP004885_1846610 Oryza sativa (japonica cultivar-group) genom...    37   0.89    
gb:AF349964_1790252 Daucus carota poly(A)-binding protein mRNA, ...    37   0.89    
gb:AE016819_1748942 Ashbya gossypii (= Eremothecium gossypii) AT...    37   0.89    
gb:AE016817_1747224 Ashbya gossypii (= Eremothecium gossypii) AT...    37   0.89    
gb:CR380957_1652799 Candida glabrata strain CBS138 chromosome K ...    37   0.89    
gb:PFA929359_1393564 Plasmodium falciparum strain 3D7, chromosom...    37   0.89    
pir|G84865|G84865 hypothetical protein At2g43410 [imported] - Ar...    37   0.89    Arabidopsis thaliana [mouse-ear cress]
gb:AF176675_2478667 Gallus gallus RNA-binding protein HuD (HuD) ...    37   1.2     
gb:BC048159_2099557 Mus musculus ELAV (embryonic lethal, abnorma...    37   1.2     
gb:AF041341_2051980 Mus musculus RNA binding protein Elavl4 mRNA...    37   1.2     
gb:BC036071_1981828 Homo sapiens ELAV (embryonic lethal, abnorma...    37   1.2     
gb:AL583843_1929040 Human DNA sequence from clone RP11-492I2 on ...    37   1.2     
gb:AL583843_1929039 Human DNA sequence from clone RP11-492I2 on ...    37   1.2     
gb:AL583843_1929038 Human DNA sequence from clone RP11-492I2 on ...    37   1.2     
gb:AL583843_1929037 Human DNA sequence from clone RP11-492I2 on ...    37   1.2     
gb:AL583843_1929036 Human DNA sequence from clone RP11-492I2 on ...    37   1.2     
gb:AL583843_1929035 Human DNA sequence from clone RP11-492I2 on ...    37   1.2     
gb:AY074319_1567476 Arabidopsis thaliana putative DNA binding pr...    37   1.2     
gb:AB025622_1516449 Arabidopsis thaliana genomic DNA, chromosome...    37   1.2     
gb:AK079088_1172583 Mus musculus adult male diencephalon cDNA, R...    37   1.2     
gb:AK014133_1157801 Mus musculus 13 days embryo head cDNA, RIKEN...    37   1.2     
pir|I51678|I51678 ribonucleoprotein - African clawed frog>gb:XLU...    37   1.2     Xenopus laevis [clawed frog]
pir|S59118|S59118 small nuclear ribonucleoprotein U1A [imported]...    37   1.2     Arabidopsis thaliana [mouse-ear cress]
sp|O09032|ELV4_RAT|ELV4_RAT ELAV-like protein 4 (Paraneoplastic encephalo...    37   1.2     Rattus norvegicus [brown rat]
sp|Q61701|ELV4_MOUSE|ELV4_MOUSE ELAV-like protein 4 (Paraneoplastic encepha...    37   1.2     Mus musculus [mouse]
sp|P26378|ELV4_HUMAN|ELV4_HUMAN ELAV-like protein 4 (Paraneoplastic encepha...    37   1.2     Homo sapiens [man]
gb:BC076956_2559695 Xenopus tropicalis MGC89376 protein, mRNA (c...    36   1.5     
gb:AY170627_2516509 Oncorhynchus mykiss RNA-binding protein HU m...    36   1.5     
gb:CR382128_1660845 Yarrowia lipolytica chromosome B of strain C...    36   1.5     
gb:CR382127_1660263 Yarrowia lipolytica chromosome A of strain C...    36   1.5     
gb:AE014185_937605 Plasmodium falciparum 3D7 chromosome 10 compl...    36   1.5     
gb:OSJN00106_1695021 Oryza sativa genomic DNA, chromosome 4, BAC...    36   2.0     
gb:AY118564_1300286 Drosophila melanogaster LD40028 full insert ...    36   2.0     
gb:AE014296_1134835 Drosophila melanogaster chromosome 3L, compl...    36   2.0     
gb:AE014296_1134832 Drosophila melanogaster chromosome 3L, compl...    36   2.0     
gb:OUU35661_1698571 Ophiostoma ulmi colony 1 (col1) gene, comple...    35   2.6     
gb:AY094948_1298122 Drosophila melanogaster RH63980 full insert ...    35   2.6     
gb:AY060995_1292798 Drosophila melanogaster HL01227 full length ...    35   2.6     
gb:AK084514_1174257 Mus musculus 13 days embryo heart cDNA, RIKE...    35   2.6     
gb:AE014296_1134833 Drosophila melanogaster chromosome 3L, compl...    35   2.6     
sp|Q62504|MINT_MOUSE|MINT_MOUSE Msx2-interacting protein (SMART/HDAC1 assoc...    35   2.6     Mus musculus [mouse]
sp|Q96T58|MINT_HUMAN|MINT_HUMAN Msx2-interacting protein (SMART/HDAC1 assoc...    35   2.6     Homo sapiens [man]
gb:BC045039_2548994 Xenopus laevis developmentally regulated RNA...    35   3.4     
gb:HSJ1069P2_2015681 Human DNA sequence from clone RP5-1069P2 on...    35   3.4     
gb:HSJ1069P2_2015680 Human DNA sequence from clone RP5-1069P2 on...    35   3.4     
gb:HSJ1069P2_2015679 Human DNA sequence from clone RP5-1069P2 on...    35   3.4     
gb:HSJ1069P2_2015678 Human DNA sequence from clone RP5-1069P2 on...    35   3.4     
gb:AF474982_1803163 Hordeum vulgare clone BAC 011009, complete s...    35   3.4     
gb:OSJN00052_1693937 Oryza sativa genomic DNA, chromosome 4, BAC...    35   3.4     
gb:CR382123_1655589 Kluyveromyces lactis strain NRRL Y-1140 chro...    35   3.4     
gb:MSSEXPROT_1390234 Megaselia scalaris mRNA for Sex-lethal orth...    35   3.4     
gb:MSSEXNONC_1390233 Megaselia scalaris mRNA for Sex-lethal orth...    35   3.4     
gb:MSMEGSXL2_1390147 Megaselia scalaris mRNA for Sex-lethal orth...    35   3.4     
gb:PFMAL13_1191636 Plasmodium falciparum 3D7 chromosome 13, *** ...    35   3.4     
gb:BX294151_770778 Pirellula sp. strain 1 complete genome; segme...    35   3.4     
pir|B86166|B86166 protein F21B7.8 [imported] - Arabidopsis thali...    35   3.4     Arabidopsis thaliana [mouse-ear cress]
pir|T00912|T00912 ribonucleoprotein homolog F21B7.26 - Arabidops...    35   3.4     Arabidopsis thaliana [mouse-ear cress]
sp|O01671|SXL_MEGSC|SXL_MEGSC Sex-lethal protein homolog.>gb:MSC245662_139...    35   3.4     Megaselia scalaris
gb:BC082875_2562951 Xenopus laevis hypothetical LOC494769, mRNA ...    35   4.4     
gb:BC055511_2551379 Danio rerio splicing factor, arginine/serine...    35   4.4     
gb:HS148E22_1997167 Human DNA sequence from clone RP1-148E22 on ...    35   4.4     
gb:AE016819_1748984 Ashbya gossypii (= Eremothecium gossypii) AT...    35   4.4     
gb:SCNOP77_1708857 S.cerevisiae NOP77 gene for essential nucleol...    35   4.4     
gb:PFMAL13_1191131 Plasmodium falciparum 3D7 chromosome 13, *** ...    35   4.4     
sp|P43332|RU1A_DROME|RU1A_DROME U1 small nuclear ribonucleoprotein A (U1 sn...    35   4.4     Drosophila melanogaster
sp|P37838|NOP4_YEAST|NOP4_YEAST Nucleolar protein NOP4 (Nucleolar protein N...    35   4.4     Saccharomyces cerevisiae [brewer's yeast]
gb:AP005651_1855492 Oryza sativa (japonica cultivar-group) genom...    34   5.8     
gb:AP000419_1820133 Arabidopsis thaliana genomic DNA, chromosome...    34   5.8     
gb:AE017356_1760214 Cryptococcus neoformans var. neoformans JEC2...    34   5.8     
gb:CR382127_1659708 Yarrowia lipolytica chromosome A of strain C...    34   5.8     
gb:BX842625_1643836 Neurospora crassa DNA linkage group I BAC cl...    34   5.8     
gb:AY084821_1569904 Arabidopsis thaliana clone 118696 mRNA, comp...    34   5.8     
gb:AF110846_1242027 Megaselia scalaris sex-lethal homolog (Megsx...    34   5.8     
gb:AF110846_1242026 Megaselia scalaris sex-lethal homolog (Megsx...    34   5.8     
pir|T48696|T48696 mRNA splicing factor srp1 [imported] - fission...    34   5.8     Schizosaccharomyces pombe
pir|G96631|G96631 probable RNA-binding protein F8A5.17 [imported...    34   5.8     
sp|P38760|YHH5_YEAST|YHH5_YEAST Hypothetical 75.9 kDa protein in SPO13-ARG4...    34   5.8     
sp|Q10193|SRP1_SCHPO|SRP1_SCHPO Pre-mRNA splicing factor srp1.>gb:SPBC11C11...    34   5.8     
gb:AP003800_1833546 Oryza sativa (japonica cultivar-group) genom...    34   7.5     
gb:AE017344_1756434 Cryptococcus neoformans var. neoformans JEC2...    34   7.5     
gb:CR382128_1660905 Yarrowia lipolytica chromosome B of strain C...    34   7.5     
gb:BX897675_1644348 Neurospora crassa DNA linkage group IV BAC c...    34   7.5     
gb:AY506544_1610011 Lycopersicon esculentum DNA-binding protein ...    34   7.5     
gb:AY086969_1572007 Arabidopsis thaliana clone 30022 mRNA, compl...    34   7.5     
gb:AX400057_1467370 Sequence 228 from Patent WO0218424.                34   7.5     
pir|A95277|A95277 hypothetical protein SMa0226 [imported] - Sino...    34   7.5     
pir|H86249|H86249 hypothetical protein [imported] - Arabidopsis ...    34   7.5     
sp|O13620|YHI2_SCHPO|YHI2_SCHPO Probable RNA-binding protein P22H7.02c.>gb:...    34   7.5     
gb:BC075558_2558656 Xenopus tropicalis splicing factor, arginine...    33   9.8     
gb:BC042354_2548162 Xenopus laevis similar to splicing factor, a...    33   9.8     
gb:AJ719371_2501558 Gallus gallus mRNA for hypothetical protein,...    33   9.8     
gb:AP001168_1820890 Oryza sativa (japonica cultivar-group) genom...    33   9.8     
gb:AF360217_1791171 Arabidopsis thaliana putative poly(A) bindin...    33   9.8     
gb:AF101056_1768127 Arabidopsis thaliana MEI2 (MEI2) mRNA, compl...    33   9.8     
gb:AF029351_1762411 Nicotiana tabacum putative RNA binding prote...    33   9.8     
gb:AE017350_1758967 Cryptococcus neoformans var. neoformans JEC2...    33   9.8     
gb:NPL292768_1691084 Nicotiana plumbaginifolia partial mRNA for ...    33   9.8     
gb:CR382128_1660841 Yarrowia lipolytica chromosome B of strain C...    33   9.8     
gb:AY579888_1616030 Lycopersicon esculentum AML1 mRNA, complete ...    33   9.8     
gb:U28944_1402636 Caenorhabditis elegans cosmid C18A3, complete ...    33   9.8     
gb:AY094788_1297962 Drosophila melanogaster LD15253 full insert ...    33   9.8     
gb:AF221715_1252479 Drosophila melanogaster split ends long isof...    33   9.8     
gb:AF188205_1249209 Drosophila melanogaster Spen RNP motif prote...    33   9.8     
gb:CR860145_1184233 Pongo pygmaeus mRNA; cDNA DKFZp469K2419 (fro...    33   9.8     
gb:AK018176_1159473 Mus musculus adult male medulla oblongata cD...    33   9.8     
gb:AK013444_1157516 Mus musculus 10, 11 days embryo whole body c...    33   9.8     
gb:AE014134_1126821 Drosophila melanogaster chromosome 2L, compl...    33   9.8     
gb:AE014134_1126820 Drosophila melanogaster chromosome 2L, compl...    33   9.8     
pir|B40040|B40040 alternative splicing factor ASF-2 - human>gb:H...    33   9.8     
pir|A40040|A40040 alternative splicing factor ASF-1 - human>gb:A...    33   9.8     
pir|S26404|S26404 alternative splicing factor ASF - mouse>gb:AK0...    33   9.8     
pir|T01932|T01932 RNA binding protein homolog - common tobacco (...    33   9.8     
pir|T03934|T03934 DNA binding protein ACBF - common tobacco>gb:N...    33   9.8     
pir|C40040|C40040 alternative splicing factor ASF-3 - human>gb:B...    33   9.8     
pir|T00497|T00497 polyadenylate-binding protein At2g23350 [impor...    33   9.8     
sp|Q8SX83|SPEN_DROME|SPEN_DROME Split ends protein.>gb:AE014134_1126819 Dro...    33   9.8     
sp|Q07955|SFR1_HUMAN|SFR1_HUMAN Splicing factor, arginine/serine-rich 1 (pr...    33   9.8     


>gb:AK117402_1815438 Arabidopsis thaliana At3g13700 mRNA for unknown
            protein, complete cds, clone: RAFL16-98-M19.
          Length = 287

 Score =  321 bits (823), Expect = 2e-86
 Identities = 174/294 (59%), Positives = 200/294 (68%), Gaps = 9/294 (3%)
 Frame = -3

Query: 1179 MALHQPYDPYY------RPQPLPIPDYGYTVGNKNERDMIRTLFVSGLPDDVKAREIHNL 1018
            MA HQPYDP+Y       P  LP P         +E   I TLFVSGLP+DVKAREIHNL
Sbjct: 1    MAYHQPYDPFYVYQLHSHPHHLP-PQLPLLA---DEPGAINTLFVSGLPNDVKAREIHNL 56

Query: 1017 FRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNGVKFDPQTGSTLHIEIARS 838
            FRRR GFESCQLKYTGRGDQVVAFATF  H+ A+AA++ LNGVKFDPQTGS LHIE+ARS
Sbjct: 57   FRRRHGFESCQLKYTGRGDQVVAFATFTSHRFALAAMNELNGVKFDPQTGSNLHIELARS 116

Query: 837  NSRRTKRPGSGPYVVIDNRSKSNTDAKGTXXXXXXXXXXXXXXXXXXXXXXXXXXXSXEK 658
            NSRR +RPGSGPYVVIDNR+K  + ++                               E 
Sbjct: 117  NSRRKERPGSGPYVVIDNRNKEISKSQDDQSDEGDSDPDEVQEPGNSDSPKENDTTKSEA 176

Query: 657  SGEKVGDGDNVLAAQSEQIEKI---GDGTHPCSTLFIANLGPNCTEDELRKILSQYPGFN 487
              E     D+   + +  +EK    G G   CSTLFIANLGPNCTEDEL+++LS+YPGF+
Sbjct: 177  DSEP----DSKAPSANGHLEKASEGGSGARACSTLFIANLGPNCTEDELKQLLSRYPGFH 232

Query: 486  TLKVRARGGMPVAFADFEGVEEATQVMNALQGSSLPSSDRGGMHIEYARSKMRK 325
             LK+RARGGMPVAFADFE +E+AT  MN LQG+ L SSDRGGMHIEYARSKMRK
Sbjct: 233  ILKIRARGGMPVAFADFEEIEQATDAMNHLQGNLLSSSDRGGMHIEYARSKMRK 286



>gb:AP004806_1845408 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC
            clone:P0710H01.>gb:AP006554_1862410 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 6, PAC
            clone:P0529C07.
          Length = 300

 Score =  240 bits (612), Expect = 5e-62
 Identities = 137/301 (45%), Positives = 175/301 (58%), Gaps = 21/301 (6%)
 Frame = -3

Query: 1164 PYDPYYRPQPLPIPDYGYTVGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQ 985
            P DPYY   P P PD         +R  + TLFV+GLPDDVK REIHNLF  RPGF+ C 
Sbjct: 11   PGDPYYVYAPHPYPD--------PQRQGVLTLFVAGLPDDVKPREIHNLFSSRPGFDHCL 62

Query: 984  LKYTGRGDQVVAFATFVDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSG 805
            L+YTGRG+QVVAF +FV+HQ+A++A+ +LNG  FDP TG  LHIE+A+S+SR+    G G
Sbjct: 63   LEYTGRGNQVVAFVSFVNHQAALSAMSALNGTVFDPDTGDRLHIELAKSSSRKRHGDG-G 121

Query: 804  PYVVIDNRSK---------------------SNTDAKGTXXXXXXXXXXXXXXXXXXXXX 688
             Y V+D R K                        D  G                      
Sbjct: 122  VYRVVDKRLKRKERAADHENAGDGGNDDDAWGEDDNGGNDGDGGSDEPLDTENDDSDEKN 181

Query: 687  XXXXXXSXEKSGEKVGDGDNVLAAQSEQIEKIGDGTHPCSTLFIANLGPNCTEDELRKIL 508
                  S  + G K   G ++     +Q +K+     PCSTLF+ANLG +CTE+EL+++L
Sbjct: 182  ELPAERSSGQPGLKQHRGQSL---SDDQPDKLSSDIPPCSTLFVANLGHSCTEEELKEVL 238

Query: 507  SQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQGSSLPSSDRGGMHIEYARSKMR 328
            S+ PGF+ LK+R RGGMPVAFADF  +E +T  M+ALQG+ L SSD  G+ IEYARSKMR
Sbjct: 239  SKQPGFHLLKMRRRGGMPVAFADFTDIESSTAAMDALQGTVLASSDADGLQIEYARSKMR 298

Query: 327  K 325
            K
Sbjct: 299  K 299



 Score = 50.8 bits (120), Expect = 6e-05
 Identities = 31/84 (36%), Positives = 42/84 (50%)
 Frame = -3

Query: 1074 TLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLN 895
            TLFV+ L       E+  +  ++PGF    LK   RG   VAFA F D +S+ AA+ +L 
Sbjct: 219  TLFVANLGHSCTEEELKEVLSKQPGFHL--LKMRRRGGMPVAFADFTDIESSTAAMDALQ 276

Query: 894  GVKFDPQTGSTLHIEIARSNSRRT 823
            G          L IE ARS  R++
Sbjct: 277  GTVLASSDADGLQIEYARSKMRKS 300



>gb:AP001307_1821107 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone:MMM17.
          Length = 271

 Score =  219 bits (558), Expect = 1e-55
 Identities = 115/208 (55%), Positives = 139/208 (66%), Gaps = 3/208 (1%)
 Frame = -3

Query: 960 QVVAFATFVDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVVIDNR 781
           QVVAFATF  H+ A+AA++ LNGVKFDPQTGS LHIE+ARSNSRR +RPGSGPYVVIDNR
Sbjct: 51  QVVAFATFTSHRFALAAMNELNGVKFDPQTGSNLHIELARSNSRRKERPGSGPYVVIDNR 110

Query: 780 SKSNTDAKGTXXXXXXXXXXXXXXXXXXXXXXXXXXXSXEKSGEKVGDGDNVLAAQSEQI 601
           +K  + ++                               E   E     D+   + +  +
Sbjct: 111 NKEISKSQDDQSDEGDSDPDEVQEPGNSDSPKENDTTKSEADSEP----DSKAPSANGHL 166

Query: 600 EKI---GDGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEG 430
           EK    G G   CSTLFIANLGPNCTEDEL+++LS+YPGF+ LK+RARGGMPVAFADFE 
Sbjct: 167 EKASEGGSGARACSTLFIANLGPNCTEDELKQLLSRYPGFHILKIRARGGMPVAFADFEE 226

Query: 429 VEEATQVMNALQGSSLPSSDRGGMHIEY 346
           +E+AT  MN LQG+ L SSDRGGMHI+Y
Sbjct: 227 IEQATDAMNHLQGNLLSSSDRGGMHIDY 254



 Score = 39.7 bits (91), Expect = 0.14
 Identities = 25/75 (33%), Positives = 35/75 (46%)
 Frame = -3

Query: 1074 TLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLN 895
            TLF++ L  +    E+  L  R PGF    LK   RG   VAFA F + + A  A++ L 
Sbjct: 181  TLFIANLGPNCTEDELKQLLSRYPGFHI--LKIRARGGMPVAFADFEEIEQATDAMNHLQ 238

Query: 894  GVKFDPQTGSTLHIE 850
            G          +HI+
Sbjct: 239  GNLLSSSDRGGMHID 253



>gb:AY219128_1590335 Arabidopsis thaliana hypothetical protein
            (At2g42245/T24P15.1) mRNA, complete cds.
          Length = 277

 Score =  156 bits (394), Expect = 1e-36
 Identities = 97/255 (38%), Positives = 139/255 (54%), Gaps = 2/255 (0%)
 Frame = -3

Query: 1089 RDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAA 910
            RD +RTLFV+GLP+DVK REI+NLFR  PG+E+  L+ +  G +  AFA F D QSA+A 
Sbjct: 31   RDEVRTLFVAGLPEDVKPREIYNLFREFPGYETSHLR-SSDGAKPFAFAVFSDLQSAVAV 89

Query: 909  LHSLNGVKFDPQTGSTLHIEIARSNSR-RTKRPGSGPYVVIDNRSKSNTDAKGTXXXXXX 733
            +H+LNG+ FD +  STLHI++A+SN + +  R   G   +   +S + T   G       
Sbjct: 90   MHALNGMVFDLEKHSTLHIDLAKSNPKSKRSRTDDGWESLKKLKSWNTTTESGFGSFQTP 149

Query: 732  XXXXXXXXXXXXXXXXXXXXXSXEKSGEKVGDGDNVLAAQSEQIEKIGDGTHPCSTLFIA 553
                                            G   +A ++    K      PC TLFIA
Sbjct: 150  GMSSSAYNTIGYSPAQ--------------SQGIANVAGRAPTSRKPSKAADPCPTLFIA 195

Query: 552  NLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQGSSLPSS 373
            N+GPNCTE EL ++ S+  GF  LK++   G PVAF DF+ V  +++ ++ LQG+ L SS
Sbjct: 196  NMGPNCTEAELIQVFSRCRGFLKLKIQGTYGTPVAFVDFQDVSCSSEALHTLQGTVLYSS 255

Query: 372  DRGG-MHIEYARSKM 331
              G  + ++YARS+M
Sbjct: 256  LTGEVLRLQYARSRM 270



 Score = 42.4 bits (98), Expect = 0.021
 Identities = 30/91 (32%), Positives = 43/91 (47%), Gaps = 1/91 (1%)
 Frame = -3

Query: 1086 DMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAAL 907
            D   TLF++ +  +    E+  +F R  GF   +LK  G     VAF  F D   +  AL
Sbjct: 187  DPCPTLFIANMGPNCTEAELIQVFSRCRGF--LKLKIQGTYGTPVAFVDFQDVSCSSEAL 244

Query: 906  HSLNG-VKFDPQTGSTLHIEIARSNSRRTKR 817
            H+L G V +   TG  L ++ ARS     K+
Sbjct: 245  HTLQGTVLYSSLTGEVLRLQYARSRMGMRKK 275



>gb:AY219130_1590337 Arabidopsis thaliana hypothetical protein
            (At2g42245/T24P15.1) mRNA, complete cds.
          Length = 287

 Score =  149 bits (375), Expect = 2e-34
 Identities = 92/243 (37%), Positives = 130/243 (53%), Gaps = 1/243 (0%)
 Frame = -3

Query: 1089 RDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAA 910
            RD +RTLFV+GLP+DVK REI+NLFR  PG+E+  L+ +  G +  AFA F D QSA+A 
Sbjct: 31   RDEVRTLFVAGLPEDVKPREIYNLFREFPGYETSHLR-SSDGAKPFAFAVFSDLQSAVAV 89

Query: 909  LHSLNGVKFDPQTGSTLHIEIARSNSR-RTKRPGSGPYVVIDNRSKSNTDAKGTXXXXXX 733
            +H+LNG+ FD +  STLHI++A+SN + +  R   G   +   +S + T   G       
Sbjct: 90   MHALNGMVFDLEKHSTLHIDLAKSNPKSKRSRTDDGWESLKKLKSWNTTTESGFGSFQTP 149

Query: 732  XXXXXXXXXXXXXXXXXXXXXSXEKSGEKVGDGDNVLAAQSEQIEKIGDGTHPCSTLFIA 553
                                            G   +A ++    K      PC TLFIA
Sbjct: 150  GMSSSAYNTIGYSPAQ--------------SQGIANVAGRAPTSRKPSKAADPCPTLFIA 195

Query: 552  NLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQGSSLPSS 373
            N+GPNCTE EL ++ S+  GF  LK++   G PVAF DF+ V  +++ ++ LQG+ L SS
Sbjct: 196  NMGPNCTEAELIQVFSRCRGFLKLKIQGTYGTPVAFVDFQDVSCSSEALHTLQGTVLYSS 255

Query: 372  DRG 364
              G
Sbjct: 256  LTG 258



 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 1/78 (1%)
 Frame = -3

Query: 567 TLFIANLGPNCTEDELRKILSQYPGFNTLKVRAR-GGMPVAFADFEGVEEATQVMNALQG 391
           TLF+A L  +    E+  +  ++PG+ T  +R+  G  P AFA F  ++ A  VM+AL G
Sbjct: 36  TLFVAGLPEDVKPREIYNLFREFPGYETSHLRSSDGAKPFAFAVFSDLQSAVAVMHALNG 95

Query: 390 SSLPSSDRGGMHIEYARS 337
                     +HI+ A+S
Sbjct: 96  MVFDLEKHSTLHIDLAKS 113



 Score = 37.0 bits (84), Expect = 0.89
 Identities = 26/80 (32%), Positives = 38/80 (47%), Gaps = 1/80 (1%)
 Frame = -3

Query: 1086 DMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAAL 907
            D   TLF++ +  +    E+  +F R  GF   +LK  G     VAF  F D   +  AL
Sbjct: 187  DPCPTLFIANMGPNCTEAELIQVFSRCRGF--LKLKIQGTYGTPVAFVDFQDVSCSSEAL 244

Query: 906  HSLNG-VKFDPQTGSTLHIE 850
            H+L G V +   TG  L ++
Sbjct: 245  HTLQGTVLYSSLTGEVLRLQ 264



>gb:AP005395_1851053 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC clone:P0623A10.
          Length = 219

 Score =  101 bits (252), Expect = 3e-20
 Identities = 51/115 (44%), Positives = 71/115 (61%), Gaps = 1/115 (0%)
 Frame = -3

Query: 1170 HQPYDPYYRPQPLPIPDY-GYTVGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFE 994
            H  Y P+  P P  +  Y  +       RD +RTLF++GLP D KARE++NLFR  PG+ 
Sbjct: 37   HHAYPPHPPPPPAYVGAYYDHAAEPLPPRDELRTLFIAGLPGDAKAREVYNLFRDFPGYV 96

Query: 993  SCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNSR 829
            S  L+ +G+  Q  AFA F D  SA+AA+ + NG  FD +   TLH+++A+SNSR
Sbjct: 97   SSHLRTSGKSSQAYAFAVFADQPSALAAMSATNGRIFDLENNCTLHVDLAKSNSR 151



 Score = 36.2 bits (82), Expect = 1.5
 Identities = 22/82 (26%), Positives = 36/82 (43%), Gaps = 2/82 (2%)
 Frame = -3

Query: 567 TLFIANLGPNCTEDELRKILSQYPGF--NTLKVRARGGMPVAFADFEGVEEATQVMNALQ 394
           TLFIA L  +    E+  +   +PG+  + L+   +     AFA F     A   M+A  
Sbjct: 70  TLFIAGLPGDAKAREVYNLFRDFPGYVSSHLRTSGKSSQAYAFAVFADQPSALAAMSATN 129

Query: 393 GSSLPSSDRGGMHIEYARSKMR 328
           G      +   +H++ A+S  R
Sbjct: 130 GRIFDLENNCTLHVDLAKSNSR 151



>pir|T00933|T00933 RNA-binding protein homolog At2g42240 - Arabidopsis
            thaliana>gb:AC002561_1530897 Arabidopsis thaliana
            chromosome 2 BAC T24P15 genomic sequence, complete
            sequence.
          Length = 158

 Score =  100 bits (250), Expect = 5e-20
 Identities = 54/106 (50%), Positives = 74/106 (69%)
 Frame = -3

Query: 1089 RDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAA 910
            RD +RTLFV+GLP+DVK REI+NLFR  PG+E+  L+ +  G +  AFA F D QSA+A 
Sbjct: 31   RDEVRTLFVAGLPEDVKPREIYNLFREFPGYETSHLR-SSDGAKPFAFAVFSDLQSAVAV 89

Query: 909  LHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVVIDNRSKS 772
            +H+LNG+ FD +  STLHI++A+SN  ++KR  +G Y      S S
Sbjct: 90   MHALNGMVFDLEKHSTLHIDLAKSNP-KSKRSRTGKYFQTPGMSSS 134



 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 1/78 (1%)
 Frame = -3

Query: 567 TLFIANLGPNCTEDELRKILSQYPGFNTLKVRAR-GGMPVAFADFEGVEEATQVMNALQG 391
           TLF+A L  +    E+  +  ++PG+ T  +R+  G  P AFA F  ++ A  VM+AL G
Sbjct: 36  TLFVAGLPEDVKPREIYNLFREFPGYETSHLRSSDGAKPFAFAVFSDLQSAVAVMHALNG 95

Query: 390 SSLPSSDRGGMHIEYARS 337
                     +HI+ A+S
Sbjct: 96  MVFDLEKHSTLHIDLAKS 113



>gb:AY219129_1590336 Arabidopsis thaliana hypothetical protein
            (At2g42245/T24P15.1) mRNA, complete cds.
          Length = 204

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 48/87 (55%), Positives = 65/87 (74%)
 Frame = -3

Query: 1089 RDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAA 910
            RD +RTLFV+GLP+DVK REI NLFR  PG+E+  L+ +  G +  AFA F D QSA+A 
Sbjct: 31   RDEVRTLFVAGLPEDVKPREIXNLFREFPGYETSHLR-SSDGAKPFAFAVFSDLQSAVAV 89

Query: 909  LHSLNGVKFDPQTGSTLHIEIARSNSR 829
            +H+LNG+ FD +  STLHI++A+SN +
Sbjct: 90   MHALNGMVFDLEKHSTLHIDLAKSNPK 116



 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 1/78 (1%)
 Frame = -3

Query: 567 TLFIANLGPNCTEDELRKILSQYPGFNTLKVRAR-GGMPVAFADFEGVEEATQVMNALQG 391
           TLF+A L  +    E+  +  ++PG+ T  +R+  G  P AFA F  ++ A  VM+AL G
Sbjct: 36  TLFVAGLPEDVKPREIXNLFREFPGYETSHLRSSDGAKPFAFAVFSDLQSAVAVMHALNG 95

Query: 390 SSLPSSDRGGMHIEYARS 337
                     +HI+ A+S
Sbjct: 96  MVFDLEKHSTLHIDLAKS 113



>sp|Q9W6I1|RBMS_CHICK RNA-binding protein with multiple splicing
            homolog (RBP-MS) (HEart, RRM Expressed Sequence)
            (Hermes).>gb:AF129933_2475671 Gallus gallus RRM-type
            RNA-binding protein hermes mRNA, complete cds.
          Length = 200

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 44/101 (43%), Positives = 63/101 (62%)
 Frame = -3

Query: 1122 DYGYTVGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFA 943
            D  +T G  N  + +RTLFVSGLP D+K RE++ LFR   G+E   +K T +  Q V F 
Sbjct: 7    DTEHTNGGGNVEEEVRTLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTSK--QPVGFV 64

Query: 942  TFVDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNSRRTK 820
            TF     A AA ++LNG++FDP+   TL +E A++N++  K
Sbjct: 65   TFDSRAGAEAAKNALNGIRFDPENPQTLRLEFAKANTKMAK 105



 Score = 33.5 bits (75), Expect = 9.8
 Identities = 18/80 (22%), Positives = 34/80 (42%)
 Frame = -3

Query: 567 TLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQGS 388
           TLF++ L  +    EL  +   + G+    ++     PV F  F+    A    NAL G 
Sbjct: 23  TLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTSKQPVGFVTFDSRAGAEAAKNALNGI 82

Query: 387 SLPSSDRGGMHIEYARSKMR 328
                +   + +E+A++  +
Sbjct: 83  RFDPENPQTLRLEFAKANTK 102



>gb:BC081153_2562056 Xenopus laevis MGC84222 protein, mRNA (cDNA clone
            MGC:84222 IMAGE:6955186), complete cds.
          Length = 197

 Score = 83.6 bits (205), Expect = 8e-15
 Identities = 42/94 (44%), Positives = 61/94 (64%)
 Frame = -3

Query: 1101 NKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQS 922
            N N  + +RTLFVSGLP D+K RE++ LFR   G+E   +K T +  Q V F TF +   
Sbjct: 12   NNNIEEEVRTLFVSGLPIDIKPRELYLLFRPFKGYEGSLIKLTSK--QPVGFVTFDNRAG 69

Query: 921  AMAALHSLNGVKFDPQTGSTLHIEIARSNSRRTK 820
            A AA ++LNG++FDP+   TL +E A++N++  K
Sbjct: 70   AEAAKNALNGIRFDPENPQTLRLEFAKANTKMAK 103



>sp|Q9YGP5|RBMS_XENLA RNA-binding protein with multiple splicing
            homolog (RBP-MS) (HEart, RRM Expressed Sequence)
            (Hermes).>gb:AF107889_2473972 Xenopus laevis RRM-type
            RNA-binding protein hermes mRNA, complete cds.
          Length = 196

 Score = 83.6 bits (205), Expect = 8e-15
 Identities = 42/94 (44%), Positives = 61/94 (64%)
 Frame = -3

Query: 1101 NKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQS 922
            N N  + +RTLFVSGLP D+K RE++ LFR   G+E   +K T +  Q V F TF +   
Sbjct: 12   NNNIEEEVRTLFVSGLPIDIKPRELYLLFRPFKGYEGSLIKLTSK--QPVGFVTFDNRAG 69

Query: 921  AMAALHSLNGVKFDPQTGSTLHIEIARSNSRRTK 820
            A AA ++LNG++FDP+   TL +E A++N++  K
Sbjct: 70   AEAAKNALNGIRFDPENPQTLRLEFAKANTKMAK 103



>gb:CERNAMEC8_1366927 C.elegans mRNA for Mec-8 protein.
          Length = 312

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 38/84 (45%), Positives = 55/84 (65%)
 Frame = -3

Query: 582 THPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMN 403
           T  CSTLF+ANL     ED LR +   + GF  L++  + G  VAF ++  +++ATQ M 
Sbjct: 224 TSACSTLFVANLSAEVNEDTLRGVFKAFSGFTRLRLHNKNGSCVAFVEYSDLQKATQAMI 283

Query: 402 ALQGSSLPSSDRGGMHIEYARSKM 331
           +LQG  + ++DRGG+ IEYAR+KM
Sbjct: 284 SLQGFQITANDRGGLRIEYARNKM 307



 Score = 77.4 bits (189), Expect = 6e-13
 Identities = 43/96 (44%), Positives = 56/96 (58%), Gaps = 3/96 (3%)
 Frame = -3

Query: 1080 IRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYT---GRGDQVVAFATFVDHQSAMAA 910
            +RTLFVSGLP D K RE++ LFR   G+E   LK T   G+    V F TF+  Q A  A
Sbjct: 30   VRTLFVSGLPMDAKPRELYLLFRGCRGYEGALLKMTSKNGKPTSPVGFVTFLSQQDAQDA 89

Query: 909  LHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGP 802
               L GV+FDP+    L +E+A+SN+ +  RP   P
Sbjct: 90   RKMLQGVRFDPECAQVLRLELAKSNT-KVARPKQSP 124



>pir|T19360|T19360 hypothetical protein F46A9.6 - Caenorhabditis
           elegans>gb:CEC17E4_1360540 Caenorhabditis elegans cosmid
           C17E4, complete sequence.>gb:CEDNAMEC8_1361830 C.elegans
           mec-8 gene.>gb:CEF46A9_1363985 Caenorhabditis elegans
           cosmid F46A9, complete sequence.
          Length = 312

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 38/84 (45%), Positives = 55/84 (65%)
 Frame = -3

Query: 582 THPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMN 403
           T  CSTLF+ANL     ED LR +   + GF  L++  + G  VAF ++  +++ATQ M 
Sbjct: 224 TSACSTLFVANLSAEVNEDTLRGVFKAFSGFTRLRLHNKNGSCVAFVEYSDLQKATQAMI 283

Query: 402 ALQGSSLPSSDRGGMHIEYARSKM 331
           +LQG  + ++DRGG+ IEYAR+KM
Sbjct: 284 SLQGFQITANDRGGLRIEYARNKM 307



 Score = 77.4 bits (189), Expect = 6e-13
 Identities = 43/96 (44%), Positives = 56/96 (58%), Gaps = 3/96 (3%)
 Frame = -3

Query: 1080 IRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYT---GRGDQVVAFATFVDHQSAMAA 910
            +RTLFVSGLP D K RE++ LFR   G+E   LK T   G+    V F TF+  Q A  A
Sbjct: 30   VRTLFVSGLPMDAKPRELYLLFRGCRGYEGALLKMTSKNGKPTSPVGFVTFLSQQDAQDA 89

Query: 909  LHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGP 802
               L GV+FDP+    L +E+A+SN+ +  RP   P
Sbjct: 90   RKMLQGVRFDPECAQVLRLELAKSNT-KVARPKQSP 124



>gb:AB080736_2463617 Danio rerio hermes mRNA for RNA binding protein,
            complete cds.>gb:BC048876_2550051 Danio rerio zgc:55559,
            mRNA (cDNA clone MGC:55559 IMAGE:2642817), complete
            cds.>gb:BC066414_2554304 Danio rerio zgc:55559, mRNA
            (cDNA clone MGC:77170 IMAGE:6961581), complete cds.
          Length = 200

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 42/94 (44%), Positives = 60/94 (63%)
 Frame = -3

Query: 1101 NKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQS 922
            N +  + +RTLFVSGLP D+K RE++ LFR   G+E   +K T +  Q V F TF     
Sbjct: 12   NVSLEEEVRTLFVSGLPTDIKPRELYLLFRPFKGYEGSLIKLTSK--QPVGFVTFDSRSG 69

Query: 921  AMAALHSLNGVKFDPQTGSTLHIEIARSNSRRTK 820
            A AA ++LNGV+FDP+   TL +E A++N++  K
Sbjct: 70   AEAAKNALNGVRFDPENPQTLRLEFAKANTKMAK 103



 Score = 34.3 bits (77), Expect = 5.8
 Identities = 18/80 (22%), Positives = 34/80 (42%)
 Frame = -3

Query: 567 TLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQGS 388
           TLF++ L  +    EL  +   + G+    ++     PV F  F+    A    NAL G 
Sbjct: 21  TLFVSGLPTDIKPRELYLLFRPFKGYEGSLIKLTSKQPVGFVTFDSRSGAEAAKNALNGV 80

Query: 387 SLPSSDRGGMHIEYARSKMR 328
                +   + +E+A++  +
Sbjct: 81  RFDPENPQTLRLEFAKANTK 100



>gb:BC076171_2559044 Danio rerio zgc:92689, mRNA (cDNA clone MGC:92689
            IMAGE:7074425), complete cds.
          Length = 199

 Score = 80.5 bits (197), Expect = 7e-14
 Identities = 40/87 (45%), Positives = 58/87 (66%)
 Frame = -3

Query: 1080 IRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHS 901
            +RTLFVSGLP D+K RE++ LFR   G+E   +K T +  Q V F TF     A AA ++
Sbjct: 19   VRTLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTSK--QPVGFVTFDSRSGAEAAKNA 76

Query: 900  LNGVKFDPQTGSTLHIEIARSNSRRTK 820
            LNG++FDP++  TL +E A++N++  K
Sbjct: 77   LNGIRFDPESPQTLRLEFAKANTKMAK 103



 Score = 33.5 bits (75), Expect = 9.8
 Identities = 18/80 (22%), Positives = 33/80 (41%)
 Frame = -3

Query: 567 TLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQGS 388
           TLF++ L  +    EL  +   + G+    ++     PV F  F+    A    NAL G 
Sbjct: 21  TLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTSKQPVGFVTFDSRSGAEAAKNALNGI 80

Query: 387 SLPSSDRGGMHIEYARSKMR 328
                    + +E+A++  +
Sbjct: 81  RFDPESPQTLRLEFAKANTK 100



>gb:AP005495_1852862 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC
            clone:OSJNBb0003H03.>gb:AP005799_1858000 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 8, BAC
            clone:OSJNBa0012K14.
          Length = 315

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 39/84 (46%), Positives = 56/84 (66%)
 Frame = -3

Query: 1086 DMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAAL 907
            D +RT+F++GLP DVK RE+HNL R  PGFE+ Q+ +  +GDQ + FA F     A+AA 
Sbjct: 59   DEVRTIFITGLPTDVKERELHNLLRWLPGFEASQINF--KGDQPMGFALFSSAHHAIAAK 116

Query: 906  HSLNGVKFDPQTGSTLHIEIARSN 835
             +L  + FD +T + LH E+A+ N
Sbjct: 117  AALQDLIFDAETKTALHTEMAKKN 140



 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 37/77 (48%), Positives = 49/77 (63%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNAL 397
           PC+TLFI NLG    E+ELR + S  PG+  +KV  +    V F +FE V  A+ V + L
Sbjct: 234 PCNTLFIGNLGETVIEEELRSLFSVQPGYKQMKVLRQDRNTVCFIEFEDVNAASAVHHNL 293

Query: 396 QGSSLPSSDRGGMHIEY 346
           QG+ +PSS RGGM I+Y
Sbjct: 294 QGAVIPSSGRGGMRIQY 310



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 27/84 (32%), Positives = 40/84 (47%)
 Frame = -3

Query: 1143 PQPLPIPDYGYTVGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRG 964
            P P+P P     V N  +     TLF+  L + V   E+ +LF  +PG++  Q+K   + 
Sbjct: 214  PSPVPGPTAYAPVQNTKDNPPCNTLFIGNLGETVIEEELRSLFSVQPGYK--QMKVLRQD 271

Query: 963  DQVVAFATFVDHQSAMAALHSLNG 892
               V F  F D  +A A  H+L G
Sbjct: 272  RNTVCFIEFEDVNAASAVHHNLQG 295



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 23/79 (29%), Positives = 35/79 (44%)
 Frame = -3

Query: 567 TLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQGS 388
           T+FI  L  +  E EL  +L   PGF   ++  +G  P+ FA F     A     ALQ  
Sbjct: 63  TIFITGLPTDVKERELHNLLRWLPGFEASQINFKGDQPMGFALFSSAHHAIAAKAALQDL 122

Query: 387 SLPSSDRGGMHIEYARSKM 331
              +  +  +H E A+  +
Sbjct: 123 IFDAETKTALHTEMAKKNL 141



>sp|Q9WVB0|RBMS_MOUSE RNA-binding protein with multiple splicing
            (RBP-MS) (HEart, RRM Expressed Sequence)
            (Hermes).>gb:AF148511_2056657 Mus musculus hermes mRNA,
            complete cds.
          Length = 197

 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 40/91 (43%), Positives = 59/91 (64%)
 Frame = -3

Query: 1092 ERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMA 913
            + + +RTLFVSGLP D+K RE++ LFR   G+E   +K T +  Q V F +F     A A
Sbjct: 19   QEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSK--QPVGFVSFDSRSEAEA 76

Query: 912  ALHSLNGVKFDPQTGSTLHIEIARSNSRRTK 820
            A ++LNG++FDP+   TL IE A++N++  K
Sbjct: 77   AKNALNGIRFDPEIPQTLRIEFAKANTKMAK 107



 Score = 35.8 bits (81), Expect = 2.0
 Identities = 20/80 (25%), Positives = 34/80 (42%)
 Frame = -3

Query: 567 TLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQGS 388
           TLF++ L  +    EL  +   + G+    ++     PV F  F+   EA    NAL G 
Sbjct: 25  TLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGI 84

Query: 387 SLPSSDRGGMHIEYARSKMR 328
                    + IE+A++  +
Sbjct: 85  RFDPEIPQTLRIEFAKANTK 104



>gb:AY143892_1583349 Arabidopsis thaliana At3g21211/At3g21211 mRNA,
           complete cds.>gb:AF361632_1791378 Arabidopsis thaliana
           At3g21211 mRNA, complete cds.>gb:AK118175_1816167
           Arabidopsis thaliana At3g21215 mRNA for unknown protein,
           complete cds, clone: RAFL19-49-E06.
          Length = 339

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 39/84 (46%), Positives = 53/84 (63%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNAL 397
           PC+TLFI NLG N  E+ELR +LS  PGF  +K+  +    V F +FE V  AT V + L
Sbjct: 231 PCNTLFIGNLGENINEEELRSLLSAQPGFKQMKILRQERHTVCFIEFEDVNSATNVHHNL 290

Query: 396 QGSSLPSSDRGGMHIEYARSKMRK 325
           QG+ +PSS   GM I+Y+++   K
Sbjct: 291 QGAVIPSSGSIGMRIQYSKNPYGK 314



 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 43/112 (38%), Positives = 69/112 (61%), Gaps = 2/112 (1%)
 Frame = -3

Query: 1164 PYDP--YYRPQPLPIPDYGYTVGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFES 991
            P+ P  ++ P P P+    +   N+   D +RT+F++GLPDDVK RE+ NL R  PG+E+
Sbjct: 31   PHPPPIHHHPPPPPVLVDNH---NRPPYDELRTIFIAGLPDDVKERELLNLLRWLPGYEA 87

Query: 990  CQLKYTGRGDQVVAFATFVDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSN 835
             Q+ +  +G++ + FA F   Q AMAA  +L  + FD ++ S +H E+A+ N
Sbjct: 88   SQVNF--KGEKPMGFALFSTAQFAMAAKDTLQHMVFDAESKSVIHTEMAKKN 137



 Score = 51.2 bits (121), Expect = 5e-05
 Identities = 39/132 (29%), Positives = 56/132 (42%), Gaps = 10/132 (7%)
 Frame = -3

Query: 1164 PYDPYY----------RPQPLPIPDYGYTVGNKNERDMIRTLFVSGLPDDVKAREIHNLF 1015
            PYDPY            P P+  P     V N  +     TLF+  L +++   E+ +L 
Sbjct: 194  PYDPYAGYHAPPVPMPTPPPIAAPSSYVPVQNIKDNPPCNTLFIGNLGENINEEELRSLL 253

Query: 1014 RRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSN 835
              +PGF+  Q+K   +    V F  F D  SA    H+L G    P +GS + + I  S 
Sbjct: 254  SAQPGFK--QMKILRQERHTVCFIEFEDVNSATNVHHNLQGAVI-PSSGS-IGMRIQYSK 309

Query: 834  SRRTKRPGSGPY 799
            +   KR   G Y
Sbjct: 310  NPYGKRKEGGGY 321



 Score = 42.0 bits (97), Expect = 0.028
 Identities = 23/79 (29%), Positives = 37/79 (46%)
 Frame = -3

Query: 567 TLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQGS 388
           T+FIA L  +  E EL  +L   PG+   +V  +G  P+ FA F   + A    + LQ  
Sbjct: 60  TIFIAGLPDDVKERELLNLLRWLPGYEASQVNFKGEKPMGFALFSTAQFAMAAKDTLQHM 119

Query: 387 SLPSSDRGGMHIEYARSKM 331
              +  +  +H E A+  +
Sbjct: 120 VFDAESKSVIHTEMAKKNL 138



>gb:BC021788_2093636 Mus musculus RNA binding protein with multiple
            splicing 2, mRNA (cDNA clone MGC:28665 IMAGE:4236661),
            complete cds.>gb:BC083941_2563354 Xenopus laevis
            hypothetical LOC494878, mRNA (cDNA clone MGC:97929
            IMAGE:7197365), complete cds.
          Length = 206

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 40/87 (45%), Positives = 56/87 (64%)
 Frame = -3

Query: 1080 IRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHS 901
            +RTLFVSGLP D+K RE++ LFR   G+E   +K T R  Q V F  F     A AA ++
Sbjct: 24   VRTLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTSR--QPVGFVIFDSRAGAEAAKNA 81

Query: 900  LNGVKFDPQTGSTLHIEIARSNSRRTK 820
            LNG++FDP+   TL +E A++N++  K
Sbjct: 82   LNGIRFDPENPQTLRLEFAKANTKMAK 108



>gb:D84108_1995009 Homo sapiens mRNA for RBP-MS/type 2, complete cds.
          Length = 204

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 39/91 (42%), Positives = 59/91 (64%)
 Frame = -3

Query: 1092 ERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMA 913
            + + +RTLFVSGLP D+K RE++ LFR   G+E   +K T +  Q V F +F     A A
Sbjct: 19   QEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSK--QPVGFVSFDSRSEAEA 76

Query: 912  ALHSLNGVKFDPQTGSTLHIEIARSNSRRTK 820
            A ++LNG++FDP+   TL +E A++N++  K
Sbjct: 77   AKNALNGIRFDPEIPQTLRLEFAKANTKMAK 107



 Score = 35.0 bits (79), Expect = 3.4
 Identities = 19/80 (23%), Positives = 34/80 (42%)
 Frame = -3

Query: 567 TLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQGS 388
           TLF++ L  +    EL  +   + G+    ++     PV F  F+   EA    NAL G 
Sbjct: 25  TLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGI 84

Query: 387 SLPSSDRGGMHIEYARSKMR 328
                    + +E+A++  +
Sbjct: 85  RFDPEIPQTLRLEFAKANTK 104



>gb:BC003608_1968920 Homo sapiens RNA binding protein with multiple
            splicing, transcript variant 3, mRNA (cDNA clone MGC:1257
            IMAGE:3505124), complete cds.>gb:D84109_1995010 Homo
            sapiens mRNA for RBP-MS/type 3, complete cds.
          Length = 219

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 39/91 (42%), Positives = 59/91 (64%)
 Frame = -3

Query: 1092 ERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMA 913
            + + +RTLFVSGLP D+K RE++ LFR   G+E   +K T +  Q V F +F     A A
Sbjct: 19   QEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSK--QPVGFVSFDSRSEAEA 76

Query: 912  ALHSLNGVKFDPQTGSTLHIEIARSNSRRTK 820
            A ++LNG++FDP+   TL +E A++N++  K
Sbjct: 77   AKNALNGIRFDPEIPQTLRLEFAKANTKMAK 107



 Score = 35.0 bits (79), Expect = 3.4
 Identities = 19/80 (23%), Positives = 34/80 (42%)
 Frame = -3

Query: 567 TLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQGS 388
           TLF++ L  +    EL  +   + G+    ++     PV F  F+   EA    NAL G 
Sbjct: 25  TLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGI 84

Query: 387 SLPSSDRGGMHIEYARSKMR 328
                    + +E+A++  +
Sbjct: 85  RFDPEIPQTLRLEFAKANTK 104



>gb:AK127873_1916940 Homo sapiens cDNA FLJ45977 fis, clone
            PROST2002078, moderately similar to RNA-binding protein
            with multiple splicing.>gb:AY369207_1948165 Homo sapiens
            RNA-binding protein with multiple splicing 2 (RBPMS2)
            mRNA, complete cds.
          Length = 209

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 40/87 (45%), Positives = 56/87 (64%)
 Frame = -3

Query: 1080 IRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHS 901
            +RTLFVSGLP D+K RE++ LFR   G+E   +K T R  Q V F  F     A AA ++
Sbjct: 30   VRTLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTAR--QPVGFVIFDSRAGAEAAKNA 87

Query: 900  LNGVKFDPQTGSTLHIEIARSNSRRTK 820
            LNG++FDP+   TL +E A++N++  K
Sbjct: 88   LNGIRFDPENPQTLRLEFAKANTKMAK 114



>gb:AK079238_1172636 Mus musculus adult male urinary bladder cDNA,
            RIKEN full-length enriched library, clone:9530046L18
            product:RNA binding protein gene with multiple splicing,
            full insert sequence.
          Length = 170

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 39/91 (42%), Positives = 59/91 (64%)
 Frame = -3

Query: 1092 ERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMA 913
            + + +RTLFVSGLP D+K RE++ LFR   G+E   +K T +  Q V F +F     A A
Sbjct: 19   QEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSK--QPVGFVSFDSRSEAEA 76

Query: 912  ALHSLNGVKFDPQTGSTLHIEIARSNSRRTK 820
            A ++LNG++FDP+   TL +E A++N++  K
Sbjct: 77   AKNALNGIRFDPEIPQTLRLEFAKANTKMAK 107



 Score = 35.0 bits (79), Expect = 3.4
 Identities = 19/80 (23%), Positives = 34/80 (42%)
 Frame = -3

Query: 567 TLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQGS 388
           TLF++ L  +    EL  +   + G+    ++     PV F  F+   EA    NAL G 
Sbjct: 25  TLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGI 84

Query: 387 SLPSSDRGGMHIEYARSKMR 328
                    + +E+A++  +
Sbjct: 85  RFDPEIPQTLRLEFAKANTK 104



>gb:AK041118_1165872 Mus musculus adult male aorta and vein cDNA,
            RIKEN full-length enriched library, clone:A530083O20
            product:RNA binding protein gene with multiple splicing,
            full insert sequence.>gb:BC011288_2091357 Mus musculus
            cDNA clone MGC:18922 IMAGE:3586451, complete
            cds.>gb:BC030397_2096783 Mus musculus RNA binding protein
            gene with multiple splicing, mRNA (cDNA clone MGC:40656
            IMAGE:4225078), complete cds.
          Length = 197

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 39/91 (42%), Positives = 59/91 (64%)
 Frame = -3

Query: 1092 ERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMA 913
            + + +RTLFVSGLP D+K RE++ LFR   G+E   +K T +  Q V F +F     A A
Sbjct: 19   QEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSK--QPVGFVSFDSRSEAEA 76

Query: 912  ALHSLNGVKFDPQTGSTLHIEIARSNSRRTK 820
            A ++LNG++FDP+   TL +E A++N++  K
Sbjct: 77   AKNALNGIRFDPEIPQTLRLEFAKANTKMAK 107



 Score = 35.0 bits (79), Expect = 3.4
 Identities = 19/80 (23%), Positives = 34/80 (42%)
 Frame = -3

Query: 567 TLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQGS 388
           TLF++ L  +    EL  +   + G+    ++     PV F  F+   EA    NAL G 
Sbjct: 25  TLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGI 84

Query: 387 SLPSSDRGGMHIEYARSKMR 328
                    + +E+A++  +
Sbjct: 85  RFDPEIPQTLRLEFAKANTK 104



>gb:AK012265_1156863 Mus musculus 11 days embryo whole body cDNA,
            RIKEN full-length enriched library, clone:2700019M19
            product:RNA binding protein gene with multiple splicing,
            full insert sequence.>gb:AK012586_1157044 Mus musculus 11
            days embryo whole body cDNA, RIKEN full-length enriched
            library, clone:2700088L14 product:RNA binding protein
            gene with multiple splicing, full insert
            sequence.>gb:BC086081_2564672 Xenopus laevis hypothetical
            LOC495607, mRNA (cDNA clone MGC:98455 IMAGE:7198155),
            complete cds.
          Length = 220

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 39/91 (42%), Positives = 59/91 (64%)
 Frame = -3

Query: 1092 ERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMA 913
            + + +RTLFVSGLP D+K RE++ LFR   G+E   +K T +  Q V F +F     A A
Sbjct: 19   QEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSK--QPVGFVSFDSRSEAEA 76

Query: 912  ALHSLNGVKFDPQTGSTLHIEIARSNSRRTK 820
            A ++LNG++FDP+   TL +E A++N++  K
Sbjct: 77   AKNALNGIRFDPEIPQTLRLEFAKANTKMAK 107



 Score = 35.0 bits (79), Expect = 3.4
 Identities = 19/80 (23%), Positives = 34/80 (42%)
 Frame = -3

Query: 567 TLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQGS 388
           TLF++ L  +    EL  +   + G+    ++     PV F  F+   EA    NAL G 
Sbjct: 25  TLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGI 84

Query: 387 SLPSSDRGGMHIEYARSKMR 328
                    + +E+A++  +
Sbjct: 85  RFDPEIPQTLRLEFAKANTK 104



>gb:AK010301_1155661 Mus musculus ES cells cDNA, RIKEN full-length
            enriched library, clone:2400008B06 product:similar to
            RNA-BINDING PROTEIN WITH MULTIPLE SPLICING (RBP-MS) [Homo
            sapiens], full insert sequence.
          Length = 168

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 40/87 (45%), Positives = 56/87 (64%)
 Frame = -3

Query: 1080 IRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHS 901
            +RTLFVSGLP D+K RE++ LFR   G+E   +K T R  Q V F  F     A AA ++
Sbjct: 24   VRTLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTSR--QPVGFVIFDSRAGAEAAKNA 81

Query: 900  LNGVKFDPQTGSTLHIEIARSNSRRTK 820
            LNG++FDP+   TL +E A++N++  K
Sbjct: 82   LNGIRFDPENPQTLRLEFAKANTKMAK 108



>sp|Q93062|RBMS_HUMAN RNA-binding protein with multiple splicing
            (RBP-MS).>pir|JC6127|JC6127 RNA-binding protein type 1 -
            human>gb:D84107_1995008 Homo sapiens mRNA for RBP-MS/type
            1, complete cds.>gb:D84110_1995011 Homo sapiens mRNA for
            RBP-MS/type 4, complete cds.
          Length = 196

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 39/91 (42%), Positives = 59/91 (64%)
 Frame = -3

Query: 1092 ERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMA 913
            + + +RTLFVSGLP D+K RE++ LFR   G+E   +K T +  Q V F +F     A A
Sbjct: 19   QEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSK--QPVGFVSFDSRSEAEA 76

Query: 912  ALHSLNGVKFDPQTGSTLHIEIARSNSRRTK 820
            A ++LNG++FDP+   TL +E A++N++  K
Sbjct: 77   AKNALNGIRFDPEIPQTLRLEFAKANTKMAK 107



 Score = 35.0 bits (79), Expect = 3.4
 Identities = 19/80 (23%), Positives = 34/80 (42%)
 Frame = -3

Query: 567 TLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQGS 388
           TLF++ L  +    EL  +   + G+    ++     PV F  F+   EA    NAL G 
Sbjct: 25  TLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGI 84

Query: 387 SLPSSDRGGMHIEYARSKMR 328
                    + +E+A++  +
Sbjct: 85  RFDPEIPQTLRLEFAKANTK 104



>gb:AB023045_1515512 Arabidopsis thaliana genomic DNA, chromosome 3,
            P1 clone: MXL8.
          Length = 317

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 43/112 (38%), Positives = 69/112 (61%), Gaps = 2/112 (1%)
 Frame = -3

Query: 1164 PYDP--YYRPQPLPIPDYGYTVGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFES 991
            P+ P  ++ P P P+    +   N+   D +RT+F++GLPDDVK RE+ NL R  PG+E+
Sbjct: 31   PHPPPIHHHPPPPPVLVDNH---NRPPYDELRTIFIAGLPDDVKERELLNLLRWLPGYEA 87

Query: 990  CQLKYTGRGDQVVAFATFVDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSN 835
             Q+ +  +G++ + FA F   Q AMAA  +L  + FD ++ S +H E+A+ N
Sbjct: 88   SQVNF--KGEKPMGFALFSTAQFAMAAKDTLQHMVFDAESKSVIHTEMAKKN 137



 Score = 77.0 bits (188), Expect = 8e-13
 Identities = 38/77 (49%), Positives = 49/77 (63%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNAL 397
           PC+TLFI NLG N  E+ELR +LS  PGF  +K+  +    V F +FE V  AT V + L
Sbjct: 231 PCNTLFIGNLGENINEEELRSLLSAQPGFKQMKILRQERHTVCFIEFEDVNSATNVHHNL 290

Query: 396 QGSSLPSSDRGGMHIEY 346
           QG+ +PSS   GM I+Y
Sbjct: 291 QGAVIPSSGSIGMRIQY 307



 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 33/110 (30%), Positives = 47/110 (42%), Gaps = 10/110 (9%)
 Frame = -3

Query: 1164 PYDPYY----------RPQPLPIPDYGYTVGNKNERDMIRTLFVSGLPDDVKAREIHNLF 1015
            PYDPY            P P+  P     V N  +     TLF+  L +++   E+ +L 
Sbjct: 194  PYDPYAGYHAPPVPMPTPPPIAAPSSYVPVQNIKDNPPCNTLFIGNLGENINEEELRSLL 253

Query: 1014 RRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNGVKFDPQTGS 865
              +PGF+  Q+K   +    V F  F D  SA    H+L G    P +GS
Sbjct: 254  SAQPGFK--QMKILRQERHTVCFIEFEDVNSATNVHHNLQGAVI-PSSGS 300



 Score = 42.0 bits (97), Expect = 0.028
 Identities = 23/79 (29%), Positives = 37/79 (46%)
 Frame = -3

Query: 567 TLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQGS 388
           T+FIA L  +  E EL  +L   PG+   +V  +G  P+ FA F   + A    + LQ  
Sbjct: 60  TIFIAGLPDDVKERELLNLLRWLPGYEASQVNFKGEKPMGFALFSTAQFAMAAKDTLQHM 119

Query: 387 SLPSSDRGGMHIEYARSKM 331
              +  +  +H E A+  +
Sbjct: 120 VFDAESKSVIHTEMAKKNL 138



>gb:BC060391_2552860 Xenopus laevis hypothetical protein MGC68512,
            mRNA (cDNA clone MGC:68512 IMAGE:4030673), complete cds.
          Length = 200

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 39/87 (44%), Positives = 57/87 (65%)
 Frame = -3

Query: 1080 IRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHS 901
            +RTLFVSGLP D+K RE++ LFR   G+E   +K T +  Q V F +F     A AA ++
Sbjct: 22   VRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSK--QPVGFVSFDSRSEAEAAKNA 79

Query: 900  LNGVKFDPQTGSTLHIEIARSNSRRTK 820
            LNG++FDP+   TL +E A++N++  K
Sbjct: 80   LNGIRFDPEIPQTLRLEFAKANTKMAK 106



 Score = 35.0 bits (79), Expect = 3.4
 Identities = 19/80 (23%), Positives = 34/80 (42%)
 Frame = -3

Query: 567 TLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQGS 388
           TLF++ L  +    EL  +   + G+    ++     PV F  F+   EA    NAL G 
Sbjct: 24  TLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGI 83

Query: 387 SLPSSDRGGMHIEYARSKMR 328
                    + +E+A++  +
Sbjct: 84  RFDPEIPQTLRLEFAKANTK 103



>gb:DMCPO611G_1378571 D.melanogaster Cpo 61.1 gene for couch potato
            protein.
          Length = 615

 Score = 77.0 bits (188), Expect = 8e-13
 Identities = 44/109 (40%), Positives = 60/109 (55%), Gaps = 3/109 (2%)
 Frame = -3

Query: 1137 PLPIPDYGYTVGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYT---GR 967
            PL +     +V   +  + +RTLFVSGLP D K RE++ LFR   G+E   LK T   G+
Sbjct: 431  PLGLSQSMDSVNTASNEEEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGK 490

Query: 966  GDQVVAFATFVDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNSRRTK 820
                V F TF     A AA   L GV+FDP    T+ +E A+SN++ +K
Sbjct: 491  TASPVGFVTFHTRAGAEAAKQDLQGVRFDPDMPQTIRLEFAKSNTKVSK 539



>gb:AE014297_1140105 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003720_1222098 Drosophila melanogaster
            chromosome 3R, section 58 of 118 of the complete
            sequence.
          Length = 615

 Score = 77.0 bits (188), Expect = 8e-13
 Identities = 44/109 (40%), Positives = 60/109 (55%), Gaps = 3/109 (2%)
 Frame = -3

Query: 1137 PLPIPDYGYTVGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYT---GR 967
            PL +     +V   +  + +RTLFVSGLP D K RE++ LFR   G+E   LK T   G+
Sbjct: 431  PLGLSQSMDSVNTASNEEEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGK 490

Query: 966  GDQVVAFATFVDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNSRRTK 820
                V F TF     A AA   L GV+FDP    T+ +E A+SN++ +K
Sbjct: 491  TASPVGFVTFHTRAGAEAAKQDLQGVRFDPDMPQTIRLEFAKSNTKVSK 539



>gb:AE014297_1140103 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE014297_1140104 Drosophila melanogaster
            chromosome 3R, complete sequence.>gb:AE003720_1222096
            Drosophila melanogaster chromosome 3R, section 58 of 118
            of the complete sequence.>gb:AE003720_1222097 Drosophila
            melanogaster chromosome 3R, section 58 of 118 of the
            complete sequence.
          Length = 615

 Score = 77.0 bits (188), Expect = 8e-13
 Identities = 44/109 (40%), Positives = 60/109 (55%), Gaps = 3/109 (2%)
 Frame = -3

Query: 1137 PLPIPDYGYTVGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYT---GR 967
            PL +     +V   +  + +RTLFVSGLP D K RE++ LFR   G+E   LK T   G+
Sbjct: 431  PLGLSQSMDSVNTASNEEEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGK 490

Query: 966  GDQVVAFATFVDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNSRRTK 820
                V F TF     A AA   L GV+FDP    T+ +E A+SN++ +K
Sbjct: 491  TASPVGFVTFHTRAGAEAAKQDLQGVRFDPDMPQTIRLEFAKSNTKVSK 539



>pir|S24761|S24761 Cpo 61.1 protein - fruit fly (Drosophila
            melanogaster)
          Length = 615

 Score = 77.0 bits (188), Expect = 8e-13
 Identities = 44/109 (40%), Positives = 60/109 (55%), Gaps = 3/109 (2%)
 Frame = -3

Query: 1137 PLPIPDYGYTVGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYT---GR 967
            PL +     +V   +  + +RTLFVSGLP D K RE++ LFR   G+E   LK T   G+
Sbjct: 431  PLGLSQSMDSVNTASNEEEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGK 490

Query: 966  GDQVVAFATFVDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNSRRTK 820
                V F TF     A AA   L GV+FDP    T+ +E A+SN++ +K
Sbjct: 491  TASPVGFVTFHTRAGAEAAKQDLQGVRFDPDMPQTIRLEFAKSNTKVSK 539



>sp|Q01617|CPO_DROME Couch potato protein.>gb:AE014297_1140102
            Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003720_1222095 Drosophila melanogaster
            chromosome 3R, section 58 of 118 of the complete
            sequence.
          Length = 738

 Score = 77.0 bits (188), Expect = 8e-13
 Identities = 44/109 (40%), Positives = 60/109 (55%), Gaps = 3/109 (2%)
 Frame = -3

Query: 1137 PLPIPDYGYTVGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYT---GR 967
            PL +     +V   +  + +RTLFVSGLP D K RE++ LFR   G+E   LK T   G+
Sbjct: 431  PLGLSQSMDSVNTASNEEEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGK 490

Query: 966  GDQVVAFATFVDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNSRRTK 820
                V F TF     A AA   L GV+FDP    T+ +E A+SN++ +K
Sbjct: 491  TASPVGFVTFHTRAGAEAAKQDLQGVRFDPDMPQTIRLEFAKSNTKVSK 539



 Score = 38.9 bits (89), Expect = 0.23
 Identities = 17/34 (50%), Positives = 24/34 (70%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQYPGFNTLKV 475
           PCSTLF+ANLG   +E EL+++ S +   N LK+
Sbjct: 702 PCSTLFVANLGQFVSEHELKEVFSSHGNSNWLKL 735



>gb:CAR489610_1645345 Cicer arietinum partial mRNA for proline rich
           protein 3 (prp3 gene).
          Length = 284

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 37/84 (44%), Positives = 52/84 (61%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNAL 397
           PC+TLFI NLG N  E+E+R + S  PGF  +K+  +    V F +FE V  AT V + L
Sbjct: 178 PCNTLFIGNLGENINEEEVRGLFSVQPGFKQMKILRQERHTVCFIEFEDVNSATNVHHNL 237

Query: 396 QGSSLPSSDRGGMHIEYARSKMRK 325
           QG+ +PSS   GM I+Y+++   K
Sbjct: 238 QGAVIPSSGSVGMRIQYSKNPFGK 261



 Score = 74.3 bits (181), Expect = 5e-12
 Identities = 37/82 (45%), Positives = 53/82 (64%)
 Frame = -3

Query: 1080 IRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHS 901
            +RT+F++GLP+DVK REI NL R  PGFE+ QL +  + ++ + FA F     A+AA   
Sbjct: 4    VRTIFITGLPEDVKEREIQNLLRWLPGFEASQLNF--KAEKPMGFALFSSPHQAIAAKDI 61

Query: 900  LNGVKFDPQTGSTLHIEIARSN 835
            L  + FDP + S LH E+A+ N
Sbjct: 62   LQDMLFDPDSKSVLHTEMAKKN 83



 Score = 50.8 bits (120), Expect = 6e-05
 Identities = 40/135 (29%), Positives = 60/135 (44%), Gaps = 11/135 (8%)
 Frame = -3

Query: 1164 PYDPYYR------PQPLPI----PDYGYTVGNKNERDMIRTLFVSGLPDDVKAREIHNLF 1015
            PYDPY        P P P+    P     V N  +     TLF+  L +++   E+  LF
Sbjct: 141  PYDPYAGYPVAPVPMPAPVSIAAPSSYVPVQNTKDNPPCNTLFIGNLGENINEEEVRGLF 200

Query: 1014 RRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNGVKFDPQTGST-LHIEIARS 838
              +PGF+  Q+K   +    V F  F D  SA    H+L G    P +GS  + I+ ++ 
Sbjct: 201  SVQPGFK--QMKILRQERHTVCFIEFEDVNSATNVHHNLQGAVI-PSSGSVGMRIQYSK- 256

Query: 837  NSRRTKRPGSGPYVV 793
            N    ++ G+ P  V
Sbjct: 257  NPFGKRKDGNFPMAV 271



 Score = 39.3 bits (90), Expect = 0.18
 Identities = 20/79 (25%), Positives = 35/79 (44%)
 Frame = -3

Query: 567 TLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQGS 388
           T+FI  L  +  E E++ +L   PGF   ++  +   P+ FA F    +A    + LQ  
Sbjct: 6   TIFITGLPEDVKEREIQNLLRWLPGFEASQLNFKAEKPMGFALFSSPHQAIAAKDILQDM 65

Query: 387 SLPSSDRGGMHIEYARSKM 331
                 +  +H E A+  +
Sbjct: 66  LFDPDSKSVLHTEMAKKNL 84



>gb:BT001569_1356342 Drosophila melanogaster RE20544 full insert cDNA.
          Length = 194

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 44/110 (40%), Positives = 60/110 (54%), Gaps = 4/110 (3%)
 Frame = -3

Query: 1137 PLPIPDYGYTVGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYT---GR 967
            PL +     +V   +  + +RTLFVSGLP D K RE++ LFR   G+E   LK T   G+
Sbjct: 9    PLGLSQSMDSVNTASNEEEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGK 68

Query: 966  GDQVVAFATFVDHQSAMAALHSL-NGVKFDPQTGSTLHIEIARSNSRRTK 820
                V F TF     A AA   L  GV+FDP    T+ +E A+SN++ +K
Sbjct: 69   TASPVGFVTFHTRAGAEAAKQDLQQGVRFDPDMPQTIRLEFAKSNTKVSK 118



>sp|O74452|SCW1_SCHPO Cell wall integrity protein scw1 (Strong cell
           wall protein 1).>pir|T41097|T41097 RNA binding protein -
           fission yeast (Schizosaccharomyces
           pombe)>gb:SPCC16C4_1721027 S.pombe chromosome III cosmid
           c16C4.
          Length = 561

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 28/86 (32%), Positives = 52/86 (60%)
 Frame = -3

Query: 588 DGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQV 409
           D   PC+T+++ NL P+ +E+EL+ + S   G+  L  R +G  P+ F +FE +  A + 
Sbjct: 420 DQNPPCNTIYVGNLPPSTSEEELKVLFSTQVGYKRLCFRTKGNGPMCFVEFENIPYAMEA 479

Query: 408 MNALQGSSLPSSDRGGMHIEYARSKM 331
           +  LQG  L SS +GG+ + ++++ +
Sbjct: 480 LKNLQGVCLSSSIKGGIRLSFSKNPL 505



>gb:CR382132_1665459 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 625

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 29/86 (33%), Positives = 51/86 (59%)
 Frame = -3

Query: 588 DGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQV 409
           D   PC+TL++ NL  N TE+EL ++ S+  G+  L  R +   P+ F +FE V  A++ 
Sbjct: 508 DQNPPCNTLYVGNLPMNTTEEELMQLFSKQKGYKRLCFRTKMNGPMCFVEFENVMYASKA 567

Query: 408 MNALQGSSLPSSDRGGMHIEYARSKM 331
           +N L G  L  S +GG+ + ++++ +
Sbjct: 568 LNELYGKGLKYSVKGGIRLSFSKNPL 593



>pir|A46230|A46230 RNA-binding protein homolog Cpo (clone 61.1) -
            fruit fly  (Drosophila melanogaster) (fragment)
          Length = 616

 Score = 64.3 bits (155), Expect = 5e-09
 Identities = 38/90 (42%), Positives = 48/90 (53%), Gaps = 3/90 (3%)
 Frame = -3

Query: 1137 PLPIPDYGYTVGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYT---GR 967
            PL +     +V   +  + +RTLFVSGLP D K RE++ LFR   G+E   LK T   G+
Sbjct: 432  PLGLSQSMDSVNTASNEEEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGK 491

Query: 966  GDQVVAFATFVDHQSAMAALHSLNGVKFDP 877
                V F TF     A AA   L GV+FDP
Sbjct: 492  TASPVGFVTFHTRAGAEAAKQDLQGVRFDP 521



>pir|S67787|S67787 hypothetical protein YDL224c - yeast
           (Saccharomyces cerevisiae)>gb:SCYDL224C_1711803
           S.cerevisiae chromosome IV reading frame ORF YDL224c.
          Length = 649

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 36/120 (30%), Positives = 58/120 (48%), Gaps = 15/120 (12%)
 Frame = -3

Query: 645 VGDGDNVLAAQSEQIEKIGDGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVR-- 472
           +   D  L A+        D   PC+TL++ NL P+ TE ELR++ S   GF  L  R  
Sbjct: 508 ISQADLSLLAKVPPPANPADQNPPCNTLYVGNLPPDATEQELRQLFSNQQGFRRLSFRNK 567

Query: 471 --------ARGGMPVAFADFEGVEEATQVMNALQGSSLPS-----SDRGGMHIEYARSKM 331
                     G  P+ F +FE V  AT+ +  L GS LP      +++GG+ + ++++ +
Sbjct: 568 MNSHGHGNGHGHGPICFVEFEDVSFATRALAELYGSQLPHPRPSLNNKGGIRLSFSKNPL 627



>gb:CR380953_1650853 Candida glabrata strain CBS138 chromosome G
           complete sequence.
          Length = 674

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 31/96 (32%), Positives = 53/96 (55%), Gaps = 10/96 (10%)
 Frame = -3

Query: 588 DGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVR-------ARGGMPVAFADFEG 430
           D   PC+TL++ NL P+ +E ELR++ S  PGF  L  +         G  P+ F +FE 
Sbjct: 552 DQNPPCNTLYVGNLPPDTSEQELRQLFSPQPGFRRLSFKNKNNNGHTHGHGPMCFVEFED 611

Query: 429 VEEATQVMNALQGSSLP---SSDRGGMHIEYARSKM 331
           V  AT+ +  L G  LP   ++ +GG+ + ++++ +
Sbjct: 612 VSFATRALAELYGRQLPRTGANSKGGIRLSFSKNPL 647



 Score = 37.0 bits (84), Expect = 0.89
 Identities = 25/75 (33%), Positives = 33/75 (44%), Gaps = 5/75 (6%)
 Frame = -3

Query: 1074 TLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTG-----RGDQVVAFATFVDHQSAMAA 910
            TL+V  LP D   +E+  LF  +PGF     K         G   + F  F D   A  A
Sbjct: 559  TLYVGNLPPDTSEQELRQLFSPQPGFRRLSFKNKNNNGHTHGHGPMCFVEFEDVSFATRA 618

Query: 909  LHSLNGVKFDPQTGS 865
            L  L G +  P+TG+
Sbjct: 619  LAELYGRQL-PRTGA 632



>gb:AE016815_1746077 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome II, complete sequence.
          Length = 729

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 32/96 (33%), Positives = 52/96 (54%), Gaps = 10/96 (10%)
 Frame = -3

Query: 588 DGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVR-----ARGGMPVAFADFEGVE 424
           D   PC+TL++ NL P+ TE ELR++ S   GF  L  R       G  P+ F +FE V 
Sbjct: 601 DQNPPCNTLYVGNLPPDATEQELRQLFSSQKGFRRLSFRNKNNNGNGHGPMCFVEFEDVA 660

Query: 423 EATQVMNALQGSSL-----PSSDRGGMHIEYARSKM 331
            AT+ +  L GS L       +++GG+ + ++++ +
Sbjct: 661 HATRALAELYGSQLARTSGTHNNKGGIRLSFSKNPL 696



 Score = 34.7 bits (78), Expect = 4.4
 Identities = 22/73 (30%), Positives = 31/73 (42%), Gaps = 3/73 (4%)
 Frame = -3

Query: 1074 TLFVSGLPDDVKAREIHNLFRRRPGFESCQLK---YTGRGDQVVAFATFVDHQSAMAALH 904
            TL+V  LP D   +E+  LF  + GF     +     G G   + F  F D   A  AL 
Sbjct: 608  TLYVGNLPPDATEQELRQLFSSQKGFRRLSFRNKNNNGNGHGPMCFVEFEDVAHATRALA 667

Query: 903  SLNGVKFDPQTGS 865
             L G +    +G+
Sbjct: 668  ELYGSQLARTSGT 680



>gb:CR382126_1659279 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 616

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 32/96 (33%), Positives = 52/96 (54%), Gaps = 10/96 (10%)
 Frame = -3

Query: 588 DGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRAR-----GGMPVAFADFEGVE 424
           D   PC+TL++ NL P+ TE ELR++     GF  L  R +     G  P+ F +FE V 
Sbjct: 443 DQNPPCNTLYVGNLPPDATEQELRQLFGGQKGFKRLSFRNKNNNNSGHGPMCFVEFEDVA 502

Query: 423 EATQVMNALQGSSLP-----SSDRGGMHIEYARSKM 331
            AT+ +  L GS LP      + +GG+ + ++++ +
Sbjct: 503 HATRALAELYGSQLPRPVGAHNTKGGIRLSFSKNPL 538



 Score = 35.0 bits (79), Expect = 3.4
 Identities = 31/122 (25%), Positives = 45/122 (36%), Gaps = 15/122 (12%)
 Frame = -3

Query: 1074 TLFVSGLPDDVKAREIHNLFRRRPGFESCQLK---YTGRGDQVVAFATFVDHQSAMAALH 904
            TL+V  LP D   +E+  LF  + GF+    +       G   + F  F D   A  AL 
Sbjct: 450  TLYVGNLPPDATEQELRQLFGGQKGFKRLSFRNKNNNNSGHGPMCFVEFEDVAHATRALA 509

Query: 903  SLNGVKFDPQTG------------STLHIEIARSNSRRTKRPGSGPYVVIDNRSKSNTDA 760
             L G +     G            S   + +   NSRR+   GSG      N +++    
Sbjct: 510  ELYGSQLPRPVGAHNTKGGIRLSFSKNPLGVRGPNSRRSGSSGSGQPTSNSNNAQNGKTI 569

Query: 759  KG 754
             G
Sbjct: 570  SG 571



>pir|T41304|T41304 probable rna-binding protein - fission yeast
           (Schizosaccharomyces pombe)>gb:SPCC320_1721262 S.pombe
           chromosome III cosmid c320.
          Length = 761

 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 28/101 (27%), Positives = 53/101 (52%)
 Frame = -3

Query: 633 DNVLAAQSEQIEKIGDGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMP 454
           DN +  +  +     D   PC+T+++ NL     E +LR   S+  G+  L  + +G  P
Sbjct: 581 DNKVLLEQVESNVQTDHNSPCNTIYVGNLSNPDQEKKLRLAFSKEKGYRRLCFKIKGNSP 640

Query: 453 VAFADFEGVEEATQVMNALQGSSLPSSDRGGMHIEYARSKM 331
           + F +FE V  A + M  +QG++L    +GG+ + Y+++ +
Sbjct: 641 MCFVEFEEVCHAAKAMEKMQGAALDDKIKGGIRLSYSKNPL 681



>gb:CR382138_1671573 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 529

 Score = 57.8 bits (138), Expect = 5e-07
 Identities = 32/103 (31%), Positives = 52/103 (50%), Gaps = 17/103 (16%)
 Frame = -3

Query: 588 DGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGM-------------PVA 448
           D   PC+TL++ NL P+ TE ELR + S   GF  L  R +                P+ 
Sbjct: 387 DQNPPCNTLYVGNLPPDATELELRALFSPQKGFRRLSFRTKNQSLSNPNQSSNHNHGPMC 446

Query: 447 FADFEGVEEATQVMNALQGSSLP----SSDRGGMHIEYARSKM 331
           F +FE V  AT+ +  L G +LP    S+ +GG+ + ++++ +
Sbjct: 447 FVEFEDVAHATRALAELYGRTLPRSGGSNGKGGIRLSFSKNPL 489



>gb:CR380953_1650848 Candida glabrata strain CBS138 chromosome G
           complete sequence.>gb:AJ617310_1812066 Candida glabrata
           gcr2B gene (partial), gcs1 gene, ho gene and whi3 gene.
          Length = 671

 Score = 57.0 bits (136), Expect = 8e-07
 Identities = 34/115 (29%), Positives = 56/115 (48%), Gaps = 10/115 (8%)
 Frame = -3

Query: 645 VGDGDNVLAAQSEQIEKIGDGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVR-- 472
           +   D  L A+        D   PC+TL++ NL  + TE ELR++ S   GF  L  R  
Sbjct: 519 ISQADLSLLARIPPPANPADQNPPCNTLYVGNLPSDATEQELRQLFSNQFGFRRLSFRNK 578

Query: 471 -----ARGGMPVAFADFEGVEEATQVMNALQGSSLPS---SDRGGMHIEYARSKM 331
                  G  P+ F +F+ V  AT+ +  L GS LP    + +GG+ + ++++ +
Sbjct: 579 NANGTGHGHGPMCFVEFDDVSCATRALVELYGSQLPRATVNTKGGIRLSFSKNPL 633



 Score = 35.4 bits (80), Expect = 2.6
 Identities = 25/76 (32%), Positives = 32/76 (42%), Gaps = 5/76 (6%)
 Frame = -3

Query: 1074 TLFVSGLPDDVKAREIHNLFR-----RRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAA 910
            TL+V  LP D   +E+  LF      RR  F +     TG G   + F  F D   A  A
Sbjct: 545  TLYVGNLPSDATEQELRQLFSNQFGFRRLSFRNKNANGTGHGHGPMCFVEFDDVSCATRA 604

Query: 909  LHSLNGVKFDPQTGST 862
            L  L G +    T +T
Sbjct: 605  LVELYGSQLPRATVNT 620



>sp|P34761|WHI3_YEAST WHI3 protein.>pir|S50734|S50734 WHI3 protein -
           yeast (Saccharomyces cerevisiae)>gb:SCXIVL_1710915
           S.cerevisiae DNA of chromosome XIV.>gb:SCYNL197C_1713801
           S.cerevisiae chromosome XIV reading frame ORF
           YNL197c.>gb:U01095_1726199 Saccharomyces cerevisiae Whi3
           protein (WHI3) gene, complete cds.
          Length = 661

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 33/115 (28%), Positives = 55/115 (47%), Gaps = 10/115 (8%)
 Frame = -3

Query: 645 VGDGDNVLAAQSEQIEKIGDGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRAR 466
           +   D  L A+        D   PC+TL++ NL  + TE ELR++ S   GF  L  R +
Sbjct: 513 ISQADLSLLARIPPPANPADQNPPCNTLYVGNLPSDATEQELRQLFSGQEGFRRLSFRNK 572

Query: 465 GGM-------PVAFADFEGVEEATQVMNALQGSSLPS---SDRGGMHIEYARSKM 331
                     P+ F +F+ V  AT+ +  L G  LP    S +GG+ + ++++ +
Sbjct: 573 NTTSNGHSHGPMCFVEFDDVSFATRALAELYGRQLPRSTVSSKGGIRLSFSKNPL 627



>gb:AE017348_1758196 Cryptococcus neoformans var. neoformans JEC21
           chromosome 8, complete sequence.
          Length = 955

 Score = 52.8 bits (125), Expect = 2e-05
 Identities = 28/94 (29%), Positives = 48/94 (51%), Gaps = 8/94 (8%)
 Frame = -3

Query: 588 DGTHPCSTLFIANLG--------PNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFE 433
           D   P +TL++ NL         P   E+ LR + S+ PGF  +  R +   P+ F +FE
Sbjct: 596 DQNPPINTLYVGNLPAVSPPTHPPGFLEESLRALFSRCPGFKRMSYRQKINGPMCFVEFE 655

Query: 432 GVEEATQVMNALQGSSLPSSDRGGMHIEYARSKM 331
            V  A+Q +  L G +L    +GG+ + Y+++ +
Sbjct: 656 EVIYASQAIKELYGHNLGGLVKGGIRLSYSKNSL 689



 Score = 48.1 bits (113), Expect = 4e-04
 Identities = 27/86 (31%), Positives = 45/86 (52%)
 Frame = -3

Query: 1092 ERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMA 913
            E ++I T+FV G PDD+  RE  N+F   PGFE+  LK+   G +    A  +   + +A
Sbjct: 190  EEEVISTIFVVGFPDDMSEREFQNIFTFAPGFEAATLKFPS-GSRREPTAALLAELTQLA 248

Query: 912  ALHSLNGVKFDPQTGSTLHIEIARSN 835
            A  +  G ++       +++E A S+
Sbjct: 249  AHQNAQGGEYSEYPLGNINLEEAISS 274



 Score = 39.7 bits (91), Expect = 0.14
 Identities = 22/56 (39%), Positives = 29/56 (51%)
 Frame = -3

Query: 960 QVVAFATFVDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVV 793
           Q + FA F     A+ A   L G K DP TGS L  E+A+ N   TK+  SG  ++
Sbjct: 320 QTIGFARFKTRSDALTAKDHLQGKKIDPLTGSVLKAEMAKKN-LHTKKTTSGEEIM 374



>gb:DMCPO612G_1378572 Drosophila melanogaster Cpo 61.2 gene for couch
            potato protein.
          Length = 536

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 33/83 (39%), Positives = 42/83 (50%), Gaps = 3/83 (3%)
 Frame = -3

Query: 1137 PLPIPDYGYTVGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYT---GR 967
            PL +     +V   +  + +RTLFVSGLP D K RE++ LFR   G+E   LK T   G+
Sbjct: 432  PLGLSQSMDSVNTASNEEEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGK 491

Query: 966  GDQVVAFATFVDHQSAMAALHSL 898
                V F TF     A AA   L
Sbjct: 492  TASPVGFVTFHTRAGAEAAKQDL 514



>pir|B46230|B46230 RNA-binding protein homolog Cpo (clone 61.2) -
            fruit fly  (Drosophila melanogaster)
          Length = 536

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 33/83 (39%), Positives = 42/83 (50%), Gaps = 3/83 (3%)
 Frame = -3

Query: 1137 PLPIPDYGYTVGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYT---GR 967
            PL +     +V   +  + +RTLFVSGLP D K RE++ LFR   G+E   LK T   G+
Sbjct: 432  PLGLSQSMDSVNTASNEEEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGK 491

Query: 966  GDQVVAFATFVDHQSAMAALHSL 898
                V F TF     A AA   L
Sbjct: 492  TASPVGFVTFHTRAGAEAAKQDL 514



>gb:AP005681_1855909 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, BAC clone:OJ1439_F07.
          Length = 235

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 34/99 (34%), Positives = 50/99 (50%), Gaps = 5/99 (5%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQL-----KYTGRGDQVVAFATFVDHQSAMA 913
            RTL+V GLP +   RE+ ++FR   GF   +L     ++ G    ++ F  F     A A
Sbjct: 137  RTLYVEGLPSNCTKREVAHIFRPFSGFREVRLVNKEIRHAG-SCNLLCFVDFSSPPEARA 195

Query: 912  ALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYV 796
            AL +L G KFD     + ++ I  S + R +RP  GP V
Sbjct: 196  ALETLQGYKFDEHDHESSNLRIQFSLTPR-RRPIGGPRV 233



 Score = 38.5 bits (88), Expect = 0.31
 Identities = 24/90 (26%), Positives = 40/90 (44%), Gaps = 8/90 (8%)
 Frame = -3

Query: 567 TLFIANLGPNCTEDELRKILSQYPGFNTLK-----VRARGGMP-VAFADFEGVEEATQVM 406
           TL++  L  NCT+ E+  I   + GF  ++     +R  G    + F DF    EA   +
Sbjct: 138 TLYVEGLPSNCTKREVAHIFRPFSGFREVRLVNKEIRHAGSCNLLCFVDFSSPPEARAAL 197

Query: 405 NALQGSSLPSSDR--GGMHIEYARSKMRKP 322
             LQG      D     + I+++ +  R+P
Sbjct: 198 ETLQGYKFDEHDHESSNLRIQFSLTPRRRP 227



>gb:D84111_1995012 Homo sapiens mRNA for RBP-MS/type 5, partial cds.
          Length = 98

 Score = 48.1 bits (113), Expect = 4e-04
 Identities = 23/61 (37%), Positives = 37/61 (60%)
 Frame = -3

Query: 1002 GFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNSRRT 823
            G+E   +K T +  Q V F +F     A AA ++LNG++FDP+   TL +E A++N++  
Sbjct: 4    GYEGSLIKLTSK--QPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMA 61

Query: 822  K 820
            K
Sbjct: 62   K 62



>gb:AY129455_1302206 Drosophila melanogaster RE30936 full insert
           cDNA.
          Length = 238

 Score = 48.1 bits (113), Expect = 4e-04
 Identities = 24/42 (57%), Positives = 29/42 (69%)
 Frame = -3

Query: 456 PVAFADFEGVEEATQVMNALQGSSLPSSDRGGMHIEYARSKM 331
           PVAF +F+    A+Q M  LQG  L SSDRG + IE+ARSKM
Sbjct: 32  PVAFIEFKDPPTASQAMQQLQGKYLLSSDRGSIRIEFARSKM 73



>gb:MTR508392_1687658 Medicago truncatula mRNA for RNA-binding protein
            (rbp1 gene).
          Length = 261

 Score = 47.0 bits (110), Expect = 9e-04
 Identities = 38/127 (29%), Positives = 55/127 (43%), Gaps = 6/127 (4%)
 Frame = -3

Query: 1164 PYDPYYR--PQPLPIPDYGYTVGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFES 991
            P DP  R  P+P  +P            D   TL++ GLP D   RE+ ++FR   G+  
Sbjct: 131  PMDPVSRHGPEPALLPP-----------DASPTLYIEGLPSDCTRREVAHIFRPFVGYRE 179

Query: 990  CQL---KYTGRGDQ-VVAFATFVDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNSRRT 823
             +L   +   RGD  ++ F  F +   A  AL +L G K D     + H+ +  S     
Sbjct: 180  VRLVSKEAKHRGDPLILCFVDFANPACAATALSALQGYKVDEINPESSHLRLQFSR-YPG 238

Query: 822  KRPGSGP 802
             R G GP
Sbjct: 239  PRSGGGP 245



>gb:AK117533_1815563 Arabidopsis thaliana At1g76940 mRNA for unknown
            protein, complete cds, clone: RAFL17-19-B16.
          Length = 156

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 38/142 (26%), Positives = 59/142 (41%), Gaps = 6/142 (4%)
 Frame = -3

Query: 1209 TLDDLRRREEMALHQPYDPYYRPQPLPIPDYGYTVGNKN-ERDMIRTLFVSGLPDDVKAR 1033
            T+DD   R    L   + P         P+    VG +N   D   TL+V GLP +   R
Sbjct: 17   TIDDFMLRRGGVLPLDHGPNGHTIGFDPPE---PVGRRNLPSDASNTLYVEGLPSNCSRR 73

Query: 1032 EIHNLFRRRPGFESCQL-----KYTGRGDQVVAFATFVDHQSAMAALHSLNGVKFDPQTG 868
            E+ ++FR   G+   +L     K+      V+ F  F +   A  AL +L G + D    
Sbjct: 74   EVAHIFRPFVGYREVRLVTKDSKHRNGDPIVLCFVDFTNPACAATALSALQGYRMDENES 133

Query: 867  STLHIEIARSNSRRTKRPGSGP 802
             +  + +  S     ++PGS P
Sbjct: 134  DSKFLRLQFS-----RKPGSRP 150



 Score = 35.8 bits (81), Expect = 2.0
 Identities = 23/92 (25%), Positives = 44/92 (47%), Gaps = 9/92 (9%)
 Frame = -3

Query: 570 STLFIANLGPNCTEDELRKILSQYPGFNTLKV-----RARGGMPV--AFADFEGVEEATQ 412
           +TL++  L  NC+  E+  I   + G+  +++     + R G P+   F DF     A  
Sbjct: 59  NTLYVEGLPSNCSRREVAHIFRPFVGYREVRLVTKDSKHRNGDPIVLCFVDFTNPACAAT 118

Query: 411 VMNALQGSSLP--SSDRGGMHIEYARSKMRKP 322
            ++ALQG  +    SD   + ++++R    +P
Sbjct: 119 ALSALQGYRMDENESDSKFLRLQFSRKPGSRP 150



>gb:AP004300_1839814 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC clone:P0470D12.
          Length = 362

 Score = 44.7 bits (104), Expect = 0.004
 Identities = 31/94 (32%), Positives = 44/94 (46%), Gaps = 3/94 (3%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSL 898
            RT++V  LP D++ RE+ +LF +        LK   R     AF  F D + A  A+   
Sbjct: 73   RTIYVGNLPGDIREREVEDLFYKYGRIVDIDLKIPPR-PPGFAFVEFEDPRDAEDAIRGR 131

Query: 897  NGVKFDPQTGSTLHIEIA---RSNSRRTKRPGSG 805
            +G  FD   G+ L +E+A   R NS      G G
Sbjct: 132  DGYNFD---GNRLRVELAHGGRGNSSSFNNSGGG 162



>gb:AF173640_1774450 Arabidopsis thaliana splicing factor SR1,
            alternatively spliced products, complete cds.
          Length = 270

 Score = 44.3 bits (103), Expect = 0.006
 Identities = 28/83 (33%), Positives = 40/83 (48%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSL 898
            RT++V  LP D++ RE+ +LF +        LK   R     AF  F D + A  A+H  
Sbjct: 7    RTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPR-PPGYAFVEFDDARDAEDAIHGR 65

Query: 897  NGVKFDPQTGSTLHIEIARSNSR 829
            +G  FD   G  L +E+A    R
Sbjct: 66   DGYDFD---GHRLRVELAHGGRR 85



>gb:AF173640_1774449 Arabidopsis thaliana splicing factor SR1,
            alternatively spliced products, complete cds.
          Length = 261

 Score = 44.3 bits (103), Expect = 0.006
 Identities = 28/83 (33%), Positives = 40/83 (48%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSL 898
            RT++V  LP D++ RE+ +LF +        LK   R     AF  F D + A  A+H  
Sbjct: 7    RTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPR-PPGYAFVEFDDARDAEDAIHGR 65

Query: 897  NGVKFDPQTGSTLHIEIARSNSR 829
            +G  FD   G  L +E+A    R
Sbjct: 66   DGYDFD---GHRLRVELAHGGRR 85



>gb:AF173640_1774448 Arabidopsis thaliana splicing factor SR1,
            alternatively spliced products, complete cds.
          Length = 276

 Score = 44.3 bits (103), Expect = 0.006
 Identities = 28/83 (33%), Positives = 40/83 (48%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSL 898
            RT++V  LP D++ RE+ +LF +        LK   R     AF  F D + A  A+H  
Sbjct: 7    RTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPR-PPGYAFVEFDDARDAEDAIHGR 65

Query: 897  NGVKFDPQTGSTLHIEIARSNSR 829
            +G  FD   G  L +E+A    R
Sbjct: 66   DGYDFD---GHRLRVELAHGGRR 85



>gb:AF173640_1774447 Arabidopsis thaliana splicing factor SR1,
            alternatively spliced products, complete cds.
          Length = 289

 Score = 44.3 bits (103), Expect = 0.006
 Identities = 28/83 (33%), Positives = 40/83 (48%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSL 898
            RT++V  LP D++ RE+ +LF +        LK   R     AF  F D + A  A+H  
Sbjct: 7    RTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPR-PPGYAFVEFDDARDAEDAIHGR 65

Query: 897  NGVKFDPQTGSTLHIEIARSNSR 829
            +G  FD   G  L +E+A    R
Sbjct: 66   DGYDFD---GHRLRVELAHGGRR 85



>gb:AF173640_1774446 Arabidopsis thaliana splicing factor SR1,
            alternatively spliced products, complete cds.
          Length = 307

 Score = 44.3 bits (103), Expect = 0.006
 Identities = 28/83 (33%), Positives = 40/83 (48%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSL 898
            RT++V  LP D++ RE+ +LF +        LK   R     AF  F D + A  A+H  
Sbjct: 7    RTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPR-PPGYAFVEFDDARDAEDAIHGR 65

Query: 897  NGVKFDPQTGSTLHIEIARSNSR 829
            +G  FD   G  L +E+A    R
Sbjct: 66   DGYDFD---GHRLRVELAHGGRR 85



>gb:AF001035_1760520 Arabidopsis thaliana ASF/SF2 homolog (SF2) gene,
            complete cds.
          Length = 272

 Score = 44.3 bits (103), Expect = 0.006
 Identities = 28/83 (33%), Positives = 40/83 (48%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSL 898
            RT++V  LP D++ RE+ +LF +        LK   R     AF  F D + A  A+H  
Sbjct: 7    RTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPR-PPGYAFVEFDDARDAEDAIHGR 65

Query: 897  NGVKFDPQTGSTLHIEIARSNSR 829
            +G  FD   G  L +E+A    R
Sbjct: 66   DGYDFD---GHRLRVELAHGGRR 85



>gb:AY128338_1580637 Arabidopsis thaliana SF2/ASF-like splicing
            modulator Srp30, putative (At1g02840) mRNA, complete
            cds.>gb:BT006316_1639208 Arabidopsis thaliana At1g02840
            mRNA, complete cds.
          Length = 285

 Score = 44.3 bits (103), Expect = 0.006
 Identities = 28/83 (33%), Positives = 40/83 (48%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSL 898
            RT++V  LP D++ RE+ +LF +        LK   R     AF  F D + A  A+H  
Sbjct: 7    RTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPR-PPGYAFVEFDDARDAEDAIHGR 65

Query: 897  NGVKFDPQTGSTLHIEIARSNSR 829
            +G  FD   G  L +E+A    R
Sbjct: 66   DGYDFD---GHRLRVELAHGGRR 85



>gb:S55886_1396626 Drosophila melanogaster RRM9 (rbp9) gene, complete
            cds.
          Length = 444

 Score = 44.3 bits (103), Expect = 0.006
 Identities = 35/105 (33%), Positives = 51/105 (48%), Gaps = 3/105 (2%)
 Frame = -3

Query: 1101 NKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFVD 931
            N NE D    L V+ LP  +   EI +LF      ESC+L   K TG+      F  +V 
Sbjct: 102  NNNEPDPKTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQ-SLGYGFVNYVK 160

Query: 930  HQSAMAALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYV 796
             + A  A+++LNG++       T+ + IAR +S   K  G+  YV
Sbjct: 161  QEDAEKAINALNGLRLQ---NKTIKVSIARPSSESIK--GANLYV 200



>gb:AE014134_1127271 Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE014134_1127272 Drosophila melanogaster
            chromosome 2L, complete sequence.>gb:AE003581_1216347
            Drosophila melanogaster chromosome 2L, section 10 of 83
            of the complete sequence.>gb:AE003581_1216348 Drosophila
            melanogaster chromosome 2L, section 10 of 83 of the
            complete sequence.>gb:BT011197_1357804 Drosophila
            melanogaster GH26440 full insert
            cDNA.>gb:DRORBP9A_1382624 Drosophila melanogaster
            RNA-binding protein gene fragment.
          Length = 439

 Score = 44.3 bits (103), Expect = 0.006
 Identities = 35/105 (33%), Positives = 51/105 (48%), Gaps = 3/105 (2%)
 Frame = -3

Query: 1101 NKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFVD 931
            N NE D    L V+ LP  +   EI +LF      ESC+L   K TG+      F  +V 
Sbjct: 102  NNNEPDPKTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQ-SLGYGFVNYVK 160

Query: 930  HQSAMAALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYV 796
             + A  A+++LNG++       T+ + IAR +S   K  G+  YV
Sbjct: 161  QEDAEKAINALNGLRLQ---NKTIKVSIARPSSESIK--GANLYV 200



>gb:AE014134_1127269 Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE014134_1127270 Drosophila melanogaster
            chromosome 2L, complete sequence.>gb:AE003581_1216345
            Drosophila melanogaster chromosome 2L, section 10 of 83
            of the complete sequence.>gb:AE003581_1216346 Drosophila
            melanogaster chromosome 2L, section 10 of 83 of the
            complete sequence.>gb:DRORBP9A_1382623 Drosophila
            melanogaster RNA-binding protein gene fragment.
          Length = 444

 Score = 44.3 bits (103), Expect = 0.006
 Identities = 35/105 (33%), Positives = 51/105 (48%), Gaps = 3/105 (2%)
 Frame = -3

Query: 1101 NKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFVD 931
            N NE D    L V+ LP  +   EI +LF      ESC+L   K TG+      F  +V 
Sbjct: 102  NNNEPDPKTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQ-SLGYGFVNYVK 160

Query: 930  HQSAMAALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYV 796
             + A  A+++LNG++       T+ + IAR +S   K  G+  YV
Sbjct: 161  QEDAEKAINALNGLRLQ---NKTIKVSIARPSSESIK--GANLYV 200



>gb:AE014134_1127268 Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE003581_1216344 Drosophila melanogaster
            chromosome 2L, section 10 of 83 of the complete sequence.
          Length = 642

 Score = 44.3 bits (103), Expect = 0.006
 Identities = 35/105 (33%), Positives = 51/105 (48%), Gaps = 3/105 (2%)
 Frame = -3

Query: 1101 NKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFVD 931
            N NE D    L V+ LP  +   EI +LF      ESC+L   K TG+      F  +V 
Sbjct: 305  NNNEPDPKTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQ-SLGYGFVNYVK 363

Query: 930  HQSAMAALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYV 796
             + A  A+++LNG++       T+ + IAR +S   K  G+  YV
Sbjct: 364  QEDAEKAINALNGLRLQ---NKTIKVSIARPSSESIK--GANLYV 403



>gb:AE014134_1127267 Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE003581_1216343 Drosophila melanogaster
            chromosome 2L, section 10 of 83 of the complete sequence.
          Length = 647

 Score = 44.3 bits (103), Expect = 0.006
 Identities = 35/105 (33%), Positives = 51/105 (48%), Gaps = 3/105 (2%)
 Frame = -3

Query: 1101 NKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFVD 931
            N NE D    L V+ LP  +   EI +LF      ESC+L   K TG+      F  +V 
Sbjct: 305  NNNEPDPKTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQ-SLGYGFVNYVK 363

Query: 930  HQSAMAALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYV 796
             + A  A+++LNG++       T+ + IAR +S   K  G+  YV
Sbjct: 364  QEDAEKAINALNGLRLQ---NKTIKVSIARPSSESIK--GANLYV 403



>pir|S71185|S71185 splicing factor SF-2 homolog - Arabidopsis
            thaliana>gb:ATHRIBNUCP_1553349 Arabidopis thaliana
            ribonucleoprotein mRNA, complete cds.
          Length = 303

 Score = 44.3 bits (103), Expect = 0.006
 Identities = 28/83 (33%), Positives = 40/83 (48%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSL 898
            RT++V  LP D++ RE+ +LF +        LK   R     AF  F D + A  A+H  
Sbjct: 7    RTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPR-PPGYAFVEFDDARDAEDAIHGR 65

Query: 897  NGVKFDPQTGSTLHIEIARSNSR 829
            +G  FD   G  L +E+A    R
Sbjct: 66   DGYDFD---GHRLRVELAHGGRR 85



>sp|O22315|SFR1_ARATH Pre-mRNA splicing factor SF2 (SR1
            protein).>pir|F86158|F86158 alternative splicing factor
            SF2a [imported] - Arabidopsis thaliana>gb:AE005172_889303
            Arabidopsis thaliana chromosome 1, top arm complete
            sequence.>gb:AC009525_1536838 Arabidopsis thaliana
            chromosome I BAC F22D16 genomic sequence, complete
            sequence.>gb:AY085920_1570983 Arabidopsis thaliana clone
            19681 mRNA, complete sequence.>gb:AF001035_1760519
            Arabidopsis thaliana ASF/SF2 homolog (SF2) gene, complete
            cds.>gb:AK118379_1816360 Arabidopsis thaliana At1g02840
            mRNA for putative ribonucleoprotein SF-2, complete cds,
            clone: RAFL19-64-H16.
          Length = 303

 Score = 44.3 bits (103), Expect = 0.006
 Identities = 28/83 (33%), Positives = 40/83 (48%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSL 898
            RT++V  LP D++ RE+ +LF +        LK   R     AF  F D + A  A+H  
Sbjct: 7    RTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPR-PPGYAFVEFDDARDAEDAIHGR 65

Query: 897  NGVKFDPQTGSTLHIEIARSNSR 829
            +G  FD   G  L +E+A    R
Sbjct: 66   DGYDFD---GHRLRVELAHGGRR 85



>gb:AK118074_1816074 Arabidopsis thaliana At4g02430 mRNA for unknown
            protein, complete cds, clone: RAFL19-32-J05.
          Length = 178

 Score = 43.9 bits (102), Expect = 0.007
 Identities = 30/93 (32%), Positives = 44/93 (47%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSL 898
            RT++V  LP D++ RE+ +LF +        LK   R     AF  F D + A  A++  
Sbjct: 7    RTIYVGNLPGDIREREVEDLFSKYGPVVQIDLKIPPR-PPGYAFVEFEDARDADDAIYGR 65

Query: 897  NGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPY 799
            +G  FD   G  L +E+A    RR+     G Y
Sbjct: 66   DGYDFD---GHHLRVELAH-GGRRSSHDARGSY 94



>pir|T01307|T01307 alternative splicing factor ASF-2 homolog T14P8.21
            - Arabidopsis thaliana>gb:ATCHRIV6_1546231 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            6.>gb:T14P8_1723440 Arabidopsis thaliana BAC T14P8.
          Length = 294

 Score = 43.9 bits (102), Expect = 0.007
 Identities = 30/93 (32%), Positives = 44/93 (47%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSL 898
            RT++V  LP D++ RE+ +LF +        LK   R     AF  F D + A  A++  
Sbjct: 7    RTIYVGNLPGDIREREVEDLFSKYGPVVQIDLKIPPR-PPGYAFVEFEDARDADDAIYGR 65

Query: 897  NGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPY 799
            +G  FD   G  L +E+A    RR+     G Y
Sbjct: 66   DGYDFD---GHHLRVELAH-GGRRSSHDARGSY 94



>pir|S34448|S34448 small nuclear ribonucleoprotein U2B'' -
           potato>gb:POTU2B_1701159 Solanum tuberosum spliceosomal
           protein (U2B) mRNA, complete cds.
          Length = 231

 Score = 43.5 bits (101), Expect = 0.009
 Identities = 31/107 (28%), Positives = 50/107 (46%), Gaps = 1/107 (0%)
 Frame = -3

Query: 657 SGEKVGDGDNVLAAQSEQIEKIGDGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLK 478
           +G +        AA  +      D   P + LFI NL    T   L  +  QYPGF  ++
Sbjct: 128 NGPRTDSNGGPAAASRQGKPSAQDVAEPNNILFIQNLPHETTSMMLEVLFKQYPGFREVR 187

Query: 477 -VRARGGMPVAFADFEGVEEATQVMNALQGSSLPSSDRGGMHIEYAR 340
            + A+ G  +AF +F+   +++  M ALQG  +  + +  M I YA+
Sbjct: 188 MIEAKPG--IAFVEFDDDVQSSVAMQALQGFKI--TPQNPMAITYAK 230



 Score = 37.7 bits (86), Expect = 0.52
 Identities = 20/66 (30%), Positives = 32/66 (48%)
 Frame = -3

Query: 1071 LFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNG 892
            LF+  LP +  +  +  LF++ PGF   ++     G   +AF  F D   +  A+ +L G
Sbjct: 159  LFIQNLPHETTSMMLEVLFKQYPGFREVRMIEAKPG---IAFVEFDDDVQSSVAMQALQG 215

Query: 891  VKFDPQ 874
             K  PQ
Sbjct: 216  FKITPQ 221



>gb:CEY111B2A_1369308 Caenorhabditis elegans YAC Y111B2A, complete
            sequence.
          Length = 258

 Score = 43.1 bits (100), Expect = 0.012
 Identities = 28/90 (31%), Positives = 46/90 (51%)
 Frame = -3

Query: 1071 LFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNG 892
            ++V  LP DV+ +E+ ++F +    +   +K +GRG    AF  F DH+ A  A+ + +G
Sbjct: 11   VYVGNLPGDVREKEVEDIFHKYGRIKYVDIK-SGRGP-AFAFVEFEDHRDAEDAVRARDG 68

Query: 891  VKFDPQTGSTLHIEIARSNSRRTKRPGSGP 802
             +FD   G  + +E  R    R   PG  P
Sbjct: 69   YEFD---GRRIRVEFTRGVGPR--GPGGRP 93



>gb:BC072799_2556726 Xenopus laevis MGC80122 protein, mRNA (cDNA
           clone MGC:80122 IMAGE:4968622), complete cds.
          Length = 223

 Score = 42.4 bits (98), Expect = 0.021
 Identities = 30/94 (31%), Positives = 46/94 (48%)
 Frame = -3

Query: 621 AAQSEQIEKIGDGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFA 442
           A+Q+ Q++       P   LF+ NL     E  L  + +Q+PGF  +++   G   +AF 
Sbjct: 136 ASQNTQVQD----NPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRL-VPGRHDIAFV 190

Query: 441 DFEGVEEATQVMNALQGSSLPSSDRGGMHIEYAR 340
           +FE   EA    +ALQG  +  S    M I YA+
Sbjct: 191 EFENETEAGSARDALQGFKITPSH--AMKITYAK 222



 Score = 36.2 bits (82), Expect = 1.5
 Identities = 22/65 (33%), Positives = 34/65 (52%)
 Frame = -3

Query: 1071 LFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNG 892
            LF++ LP++     +  LF + PGF+  +L   GR D  +AF  F +   A +A  +L G
Sbjct: 151  LFLNNLPEETNEMMLSMLFNQFPGFKEVRL-VPGRHD--IAFVEFENETEAGSARDALQG 207

Query: 891  VKFDP 877
             K  P
Sbjct: 208  FKITP 212



>gb:BC064164_2553717 Xenopus tropicalis hypothetical protein MGC75625,
            mRNA (cDNA clone MGC:75625 IMAGE:5379389), complete cds.
          Length = 386

 Score = 42.4 bits (98), Expect = 0.021
 Identities = 29/99 (29%), Positives = 46/99 (46%)
 Frame = -3

Query: 1092 ERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMA 913
            E D+ RTL+V  L  DV    I  +F +    +SC++     G+    F  F +H+ A A
Sbjct: 2    EEDLPRTLYVGNLSRDVTEPLILQVFSQLGPCKSCKMIMDTAGNDPYCFVEFFEHRHAAA 61

Query: 912  ALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYV 796
            +L ++NG K     G  + +  A + S + K   S   V
Sbjct: 62   SLAAMNGRKI---MGKEVKVNWATTPSSQKKDANSSSVV 97



>gb:AP006068_1860883 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0020D05.
          Length = 396

 Score = 42.4 bits (98), Expect = 0.021
 Identities = 23/81 (28%), Positives = 40/81 (49%)
 Frame = -3

Query: 567 TLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQGS 388
           T+++  L PN TEDELRK  ++Y    ++K+    G    F  F    +A + +  L GS
Sbjct: 269 TIYVGGLDPNATEDELRKAFAKYGDLASVKIPV--GKQCGFVQFVNRPDAEEALQGLNGS 326

Query: 387 SLPSSDRGGMHIEYARSKMRK 325
           ++    +  + + + RS   K
Sbjct: 327 TI---GKQAVRLSWGRSPASK 344



>gb:AP005755_1857270 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC
           clone:OSJNBb0019B14.>gb:AP006849_1863093 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OSJNBa0054F02.
          Length = 316

 Score = 42.0 bits (97), Expect = 0.028
 Identities = 22/69 (31%), Positives = 36/69 (52%)
 Frame = -3

Query: 588 DGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQV 409
           DG    +T+F+  L PN +ED+LR+  SQY   +++K+    G    F  F   + A   
Sbjct: 179 DGDLTNTTVFVGGLDPNVSEDDLRQTFSQYGEISSVKIPV--GKQCGFVQFVQRKNAEDA 236

Query: 408 MNALQGSSL 382
           +  L GS++
Sbjct: 237 LQGLNGSTI 245



>gb:AC135928_1742918 Oryza sativa (japonica cultivar-group) chromosome
            5 clone P0686B10, complete sequence.
          Length = 145

 Score = 42.0 bits (97), Expect = 0.028
 Identities = 26/78 (33%), Positives = 39/78 (50%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSL 898
            RT++V  LP D++ RE+ +LF +        LK   R     AF  F D + A  A++  
Sbjct: 7    RTIYVGNLPGDIREREVEDLFYKYGRIVDIDLKIPPR-PPGYAFVEFEDPRDAQDAIYGR 65

Query: 897  NGVKFDPQTGSTLHIEIA 844
            +G  FD   G  L +E+A
Sbjct: 66   HGYDFD---GHRLRVELA 80



>gb:AC135927_1742897 Oryza sativa (japonica cultivar-group) chromosome
            5 clone P0683B02, complete sequence.
          Length = 151

 Score = 42.0 bits (97), Expect = 0.028
 Identities = 26/78 (33%), Positives = 39/78 (50%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSL 898
            RT++V  LP D++ RE+ +LF +        LK   R     AF  F D + A  A++  
Sbjct: 7    RTIYVGNLPGDIREREVEDLFYKYGRIVDIDLKIPPR-PPGYAFVEFEDPRDAQDAIYGR 65

Query: 897  NGVKFDPQTGSTLHIEIA 844
            +G  FD   G  L +E+A
Sbjct: 66   HGYDFD---GHRLRVELA 80



>gb:D89144_1675262 Schizosaccharomyces pombe mRNA, partial cds, clone:
            SY 0568.
          Length = 129

 Score = 42.0 bits (97), Expect = 0.028
 Identities = 28/72 (38%), Positives = 38/72 (52%), Gaps = 3/72 (4%)
 Frame = -3

Query: 1098 KNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFVDH 928
            K ERD   TL V+ L DD +  E+ +LFRR  G +   L   K TGR  +  AF ++ D 
Sbjct: 42   KRERDDSATLRVTNLSDDTREEELRDLFRRFGGIQRVYLAKDKETGRA-KGFAFVSYYDR 100

Query: 927  QSAMAALHSLNG 892
              A+ A   L+G
Sbjct: 101  DCAIKARDRLDG 112



>gb:AY536125_1612327 Zea mays MEG5 (meg5) mRNA, complete cds.
          Length = 163

 Score = 42.0 bits (97), Expect = 0.028
 Identities = 30/98 (30%), Positives = 43/98 (43%), Gaps = 15/98 (15%)
 Frame = -3

Query: 639 DGDNVLAAQSEQIEKIGDGTHP--------CSTLFIANLGPNCTEDELRKILSQYPGFNT 484
           DG  ++         +G G  P         STL+I  L  NCT  E+  I   + GF  
Sbjct: 7   DGQRMMGVVGMDSRGMGYGGRPEPPLPPDASSTLYIEGLPANCTRREVSHIFRPFVGFRE 66

Query: 483 LKV-----RARGGMP--VAFADFEGVEEATQVMNALQG 391
           +++     R  GG P  + F DF+   +AT  + ALQG
Sbjct: 67  VRLVNKESRHPGGDPHVLCFVDFDNPAQATIALEALQG 104



 Score = 38.5 bits (88), Expect = 0.31
 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 5/90 (5%)
 Frame = -3

Query: 1146 RPQPLPIPDYGYTVGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL----- 982
            RP+P P+P            D   TL++ GLP +   RE+ ++FR   GF   +L     
Sbjct: 27   RPEP-PLPP-----------DASSTLYIEGLPANCTRREVSHIFRPFVGFREVRLVNKES 74

Query: 981  KYTGRGDQVVAFATFVDHQSAMAALHSLNG 892
            ++ G    V+ F  F +   A  AL +L G
Sbjct: 75   RHPGGDPHVLCFVDFDNPAQATIALEALQG 104



>gb:AY094463_1575760 Arabidopsis thaliana At2g43410/T1O24.15 mRNA,
           complete cds.>gb:BT003029_1636611 Arabidopsis thaliana
           At2g43410/T1O24.15 gene, complete cds.
          Length = 901

 Score = 42.0 bits (97), Expect = 0.028
 Identities = 27/83 (32%), Positives = 42/83 (50%)
 Frame = -3

Query: 588 DGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQV 409
           D     + L++ +L P  TE +L ++  +Y   + + V +  G   AF  +  VEEA   
Sbjct: 12  DSGFQSNNLWVGSLTPETTESDLTELFGRYGDIDRITVYSSRGF--AFIYYRHVEEAVAA 69

Query: 408 MNALQGSSLPSSDRGGMHIEYAR 340
             ALQG++L  S    + IEYAR
Sbjct: 70  KEALQGANLNGSQ---IKIEYAR 89



 Score = 36.2 bits (82), Expect = 1.5
 Identities = 24/89 (26%), Positives = 45/89 (50%), Gaps = 5/89 (5%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQY---PGFNTLKVRARGGMPVAFADFEGVEEATQVM 406
           PC +L++  +GPN ++D+L +  S++     F  L+ R       AF D+  +++     
Sbjct: 93  PCKSLWVGGIGPNVSKDDLEEEFSKFGKIEDFRFLRER-----KTAFIDYYEMDD----- 142

Query: 405 NALQGSSLPSSDRGG--MHIEYARSKMRK 325
            ALQ  S+     GG  + +++ RS+  K
Sbjct: 143 -ALQAKSMNGKPMGGSFLRVDFLRSQAPK 170



>gb:AB011823_1511585 Schizosaccharomyces pombe mRNA for translation
            initiation factor 3, partial cds.
          Length = 280

 Score = 42.0 bits (97), Expect = 0.028
 Identities = 28/72 (38%), Positives = 38/72 (52%), Gaps = 3/72 (4%)
 Frame = -3

Query: 1098 KNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFVDH 928
            K ERD   TL V+ L DD +  E+ +LFRR  G +   L   K TGR  +  AF ++ D 
Sbjct: 193  KRERDDSATLRVTNLSDDTREEELRDLFRRFGGIQRVYLAKDKETGRA-KGFAFVSYYDR 251

Query: 927  QSAMAALHSLNG 892
              A+ A   L+G
Sbjct: 252  DCAIKARDRLDG 263



>gb:AX420420_1468201 Sequence 2 from Patent WO0212518.
          Length = 901

 Score = 42.0 bits (97), Expect = 0.028
 Identities = 27/83 (32%), Positives = 42/83 (50%)
 Frame = -3

Query: 588 DGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQV 409
           D     + L++ +L P  TE +L ++  +Y   + + V +  G   AF  +  VEEA   
Sbjct: 12  DSGFQSNNLWVGSLTPETTESDLTELFGRYGDIDRITVYSSRGF--AFIYYRHVEEAVAA 69

Query: 408 MNALQGSSLPSSDRGGMHIEYAR 340
             ALQG++L  S    + IEYAR
Sbjct: 70  KEALQGANLNGSQ---IKIEYAR 89



 Score = 36.2 bits (82), Expect = 1.5
 Identities = 24/89 (26%), Positives = 45/89 (50%), Gaps = 5/89 (5%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQY---PGFNTLKVRARGGMPVAFADFEGVEEATQVM 406
           PC +L++  +GPN ++D+L +  S++     F  L+ R       AF D+  +++     
Sbjct: 93  PCKSLWVGGIGPNVSKDDLEEEFSKFGKIEDFRFLRER-----KTAFIDYYEMDD----- 142

Query: 405 NALQGSSLPSSDRGG--MHIEYARSKMRK 325
            ALQ  S+     GG  + +++ RS+  K
Sbjct: 143 -ALQAKSMNGKPMGGSFLRVDFLRSQAPK 170



>gb:AF242767_1254874 Caenorhabditis elegans SF2 mRNA, complete cds.
          Length = 258

 Score = 42.0 bits (97), Expect = 0.028
 Identities = 24/77 (31%), Positives = 42/77 (54%)
 Frame = -3

Query: 1071 LFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNG 892
            ++V  LP DV+ +E+ ++F +    +   +K +GRG    AF  F DH+ A  A+ + +G
Sbjct: 11   VYVGNLPGDVREKEVEDIFHKYGRIKYVDIK-SGRGP-AFAFVEFEDHRDAEDAVRARDG 68

Query: 891  VKFDPQTGSTLHIEIAR 841
             +FD   G  + +E  R
Sbjct: 69   YEFD---GRRIRVEFTR 82



>sp|P78795|IF34_SCHPO Probable eukaryotic translation initiation
            factor 3 RNA-binding subunit (eIF-3 RNA-binding subunit)
            (eIF3 p33) (Translation initiation factor eIF3, p33
            subunit).>pir|T39767|T39767 translation initiation factor
            eIF-3 RNA-binding subunit [imported] - fission yeast
            (Schizosaccharomyces pombe)>gb:SPBC18H10_1719374 S.pombe
            chromosome II cosmid c18H10.
          Length = 282

 Score = 42.0 bits (97), Expect = 0.028
 Identities = 28/72 (38%), Positives = 38/72 (52%), Gaps = 3/72 (4%)
 Frame = -3

Query: 1098 KNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFVDH 928
            K ERD   TL V+ L DD +  E+ +LFRR  G +   L   K TGR  +  AF ++ D 
Sbjct: 195  KRERDDSATLRVTNLSDDTREEELRDLFRRFGGIQRVYLAKDKETGRA-KGFAFVSYYDR 253

Query: 927  QSAMAALHSLNG 892
              A+ A   L+G
Sbjct: 254  DCAIKARDRLDG 265



>gb:AF324983_1786437 Arabidopsis thaliana AT5g54900
            (AT5g54900/MBG8_17) mRNA, complete cds.
          Length = 387

 Score = 41.6 bits (96), Expect = 0.036
 Identities = 57/285 (20%), Positives = 100/285 (35%), Gaps = 35/285 (12%)
 Frame = -3

Query: 1131 PIPDYGYTVGNKNERDM--IRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGR 967
            P+  + Y +G++N      +++L++  L   +    I ++F +     S ++   K TG+
Sbjct: 40   PLGQHQYGIGSQNPGSASDVKSLWIGDLQQWMDENYIMSVFAQSGEATSAKVIRNKLTGQ 99

Query: 966  GDQVVAFATFVDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGP----- 802
             +    F  FV H  A   L + NG    P T  T  +  A++ +   +    GP     
Sbjct: 100  SEGY-GFIEFVSHSVAERVLQTYNGAPM-PSTEQTFRLNWAQAGAGEKRFQTEGPDHTIF 157

Query: 801  ----------YVVIDNRSKSNTDAKGTXXXXXXXXXXXXXXXXXXXXXXXXXXXS-XEKS 655
                      Y++ D         KG                            +  E +
Sbjct: 158  VGDLAPEVTDYMLSDTFKNVYGSVKGAKVVLDRTTGRSKGYGFVRFADENEQMRAMTEMN 217

Query: 654  GE-------KVGDGDNVLAA-------QSEQIEKIGDGTHPCSTLFIANLGPNCTEDELR 517
            G+       ++G   N  A        Q+ Q    GD     +T+F+  L  N T+DEL+
Sbjct: 218  GQYCSTRPMRIGPAANKNALPMQPAMYQNTQGANAGDNDPNNTTIFVGGLDANVTDDELK 277

Query: 516  KILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQGSSL 382
             I  Q+     L V+   G    F  +     A   ++ L G+ L
Sbjct: 278  SIFGQFG--ELLHVKIPPGKRCGFVQYANKASAEHALSVLNGTQL 320



>gb:AE017349_1758512 Cryptococcus neoformans var. neoformans JEC21
            chromosome 9, complete sequence.
          Length = 455

 Score = 41.6 bits (96), Expect = 0.036
 Identities = 28/98 (28%), Positives = 51/98 (52%), Gaps = 3/98 (3%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKY---TGRGDQVVAFATFVDHQSAMAAL 907
            +T+FV+ +P DV   ++ N+F       + ++K+   TGR  +  AF  F D  +A++A+
Sbjct: 7    KTVFVANIPYDVSEEQLANVFSEAGPVANVEIKFDANTGR-SKGYAFVQFYDEATALSAV 65

Query: 906  HSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVV 793
             +L      P  G  L +E++ ++    +R G GP  V
Sbjct: 66   RNLQDA---PVNGRNLRVELS-TDEPGPRRRGPGPGAV 99



>gb:AB005232_1509295 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MBG8.
          Length = 390

 Score = 41.6 bits (96), Expect = 0.036
 Identities = 57/285 (20%), Positives = 100/285 (35%), Gaps = 35/285 (12%)
 Frame = -3

Query: 1131 PIPDYGYTVGNKNERDM--IRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGR 967
            P+  + Y +G++N      +++L++  L   +    I ++F +     S ++   K TG+
Sbjct: 40   PLGQHQYGIGSQNPGSASDVKSLWIGDLQQWMDENYIMSVFAQSGEATSAKVIRNKLTGQ 99

Query: 966  GDQVVAFATFVDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGP----- 802
             +    F  FV H  A   L + NG    P T  T  +  A++ +   +    GP     
Sbjct: 100  SEGY-GFIEFVSHSVAERVLQTYNGAPM-PSTEQTFRLNWAQAGAGEKRFQTEGPDHTIF 157

Query: 801  ----------YVVIDNRSKSNTDAKGTXXXXXXXXXXXXXXXXXXXXXXXXXXXS-XEKS 655
                      Y++ D         KG                            +  E +
Sbjct: 158  VGDLAPEVTDYMLSDTFKNVYGSVKGAKVVLDRTTGRSKGYGFVRFADENEQMRAMTEMN 217

Query: 654  GE-------KVGDGDNVLAA-------QSEQIEKIGDGTHPCSTLFIANLGPNCTEDELR 517
            G+       ++G   N  A        Q+ Q    GD     +T+F+  L  N T+DEL+
Sbjct: 218  GQYCSTRPMRIGPAANKNALPMQPAMYQNTQGANAGDNDPNNTTIFVGGLDANVTDDELK 277

Query: 516  KILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQGSSL 382
             I  Q+     L V+   G    F  +     A   ++ L G+ L
Sbjct: 278  SIFGQFG--ELLHVKIPPGKRCGFVQYANKASAEHALSVLNGTQL 320



>gb:AY542999_1334455 Bigelowiella natans small nuclear
           ribonucleoprotein mRNA, complete cds.
          Length = 227

 Score = 41.6 bits (96), Expect = 0.036
 Identities = 29/100 (29%), Positives = 48/100 (48%), Gaps = 1/100 (1%)
 Frame = -3

Query: 636 GDNVLAAQSEQIEKIGDGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGM 457
           G+   A ++++ E+  D + P   LF  NL P  T+  L  +  QY GF   +VR   G 
Sbjct: 132 GEGAPAMETDEPEE-EDSSPPNKILFARNLPPQATKKMLETLFKQYDGFK--EVRLVDGK 188

Query: 456 P-VAFADFEGVEEATQVMNALQGSSLPSSDRGGMHIEYAR 340
           P +AF +F   +E+      LQ   + S  +  M + +A+
Sbjct: 189 PDIAFIEFNDAQESALAKEGLQNFKITS--QNAMKLTFAK 226



>sp|P31483|TIA1_HUMAN Nucleolysin TIA-1 (RNA-binding protein TIA-1)
            (p40-TIA-1) [Contains: Nucleolysin TIA-1 isoform p15
            (p15-TIA-1)].
          Length = 386

 Score = 41.6 bits (96), Expect = 0.036
 Identities = 32/108 (29%), Positives = 53/108 (49%)
 Frame = -3

Query: 1092 ERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMA 913
            E +M +TL+V  L  DV    I  LF +    ++C++     G+    F  F +H+ A A
Sbjct: 2    EDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAA 61

Query: 912  ALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVVIDNRSKSN 769
            AL ++NG K     G  + +  A + S + K+  S   VV   RS+++
Sbjct: 62   ALAAMNGRKI---MGKEVKVNWATTPSSQ-KKDTSSSTVVSTQRSQNH 105



>gb:XLA416632_2582569 Xenopus laevis partial mRNA for TIA-1 protein.
          Length = 388

 Score = 41.2 bits (95), Expect = 0.047
 Identities = 28/99 (28%), Positives = 46/99 (46%)
 Frame = -3

Query: 1092 ERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMA 913
            E D+ +TL+V  L  DV    I  +F +    +SC++     G+    F  F +H+ A A
Sbjct: 2    EEDLPKTLYVGNLSRDVTEPLILQVFSQLGPCKSCKMIMDTAGNDPYCFVEFFEHRHAAA 61

Query: 912  ALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYV 796
            +L ++NG K     G  + +  A + S + K   S   V
Sbjct: 62   SLAAINGRKI---LGKEVKVNWATTPSSQKKDANSSSVV 97



>gb:BC084519_2563890 Xenopus tropicalis hypothetical LOC496533, mRNA
           (cDNA clone MGC:89754 IMAGE:7027405), complete cds.
          Length = 223

 Score = 41.2 bits (95), Expect = 0.047
 Identities = 30/93 (32%), Positives = 45/93 (48%)
 Frame = -3

Query: 621 AAQSEQIEKIGDGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFA 442
           A+Q++Q+        P   LF+ NL     E  L  + +Q+PGF  +++   G   +AF 
Sbjct: 136 ASQNQQVPD----NPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRL-VPGRHDIAFV 190

Query: 441 DFEGVEEATQVMNALQGSSLPSSDRGGMHIEYA 343
           +FE   EA    +ALQG  +  S    M I YA
Sbjct: 191 EFENETEAGAARDALQGFKITPSH--AMKITYA 221



 Score = 37.4 bits (85), Expect = 0.68
 Identities = 23/65 (35%), Positives = 34/65 (52%)
 Frame = -3

Query: 1071 LFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNG 892
            LF++ LP++     +  LF + PGF+  +L   GR D  +AF  F +   A AA  +L G
Sbjct: 151  LFLNNLPEETNEMMLSMLFNQFPGFKEVRL-VPGRHD--IAFVEFENETEAGAARDALQG 207

Query: 891  VKFDP 877
             K  P
Sbjct: 208  FKITP 212



>gb:BC077169_2559887 Xenopus laevis cDNA clone MGC:78766
            IMAGE:3399692, complete cds.
          Length = 385

 Score = 41.2 bits (95), Expect = 0.047
 Identities = 28/99 (28%), Positives = 46/99 (46%)
 Frame = -3

Query: 1092 ERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMA 913
            E D+ +TL+V  L  DV    I  +F +    +SC++     G+    F  F +H+ A A
Sbjct: 2    EEDLPKTLYVGNLSRDVTEPLILQVFSQLGPCKSCKMIMDTAGNDPYCFVEFFEHRHAAA 61

Query: 912  ALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYV 796
            +L ++NG K     G  + +  A + S + K   S   V
Sbjct: 62   SLAAINGRKI---LGKEVKVNWATTPSSQKKDANSSSVV 97



>gb:BC015944_1975402 Homo sapiens TIA1 cytotoxic granule-associated
            RNA binding protein, mRNA (cDNA clone MGC:9449
            IMAGE:3909177), complete cds.
          Length = 214

 Score = 41.2 bits (95), Expect = 0.047
 Identities = 32/108 (29%), Positives = 52/108 (48%)
 Frame = -3

Query: 1092 ERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMA 913
            E +M +TL+V  L  DV    I  LF +    ++C++     G+    F  F +H+ A A
Sbjct: 2    EDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAA 61

Query: 912  ALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVVIDNRSKSN 769
            AL ++NG K     G  + +  A + S + K+  S   VV   RS+ +
Sbjct: 62   ALAAMNGRKI---MGKEVKVNWATTPSSQ-KKDTSSSTVVSTQRSQDH 105



>gb:AP005735_1856854 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC
           clone:OSJNBb0034B12.>gb:AP006756_1862911 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, PAC
           clone:P0450E05.
          Length = 900

 Score = 41.2 bits (95), Expect = 0.047
 Identities = 27/84 (32%), Positives = 41/84 (48%)
 Frame = -3

Query: 591 GDGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQ 412
           G G    +TL++ NL     ED++    S +   + +  RA G    AF  F  V EA  
Sbjct: 39  GSGAPETNTLWVGNLPAQAAEDDVMASFSPHGALDCVMARA-GPRSYAFVLFRSVPEARA 97

Query: 411 VMNALQGSSLPSSDRGGMHIEYAR 340
            ++ALQGS +  S    + +E+AR
Sbjct: 98  ALDALQGSKVKGS---VVRLEFAR 118



>gb:AP004163_1838449 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1323_A06.>gb:AP004704_1843685 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0544G09.
          Length = 294

 Score = 41.2 bits (95), Expect = 0.047
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 7/67 (10%)
 Frame = -3

Query: 570 STLFIANLGPNCTEDELRKILSQYPGFNTLKV-----RARGGMP--VAFADFEGVEEATQ 412
           STL++  L  NCT  E+  I   + GF  +++     R  GG P  + F DF+   +AT 
Sbjct: 169 STLYVEGLPANCTRREVSHIFRPFVGFREVRLVNKESRHPGGDPHVLCFVDFDNPAQATL 228

Query: 411 VMNALQG 391
            + ALQG
Sbjct: 229 ALEALQG 235



 Score = 38.9 bits (89), Expect = 0.23
 Identities = 28/90 (31%), Positives = 41/90 (45%), Gaps = 5/90 (5%)
 Frame = -3

Query: 1146 RPQPLPIPDYGYTVGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL----- 982
            RP+P P+P            D   TL+V GLP +   RE+ ++FR   GF   +L     
Sbjct: 158  RPEP-PLP-----------ADASSTLYVEGLPANCTRREVSHIFRPFVGFREVRLVNKES 205

Query: 981  KYTGRGDQVVAFATFVDHQSAMAALHSLNG 892
            ++ G    V+ F  F +   A  AL +L G
Sbjct: 206  RHPGGDPHVLCFVDFDNPAQATLALEALQG 235



>gb:AE016818_1748493 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome V, complete sequence.
          Length = 218

 Score = 41.2 bits (95), Expect = 0.047
 Identities = 28/97 (28%), Positives = 43/97 (44%), Gaps = 7/97 (7%)
 Frame = -3

Query: 1074 TLFVSGLPDDVKAREIHNLFRRRPGFESCQL-------KYTGRGDQVVAFATFVDHQSAM 916
            T+ VSG P + +AR++       P FE+                D+  AF  F  H+  +
Sbjct: 6    TVHVSGFPAETRARDM------APDFEAVGKIVRIDIPPMRPFQDRPFAFVKFETHEECV 59

Query: 915  AALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSG 805
             A+  L+G  F P T  T H+++ARS       P +G
Sbjct: 60   RAVEELDGRPFTPDTRFTYHVQVARSRPYAPYAPRNG 96



>gb:NCB7A16_1690126 Neurospora crassa DNA linkage group V BAC clone
            B7A16.
          Length = 343

 Score = 41.2 bits (95), Expect = 0.047
 Identities = 34/112 (30%), Positives = 51/112 (45%), Gaps = 5/112 (4%)
 Frame = -3

Query: 1131 PIPDYGYTVGNKNE--RDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGR 967
            P  D G + G + +  R+    LFV+G+   ++  E+  LF +    E CQ+    +TG 
Sbjct: 54   PAKDEGQSKGGEEDGARNPGSNLFVTGIHPRLEEAEVTRLFEKYGEVEKCQIMKDPHTGE 113

Query: 966  GDQVVAFATFVDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPG 811
              +   F   +  + A AA   L G   +   G TL IE+AR    RT  PG
Sbjct: 114  -SRGFGFVKMMTPEQANAAKEGLQGEVIE---GRTLSIEMARRARPRTPTPG 161



>gb:AY579889_1616031 Solanum tuberosum AML1 mRNA, complete cds.
          Length = 843

 Score = 41.2 bits (95), Expect = 0.047
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 2/70 (2%)
 Frame = -3

Query: 585 GTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTL--KVRARGGMPVAFADFEGVEEATQ 412
           G HP  TLF+ N+  N  + ELR +  QY    TL    + RG + +++ D   +  A  
Sbjct: 175 GEHPSRTLFVRNINSNVEDSELRTLFEQYGDIRTLYTACKHRGFVMISYFD---IRAART 231

Query: 411 VMNALQGSSL 382
            M ALQ   L
Sbjct: 232 AMRALQNKPL 241



>gb:AY579887_1616029 Citrus unshiu AML1 mRNA, complete cds.
          Length = 858

 Score = 41.2 bits (95), Expect = 0.047
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 2/70 (2%)
 Frame = -3

Query: 585 GTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTL--KVRARGGMPVAFADFEGVEEATQ 412
           G HP  TLF+ N+  N  + ELR +  QY    TL    + RG + +++ D   +  A  
Sbjct: 188 GEHPSRTLFVRNINSNVEDSELRALFEQYGDIRTLYTACKHRGFVMISYYD---IRAART 244

Query: 411 VMNALQGSSL 382
            M ALQ   L
Sbjct: 245 AMRALQNKPL 254



>gb:AY579881_1616023 Medicago truncatula AML1 mRNA, complete cds.
          Length = 856

 Score = 41.2 bits (95), Expect = 0.047
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 2/70 (2%)
 Frame = -3

Query: 585 GTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTL--KVRARGGMPVAFADFEGVEEATQ 412
           G HP  TLF+ N+  N  + ELR +  QY    TL    + RG + +++ D   +  A  
Sbjct: 193 GEHPSRTLFVRNINSNVEDSELRTLFEQYGDIRTLYTACKHRGFVMISYYD---IRAART 249

Query: 411 VMNALQGSSL 382
            M ALQ   L
Sbjct: 250 AMRALQNKPL 259



>sp|P52912|TIA1_MOUSE Nucleolysin TIA-1 (RNA-binding protein
            TIA-1).>pir|S72435|S72435 RNA-binding protein TIA-1 -
            mouse>gb:AK088486_1175436 Mus musculus 2 days neonate
            thymus thymic cells cDNA, RIKEN full-length enriched
            library, clone:E430018M15 product:cytotoxic
            granule-associated RNA binding protein 1, full insert
            sequence.>gb:MMU55862_2122414 Mus musculus RNA binding
            protein TIA-1 mRNA, complete cds.>gb:U00689_2140176 Mus
            musculus TIA mRNA, complete cds.
          Length = 386

 Score = 41.2 bits (95), Expect = 0.047
 Identities = 32/108 (29%), Positives = 52/108 (48%)
 Frame = -3

Query: 1092 ERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMA 913
            E +M +TL+V  L  DV    I  LF +    ++C++     G+    F  F +H+ A A
Sbjct: 2    EDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAA 61

Query: 912  ALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVVIDNRSKSN 769
            AL ++NG K     G  + +  A + S + K+  S   VV   RS+ +
Sbjct: 62   ALAAMNGRKI---MGKEVKVNWATTPSSQ-KKDTSSSTVVSTQRSQDH 105



>gb:BC080105_2561537 Xenopus laevis MGC84540 protein, mRNA (cDNA clone
            MGC:84540 IMAGE:5084535), complete cds.
          Length = 389

 Score = 40.8 bits (94), Expect = 0.062
 Identities = 28/99 (28%), Positives = 46/99 (46%)
 Frame = -3

Query: 1092 ERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMA 913
            E ++ RTL+V  L  DV    I  +F +    +SC++     G+    F  F +H+ A A
Sbjct: 2    EEELPRTLYVGNLSRDVTEPLILQVFSQLGPCKSCKMIMDTAGNDPYCFVEFFEHRHAAA 61

Query: 912  ALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYV 796
            +L ++NG K     G  + +  A + S + K   S   V
Sbjct: 62   SLAAINGRKI---MGKEVKVNWATTPSSQKKDANSSSVV 97



>gb:MMU2SNRP1_2120527 M.musculus mRNA for U2-snRNP b'' (pRNP11).
          Length = 97

 Score = 40.8 bits (94), Expect = 0.062
 Identities = 27/79 (34%), Positives = 40/79 (50%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNAL 397
           P   LF+ NL     E  L  +L+Q+PGF  +++   G   +AF +FE   +A    +AL
Sbjct: 21  PNYILFLNNLPEETNEMMLSMLLNQFPGFKEVRL-VPGRHDIAFVEFENDGQAGAARDAL 79

Query: 396 QGSSLPSSDRGGMHIEYAR 340
           QG  +  S    M I YA+
Sbjct: 80  QGFKITPSH--AMKITYAK 96



 Score = 34.3 bits (77), Expect = 5.8
 Identities = 22/65 (33%), Positives = 33/65 (50%)
 Frame = -3

Query: 1071 LFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNG 892
            LF++ LP++     +  L  + PGF+  +L   GR D  +AF  F +   A AA  +L G
Sbjct: 25   LFLNNLPEETNEMMLSMLLNQFPGFKEVRL-VPGRHD--IAFVEFENDGQAGAARDALQG 81

Query: 891  VKFDP 877
             K  P
Sbjct: 82   FKITP 86



>gb:AY579882_1616024 Medicago truncatula AML5 mRNA, complete cds.
          Length = 865

 Score = 40.8 bits (94), Expect = 0.062
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 2/70 (2%)
 Frame = -3

Query: 585 GTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTL--KVRARGGMPVAFADFEGVEEATQ 412
           G HP  TLF+ N+  N  + ELR +  QY    TL    + RG + +++ D   +  A  
Sbjct: 191 GEHPSRTLFVRNINSNVEDTELRTLFEQYGDIRTLYTACKHRGFVMISYYD---IRAART 247

Query: 411 VMNALQGSSL 382
            M ALQ   L
Sbjct: 248 AMRALQNKPL 257



>gb:BC087064_2109960 Rattus norvegicus cytotoxic granule-associated
            RNA binding protein 1 (predicted), mRNA (cDNA clone
            MGC:94287 IMAGE:7132038), complete cds.
          Length = 375

 Score = 40.4 bits (93), Expect = 0.080
 Identities = 30/109 (27%), Positives = 51/109 (46%)
 Frame = -3

Query: 1092 ERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMA 913
            E +M +TL+V  L  DV    I  LF +    ++C++     G+    F  F +H+ A A
Sbjct: 2    EDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAA 61

Query: 912  ALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVVIDNRSKSNT 766
            AL ++NG K     G  + +  A + S + K   +  +V + + S   T
Sbjct: 62   ALAAMNGRKI---MGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEIT 107



>gb:BC023813_2094268 Mus musculus cytotoxic granule-associated RNA
            binding protein 1, mRNA (cDNA clone MGC:36034
            IMAGE:5353938), complete cds.
          Length = 285

 Score = 40.4 bits (93), Expect = 0.080
 Identities = 30/109 (27%), Positives = 51/109 (46%)
 Frame = -3

Query: 1092 ERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMA 913
            E +M +TL+V  L  DV    I  LF +    ++C++     G+    F  F +H+ A A
Sbjct: 2    EDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAA 61

Query: 912  ALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVVIDNRSKSNT 766
            AL ++NG K     G  + +  A + S + K   +  +V + + S   T
Sbjct: 62   ALAAMNGRKI---MGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEIT 107



>gb:AY649843_1620131 Zea mays ASF/SF2-like pre-mRNA splicing factor
            SRP31 (srp31) gene, complete cds, alternatively spliced.
          Length = 253

 Score = 40.4 bits (93), Expect = 0.080
 Identities = 29/101 (28%), Positives = 43/101 (42%)
 Frame = -3

Query: 1074 TLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLN 895
            T++V  LP D++ RE+ +LF +        LK   R     AF  F D + A  A++  +
Sbjct: 8    TIYVGNLPGDIREREVDDLFYKYGRIVEIDLKIPPR-PPGFAFVEFEDARDAEDAIYGRD 66

Query: 894  GVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVVIDNRSKS 772
            G  FD   G  L +E+A      +    S  Y     R  S
Sbjct: 67   GYNFD---GHRLRVELAHGGRGTSSFDRSSSYSSAGQRGAS 104



>gb:AY649843_1620130 Zea mays ASF/SF2-like pre-mRNA splicing factor
            SRP31 (srp31) gene, complete cds, alternatively spliced.
          Length = 264

 Score = 40.4 bits (93), Expect = 0.080
 Identities = 29/101 (28%), Positives = 43/101 (42%)
 Frame = -3

Query: 1074 TLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLN 895
            T++V  LP D++ RE+ +LF +        LK   R     AF  F D + A  A++  +
Sbjct: 8    TIYVGNLPGDIREREVDDLFYKYGRIVEIDLKIPPR-PPGFAFVEFEDARDAEDAIYGRD 66

Query: 894  GVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVVIDNRSKS 772
            G  FD   G  L +E+A      +    S  Y     R  S
Sbjct: 67   GYNFD---GHRLRVELAHGGRGTSSFDRSSSYSSAGQRGAS 104



>gb:AY649843_1620129 Zea mays ASF/SF2-like pre-mRNA splicing factor
            SRP31 (srp31) gene, complete cds, alternatively spliced.
          Length = 276

 Score = 40.4 bits (93), Expect = 0.080
 Identities = 29/101 (28%), Positives = 43/101 (42%)
 Frame = -3

Query: 1074 TLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLN 895
            T++V  LP D++ RE+ +LF +        LK   R     AF  F D + A  A++  +
Sbjct: 8    TIYVGNLPGDIREREVDDLFYKYGRIVEIDLKIPPR-PPGFAFVEFEDARDAEDAIYGRD 66

Query: 894  GVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVVIDNRSKS 772
            G  FD   G  L +E+A      +    S  Y     R  S
Sbjct: 67   GYNFD---GHRLRVELAHGGRGTSSFDRSSSYSSAGQRGAS 104



>gb:AY649842_1620127 Zea mays ASF/SF2-like pre-mRNA splicing factor
            SRP30 (srp30) gene, complete cds, alternatively spliced.
          Length = 241

 Score = 40.4 bits (93), Expect = 0.080
 Identities = 26/78 (33%), Positives = 39/78 (50%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSL 898
            RT++V  LP D++ RE+ +LF +        LK   R     AF  F D + A  A++  
Sbjct: 7    RTIYVGNLPGDIREREVEDLFYKYGRILDIDLKIPPR-PPGYAFVEFEDPRDADDAIYGR 65

Query: 897  NGVKFDPQTGSTLHIEIA 844
            +G  FD   G  L +E+A
Sbjct: 66   DGYNFD---GYRLRVELA 80



>gb:AY649842_1620126 Zea mays ASF/SF2-like pre-mRNA splicing factor
            SRP30 (srp30) gene, complete cds, alternatively spliced.
          Length = 260

 Score = 40.4 bits (93), Expect = 0.080
 Identities = 26/78 (33%), Positives = 39/78 (50%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSL 898
            RT++V  LP D++ RE+ +LF +        LK   R     AF  F D + A  A++  
Sbjct: 7    RTIYVGNLPGDIREREVEDLFYKYGRILDIDLKIPPR-PPGYAFVEFEDPRDADDAIYGR 65

Query: 897  NGVKFDPQTGSTLHIEIA 844
            +G  FD   G  L +E+A
Sbjct: 66   DGYNFD---GYRLRVELA 80



>pir|A39293|A39293 cytotoxic granule-associated RNA-binding protein
            TIA1 precursor, leukocyte - human
          Length = 375

 Score = 40.4 bits (93), Expect = 0.080
 Identities = 30/109 (27%), Positives = 51/109 (46%)
 Frame = -3

Query: 1092 ERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMA 913
            E +M +TL+V  L  DV    I  LF +    ++C++     G+    F  F +H+ A A
Sbjct: 2    EDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAA 61

Query: 912  ALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVVIDNRSKSNT 766
            AL ++NG K     G  + +  A + S + K   +  +V + + S   T
Sbjct: 62   ALAAMNGRKI---MGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPQIT 107



>pir|S59117|S59117 small nuclear ribonucleoprotein U1A -
           potato>gb:STU1A_1722973 S.tuberosum mRNA for
           U1snRNP-specific protein (U1A).
          Length = 253

 Score = 40.4 bits (93), Expect = 0.080
 Identities = 27/80 (33%), Positives = 43/80 (53%), Gaps = 1/80 (1%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQYPGFNTLK-VRARGGMPVAFADFEGVEEATQVMNA 400
           P S LF+ NL    T   L+ +  QYPGF  ++ + A+ G  +AF ++    ++T  M A
Sbjct: 177 PNSILFVQNLPHQSTPMMLQMLFCQYPGFKEVRMIEAKPG--IAFIEYGDEMQSTVAMQA 234

Query: 399 LQGSSLPSSDRGGMHIEYAR 340
           LQG  + + +   M I YA+
Sbjct: 235 LQGFKITAEN--PMLITYAK 252



>gb:AY189903_2517958 Gallus gallus TIA-1 mRNA, complete cds.
          Length = 372

 Score = 40.0 bits (92), Expect = 0.10
 Identities = 29/109 (26%), Positives = 51/109 (46%)
 Frame = -3

Query: 1092 ERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMA 913
            E +M +TL+V  L  DV    I  LF +    ++C++     G+    F  F +H+ A +
Sbjct: 2    EDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFYEHRHAAS 61

Query: 912  ALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVVIDNRSKSNT 766
            AL ++NG K     G  + +  A + S + K   +  +V + + S   T
Sbjct: 62   ALAAMNGRKI---MGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEIT 107



>gb:AY080742_1568456 Arabidopsis thaliana putative spliceosomal
           protein (U2B) (At1g06960) mRNA, complete cds.
          Length = 228

 Score = 40.0 bits (92), Expect = 0.10
 Identities = 26/84 (30%), Positives = 44/84 (52%), Gaps = 1/84 (1%)
 Frame = -3

Query: 588 DGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLK-VRARGGMPVAFADFEGVEEATQ 412
           D   P + LFI NL        L+ +  QYPGF  ++ + A+ G  +AF ++E   +++ 
Sbjct: 148 DTMPPNNILFIHNLPIETNSMMLQLLFEQYPGFKEIRMIEAKPG--IAFVEYEDDVQSSM 205

Query: 411 VMNALQGSSLPSSDRGGMHIEYAR 340
            M ALQG  +  + R  M + +A+
Sbjct: 206 AMQALQGFKI--TPRNPMVVSFAK 227



 Score = 33.9 bits (76), Expect = 7.5
 Identities = 18/66 (27%), Positives = 32/66 (48%)
 Frame = -3

Query: 1071 LFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNG 892
            LF+  LP +  +  +  LF + PGF+  ++     G   +AF  + D   +  A+ +L G
Sbjct: 156  LFIHNLPIETNSMMLQLLFEQYPGFKEIRMIEAKPG---IAFVEYEDDVQSSMAMQALQG 212

Query: 891  VKFDPQ 874
             K  P+
Sbjct: 213  FKITPR 218



>gb:ATH131214_1551981 Arabidopsis thaliana srp30 gene, exons 1-12.
          Length = 256

 Score = 40.0 bits (92), Expect = 0.10
 Identities = 27/83 (32%), Positives = 39/83 (46%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSL 898
            RT++V  LP D++  E+ +LF +        LK   R     AF  F D + A  A++  
Sbjct: 7    RTIYVGNLPGDIRKCEVEDLFYKYGPIVDIDLKIPPR-PPGYAFVEFEDPRDADDAIYGR 65

Query: 897  NGVKFDPQTGSTLHIEIARSNSR 829
            +G  FD   G  L +EIA    R
Sbjct: 66   DGYDFD---GCRLRVEIAHGGRR 85



>gb:ATH131214_1551980 Arabidopsis thaliana srp30 gene, exons
            1-12.>gb:AY150486_1585051 Arabidopsis thaliana putative
            SF2/ASF splicing modulator Srp30 (At1g09140) mRNA,
            complete cds.
          Length = 268

 Score = 40.0 bits (92), Expect = 0.10
 Identities = 27/83 (32%), Positives = 39/83 (46%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSL 898
            RT++V  LP D++  E+ +LF +        LK   R     AF  F D + A  A++  
Sbjct: 7    RTIYVGNLPGDIRKCEVEDLFYKYGPIVDIDLKIPPR-PPGYAFVEFEDPRDADDAIYGR 65

Query: 897  NGVKFDPQTGSTLHIEIARSNSR 829
            +G  FD   G  L +EIA    R
Sbjct: 66   DGYDFD---GCRLRVEIAHGGRR 85



>pir|E86223|E86223 hypothetical protein [imported] - Arabidopsis
            thaliana>gb:AE005172_889916 Arabidopsis thaliana
            chromosome 1, top arm complete sequence.>gb:T12M4_1723389
            Arabidopsis thaliana chromosome 1 BAC T12M4 sequence,
            complete sequence.
          Length = 237

 Score = 40.0 bits (92), Expect = 0.10
 Identities = 27/83 (32%), Positives = 39/83 (46%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSL 898
            RT++V  LP D++  E+ +LF +        LK   R     AF  F D + A  A++  
Sbjct: 7    RTIYVGNLPGDIRKCEVEDLFYKYGPIVDIDLKIPPR-PPGYAFVEFEDPRDADDAIYGR 65

Query: 897  NGVKFDPQTGSTLHIEIARSNSR 829
            +G  FD   G  L +EIA    R
Sbjct: 66   DGYDFD---GCRLRVEIAHGGRR 85



>gb:BC084107_2563513 Xenopus laevis hypothetical LOC495019, mRNA
           (cDNA clone MGC:84048 IMAGE:6947991), complete cds.
          Length = 223

 Score = 39.7 bits (91), Expect = 0.14
 Identities = 25/79 (31%), Positives = 40/79 (50%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNAL 397
           P   LF+ NL     E  L  + +Q+PGF  +++   G   +AF +F+   EA    +AL
Sbjct: 147 PNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRL-VPGRHDIAFVEFDNETEAGSARDAL 205

Query: 396 QGSSLPSSDRGGMHIEYAR 340
           QG  +  S+   M I +A+
Sbjct: 206 QGFKITPSN--AMKITFAK 222



 Score = 35.8 bits (81), Expect = 2.0
 Identities = 22/65 (33%), Positives = 34/65 (52%)
 Frame = -3

Query: 1071 LFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNG 892
            LF++ LP++     +  LF + PGF+  +L   GR D  +AF  F +   A +A  +L G
Sbjct: 151  LFLNNLPEETNEMMLSMLFNQFPGFKEVRL-VPGRHD--IAFVEFDNETEAGSARDALQG 207

Query: 891  VKFDP 877
             K  P
Sbjct: 208  FKITP 212



>gb:BC045368_2549210 Danio rerio zgc:55520, mRNA (cDNA clone MGC:55520
            IMAGE:2641991), complete cds.
          Length = 386

 Score = 39.7 bits (91), Expect = 0.14
 Identities = 29/104 (27%), Positives = 48/104 (46%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSL 898
            +TL+V  L  DV    I  LF +    +SC++     G+    F  F +H+ A A+L ++
Sbjct: 8    KTLYVGNLSRDVTEALIMQLFGQIGPCKSCKMIVDTAGNDPYCFVEFFEHRHAAASLAAM 67

Query: 897  NGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVVIDNRSKSNT 766
            NG K     G  + +  A S S + K   +  +V + + S   T
Sbjct: 68   NGRKI---MGKEVKVNWATSPSSQKKDTSNHFHVFVGDLSPEIT 108



>gb:BC049125_2099939 Mus musculus ELAV (embryonic lethal, abnormal
            vision, Drosophila)-like 2 (Hu antigen B), transcript
            variant 1, mRNA (cDNA clone MGC:61216 IMAGE:6821133),
            complete cds.>gb:BC058393_2103198 Mus musculus ELAV
            (embryonic lethal, abnormal vision, Drosophila)-like 2
            (Hu antigen B), transcript variant 1, mRNA (cDNA clone
            MGC:67040 IMAGE:6821133), complete cds.
          Length = 373

 Score = 39.7 bits (91), Expect = 0.14
 Identities = 28/95 (29%), Positives = 48/95 (50%), Gaps = 3/95 (3%)
 Frame = -3

Query: 1107 VGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATF 937
            V + N  D    L V+ LP ++   E+ +LF      ESC+L   K TG+      F  +
Sbjct: 43   VDSGNTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQS-LGYGFVNY 101

Query: 936  VDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNS 832
            +D + A  A+++LNG++   +   T+ +  AR +S
Sbjct: 102  IDPKDAEKAINTLNGLRLQTK---TIKVSYARPSS 133



>gb:BC046598_2099302 Mus musculus ELAV (embryonic lethal, abnormal
            vision, Drosophila)-like 2 (Hu antigen B), transcript
            variant 3, mRNA (cDNA clone MGC:54659 IMAGE:6312245),
            complete cds.
          Length = 347

 Score = 39.7 bits (91), Expect = 0.14
 Identities = 28/95 (29%), Positives = 48/95 (50%), Gaps = 3/95 (3%)
 Frame = -3

Query: 1107 VGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATF 937
            V + N  D    L V+ LP ++   E+ +LF      ESC+L   K TG+      F  +
Sbjct: 29   VDSGNTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQS-LGYGFVNY 87

Query: 936  VDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNS 832
            +D + A  A+++LNG++   +   T+ +  AR +S
Sbjct: 88   IDPKDAEKAINTLNGLRLQTK---TIKVSYARPSS 119



>gb:AY035379_2074233 Mus musculus ELAV-like neuronal protein-2 mRNA,
            complete cds, alternatively spliced.
          Length = 347

 Score = 39.7 bits (91), Expect = 0.14
 Identities = 28/95 (29%), Positives = 48/95 (50%), Gaps = 3/95 (3%)
 Frame = -3

Query: 1107 VGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATF 937
            V + N  D    L V+ LP ++   E+ +LF      ESC+L   K TG+      F  +
Sbjct: 29   VDSGNTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQS-LGYGFVNY 87

Query: 936  VDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNS 832
            +D + A  A+++LNG++   +   T+ +  AR +S
Sbjct: 88   IDPKDAEKAINTLNGLRLQTK---TIKVSYARPSS 119



>gb:AY035378_2074232 Mus musculus ELAV-like neuronal protein-3 mRNA,
            complete cds, alternatively spliced.
          Length = 348

 Score = 39.7 bits (91), Expect = 0.14
 Identities = 28/95 (29%), Positives = 48/95 (50%), Gaps = 3/95 (3%)
 Frame = -3

Query: 1107 VGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATF 937
            V + N  D    L V+ LP ++   E+ +LF      ESC+L   K TG+      F  +
Sbjct: 29   VDSGNTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQS-LGYGFVNY 87

Query: 936  VDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNS 832
            +D + A  A+++LNG++   +   T+ +  AR +S
Sbjct: 88   IDPKDAEKAINTLNGLRLQTK---TIKVSYARPSS 119



>gb:AL161628_1922056 Human DNA sequence from clone RP11-31K16 on
            chromosome 9 Contains a pseudogene similar to part of
            nucleolar protein 5A (56kDa with KKE/D repeat) (NOL5A)
            (NOP56), the ELAVL2 gene for ELAV (embryonic lethal,
            abnormal vision, Drosophila)-like 2 (Hu antigen B) (HUB,
            HELN1), two novel genes, the 5' end of a novel gene and a
            CpG island, complete sequence.
          Length = 189

 Score = 39.7 bits (91), Expect = 0.14
 Identities = 28/95 (29%), Positives = 48/95 (50%), Gaps = 3/95 (3%)
 Frame = -3

Query: 1107 VGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATF 937
            V + N  D    L V+ LP ++   E+ +LF      ESC+L   K TG+      F  +
Sbjct: 29   VDSGNTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQS-LGYGFVNY 87

Query: 936  VDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNS 832
            +D + A  A+++LNG++   +   T+ +  AR +S
Sbjct: 88   IDPKDAEKAINTLNGLRLQTK---TIKVSYARPSS 119



>gb:AL161628_1922055 Human DNA sequence from clone RP11-31K16 on
            chromosome 9 Contains a pseudogene similar to part of
            nucleolar protein 5A (56kDa with KKE/D repeat) (NOL5A)
            (NOP56), the ELAVL2 gene for ELAV (embryonic lethal,
            abnormal vision, Drosophila)-like 2 (Hu antigen B) (HUB,
            HELN1), two novel genes, the 5' end of a novel gene and a
            CpG island, complete sequence.>gb:BC030692_1979915 Homo
            sapiens ELAV (embryonic lethal, abnormal vision,
            Drosophila)-like 2 (Hu antigen B), mRNA (cDNA clone
            MGC:26319 IMAGE:4826082), complete cds.
          Length = 346

 Score = 39.7 bits (91), Expect = 0.14
 Identities = 28/95 (29%), Positives = 48/95 (50%), Gaps = 3/95 (3%)
 Frame = -3

Query: 1107 VGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATF 937
            V + N  D    L V+ LP ++   E+ +LF      ESC+L   K TG+      F  +
Sbjct: 29   VDSGNTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQS-LGYGFVNY 87

Query: 936  VDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNS 832
            +D + A  A+++LNG++   +   T+ +  AR +S
Sbjct: 88   IDPKDAEKAINTLNGLRLQTK---TIKVSYARPSS 119



>gb:AL161628_1922053 Human DNA sequence from clone RP11-31K16 on
            chromosome 9 Contains a pseudogene similar to part of
            nucleolar protein 5A (56kDa with KKE/D repeat) (NOL5A)
            (NOP56), the ELAVL2 gene for ELAV (embryonic lethal,
            abnormal vision, Drosophila)-like 2 (Hu antigen B) (HUB,
            HELN1), two novel genes, the 5' end of a novel gene and a
            CpG island, complete sequence.
          Length = 387

 Score = 39.7 bits (91), Expect = 0.14
 Identities = 28/95 (29%), Positives = 48/95 (50%), Gaps = 3/95 (3%)
 Frame = -3

Query: 1107 VGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATF 937
            V + N  D    L V+ LP ++   E+ +LF      ESC+L   K TG+      F  +
Sbjct: 57   VDSGNTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQS-LGYGFVNY 115

Query: 936  VDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNS 832
            +D + A  A+++LNG++   +   T+ +  AR +S
Sbjct: 116  IDPKDAEKAINTLNGLRLQTK---TIKVSYARPSS 147



>gb:AP004040_1836737 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1008_D06.
          Length = 848

 Score = 39.7 bits (91), Expect = 0.14
 Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 2/70 (2%)
 Frame = -3

Query: 585 GTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTL--KVRARGGMPVAFADFEGVEEATQ 412
           G HP  TLF+ N+  N  + ELR +  QY    TL    + RG + +++ D   +  A  
Sbjct: 192 GEHPSRTLFVRNINSNVDDTELRSLFEQYGDIRTLYTATKHRGFVMISYFD---IRAARG 248

Query: 411 VMNALQGSSL 382
            M  LQ   L
Sbjct: 249 AMRGLQNKPL 258



>gb:AY649843_1620128 Zea mays ASF/SF2-like pre-mRNA splicing factor
            SRP31 (srp31) gene, complete cds, alternatively spliced.
          Length = 284

 Score = 39.7 bits (91), Expect = 0.14
 Identities = 30/111 (27%), Positives = 47/111 (42%), Gaps = 10/111 (9%)
 Frame = -3

Query: 1074 TLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQV----------VAFATFVDHQ 925
            T++V  LP D++ RE+ +LF +      C L+  GR  ++           AF  F D +
Sbjct: 8    TIYVGNLPGDIREREVDDLFYKG---RQCGLRMYGRIVEIDLKIPPRPPGFAFVEFEDAR 64

Query: 924  SAMAALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVVIDNRSKS 772
             A  A++  +G  FD   G  L +E+A      +    S  Y     R  S
Sbjct: 65   DAEDAIYGRDGYNFD---GHRLRVELAHGGRGTSSFDRSSSYSSAGQRGAS 112



>gb:CR860401_1184472 Pongo pygmaeus mRNA; cDNA DKFZp459N111 (from
            clone DKFZp459N111).
          Length = 389

 Score = 39.7 bits (91), Expect = 0.14
 Identities = 28/95 (29%), Positives = 48/95 (50%), Gaps = 3/95 (3%)
 Frame = -3

Query: 1107 VGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATF 937
            V + N  D    L V+ LP ++   E+ +LF      ESC+L   K TG+      F  +
Sbjct: 58   VDSGNTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQS-LGYGFVNY 116

Query: 936  VDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNS 832
            +D + A  A+++LNG++   +   T+ +  AR +S
Sbjct: 117  IDPKDAEKAINTLNGLRLQTK---TIKVSYARPSS 148



>gb:CR859234_1183359 Pongo pygmaeus mRNA; cDNA DKFZp459M0124 (from
            clone DKFZp459M0124).>gb:AL161628_1922054 Human DNA
            sequence from clone RP11-31K16 on chromosome 9 Contains a
            pseudogene similar to part of nucleolar protein 5A (56kDa
            with KKE/D repeat) (NOL5A) (NOP56), the ELAVL2 gene for
            ELAV (embryonic lethal, abnormal vision, Drosophila)-like
            2 (Hu antigen B) (HUB, HELN1), two novel genes, the 5'
            end of a novel gene and a CpG island, complete sequence.
          Length = 359

 Score = 39.7 bits (91), Expect = 0.14
 Identities = 28/95 (29%), Positives = 48/95 (50%), Gaps = 3/95 (3%)
 Frame = -3

Query: 1107 VGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATF 937
            V + N  D    L V+ LP ++   E+ +LF      ESC+L   K TG+      F  +
Sbjct: 29   VDSGNTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQS-LGYGFVNY 87

Query: 936  VDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNS 832
            +D + A  A+++LNG++   +   T+ +  AR +S
Sbjct: 88   IDPKDAEKAINTLNGLRLQTK---TIKVSYARPSS 119



>pir|I51676|I51676 ribonucleoprotein - African clawed
            frog>gb:XLU17597_2583251 Xenopus laevis ribonucleoprotein
            (elrB) mRNA, complete cds.
          Length = 389

 Score = 39.7 bits (91), Expect = 0.14
 Identities = 27/95 (28%), Positives = 46/95 (48%), Gaps = 3/95 (3%)
 Frame = -3

Query: 1107 VGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATF 937
            V + N  D    L V+ LP ++   E+ +LF      ESC+L   K T        F  +
Sbjct: 56   VESNNTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITEGQSLGYGFVNY 115

Query: 936  VDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNS 832
            +D + A  A+++LNG++   +   T+ +  AR +S
Sbjct: 116  IDPKDAEKAINTLNGLRLQTK---TIKVSYARPSS 147



>pir|I39077|I39077 RNA-binding protein Hel-N2 -
            human>gb:HSU29943_2023245 Human ELAV-like neuronal
            protein-2 Hel-N2 mRNA, complete cds.
          Length = 346

 Score = 39.7 bits (91), Expect = 0.14
 Identities = 28/95 (29%), Positives = 48/95 (50%), Gaps = 3/95 (3%)
 Frame = -3

Query: 1107 VGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATF 937
            V + N  D    L V+ LP ++   E+ +LF      ESC+L   K TG+      F  +
Sbjct: 29   VDSGNTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQS-LGYGFVNY 87

Query: 936  VDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNS 832
            +D + A  A+++LNG++   +   T+ +  AR +S
Sbjct: 88   IDPKDAEKAINTLNGLRLQTK---TIKVSYARPSS 119



>sp|Q60899|ELV2_MOUSE ELAV-like protein 2 (Hu-antigen B) (HuB)
            (ELAV-like neuronal protein 1) (Nervous system-specific
            RNA binding protein Mel-N1).>pir|JC6057|JC6057
            RNA-binding protein Mel-N1, nervous system-specific -
            mouse>gb:AY035380_2074234 Mus musculus ELAV-like neuronal
            protein-1 mRNA, complete cds, alternatively
            spliced.>gb:MMU29088_2120304 Mus musculus nervous
            system-specific RNA binding protein Mel-N1 mRNA, complete
            cds.
          Length = 360

 Score = 39.7 bits (91), Expect = 0.14
 Identities = 28/95 (29%), Positives = 48/95 (50%), Gaps = 3/95 (3%)
 Frame = -3

Query: 1107 VGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATF 937
            V + N  D    L V+ LP ++   E+ +LF      ESC+L   K TG+      F  +
Sbjct: 29   VDSGNTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQS-LGYGFVNY 87

Query: 936  VDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNS 832
            +D + A  A+++LNG++   +   T+ +  AR +S
Sbjct: 88   IDPKDAEKAINTLNGLRLQTK---TIKVSYARPSS 119



>sp|Q12926|ELV2_HUMAN ELAV-like protein 2 (Hu-antigen B) (HuB)
            (ELAV-like neuronal protein 1) (Nervous system-specific
            RNA binding protein Hel-N1).>pir|I38726|I38726 ELAV-like
            neuronal protein 1 - human>gb:AX463221_1469034 Sequence
            22 from Patent WO0249625.>gb:HSU12431_2022172 Human
            ELAV-like neuronal protein 1 (hel-N1) mRNA, complete cds.
          Length = 359

 Score = 39.7 bits (91), Expect = 0.14
 Identities = 28/95 (29%), Positives = 48/95 (50%), Gaps = 3/95 (3%)
 Frame = -3

Query: 1107 VGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATF 937
            V + N  D    L V+ LP ++   E+ +LF      ESC+L   K TG+      F  +
Sbjct: 29   VDSGNTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQS-LGYGFVNY 87

Query: 936  VDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNS 832
            +D + A  A+++LNG++   +   T+ +  AR +S
Sbjct: 88   IDPKDAEKAINTLNGLRLQTK---TIKVSYARPSS 119



>gb:MMU2SNRP2_2120528 M.musculus mRNA for U2-snRNP b'' (pRNP31).
          Length = 123

 Score = 39.3 bits (90), Expect = 0.18
 Identities = 26/79 (32%), Positives = 39/79 (49%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNAL 397
           P   LF+ NL     E  L  + +Q+PGF  +++   G   +AF +FE   +A    +AL
Sbjct: 47  PNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRL-VPGRHDIAFVEFENDGQAGAARDAL 105

Query: 396 QGSSLPSSDRGGMHIEYAR 340
           QG  +  S    M I YA+
Sbjct: 106 QGFKITPSH--AMKITYAK 122



 Score = 36.6 bits (83), Expect = 1.2
 Identities = 23/65 (35%), Positives = 34/65 (52%)
 Frame = -3

Query: 1071 LFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNG 892
            LF++ LP++     +  LF + PGF+  +L   GR D  +AF  F +   A AA  +L G
Sbjct: 51   LFLNNLPEETNEMMLSMLFNQFPGFKEVRL-VPGRHD--IAFVEFENDGQAGAARDALQG 107

Query: 891  VKFDP 877
             K  P
Sbjct: 108  FKITP 112



>gb:CR382134_1667540 Debaryomyces hansenii chromosome B of strain
            CBS767 of Debaryomyces hansenii.
          Length = 252

 Score = 39.3 bits (90), Expect = 0.18
 Identities = 63/258 (24%), Positives = 96/258 (37%), Gaps = 13/258 (5%)
 Frame = -3

Query: 1116 GYTVGNKNERDMIRTLFVSGLPDDVKAR----EIHNLFRRRPGFESC----QLKYTGRGD 961
            G T    N+ +   T++V+ L D V       E+ ++F++            LK  G+  
Sbjct: 31   GATNDGTNDAESTETVYVNNLNDKVSVNKLKGELESVFQKYGKIIQITAHKNLKMKGQ-- 88

Query: 960  QVVAFATFVDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVVIDNR 781
               AF TF +  ++ AA+H   G++     G  +H+E ARSNS    R        I+ R
Sbjct: 89   ---AFVTFENKTASEAAIH---GLQEHELFGKPMHVEYARSNSDNYYRDILKDEEAIEIR 142

Query: 780  S----KSNTDAKGTXXXXXXXXXXXXXXXXXXXXXXXXXXXSXEKSGEKVGDGDNVLAAQ 613
                 K+N  A G                               K  +K+G    V  AQ
Sbjct: 143  KQLKMKANEQAAGDA-----------------------------KGVKKLG----VKKAQ 169

Query: 612  SEQIEKIGDGTHPCSTLFIANLGPNCTEDELRKILSQYPGF-NTLKVRARGGMPVAFADF 436
            + +         P   L I NL P  T  +L +    Y GF N+  V+ R    ++F +F
Sbjct: 170  TWK------AIPPNKILLIQNLKPEITNGDLLEFFEAYGGFINSRLVKVRN---LSFIEF 220

Query: 435  EGVEEATQVMNALQGSSL 382
            E    AT  +  L    L
Sbjct: 221  ENEMSATNCLEDLTKEKL 238



>gb:CR382130_1663279 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 146

 Score = 39.3 bits (90), Expect = 0.18
 Identities = 31/96 (32%), Positives = 44/96 (45%), Gaps = 10/96 (10%)
 Frame = -3

Query: 591 GDGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTL----------KVRARGGMPVAFA 442
           GD   P  TL++ NL   CT+ +L++ L  Y  F++             R RG   V F 
Sbjct: 24  GDEPTPSPTLYVKNLTDKCTKSDLKRYL--YMRFSSYGHILDIVAMKNERMRGQAHVVFN 81

Query: 441 DFEGVEEATQVMNALQGSSLPSSDRGGMHIEYARSK 334
           D   ++ +   +N LQ S     +   M IEYARSK
Sbjct: 82  D---IDASISALNGLQKSEFMGKE---MVIEYARSK 111



>gb:AY649841_1620125 Zea mays ASF/SF2-like pre-mRNA splicing factor
            SRP32 (srp32) gene, complete cds, alternatively spliced.
          Length = 150

 Score = 39.3 bits (90), Expect = 0.18
 Identities = 26/78 (33%), Positives = 37/78 (47%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSL 898
            RT++V  LP D++ RE+ +LF +        LK   R     AF  F D + A  A+   
Sbjct: 7    RTIYVGNLPGDIREREVEDLFYKYGKIVDIDLKVPPR-PPGYAFVEFEDPRDAEEAIAGR 65

Query: 897  NGVKFDPQTGSTLHIEIA 844
            +G  FD   G  L +E A
Sbjct: 66   DGYNFD---GHRLRVEAA 80



>gb:AY649841_1620124 Zea mays ASF/SF2-like pre-mRNA splicing factor
            SRP32 (srp32) gene, complete cds, alternatively spliced.
          Length = 257

 Score = 39.3 bits (90), Expect = 0.18
 Identities = 26/78 (33%), Positives = 37/78 (47%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSL 898
            RT++V  LP D++ RE+ +LF +        LK   R     AF  F D + A  A+   
Sbjct: 7    RTIYVGNLPGDIREREVEDLFYKYGKIVDIDLKVPPR-PPGYAFVEFEDPRDAEEAIAGR 65

Query: 897  NGVKFDPQTGSTLHIEIA 844
            +G  FD   G  L +E A
Sbjct: 66   DGYNFD---GHRLRVEAA 80



>gb:AY649841_1620123 Zea mays ASF/SF2-like pre-mRNA splicing factor
            SRP32 (srp32) gene, complete cds, alternatively spliced.
          Length = 285

 Score = 39.3 bits (90), Expect = 0.18
 Identities = 26/78 (33%), Positives = 37/78 (47%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSL 898
            RT++V  LP D++ RE+ +LF +        LK   R     AF  F D + A  A+   
Sbjct: 7    RTIYVGNLPGDIREREVEDLFYKYGKIVDIDLKVPPR-PPGYAFVEFEDPRDAEEAIAGR 65

Query: 897  NGVKFDPQTGSTLHIEIA 844
            +G  FD   G  L +E A
Sbjct: 66   DGYNFD---GHRLRVEAA 80



>gb:AX884240_1479693 Sequence 103 from Patent EP1033401.
          Length = 77

 Score = 39.3 bits (90), Expect = 0.18
 Identities = 23/69 (33%), Positives = 36/69 (52%)
 Frame = -3

Query: 1092 ERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMA 913
            E +M +TL+V  L  DV    I  LF +    ++C++     G+    F  F +H+ A A
Sbjct: 2    EDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAA 61

Query: 912  ALHSLNGVK 886
            AL ++NG K
Sbjct: 62   ALAAMNGRK 70



>gb:AY615399_1340766 Toxoplasma gondii splice factor gene, complete
            cds.
          Length = 345

 Score = 39.3 bits (90), Expect = 0.18
 Identities = 25/87 (28%), Positives = 42/87 (48%)
 Frame = -3

Query: 1071 LFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNG 892
            +FV+ LP DV   E+ +LF +    E  +++     D  +AF  F ++++A  A+   +G
Sbjct: 22   IFVANLPLDVTENELEDLFYKFGRIEDIEMRRDRTNDSTIAFVQFAEYKAADDAIEGRDG 81

Query: 891  VKFDPQTGSTLHIEIARSNSRRTKRPG 811
                        I I RS  +R +RPG
Sbjct: 82   AHL-----GFHRIRIERSR-QRLRRPG 102



>gb:CR860918_1184962 Pongo pygmaeus mRNA; cDNA DKFZp469G2231 (from
           clone DKFZp469G2231).
          Length = 225

 Score = 39.3 bits (90), Expect = 0.18
 Identities = 26/79 (32%), Positives = 39/79 (49%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNAL 397
           P   LF+ NL     E  L  + +Q+PGF  +++   G   +AF +FE   +A    +AL
Sbjct: 149 PNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRL-VPGRHDIAFVEFENDGQAGAARDAL 207

Query: 396 QGSSLPSSDRGGMHIEYAR 340
           QG  +  S    M I YA+
Sbjct: 208 QGFKITPSH--AMKITYAK 224



 Score = 36.6 bits (83), Expect = 1.2
 Identities = 23/65 (35%), Positives = 34/65 (52%)
 Frame = -3

Query: 1071 LFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNG 892
            LF++ LP++     +  LF + PGF+  +L   GR D  +AF  F +   A AA  +L G
Sbjct: 153  LFLNNLPEETNEMMLSMLFNQFPGFKEVRL-VPGRHD--IAFVEFENDGQAGAARDALQG 209

Query: 891  VKFDP 877
             K  P
Sbjct: 210  FKITP 214



>gb:AK011274_1156298 Mus musculus 10 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2610002C14
           product:U2 small nuclear ribonucleoprotein B, full
           insert sequence.>gb:AK013871_1157667 Mus musculus 12
           days embryo head cDNA, RIKEN full-length enriched
           library, clone:3000004N17 product:U2 small nuclear
           ribonucleoprotein B, full insert
           sequence.>gb:BC026794_2095554 Mus musculus U2 small
           nuclear ribonucleoprotein B, mRNA (cDNA clone MGC:25517
           IMAGE:3483683), complete cds.
          Length = 225

 Score = 39.3 bits (90), Expect = 0.18
 Identities = 26/79 (32%), Positives = 39/79 (49%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNAL 397
           P   LF+ NL     E  L  + +Q+PGF  +++   G   +AF +FE   +A    +AL
Sbjct: 149 PNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRL-VPGRHDIAFVEFENDGQAGAARDAL 207

Query: 396 QGSSLPSSDRGGMHIEYAR 340
           QG  +  S    M I YA+
Sbjct: 208 QGFKITPSH--AMKITYAK 224



 Score = 36.6 bits (83), Expect = 1.2
 Identities = 23/65 (35%), Positives = 34/65 (52%)
 Frame = -3

Query: 1071 LFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNG 892
            LF++ LP++     +  LF + PGF+  +L   GR D  +AF  F +   A AA  +L G
Sbjct: 153  LFLNNLPEETNEMMLSMLFNQFPGFKEVRL-VPGRHD--IAFVEFENDGQAGAARDALQG 209

Query: 891  VKFDP 877
             K  P
Sbjct: 210  FKITP 214



>pir|I51677|I51677 ribonucleoprotein - African clawed
            frog>gb:XLU17598_2583252 Xenopus laevis ribonucleoprotein
            (elrC) mRNA, complete cds.
          Length = 348

 Score = 39.3 bits (90), Expect = 0.18
 Identities = 32/99 (32%), Positives = 48/99 (48%), Gaps = 4/99 (4%)
 Frame = -3

Query: 1116 GYTVGNKNERDMIRT-LFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVA 949
            G   G   E D  +T L V+ LP ++   E  +LF      ESC+L   K TG+      
Sbjct: 20   GILNGTNGEADDSKTNLIVNYLPQNMTQEEFKSLFGSIGEIESCKLVRDKITGQS-LGYG 78

Query: 948  FATFVDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNS 832
            F  +VD   A  A+++LNG+K   +   T+ +  AR +S
Sbjct: 79   FVNYVDPNDADKAINTLNGLKLQTK---TIKVSYARPSS 114



>pir|S54857|S54857 small nuclear ribonucleoprotein U2B'' - mouse
           (fragment)
          Length = 123

 Score = 39.3 bits (90), Expect = 0.18
 Identities = 26/79 (32%), Positives = 39/79 (49%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNAL 397
           P   LF+ NL     E  L  + +Q+PGF  +++   G   +AF +FE   +A    +AL
Sbjct: 47  PNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRL-VPGRHDIAFVEFENDGQAGAARDAL 105

Query: 396 QGSSLPSSDRGGMHIEYAR 340
           QG  +  S    M I YA+
Sbjct: 106 QGFKITPSH--AMKITYAK 122



 Score = 36.6 bits (83), Expect = 1.2
 Identities = 23/65 (35%), Positives = 34/65 (52%)
 Frame = -3

Query: 1071 LFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNG 892
            LF++ LP++     +  LF + PGF+  +L   GR D  +AF  F +   A AA  +L G
Sbjct: 51   LFLNNLPEETNEMMLSMLFNQFPGFKEVRL-VPGRHD--IAFVEFENDGQAGAARDALQG 107

Query: 891  VKFDP 877
             K  P
Sbjct: 108  FKITP 112



>sp|P08579|RU2B_HUMAN U2 small nuclear ribonucleoprotein
           B".>pir|A25910|A25910 small nuclear ribonucleoprotein
           U2B'' - human>gb:BC018022_1976367 Homo sapiens small
           nuclear ribonucleoprotein polypeptide B'', transcript
           variant 1, mRNA (cDNA clone MGC:24807 IMAGE:4286926),
           complete cds.>gb:BC036737_1982023 Homo sapiens small
           nuclear ribonucleoprotein polypeptide B'', transcript
           variant 2, mRNA (cDNA clone MGC:45309 IMAGE:5533477),
           complete cds.>gb:HS705D16_1999340 Human DNA sequence
           from clone RP4-705D16 on chromosome 20p11.22-12.2
           Contains the SNRPB2 gene for small nuclear
           ribonucleoprotein polypeptide B'', the OTOR gene for
           otoraplin, a novel gene and a CpG island, complete
           sequence.>gb:HUMUG2BA_2037982 Human U2 small nuclear
           RNA-associated B'' antigen mRNA, complete cds.
          Length = 225

 Score = 39.3 bits (90), Expect = 0.18
 Identities = 26/79 (32%), Positives = 39/79 (49%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNAL 397
           P   LF+ NL     E  L  + +Q+PGF  +++   G   +AF +FE   +A    +AL
Sbjct: 149 PNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRL-VPGRHDIAFVEFENDGQAGAARDAL 207

Query: 396 QGSSLPSSDRGGMHIEYAR 340
           QG  +  S    M I YA+
Sbjct: 208 QGFKITPSH--AMKITYAK 224



 Score = 36.6 bits (83), Expect = 1.2
 Identities = 23/65 (35%), Positives = 34/65 (52%)
 Frame = -3

Query: 1071 LFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNG 892
            LF++ LP++     +  LF + PGF+  +L   GR D  +AF  F +   A AA  +L G
Sbjct: 153  LFLNNLPEETNEMMLSMLFNQFPGFKEVRL-VPGRHD--IAFVEFENDGQAGAARDALQG 209

Query: 891  VKFDP 877
             K  P
Sbjct: 210  FKITP 214



>gb:BC064308_2553857 Danio rerio small nuclear ribonucleoprotein
           polypeptide A, mRNA (cDNA clone MGC:77810
           IMAGE:7001461), complete cds.
          Length = 281

 Score = 38.9 bits (89), Expect = 0.23
 Identities = 24/79 (30%), Positives = 39/79 (49%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNAL 397
           P   LF+ NL     E  L  + +Q+PGF  +++   G   +AF +F+   +A     AL
Sbjct: 205 PNHILFLTNLPEETNELMLSMLFNQFPGFKEVRL-VPGRHDIAFVEFDNEVQAGAAREAL 263

Query: 396 QGSSLPSSDRGGMHIEYAR 340
           QG  +  S+   M I +A+
Sbjct: 264 QGFKITQSN--AMKISFAK 280



 Score = 34.3 bits (77), Expect = 5.8
 Identities = 22/62 (35%), Positives = 33/62 (53%)
 Frame = -3

Query: 1071 LFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNG 892
            LF++ LP++     +  LF + PGF+  +L   GR D  +AF  F +   A AA  +L G
Sbjct: 209  LFLTNLPEETNELMLSMLFNQFPGFKEVRL-VPGRHD--IAFVEFDNEVQAGAAREALQG 265

Query: 891  VK 886
             K
Sbjct: 266  FK 267



>gb:BC045485_2549321 Danio rerio zgc:76917, mRNA (cDNA clone MGC:55893
            IMAGE:3818796), complete cds.>gb:BC066734_2554571 Danio
            rerio zgc:76917, mRNA (cDNA clone MGC:76917
            IMAGE:6524348), complete cds.
          Length = 342

 Score = 38.9 bits (89), Expect = 0.23
 Identities = 28/105 (26%), Positives = 49/105 (46%)
 Frame = -3

Query: 1092 ERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMA 913
            + D  RTL+V  L  DV    I  +F +    +SC++     G+    F  F +++ A A
Sbjct: 4    DEDQPRTLYVGNLSRDVTEALILQVFSQIGPCKSCKMILDTTGNDPYCFVEFYENRHAAA 63

Query: 912  ALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVVIDNRS 778
            AL ++NG K     G  + +  A + S + K   +  +V + + S
Sbjct: 64   ALAAMNGRKI---LGKDMKVNWASTPSSQKKDTSNHFHVFVGDLS 105



>gb:AY398424_2531954 Danio rerio clone RK068A2A06 TIA1 cytotoxic
            granule-associated RNA binding protein (TIA1) mRNA,
            complete cds.
          Length = 342

 Score = 38.9 bits (89), Expect = 0.23
 Identities = 28/105 (26%), Positives = 49/105 (46%)
 Frame = -3

Query: 1092 ERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMA 913
            + D  RTL+V  L  DV    I  +F +    +SC++     G+    F  F +++ A A
Sbjct: 4    DEDQPRTLYVGNLSRDVTEALILQVFSQIGPCKSCKMILDTTGNDPYCFVEFYENRHAAA 63

Query: 912  ALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVVIDNRS 778
            AL ++NG K     G  + +  A + S + K   +  +V + + S
Sbjct: 64   ALAAMNGRKI---LGKDMKVNWASTPSSQKKDTSNHFHVFVGDLS 105



>gb:AE017343_1755858 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 769

 Score = 38.9 bits (89), Expect = 0.23
 Identities = 28/106 (26%), Positives = 50/106 (47%), Gaps = 13/106 (12%)
 Frame = -3

Query: 618 AQSEQIEKIGDGTHPC----STLFIANLGPNCTEDELRKILSQYPGFNTLKVRARG---- 463
           A +E++E + +   P     STLF+  L    T   L+ +LS  PGF+  +V+ +     
Sbjct: 515 ALAEKVESLPEQPDPTDEAGSTLFLKGLNFTTTTPHLQTVLSHIPGFSFARVQMKPDPKR 574

Query: 462 -----GMPVAFADFEGVEEATQVMNALQGSSLPSSDRGGMHIEYAR 340
                 M   F  F+  E AT+ + AL+G  +   D   + +++A+
Sbjct: 575 PGEKLSMGYGFVGFKTKEAATKALKALEGFEI---DGKSLEVKFAQ 617



>gb:AY579886_1616028 Triticum aestivum AML15 mRNA, complete cds.
          Length = 870

 Score = 38.9 bits (89), Expect = 0.23
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 2/70 (2%)
 Frame = -3

Query: 585 GTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTL--KVRARGGMPVAFADFEGVEEATQ 412
           G HP  TLF+ N+  N  + ELR +  Q+    TL    + RG + +++ D   +  A  
Sbjct: 206 GEHPSRTLFVRNINSNVEDSELRSLFEQFGDIRTLYTATKHRGFVMISYFD---IRAARG 262

Query: 411 VMNALQGSSL 382
            M +LQ   L
Sbjct: 263 AMRSLQNKPL 272



>gb:AY579883_1616025 Aegilops speltoides AML1 mRNA, complete cds.
          Length = 869

 Score = 38.9 bits (89), Expect = 0.23
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 2/70 (2%)
 Frame = -3

Query: 585 GTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTL--KVRARGGMPVAFADFEGVEEATQ 412
           G HP  TLF+ N+  N  + ELR +  Q+    TL    + RG + +++ D   +  A  
Sbjct: 206 GEHPSRTLFVRNINSNVEDSELRSLFEQFGDIRTLYTATKHRGFVMISYFD---IRAARG 262

Query: 411 VMNALQGSSL 382
            M +LQ   L
Sbjct: 263 AMRSLQNKPL 272



>gb:AY387676_1429976 Oryctolagus cuniculus nuclear ribonucleoprotein A
            mRNA, complete cds.
          Length = 282

 Score = 38.9 bits (89), Expect = 0.23
 Identities = 34/116 (29%), Positives = 45/116 (38%), Gaps = 21/116 (18%)
 Frame = -3

Query: 1170 HQPYDPYYRPQPLPIPDYGYTVGNK---------------------NERDMIRTLFVSGL 1054
            H P  P Y P P  IP  G   G                       +E      LF++ L
Sbjct: 156  HMPGQPPYMPPPGMIPPPGLAPGQLPPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNL 215

Query: 1053 PDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNGVK 886
            P++     +  LF + PGF+  +L   GR D  +AF  F +   A AA  SL G K
Sbjct: 216  PEETNELMLSMLFNQFPGFKEVRL-VPGRHD--IAFVEFDNEVQAGAARDSLQGFK 268



 Score = 37.0 bits (84), Expect = 0.89
 Identities = 22/79 (27%), Positives = 39/79 (49%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNAL 397
           P   LF+ NL     E  L  + +Q+PGF  +++   G   +AF +F+   +A    ++L
Sbjct: 206 PNHILFLTNLPEETNELMLSMLFNQFPGFKEVRL-VPGRHDIAFVEFDNEVQAGAARDSL 264

Query: 396 QGSSLPSSDRGGMHIEYAR 340
           QG  +  +    M I +A+
Sbjct: 265 QGFKI--TQNNAMKISFAK 281



 Score = 35.8 bits (81), Expect = 2.0
 Identities = 30/92 (32%), Positives = 46/92 (50%), Gaps = 10/92 (10%)
 Frame = -3

Query: 582 THPCSTLFIANLGPNCTEDELRK----ILSQYPGF------NTLKVRARGGMPVAFADFE 433
           T P  T++I NL     +DEL+K    I SQ+          +LK+R +     AF  F+
Sbjct: 6   TRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQ-----AFVIFK 60

Query: 432 GVEEATQVMNALQGSSLPSSDRGGMHIEYARS 337
            V  AT  + ++QG   P  D+  M I+YA++
Sbjct: 61  EVSSATNALRSMQG--FPFYDK-PMRIQYAKT 89



>gb:AF067616_1238030 Caenorhabditis elegans cosmid F29C4, complete
            sequence.
          Length = 423

 Score = 38.9 bits (89), Expect = 0.23
 Identities = 21/63 (33%), Positives = 30/63 (47%)
 Frame = -3

Query: 1098 KNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSA 919
            +++ +  RTLFV  +P DVK REI ++F      E   +K     D   AF  F     A
Sbjct: 162  QDDDEATRTLFVGNMPSDVKEREIRHVFEEHGKVEEVDIKTPINTDAAYAFVMFQTVDQA 221

Query: 918  MAA 910
            + A
Sbjct: 222  IQA 224



>gb:AF067616_1238028 Caenorhabditis elegans cosmid F29C4, complete
            sequence.
          Length = 497

 Score = 38.9 bits (89), Expect = 0.23
 Identities = 21/63 (33%), Positives = 30/63 (47%)
 Frame = -3

Query: 1098 KNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSA 919
            +++ +  RTLFV  +P DVK REI ++F      E   +K     D   AF  F     A
Sbjct: 139  QDDDEATRTLFVGNMPSDVKEREIRHVFEEHGKVEEVDIKTPINTDAAYAFVMFQTVDQA 198

Query: 918  MAA 910
            + A
Sbjct: 199  IQA 201



>pir|T33146|T33146 hypothetical protein F29C4.7 - Caenorhabditis
            elegans>gb:AF067616_1238029 Caenorhabditis elegans cosmid
            F29C4, complete sequence.
          Length = 520

 Score = 38.9 bits (89), Expect = 0.23
 Identities = 21/63 (33%), Positives = 30/63 (47%)
 Frame = -3

Query: 1098 KNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSA 919
            +++ +  RTLFV  +P DVK REI ++F      E   +K     D   AF  F     A
Sbjct: 162  QDDDEATRTLFVGNMPSDVKEREIRHVFEEHGKVEEVDIKTPINTDAAYAFVMFQTVDQA 221

Query: 918  MAA 910
            + A
Sbjct: 222  IQA 224



>gb:XLXEL1_2583600 X.laevis mRNA for XEL-1.
          Length = 389

 Score = 38.5 bits (88), Expect = 0.31
 Identities = 26/95 (27%), Positives = 46/95 (48%), Gaps = 3/95 (3%)
 Frame = -3

Query: 1107 VGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATF 937
            V + N  D    L V+ LP ++   E+ +LF      ESC+L   K T        F  +
Sbjct: 56   VESNNTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITEGQSLGYGFVNY 115

Query: 936  VDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNS 832
            +D + A  A++++NG++   +   T+ +  AR +S
Sbjct: 116  IDPKDAEKAINTVNGLRLQTK---TIKVSYARPSS 147



>gb:AY016023_2508358 Sphoeroides nephelus alpha globin gene cluster,
            complete sequence.
          Length = 356

 Score = 38.5 bits (88), Expect = 0.31
 Identities = 31/107 (28%), Positives = 49/107 (45%), Gaps = 3/107 (2%)
 Frame = -3

Query: 1143 PQPLPIPDYGYTVGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYT 973
            P    +P+      N +  D    L V+ LP ++   E  +LF      ESC+L   K T
Sbjct: 14   PSGTSLPNGPVISTNGSTDDSKTNLIVNYLPQNMTQEEFKSLFGSIGEIESCKLVRDKIT 73

Query: 972  GRGDQVVAFATFVDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNS 832
            G+      F  +VD   A  A+++LNG+K   +   T+ +  AR +S
Sbjct: 74   GQS-LGYGFVNYVDPNDADKAINTLNGLKLQTK---TIKVSYARPSS 116



>gb:AY579879_1616021 Pinus taeda Mei2-like protein mRNA, partial
           cds.
          Length = 632

 Score = 38.5 bits (88), Expect = 0.31
 Identities = 23/70 (32%), Positives = 32/70 (45%), Gaps = 2/70 (2%)
 Frame = -3

Query: 585 GTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTL--KVRARGGMPVAFADFEGVEEATQ 412
           G HP  TLF+ N+  N  + ELR     Y    TL    + RG + +++ D   +  A  
Sbjct: 45  GEHPSRTLFVRNINSNVEDSELRTYFEHYGDIRTLYTACKHRGFVMISYYD---IRAARN 101

Query: 411 VMNALQGSSL 382
            M ALQ   L
Sbjct: 102 AMRALQNKPL 111



>gb:AY142487_1582916 Arabidopsis thaliana putative spliceosomal
           protein (U2B) (At1g06960) mRNA, complete cds.
          Length = 229

 Score = 38.5 bits (88), Expect = 0.31
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 1/67 (1%)
 Frame = -3

Query: 588 DGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLK-VRARGGMPVAFADFEGVEEATQ 412
           D   P + LFI NL        L+ +  QYPGF  ++ + A+ G  +AF ++E   +++ 
Sbjct: 149 DTMPPNNILFIHNLPIETNSMMLQLLFEQYPGFKEIRMIEAKPG--IAFVEYEDDVQSSM 206

Query: 411 VMNALQG 391
            M ALQG
Sbjct: 207 AMQALQG 213



 Score = 35.4 bits (80), Expect = 2.6
 Identities = 19/66 (28%), Positives = 32/66 (48%)
 Frame = -3

Query: 1071 LFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNG 892
            LF+  LP +  +  +  LF + PGF+  ++     G   +AF  + D   +  A+ +L G
Sbjct: 157  LFIHNLPIETNSMMLQLLFEQYPGFKEIRMIEAKPG---IAFVEYEDDVQSSMAMQALQG 213

Query: 891  VKFDPQ 874
             K  PQ
Sbjct: 214  FKITPQ 219



>gb:AY087401_1572432 Arabidopsis thaliana clone 34995 mRNA, complete
           sequence.
          Length = 232

 Score = 38.5 bits (88), Expect = 0.31
 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 1/80 (1%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQYPGFNTLK-VRARGGMPVAFADFEGVEEATQVMNA 400
           P + LFI NL    T   L+ +  QYPGF  ++ + A+ G  +AF ++E   +A+  M  
Sbjct: 156 PNNILFIQNLPHETTSMMLQLLFEQYPGFKEIRMIDAKPG--IAFVEYEDDVQASIAMQP 213

Query: 399 LQGSSLPSSDRGGMHIEYAR 340
           LQG  +  + +  M I +A+
Sbjct: 214 LQGFKI--TPQNPMVISFAK 231



 Score = 36.2 bits (82), Expect = 1.5
 Identities = 20/66 (30%), Positives = 31/66 (46%)
 Frame = -3

Query: 1071 LFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNG 892
            LF+  LP +  +  +  LF + PGF+  ++     G   +AF  + D   A  A+  L G
Sbjct: 160  LFIQNLPHETTSMMLQLLFEQYPGFKEIRMIDAKPG---IAFVEYEDDVQASIAMQPLQG 216

Query: 891  VKFDPQ 874
             K  PQ
Sbjct: 217  FKITPQ 222



>gb:AY062613_1565269 Arabidopsis thaliana RNA-binding protein MEI2,
           putative (F15D2.30) mRNA, complete
           cds.>gb:AY070368_1566772 Arabidopsis thaliana putative
           RNA-binding protein MEI2 (At1g29400) mRNA, complete
           cds.>gb:AY091327_1574531 Arabidopsis thaliana putative
           RNA-binding protein MEI2 (At1g29400) mRNA, complete cds.
          Length = 800

 Score = 38.5 bits (88), Expect = 0.31
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 2/70 (2%)
 Frame = -3

Query: 585 GTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTL--KVRARGGMPVAFADFEGVEEATQ 412
           G HP  TLF+ N+  N  + EL  +  QY    TL    + RG + +++ D   +  A  
Sbjct: 163 GEHPSRTLFVRNINSNVEDSELTALFEQYGDIRTLYTTCKHRGFVMISYYD---IRSARM 219

Query: 411 VMNALQGSSL 382
            M +LQ   L
Sbjct: 220 AMRSLQNKPL 229



>gb:CEY46G5A_1370129 Caenorhabditis elegans YAC Y46G5A, complete
           sequence.
          Length = 434

 Score = 38.5 bits (88), Expect = 0.31
 Identities = 31/109 (28%), Positives = 49/109 (44%), Gaps = 5/109 (4%)
 Frame = -3

Query: 654 GEKVGDGDN----VLAAQSEQIEKIGDGTHPCSTLFIANLGPNCTEDELRKILSQYPGFN 487
           G + GDG N       A+ E  + +  G+    TLF+ANL P  T++ L  + +Q     
Sbjct: 9   GGEDGDGFNPRVHARIAEREGFQ-LASGSEDPRTLFVANLDPAITDEFLATLFNQIGAVM 67

Query: 486 TLKVRARG-GMPVAFADFEGVEEATQVMNALQGSSLPSSDRGGMHIEYA 343
             K+   G   P AF +F    +AT  + +  G  L   +   MH+ +A
Sbjct: 68  KAKIIFEGLNDPYAFVEFSDHNQATLALQSHNGRELLEKE---MHVTWA 113



>pir|F86416|F86416 probable RNA-binding protein MEI2, 36123-32976
           [imported] - Arabidopsis thaliana>gb:AE005172_891790
           Arabidopsis thaliana chromosome 1, top arm complete
           sequence.>gb:AC068667_1540442 Arabidopsis thaliana
           chromosome 1 BAC F15D2 genomic sequence, complete
           sequence.
          Length = 779

 Score = 38.5 bits (88), Expect = 0.31
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 2/70 (2%)
 Frame = -3

Query: 585 GTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTL--KVRARGGMPVAFADFEGVEEATQ 412
           G HP  TLF+ N+  N  + EL  +  QY    TL    + RG + +++ D   +  A  
Sbjct: 153 GEHPSRTLFVRNINSNVEDSELTALFEQYGDIRTLYTTCKHRGFVMISYYD---IRSARM 209

Query: 411 VMNALQGSSL 382
            M +LQ   L
Sbjct: 210 AMRSLQNKPL 219



>pir|C84706|C84706 probable small nuclear ribonucleoprotein U2B
           [imported] - Arabidopsis thaliana>gb:AC002338_1530482
           Arabidopsis thaliana chromosome 2 clone T9D9 map m283,
           complete sequence.>gb:BT003068_1636650 Arabidopsis
           thaliana At2g30260 gene, complete cds.
          Length = 232

 Score = 38.5 bits (88), Expect = 0.31
 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 1/80 (1%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQYPGFNTLK-VRARGGMPVAFADFEGVEEATQVMNA 400
           P + LFI NL    T   L+ +  QYPGF  ++ + A+ G  +AF ++E   +A+  M  
Sbjct: 156 PNNILFIQNLPHETTSMMLQLLFEQYPGFKEIRMIDAKPG--IAFVEYEDDVQASIAMQP 213

Query: 399 LQGSSLPSSDRGGMHIEYAR 340
           LQG  +  + +  M I +A+
Sbjct: 214 LQGFKI--TPQNPMVISFAK 231



 Score = 36.2 bits (82), Expect = 1.5
 Identities = 20/66 (30%), Positives = 31/66 (46%)
 Frame = -3

Query: 1071 LFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNG 892
            LF+  LP +  +  +  LF + PGF+  ++     G   +AF  + D   A  A+  L G
Sbjct: 160  LFIQNLPHETTSMMLQLLFEQYPGFKEIRMIDAKPG---IAFVEYEDDVQASIAMQPLQG 216

Query: 891  VKFDPQ 874
             K  PQ
Sbjct: 217  FKITPQ 222



>pir|C86204|C86204 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_889699 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F10K1_1677277 Sequence of BAC F10K1 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 247

 Score = 38.5 bits (88), Expect = 0.31
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 1/67 (1%)
 Frame = -3

Query: 588 DGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLK-VRARGGMPVAFADFEGVEEATQ 412
           D   P + LFI NL        L+ +  QYPGF  ++ + A+ G  +AF ++E   +++ 
Sbjct: 167 DTMPPNNILFIHNLPIETNSMMLQLLFEQYPGFKEIRMIEAKPG--IAFVEYEDDVQSSM 224

Query: 411 VMNALQG 391
            M ALQG
Sbjct: 225 AMQALQG 231



 Score = 35.4 bits (80), Expect = 2.6
 Identities = 19/66 (28%), Positives = 32/66 (48%)
 Frame = -3

Query: 1071 LFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNG 892
            LF+  LP +  +  +  LF + PGF+  ++     G   +AF  + D   +  A+ +L G
Sbjct: 175  LFIHNLPIETNSMMLQLLFEQYPGFKEIRMIEAKPG---IAFVEYEDDVQSSMAMQALQG 231

Query: 891  VKFDPQ 874
             K  PQ
Sbjct: 232  FKITPQ 237



>gb:TCA309135_2580480 Triturus carnifex partial mRNA for putative
            nucleolin (nnuc gene).
          Length = 338

 Score = 38.1 bits (87), Expect = 0.40
 Identities = 52/270 (19%), Positives = 93/270 (34%), Gaps = 5/270 (1%)
 Frame = -3

Query: 1119 YGYTVGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFE--SCQLKYTGRGDQVVAF 946
            Y  ++  K ER   R LF   LP    A ++  +F         +   K T RG   + F
Sbjct: 21   YDSSIKTKKERTE-RILFAKNLPYSTTADDLRKVFENAVNIRILASNKKGTSRGAASIEF 79

Query: 945  ATFVDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVVIDNRSKSNT 766
             +  + ++A+         K     G    I++  +  + T        VV+ N +   T
Sbjct: 80   KSAAETENALKE-------KQGADVGGR-QIDLHYAGEKSTNMQSDLETVVVKNLAFKAT 131

Query: 765  DAKGTXXXXXXXXXXXXXXXXXXXXXXXXXXXSXEKSGEKVGDGDNVLAAQSEQI--EKI 592
            ++                                +KS  K  +    +  +   I  E  
Sbjct: 132  ESSLQNVFKNAVSIRIPKDDSGRSQGFALVEYPNKKSARKAMESHKNVEIEGRHICLELQ 191

Query: 591  GDGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMP-VAFADFEGVEEAT 415
            G  +    TLF+  L  + TE+ L++      G   +  R  G      F DF   E+A+
Sbjct: 192  GAPSEKSKTLFVRGLSADTTEETLKEAFDGAVGTRIVTDRDSGASKGFGFVDFSTAEDAS 251

Query: 414  QVMNALQGSSLPSSDRGGMHIEYARSKMRK 325
                A++   +   D   + +E+A+SK  +
Sbjct: 252  AAKEAMEDGEI---DGNKVTVEFAQSKRER 278



>gb:BC071118_2555980 Xenopus laevis MGC81363 protein, mRNA (cDNA clone
            MGC:81363 IMAGE:6634065), complete cds.
          Length = 629

 Score = 38.1 bits (87), Expect = 0.40
 Identities = 51/279 (18%), Positives = 93/279 (33%), Gaps = 49/279 (17%)
 Frame = -3

Query: 1080 IRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHS 901
            +  +F+  L D +  + +++ F       SC++     G +   F  F   ++A  A+ +
Sbjct: 98   VGNVFIKNLDDSIDNKALYDTFSAFGDILSCKVVCDEYGSRGYGFVHFETQEAANRAIQT 157

Query: 900  LNGVKFDPQT-----------------------------------------------GST 862
            +NG+  + +                                                G+T
Sbjct: 158  MNGMLLNDRKVFVGHFKSRRERELEYGAKVMEFTNVYIKNFGEDMDDKRLKEIFSAFGNT 217

Query: 861  LHIEIARSNSRRTKRPGSGPYVVIDNRSKSNTDAKGTXXXXXXXXXXXXXXXXXXXXXXX 682
            L +++   NS R++  G   Y   +   K+ T+  G                        
Sbjct: 218  LSVKVMMDNSGRSRGFGFVNYGNHEEAQKAVTEMNGKEVNGRMVYVGRA----------- 266

Query: 681  XXXXSXEKSGEKVGDGDNVLAAQSEQIEKIGDGTHPCSTLFIANLGPNCTEDELRKILSQ 502
                  +K  E+ G+    L  + EQI++     +    L++ NL     +D LRK  S 
Sbjct: 267  ------QKRIERQGE----LKRKFEQIKQERINRYQGVNLYVKNLDDGIDDDRLRKEFSP 316

Query: 501  YPGFNTLKVRARGG--MPVAFADFEGVEEATQVMNALQG 391
            Y    + KV   GG      F  F   EEAT+ +  + G
Sbjct: 317  YGTITSTKVMTEGGHSKGFGFVCFSSPEEATKAVTEMNG 355



>gb:AF357912_2489186 Labeo rohita ribonucleoprotein mRNA, complete
            cds.
          Length = 179

 Score = 38.1 bits (87), Expect = 0.40
 Identities = 30/106 (28%), Positives = 50/106 (47%), Gaps = 3/106 (2%)
 Frame = -3

Query: 1104 GNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFV 934
            G  N+ D    L V+ LP ++   E  +LF      ESC+L   K TG+      F  ++
Sbjct: 67   GGSND-DSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQS-LGYGFVNYI 124

Query: 933  DHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYV 796
            D + A  A+++LNG++   +   T+ +E    +   T  P + P V
Sbjct: 125  DPKDAEKAINTLNGLRLQTK---TIKVEAFSQSPFLTSAPVNSPNV 167



>gb:BC086331_2109525 Rattus norvegicus small nuclear
           ribonucleoprotein polypeptide A (predicted), mRNA (cDNA
           clone MGC:105915 IMAGE:7300752), complete cds.
          Length = 281

 Score = 38.1 bits (87), Expect = 0.40
 Identities = 23/79 (29%), Positives = 39/79 (49%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNAL 397
           P   LF+ NL     E  L  + +Q+PGF  +++   G   +AF +F+   +A    +AL
Sbjct: 205 PNHILFLTNLPEETNELMLSMLFNQFPGFKEVRL-VPGRHDIAFVEFDNEVQAGAARDAL 263

Query: 396 QGSSLPSSDRGGMHIEYAR 340
           QG  +  +    M I +A+
Sbjct: 264 QGFKI--TQNNAMKISFAK 280



 Score = 37.7 bits (86), Expect = 0.52
 Identities = 33/116 (28%), Positives = 45/116 (38%), Gaps = 21/116 (18%)
 Frame = -3

Query: 1170 HQPYDPYYRPQPLPIPDYGYTVGN---------------------KNERDMIRTLFVSGL 1054
            H P  P Y P P  IP  G   G                       +E      LF++ L
Sbjct: 155  HMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNL 214

Query: 1053 PDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNGVK 886
            P++     +  LF + PGF+  +L   GR D  +AF  F +   A AA  +L G K
Sbjct: 215  PEETNELMLSMLFNQFPGFKEVRL-VPGRHD--IAFVEFDNEVQAGAARDALQGFK 267



 Score = 35.8 bits (81), Expect = 2.0
 Identities = 30/92 (32%), Positives = 46/92 (50%), Gaps = 10/92 (10%)
 Frame = -3

Query: 582 THPCSTLFIANLGPNCTEDELRK----ILSQYPGF------NTLKVRARGGMPVAFADFE 433
           T P  T++I NL     +DEL+K    I SQ+          +LK+R +     AF  F+
Sbjct: 6   TRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQ-----AFVIFK 60

Query: 432 GVEEATQVMNALQGSSLPSSDRGGMHIEYARS 337
            V  AT  + ++QG   P  D+  M I+YA++
Sbjct: 61  EVSSATNALRSMQG--FPFYDK-PMRIQYAKT 89



>gb:BC052062_2100945 Mus musculus RIKEN cDNA D230005D02 gene, mRNA
           (cDNA clone MGC:62454 IMAGE:5703279), complete cds.
          Length = 662

 Score = 38.1 bits (87), Expect = 0.40
 Identities = 19/82 (23%), Positives = 41/82 (50%), Gaps = 2/82 (2%)
 Frame = -3

Query: 573 CSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQ 394
           C T+F+  L  N TE+ ++++  Q      ++   +    + FA+   V++A  +     
Sbjct: 141 CKTVFVGGLPENATEEIIQEVFEQCGDITAIRKSKKNFCHIRFAEEFMVDKAIYLSGYRM 200

Query: 393 --GSSLPSSDRGGMHIEYARSK 334
             GSS    D G +H+++A+++
Sbjct: 201 RLGSSTDKKDSGRLHVDFAQAR 222



>gb:BC024178_1978252 Homo sapiens hypothetical protein FLJ10094,
           mRNA (cDNA clone MGC:26180 IMAGE:4826032), complete cds.
          Length = 643

 Score = 38.1 bits (87), Expect = 0.40
 Identities = 19/82 (23%), Positives = 41/82 (50%), Gaps = 2/82 (2%)
 Frame = -3

Query: 573 CSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQ 394
           C T+F+  L  N TE+ ++++  Q      ++   +    + FA+   V++A  +     
Sbjct: 141 CKTVFVGGLPENATEEIIQEVFEQCGDITAIRKSKKNFCHIRFAEEFMVDKAIYLSGYRM 200

Query: 393 --GSSLPSSDRGGMHIEYARSK 334
             GSS    D G +H+++A+++
Sbjct: 201 RLGSSTDKKDSGRLHVDFAQAR 222



>gb:AL138823_1919985 Human DNA sequence from clone RP11-64J21 on
           chromosome 13 Contains part of a novel gene similar to
           tumour-associated hydroquinone (NADH) oxidase TNOX, a
           ribosomal protein L36 (RPL36) pseudogene and a CpG
           island, complete sequence.>gb:AL607148_1930989 Human DNA
           sequence from clone RP11-147D24 on chromosome 13,
           complete sequence.>gb:AL627430_1931124 Human DNA
           sequence from clone RP11-301I17 on chromosome 13
           Contains the 3' end of a novel gene, complete sequence.
          Length = 637

 Score = 38.1 bits (87), Expect = 0.40
 Identities = 19/82 (23%), Positives = 41/82 (50%), Gaps = 2/82 (2%)
 Frame = -3

Query: 573 CSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQ 394
           C T+F+  L  N TE+ ++++  Q      ++   +    + FA+   V++A  +     
Sbjct: 135 CKTVFVGGLPENATEEIIQEVFEQCGDITAIRKSKKNFCHIRFAEEFMVDKAIYLSGYRM 194

Query: 393 --GSSLPSSDRGGMHIEYARSK 334
             GSS    D G +H+++A+++
Sbjct: 195 RLGSSTDKKDSGRLHVDFAQAR 216



>gb:AX875747_1476229 Sequence 10652 from Patent
           EP1074617.>gb:AK000956_1908188 Homo sapiens cDNA
           FLJ10094 fis, clone HEMBA1002419.
          Length = 643

 Score = 38.1 bits (87), Expect = 0.40
 Identities = 19/82 (23%), Positives = 41/82 (50%), Gaps = 2/82 (2%)
 Frame = -3

Query: 573 CSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQ 394
           C T+F+  L  N TE+ ++++  Q      ++   +    + FA+   V++A  +     
Sbjct: 141 CKTVFVGGLPENATEEIIQEVFEQCGDITAIRKSKKNFCHIRFAEEFMVDKAIYLSGYRM 200

Query: 393 --GSSLPSSDRGGMHIEYARSK 334
             GSS    D G +H+++A+++
Sbjct: 201 RLGSSTDKKDSGRLHVDFAQAR 222



>gb:AK051821_1169830 Mus musculus 12 days embryo eyeball cDNA, RIKEN
           full-length enriched library, clone:D230005D02
           product:HYPOTHETICAL 73.3 KDA PROTEIN homolog [Homo
           sapiens], full insert sequence.
          Length = 643

 Score = 38.1 bits (87), Expect = 0.40
 Identities = 19/82 (23%), Positives = 41/82 (50%), Gaps = 2/82 (2%)
 Frame = -3

Query: 573 CSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQ 394
           C T+F+  L  N TE+ ++++  Q      ++   +    + FA+   V++A  +     
Sbjct: 141 CKTVFVGGLPENATEEIIQEVFEQCGDITAIRKSKKNFCHIRFAEEFMVDKAIYLSGYRM 200

Query: 393 --GSSLPSSDRGGMHIEYARSK 334
             GSS    D G +H+++A+++
Sbjct: 201 RLGSSTDKKDSGRLHVDFAQAR 222



>gb:AK013886_1157677 Mus musculus 12 days embryo head cDNA, RIKEN
           full-length enriched library, clone:3010002H06
           product:small nuclear ribonucleoprotein polypeptide A,
           full insert sequence.
          Length = 287

 Score = 38.1 bits (87), Expect = 0.40
 Identities = 23/79 (29%), Positives = 39/79 (49%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNAL 397
           P   LF+ NL     E  L  + +Q+PGF  +++   G   +AF +F+   +A    +AL
Sbjct: 211 PNHILFLTNLPEETNELMLSMLFNQFPGFKEVRL-VPGRHDIAFVEFDNEVQAGAARDAL 269

Query: 396 QGSSLPSSDRGGMHIEYAR 340
           QG  +  +    M I +A+
Sbjct: 270 QGFKI--TQNNAMKISFAK 286



 Score = 38.1 bits (87), Expect = 0.40
 Identities = 36/142 (25%), Positives = 54/142 (38%), Gaps = 21/142 (14%)
 Frame = -3

Query: 1248 RLRSLYN*SSATATLDDLRRREEMALHQPYDPYYRPQPLPIPDYGYTVGN---------- 1099
            +LR  +  S     +  + +   +  H P  P Y P P  IP  G   G           
Sbjct: 135  QLRPWWGLSQPVPGMPPMPQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQ 194

Query: 1098 -----------KNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVV 952
                        +E      LF++ LP++     +  LF + PGF+  +L   GR D  +
Sbjct: 195  LMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRL-VPGRHD--I 251

Query: 951  AFATFVDHQSAMAALHSLNGVK 886
            AF  F +   A AA  +L G K
Sbjct: 252  AFVEFDNEVQAGAARDALQGFK 273



>gb:AK012944_1157244 Mus musculus 10, 11 days embryo whole body
           cDNA, RIKEN full-length enriched library,
           clone:2810052G09 product:U2 small nuclear
           ribonucleoprotein B, full insert sequence.
          Length = 225

 Score = 38.1 bits (87), Expect = 0.40
 Identities = 26/79 (32%), Positives = 39/79 (49%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNAL 397
           P   LF+ NL     E  L  + +Q+PGF  +++   G   +AF +FE   +A    +AL
Sbjct: 149 PNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRL-VPGRHDIAFVEFEYDGQAGAARDAL 207

Query: 396 QGSSLPSSDRGGMHIEYAR 340
           QG  +  S    M I YA+
Sbjct: 208 QGFKITPSH--AMKITYAK 224



 Score = 35.0 bits (79), Expect = 3.4
 Identities = 23/65 (35%), Positives = 33/65 (50%)
 Frame = -3

Query: 1071 LFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNG 892
            LF++ LP++     +  LF + PGF+  +L   GR D  +AF  F     A AA  +L G
Sbjct: 153  LFLNNLPEETNEMMLSMLFNQFPGFKEVRL-VPGRHD--IAFVEFEYDGQAGAARDALQG 209

Query: 891  VKFDP 877
             K  P
Sbjct: 210  FKITP 214



>sp|Q62189|RU1A_MOUSE U1 small nuclear ribonucleoprotein A (U1 snRNP
           protein A) (U1A protein) (U1-A).>pir|S42113|S42114 small
           nuclear ribonucleoprotein U1A -
           mouse>gb:BC003229_2089091 Mus musculus small nuclear
           ribonucleoprotein polypeptide A, mRNA (cDNA clone
           MGC:6132 IMAGE:3483391), complete
           cds.>gb:MUSRNU1A1X_2129885 Mouse small nuclear RNA
           (Rnu1a-1) mRNA, complete cds.>gb:BC083978_2563390
           Xenopus laevis hypothetical LOC494909, mRNA (cDNA clone
           MGC:98051 IMAGE:7199233), complete cds.
          Length = 287

 Score = 38.1 bits (87), Expect = 0.40
 Identities = 23/79 (29%), Positives = 39/79 (49%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNAL 397
           P   LF+ NL     E  L  + +Q+PGF  +++   G   +AF +F+   +A    +AL
Sbjct: 211 PNHILFLTNLPEETNELMLSMLFNQFPGFKEVRL-VPGRHDIAFVEFDNEVQAGAARDAL 269

Query: 396 QGSSLPSSDRGGMHIEYAR 340
           QG  +  +    M I +A+
Sbjct: 270 QGFKI--TQNNAMKISFAK 286



 Score = 37.7 bits (86), Expect = 0.52
 Identities = 33/116 (28%), Positives = 45/116 (38%), Gaps = 21/116 (18%)
 Frame = -3

Query: 1170 HQPYDPYYRPQPLPIPDYGYTVGN---------------------KNERDMIRTLFVSGL 1054
            H P  P Y P P  IP  G   G                       +E      LF++ L
Sbjct: 161  HMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNL 220

Query: 1053 PDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNGVK 886
            P++     +  LF + PGF+  +L   GR D  +AF  F +   A AA  +L G K
Sbjct: 221  PEETNELMLSMLFNQFPGFKEVRL-VPGRHD--IAFVEFDNEVQAGAARDALQGFK 273



>sp|P09012|RU1A_HUMAN U1 small nuclear ribonucleoprotein A (U1 snRNP
           protein A) (U1A protein) (U1-A).>pir|JQ1528|JQ1528 small
           nuclear ribonucleoprotein U1A - human>gb:A14656_1447562
           immunochemically reactive protein fragment for the
           detection of auto-antibodies.>gb:BC000405_1966693 Homo
           sapiens small nuclear ribonucleoprotein polypeptide A,
           mRNA (cDNA clone MGC:8567 IMAGE:2822987), complete
           cds.>gb:BC008290_1971276 Homo sapiens small nuclear
           ribonucleoprotein polypeptide A, mRNA (cDNA clone
           MGC:12696 IMAGE:3677365), complete
           cds.>gb:HSU1RNPA_2022697 Human mRNA for U1 small nuclear
           RNP-specific A protein.>gb:HUMU1RNP6_2037961 Human U1
           snRNP-specific protein A gene, exon 6.
          Length = 282

 Score = 38.1 bits (87), Expect = 0.40
 Identities = 23/79 (29%), Positives = 39/79 (49%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNAL 397
           P   LF+ NL     E  L  + +Q+PGF  +++   G   +AF +F+   +A    +AL
Sbjct: 206 PNHILFLTNLPEETNELMLSMLFNQFPGFKEVRL-VPGRHDIAFVEFDNEVQAGAARDAL 264

Query: 396 QGSSLPSSDRGGMHIEYAR 340
           QG  +  +    M I +A+
Sbjct: 265 QGFKI--TQNNAMKISFAK 281



 Score = 37.7 bits (86), Expect = 0.52
 Identities = 33/116 (28%), Positives = 45/116 (38%), Gaps = 21/116 (18%)
 Frame = -3

Query: 1170 HQPYDPYYRPQPLPIPDYGYTVGN---------------------KNERDMIRTLFVSGL 1054
            H P  P Y P P  IP  G   G                       +E      LF++ L
Sbjct: 156  HMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNL 215

Query: 1053 PDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNGVK 886
            P++     +  LF + PGF+  +L   GR D  +AF  F +   A AA  +L G K
Sbjct: 216  PEETNELMLSMLFNQFPGFKEVRL-VPGRHD--IAFVEFDNEVQAGAARDALQGFK 268



 Score = 35.8 bits (81), Expect = 2.0
 Identities = 30/92 (32%), Positives = 46/92 (50%), Gaps = 10/92 (10%)
 Frame = -3

Query: 582 THPCSTLFIANLGPNCTEDELRK----ILSQYPGF------NTLKVRARGGMPVAFADFE 433
           T P  T++I NL     +DEL+K    I SQ+          +LK+R +     AF  F+
Sbjct: 6   TRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQ-----AFVIFK 60

Query: 432 GVEEATQVMNALQGSSLPSSDRGGMHIEYARS 337
            V  AT  + ++QG   P  D+  M I+YA++
Sbjct: 61  EVSSATNALRSMQG--FPFYDK-PMRIQYAKT 89



>gb:BC055501_2551372 Danio rerio TIA1 cytotoxic granule-associated RNA
            binding protein-like 1, mRNA (cDNA clone MGC:66130
            IMAGE:2643234), complete cds.
          Length = 370

 Score = 37.7 bits (86), Expect = 0.52
 Identities = 28/104 (26%), Positives = 47/104 (45%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSL 898
            +TL+V  L  DV    I  LF +    +SC++      +    F  F +H+ A AAL ++
Sbjct: 8    KTLYVGNLSRDVTENLILQLFTQIGPCKSCKMITEHTSNDPYCFVEFFEHRDAAAALAAM 67

Query: 897  NGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVVIDNRSKSNT 766
            NG K     G  + +  A + S + K   +  +V + + S   T
Sbjct: 68   NGRKI---LGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEIT 108



>gb:BC044979_2548938 Xenopus laevis sans fille, mRNA (cDNA clone
           MGC:52976 IMAGE:4930667), complete cds.
          Length = 282

 Score = 37.7 bits (86), Expect = 0.52
 Identities = 23/79 (29%), Positives = 39/79 (49%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNAL 397
           P   LF+ NL     E  L  + +Q+PGF  +++   G   +AF +F+   +A     +L
Sbjct: 206 PNHILFLTNLPEETNELMLSMLFNQFPGFKEVRL-VPGRHDIAFVEFDNEVQAGAARESL 264

Query: 396 QGSSLPSSDRGGMHIEYAR 340
           QG  +  S+   M I +A+
Sbjct: 265 QGFKITQSN--SMKISFAK 281



 Score = 35.4 bits (80), Expect = 2.6
 Identities = 23/62 (37%), Positives = 33/62 (53%)
 Frame = -3

Query: 1071 LFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNG 892
            LF++ LP++     +  LF + PGF+  +L   GR D  +AF  F +   A AA  SL G
Sbjct: 210  LFLTNLPEETNELMLSMLFNQFPGFKEVRL-VPGRHD--IAFVEFDNEVQAGAARESLQG 266

Query: 891  VK 886
             K
Sbjct: 267  FK 268



>gb:BC010496_2091006 Mus musculus Tial1 cytotoxic granule-associated
            RNA binding protein-like 1, mRNA (cDNA clone MGC:5930
            IMAGE:3497971), complete cds.
          Length = 375

 Score = 37.7 bits (86), Expect = 0.52
 Identities = 29/104 (27%), Positives = 47/104 (45%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSL 898
            RTL+V  L  DV    I  LF +    +SC++      +    F  F +H+ A AAL ++
Sbjct: 9    RTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTSNDPYCFVEFYEHRDAAAALAAM 68

Query: 897  NGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVVIDNRSKSNT 766
            NG K     G  + +  A + S + K   +  +V + + S   T
Sbjct: 69   NGRKI---LGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEIT 109



>gb:AF190655_1775438 Nicotiana tabacum poly(A)-binding protein
           (PABP) mRNA, complete cds.
          Length = 649

 Score = 37.7 bits (86), Expect = 0.52
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 3/70 (4%)
 Frame = -3

Query: 570 STLFIANLGPNCTEDELRKILSQYPGFNTLKV-RARGGMP--VAFADFEGVEEATQVMNA 400
           + +F+ NL  +  E+ELRKI  ++    ++ V +   G      F +FE  E+A + + A
Sbjct: 206 TNVFVKNLSESTLEEELRKIFGEFGAITSVAVMKDEDGKSRCFGFVNFENAEDAARAVEA 265

Query: 399 LQGSSLPSSD 370
           L G  L + D
Sbjct: 266 LNGYKLDNKD 275



>pir|H90083|H90083 polyadenylate-binding protein [imported] -
            Guillardia theta nucleomorph>gb:AF165818_1773753
            Guillardia theta nucleomorph chromosome 1, complete
            sequence.
          Length = 389

 Score = 37.7 bits (86), Expect = 0.52
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 6/75 (8%)
 Frame = -3

Query: 1098 KNERDMIR-----TLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQV-VAFATF 937
            KN  + IR      LF+  LP +   +++H+LF       S ++KY   G  +   F  +
Sbjct: 83   KNNNNSIRKSGYGNLFIKNLPYNFSPKDLHSLFSEYGEILSSKIKYDNEGSSLGYGFVHY 142

Query: 936  VDHQSAMAALHSLNG 892
             + + A++A+++LNG
Sbjct: 143  KEMKDAISAINNLNG 157



>sp|Q01085|TIAR_HUMAN Nucleolysin TIAR (TIA-1 related
            protein).>pir|A46174|A46174 RNA-binding protein TIAR -
            human>gb:HUMNUCTIAR_2035217 Homo sapiens nucleolysin TIAR
            mRNA, complete cds.
          Length = 375

 Score = 37.7 bits (86), Expect = 0.52
 Identities = 29/104 (27%), Positives = 47/104 (45%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSL 898
            RTL+V  L  DV    I  LF +    +SC++      +    F  F +H+ A AAL ++
Sbjct: 9    RTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTSNDPYCFVEFYEHRDAAAALAAM 68

Query: 897  NGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVVIDNRSKSNT 766
            NG K     G  + +  A + S + K   +  +V + + S   T
Sbjct: 69   NGRKI---LGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEIT 109



>sp|P45429|RU1A_XENLA U1 small nuclear ribonucleoprotein A (U1 snRNP
           protein A) (U1A protein) (U1-A).>pir|S30564|S30564 small
           nuclear ribonucleoprotein U1A - African clawed
           frog>gb:XLU1AA_2583266 X.laevis U1 A mRNA.
          Length = 282

 Score = 37.7 bits (86), Expect = 0.52
 Identities = 23/79 (29%), Positives = 39/79 (49%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNAL 397
           P   LF+ NL     E  L  + +Q+PGF  +++   G   +AF +F+   +A     +L
Sbjct: 206 PNHILFLTNLPEETNELMLSMLFNQFPGFKEVRL-VPGRHDIAFVEFDNEVQAGAARESL 264

Query: 396 QGSSLPSSDRGGMHIEYAR 340
           QG  +  S+   M I +A+
Sbjct: 265 QGFKITQSN--SMKISFAK 281



 Score = 35.4 bits (80), Expect = 2.6
 Identities = 23/62 (37%), Positives = 33/62 (53%)
 Frame = -3

Query: 1071 LFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSLNG 892
            LF++ LP++     +  LF + PGF+  +L   GR D  +AF  F +   A AA  SL G
Sbjct: 210  LFLTNLPEETNELMLSMLFNQFPGFKEVRL-VPGRHD--IAFVEFDNEVQAGAARESLQG 266

Query: 891  VK 886
             K
Sbjct: 267  FK 268



>gb:DRU62018_2571346 Danio rerio zHuC mRNA, complete cds.
          Length = 345

 Score = 37.4 bits (85), Expect = 0.68
 Identities = 31/107 (28%), Positives = 48/107 (44%), Gaps = 3/107 (2%)
 Frame = -3

Query: 1143 PQPLPIPDYGYTVGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYT 973
            P    +P+      N    D    L V+ LP ++   E  +LF      ESC+L   K T
Sbjct: 16   PSGTSLPNGPVISTNGATDDSKTNLIVNYLPQNMTQEEFKSLFGSIGEIESCKLVRDKIT 75

Query: 972  GRGDQVVAFATFVDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNS 832
            G+      F  +VD   A  A+++LNG+K   +   T+ +  AR +S
Sbjct: 76   GQS-LGYGFVNYVDPNDADKAINTLNGLKLQTK---TIKVSYARPSS 118



>gb:BC065965_2554219 Danio rerio ELAV (embryonic lethal, abnormal
            vision, Drosophila)-like 4 (Hu antigen D), mRNA (cDNA
            clone MGC:77361 IMAGE:6968572), complete cds.
          Length = 362

 Score = 37.4 bits (85), Expect = 0.68
 Identities = 28/94 (29%), Positives = 47/94 (50%), Gaps = 3/94 (3%)
 Frame = -3

Query: 1104 GNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFV 934
            G  N+ D    L V+ LP ++   E  +LF      ESC+L   K TG+      F  ++
Sbjct: 31   GGSND-DSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQS-LGYGFVNYI 88

Query: 933  DHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNS 832
            D + A  A+++LNG++   +   T+ +  AR +S
Sbjct: 89   DPKDAEKAINTLNGLRLQTK---TIKVSYARPSS 119



>gb:BC065343_2553961 Danio rerio ELAV (embryonic lethal, abnormal
            vision, Drosophila)-like 3 (Hu antigen C), mRNA (cDNA
            clone MGC:77335 IMAGE:6967800), complete cds.
          Length = 359

 Score = 37.4 bits (85), Expect = 0.68
 Identities = 31/107 (28%), Positives = 48/107 (44%), Gaps = 3/107 (2%)
 Frame = -3

Query: 1143 PQPLPIPDYGYTVGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYT 973
            P    +P+      N    D    L V+ LP ++   E  +LF      ESC+L   K T
Sbjct: 16   PSGTSLPNGPVISTNGATDDSKTNLIVNYLPQNMTQEEFKSLFGSIGEIESCKLVRDKIT 75

Query: 972  GRGDQVVAFATFVDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNS 832
            G+      F  +VD   A  A+++LNG+K   +   T+ +  AR +S
Sbjct: 76   GQS-LGYGFVNYVDPNDADKAINTLNGLKLQTK---TIKVSYARPSS 118



>gb:BC046812_2099388 Mus musculus cytotoxic granule-associated RNA
            binding protein 1, mRNA (cDNA clone MGC:61396
            IMAGE:5702183), complete cds.
          Length = 377

 Score = 37.4 bits (85), Expect = 0.68
 Identities = 31/111 (27%), Positives = 52/111 (46%), Gaps = 2/111 (1%)
 Frame = -3

Query: 1092 ERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGR--GDQVVAFATFVDHQSA 919
            E +M +TL+V  L  DV    I  LF +    ++C++    R  G+    F  F +H+ A
Sbjct: 2    EDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDVRTAGNDPYCFVEFHEHRHA 61

Query: 918  MAALHSLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVVIDNRSKSNT 766
             AAL ++NG K     G  + +  A + S + K   +  +V + + S   T
Sbjct: 62   AAALAAMNGRKI---MGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEIT 109



>gb:BC004289_1969145 Homo sapiens RNA binding motif protein 19, mRNA
            (cDNA clone MGC:10866 IMAGE:3619715), complete
            cds.>gb:BC006137_1970052 Homo sapiens RNA binding motif
            protein 19, mRNA (cDNA clone MGC:13068 IMAGE:3677625),
            complete cds.
          Length = 960

 Score = 37.4 bits (85), Expect = 0.68
 Identities = 32/132 (24%), Positives = 59/132 (44%), Gaps = 8/132 (6%)
 Frame = -3

Query: 663  EKSGEKVGDGDNVLAAQSEQIEKIGDGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNT 484
            E   E+  D  +    + E+ E+  + + P  TLFI NL  + TE++L+++ S+     +
Sbjct: 699  ENPTEEGADNSSAKMEEEEEEEEEEEESLPGCTLFIKNLNFDTTEEKLKEVFSKVGTVKS 758

Query: 483  LKVRARG-------GMPVAFADFEGVEEATQVMNALQGSSLPSSDRGGMHIEYARS-KMR 328
              +  +         M   F ++   E+A + +  LQG  +      G  +E   S +  
Sbjct: 759  CSISKKKNKAGVLLSMGFGFVEYRKPEQAQKALKQLQGHVV-----DGHKLEVRISERAT 813

Query: 327  KP*ITLR*KKNL 292
            KP +TL  KK +
Sbjct: 814  KPAVTLARKKQV 825



>gb:AB014582_1864611 Homo sapiens mRNA for KIAA0682 protein, partial
            cds.
          Length = 973

 Score = 37.4 bits (85), Expect = 0.68
 Identities = 32/132 (24%), Positives = 59/132 (44%), Gaps = 8/132 (6%)
 Frame = -3

Query: 663  EKSGEKVGDGDNVLAAQSEQIEKIGDGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNT 484
            E   E+  D  +    + E+ E+  + + P  TLFI NL  + TE++L+++ S+     +
Sbjct: 712  ENPTEEGADNSSAKMEEEEEEEEEEEESLPGCTLFIKNLNFDTTEEKLKEVFSKVGTVKS 771

Query: 483  LKVRARG-------GMPVAFADFEGVEEATQVMNALQGSSLPSSDRGGMHIEYARS-KMR 328
              +  +         M   F ++   E+A + +  LQG  +      G  +E   S +  
Sbjct: 772  CSISKKKNKAGVLLSMGFGFVEYRKPEQAQKALKQLQGHVV-----DGHKLEVRISERAT 826

Query: 327  KP*ITLR*KKNL 292
            KP +TL  KK +
Sbjct: 827  KPAVTLARKKQV 838



>pir|T17297|T17297 hypothetical protein DKFZp586F1023.1 -
            human>gb:HSM801072_1186045 Homo sapiens mRNA; cDNA
            DKFZp586F1023 (from clone DKFZp586F1023).
          Length = 960

 Score = 37.4 bits (85), Expect = 0.68
 Identities = 32/132 (24%), Positives = 59/132 (44%), Gaps = 8/132 (6%)
 Frame = -3

Query: 663  EKSGEKVGDGDNVLAAQSEQIEKIGDGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNT 484
            E   E+  D  +    + E+ E+  + + P  TLFI NL  + TE++L+++ S+     +
Sbjct: 699  ENPTEEGADNSSAKMEEEEEEEEEEEESLPGCTLFIKNLNFDTTEEKLKEVFSKVGTVKS 758

Query: 483  LKVRARG-------GMPVAFADFEGVEEATQVMNALQGSSLPSSDRGGMHIEYARS-KMR 328
              +  +         M   F ++   E+A + +  LQG  +      G  +E   S +  
Sbjct: 759  CSISKKKNKAGVLLSMGFGFVEYRKPEQAQKALKQLQGHVV-----DGHKLEVRISERAT 813

Query: 327  KP*ITLR*KKNL 292
            KP +TL  KK +
Sbjct: 814  KPAVTLARKKQV 825



>pir|I50513|I50513 ribonucleoprotein - zebra fish>gb:DRU17602_2571262
            Danio rerio ribonucleoprotein (elrD) mRNA, complete cds.
          Length = 367

 Score = 37.4 bits (85), Expect = 0.68
 Identities = 28/94 (29%), Positives = 47/94 (50%), Gaps = 3/94 (3%)
 Frame = -3

Query: 1104 GNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFV 934
            G  N+ D    L V+ LP ++   E  +LF      ESC+L   K TG+      F  ++
Sbjct: 36   GGSND-DSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQS-LGYGFVNYI 93

Query: 933  DHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNS 832
            D + A  A+++LNG++   +   T+ +  AR +S
Sbjct: 94   DPKDAEKAINTLNGLRLQTK---TIKVSYARPSS 124



>sp|Q9Y4C8|K682_HUMAN Probable RNA-binding protein KIAA0682.
          Length = 960

 Score = 37.4 bits (85), Expect = 0.68
 Identities = 32/132 (24%), Positives = 59/132 (44%), Gaps = 8/132 (6%)
 Frame = -3

Query: 663  EKSGEKVGDGDNVLAAQSEQIEKIGDGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNT 484
            E   E+  D  +    + E+ E+  + + P  TLFI NL  + TE++L+++ S+     +
Sbjct: 699  ENPTEEGADNSSAKMEEEEEEEEEEEESLPGCTLFIKNLNFDTTEEKLKEVFSKVGTVKS 758

Query: 483  LKVRARG-------GMPVAFADFEGVEEATQVMNALQGSSLPSSDRGGMHIEYARS-KMR 328
              +  +         M   F ++   E+A + +  LQG  +      G  +E   S +  
Sbjct: 759  CSISKKKNKAGVLLSMGFGFVEYRKPEQAQKALKQLQGHVV-----DGHKLEVRISERAT 813

Query: 327  KP*ITLR*KKNL 292
            KP +TL  KK +
Sbjct: 814  KPAVTLARKKQV 825



>gb:BC080020_2561457 Xenopus laevis embryonic poly(A) binding protein,
            mRNA (cDNA clone MGC:82273 IMAGE:4032449), complete cds.
          Length = 629

 Score = 37.0 bits (84), Expect = 0.89
 Identities = 48/263 (18%), Positives = 89/263 (33%), Gaps = 33/263 (12%)
 Frame = -3

Query: 1080 IRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHS 901
            +  +F+  L + +  + +++ F       SC++     G +   F  F  H++A  A+ +
Sbjct: 98   VGNVFIKNLDESIDNKALYDTFSAFGNILSCKVVCDEHGSRGYGFVHFETHEAANRAIQT 157

Query: 900  LNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVVI--------------DNRSKSNTD 763
            +NG+  + +      + +    SRR +    G  V+               D R +    
Sbjct: 158  MNGMLLNDRK-----VFVGHFKSRRERELEYGAKVMEFTNVYIKNFGEDMDDKRLREIFS 212

Query: 762  AKGTXXXXXXXXXXXXXXXXXXXXXXX----XXXXSXEKSGEKVG-------------DG 634
            A G                                  E +G++V              + 
Sbjct: 213  AFGNTLSVKVMMDDSGRSRGFGFVNYGNHEEAQKAVSEMNGKEVNGRMIYVGRAQKRIER 272

Query: 633  DNVLAAQSEQIEKIGDGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGG-- 460
             + L  + EQI++     +    L++ NL     +D LRK    Y    + KV   GG  
Sbjct: 273  QSELKRKFEQIKQERINRYQGVNLYVKNLDDGIDDDRLRKEFLPYGTITSAKVMTEGGHS 332

Query: 459  MPVAFADFEGVEEATQVMNALQG 391
                F  F   EEAT+ +  + G
Sbjct: 333  KGFGFVCFSSPEEATKAVTEMNG 355



>gb:BC059527_2552504 Danio rerio hypothetical protein LOC402896,
           mRNA (cDNA clone IMAGE:4201535), partial cds.
          Length = 229

 Score = 37.0 bits (84), Expect = 0.89
 Identities = 24/79 (30%), Positives = 40/79 (50%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNAL 397
           P   LF+ NL     E  L  + +Q+PGF  +++   G   ++F +FE   +A    +AL
Sbjct: 153 PNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRL-VPGKHDISFVEFESEAQAGVAKDAL 211

Query: 396 QGSSLPSSDRGGMHIEYAR 340
           QG  + ++    M I YA+
Sbjct: 212 QGFRITAT--CAMKITYAK 228



>gb:AF338225_2488347 Xenopus laevis embryonic poly(A) binding protein
            (ePAB) mRNA, complete cds.
          Length = 629

 Score = 37.0 bits (84), Expect = 0.89
 Identities = 48/263 (18%), Positives = 89/263 (33%), Gaps = 33/263 (12%)
 Frame = -3

Query: 1080 IRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHS 901
            +  +F+  L + +  + +++ F       SC++     G +   F  F  H++A  A+ +
Sbjct: 98   VGNVFIKNLDESIDNKALYDTFSAFGNILSCKVVCDEHGSRGYGFVHFETHEAANRAIQT 157

Query: 900  LNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVVI--------------DNRSKSNTD 763
            +NG+  + +      + +    SRR +    G  V+               D R +    
Sbjct: 158  MNGMLLNDRK-----VFVGHFKSRRERELEYGAKVMEFTNVYIKNFGEDMDDKRLREIFS 212

Query: 762  AKGTXXXXXXXXXXXXXXXXXXXXXXX----XXXXSXEKSGEKVG-------------DG 634
            A G                                  E +G++V              + 
Sbjct: 213  AFGNTLSVKVMMDDSGRSRGFGFVNYGNHEEAQKAVSEMNGKEVNGRMIYVGRAQKRIER 272

Query: 633  DNVLAAQSEQIEKIGDGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGG-- 460
             + L  + EQI++     +    L++ NL     +D LRK    Y    + KV   GG  
Sbjct: 273  QSELKRKFEQIKQERINRYQGVNLYVKNLDDGIDDDRLRKEFLPYGTITSAKVMTEGGHS 332

Query: 459  MPVAFADFEGVEEATQVMNALQG 391
                F  F   EEAT+ +  + G
Sbjct: 333  KGFGFVCFSSPEEATKAVTEMNG 355



>gb:AB098713_2048260 Rattus norvegicus mRNA for RNA binding protein
            HuB, complete cds.
          Length = 359

 Score = 37.0 bits (84), Expect = 0.89
 Identities = 27/95 (28%), Positives = 47/95 (49%), Gaps = 3/95 (3%)
 Frame = -3

Query: 1107 VGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATF 937
            V + N  D    L  + LP ++   E+ +LF      ESC+L   K TG+      F  +
Sbjct: 29   VDSGNTEDSKTNLIDNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQS-LGYGFVNY 87

Query: 936  VDHQSAMAALHSLNGVKFDPQTGSTLHIEIARSNS 832
            +D + A  A+++LNG++   +   T+ +  AR +S
Sbjct: 88   IDPKDAEKAINTLNGLRLQTK---TIKVSYARPSS 119



>gb:AP004885_1846610 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0575F10.
          Length = 279

 Score = 37.0 bits (84), Expect = 0.89
 Identities = 26/83 (31%), Positives = 41/83 (49%), Gaps = 1/83 (1%)
 Frame = -3

Query: 588 DGTHPCSTLFIANLGP-NCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQ 412
           + T P  TLF+ N  P N    +L +   QY   + +++R       AF  +E  E+AT+
Sbjct: 89  NNTRPTKTLFVINFDPINTRTRDLERHFDQYGKISNVRIRRN----FAFVQYELQEDATK 144

Query: 411 VMNALQGSSLPSSDRGGMHIEYA 343
            +    GS+L   DR  + +EYA
Sbjct: 145 ALEGTNGSTL--MDR-VISVEYA 164



>gb:AF349964_1790252 Daucus carota poly(A)-binding protein mRNA,
            complete cds.
          Length = 658

 Score = 37.0 bits (84), Expect = 0.89
 Identities = 53/255 (20%), Positives = 92/255 (36%), Gaps = 20/255 (7%)
 Frame = -3

Query: 1074 TLFVSGLPDDVKAREIHNLFRRRPGFES---CQLKYTGRGDQVVAFATFVDHQSAMAALH 904
            +L+V  L   V   ++++LF +     S   C+   TGR      +  + + Q A  A+ 
Sbjct: 41   SLYVGDLDQSVTDSQLYDLFNQVGQVVSVRVCRDLSTGRS-LGYGYVNYSNQQDATRAID 99

Query: 903  SLNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVVIDNRSKSNTDAKGTXXXXXXXXX 724
             LN   F P    T+ + ++R +   T R      + I N  KS  D K           
Sbjct: 100  VLN---FTPLNNKTIRVSVSRRDP--TDRKSGAGNIFIKNLDKS-IDIKALHETFSSFGT 153

Query: 723  XXXXXXXXXXXXXXXXXXSXEKSGEKVG----DGDNVLAAQSEQI------EKIGDGTHP 574
                                +   E+      D  N +    +Q+       K    +  
Sbjct: 154  IISCKIATDASGQSKGYGFVQYDSEEAAQTAIDKLNGMLMNDKQVYVGVFLRKQDRDSEM 213

Query: 573  CST----LFIANLGPNCTEDELRKILSQYPGFNTLKV-RARGGMP--VAFADFEGVEEAT 415
              T    +++ NL  + +ED+LRK   +Y    ++ V R   G      F +FE  E+A 
Sbjct: 214  SKTKFNNIYVKNLSDSTSEDDLRKTFGEYGTITSVVVMRDADGKSKCFGFVNFENPEDAA 273

Query: 414  QVMNALQGSSLPSSD 370
            + ++AL G      +
Sbjct: 274  KAVDALNGKKFDDKE 288



>gb:AE016819_1748942 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 396

 Score = 37.0 bits (84), Expect = 0.89
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 5/82 (6%)
 Frame = -3

Query: 621 AAQSEQIEKIGDG-THPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKV--RARGGMPV 451
           A + ++ +K GD  + P  TLF+ NL  N   D L ++ S++    ++++        P 
Sbjct: 250 APREDRAKKYGDTPSQPSDTLFLGNLSFNADRDALFELFSKHGNVISVRIPTHPESNQPK 309

Query: 450 AFA--DFEGVEEATQVMNALQG 391
            F    +  VEEA   ++ALQG
Sbjct: 310 GFGYVQYGSVEEAQAALDALQG 331



>gb:AE016817_1747224 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 526

 Score = 37.0 bits (84), Expect = 0.89
 Identities = 24/82 (29%), Positives = 38/82 (46%), Gaps = 7/82 (8%)
 Frame = -3

Query: 615 QSEQIEKIGDGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKV-------RARGGM 457
           Q E  +   D +   + +FI  L    TED LR+  S+Y     +K+       R+RG  
Sbjct: 148 QQEAKQVKADLSRDINKMFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFG 207

Query: 456 PVAFADFEGVEEATQVMNALQG 391
            ++FAD   V+E  +  + L G
Sbjct: 208 FLSFADASSVDEVVKTQHILDG 229



>gb:CR380957_1652799 Candida glabrata strain CBS138 chromosome K
           complete sequence.
          Length = 802

 Score = 37.0 bits (84), Expect = 0.89
 Identities = 21/60 (35%), Positives = 29/60 (48%)
 Frame = -3

Query: 570 STLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQG 391
           +T+F+  LGP   E +LRKI    P  N L ++   G    F  FE   +A   +  LQG
Sbjct: 467 TTVFVGGLGPTVQEQQLRKIFQ--PFGNILSIKIPPGKNCGFVKFEHKIDAEAAIQGLQG 524



>gb:PFA929359_1393564 Plasmodium falciparum strain 3D7, chromosome
           9; segment 5/5.
          Length = 193

 Score = 37.0 bits (84), Expect = 0.89
 Identities = 22/58 (37%), Positives = 29/58 (50%)
 Frame = -3

Query: 567 TLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNALQ 394
           TL + NL     ++ L  + +QYPGF   +VR   G  +AF DF   E A   M  LQ
Sbjct: 122 TLLVQNLPDEINKNALEILFNQYPGF--YEVRYIPGKNIAFVDFTAQEHAEISMTGLQ 177



 Score = 35.8 bits (81), Expect = 2.0
 Identities = 22/85 (25%), Positives = 41/85 (48%)
 Frame = -3

Query: 1131 PIPDYGYTVGNKNERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVV 952
            P+ +Y      +++ ++I TL V  LPD++    +  LF + PGF   +++Y     + +
Sbjct: 103  PLLNYKSKHNIEHKSNLIYTLLVQNLPDEINKNALEILFNQYPGF--YEVRYI--PGKNI 158

Query: 951  AFATFVDHQSAMAALHSLNGVKFDP 877
            AF  F   + A  ++  L   K  P
Sbjct: 159  AFVDFTAQEHAEISMTGLQNFKITP 183



>pir|G84865|G84865 hypothetical protein At2g43410 [imported] -
           Arabidopsis thaliana>gb:AC002335_1530407 Arabidopsis
           thaliana chromosome 2 clone T1O24 map CIC10F02, complete
           sequence.
          Length = 1056

 Score = 37.0 bits (84), Expect = 0.89
 Identities = 21/69 (30%), Positives = 35/69 (50%)
 Frame = -3

Query: 588 DGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQV 409
           D     + L++ +L P  TE +L ++  +Y   + + V +  G   AF  +  VEEA   
Sbjct: 12  DSGFQSNNLWVGSLTPETTESDLTELFGRYGDIDRITVYSSRGF--AFIYYRHVEEAVAA 69

Query: 408 MNALQGSSL 382
             ALQG++L
Sbjct: 70  KEALQGANL 78



 Score = 36.2 bits (82), Expect = 1.5
 Identities = 24/89 (26%), Positives = 45/89 (50%), Gaps = 5/89 (5%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQY---PGFNTLKVRARGGMPVAFADFEGVEEATQVM 406
           PC +L++  +GPN ++D+L +  S++     F  L+ R       AF D+  +++     
Sbjct: 248 PCKSLWVGGIGPNVSKDDLEEEFSKFGKIEDFRFLRER-----KTAFIDYYEMDD----- 297

Query: 405 NALQGSSLPSSDRGG--MHIEYARSKMRK 325
            ALQ  S+     GG  + +++ RS+  K
Sbjct: 298 -ALQAKSMNGKPMGGSFLRVDFLRSQAPK 325



>gb:AF176675_2478667 Gallus gallus RNA-binding protein HuD (HuD) mRNA,
            complete cds.
          Length = 371

 Score = 36.6 bits (83), Expect = 1.2
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 3/88 (3%)
 Frame = -3

Query: 1086 DMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFVDHQSAM 916
            D    L V+ LP ++   E  +LF      ESC+L   K TG+      F  ++D + A 
Sbjct: 48   DSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQS-LGYGFVNYIDPKDAE 106

Query: 915  AALHSLNGVKFDPQTGSTLHIEIARSNS 832
             A+++LNG++   +   T+ +  AR +S
Sbjct: 107  KAINTLNGLRLQTK---TIKVSYARPSS 131



>gb:BC048159_2099557 Mus musculus ELAV (embryonic lethal, abnormal
            vision, Drosophila)-like 4 (Hu antigen D), mRNA (cDNA
            clone MGC:61389 IMAGE:5703005), complete cds.
          Length = 412

 Score = 36.6 bits (83), Expect = 1.2
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 3/88 (3%)
 Frame = -3

Query: 1086 DMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFVDHQSAM 916
            D    L V+ LP ++   E  +LF      ESC+L   K TG+      F  ++D + A 
Sbjct: 48   DSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQS-LGYGFVNYIDPKDAE 106

Query: 915  AALHSLNGVKFDPQTGSTLHIEIARSNS 832
             A+++LNG++   +   T+ +  AR +S
Sbjct: 107  KAINTLNGLRLQTK---TIKVSYARPSS 131



>gb:AF041341_2051980 Mus musculus RNA binding protein Elavl4 mRNA,
            alternatively spliced, complete cds.
          Length = 346

 Score = 36.6 bits (83), Expect = 1.2
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 3/88 (3%)
 Frame = -3

Query: 1086 DMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFVDHQSAM 916
            D    L V+ LP ++   E  +LF      ESC+L   K TG+      F  ++D + A 
Sbjct: 36   DSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQS-LGYGFVNYIDPKDAE 94

Query: 915  AALHSLNGVKFDPQTGSTLHIEIARSNS 832
             A+++LNG++   +   T+ +  AR +S
Sbjct: 95   KAINTLNGLRLQTK---TIKVSYARPSS 119



>gb:BC036071_1981828 Homo sapiens ELAV (embryonic lethal, abnormal
            vision, Drosophila)-like 4 (Hu antigen D), mRNA (cDNA
            clone MGC:33705 IMAGE:5286347), complete cds.
          Length = 366

 Score = 36.6 bits (83), Expect = 1.2
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 3/88 (3%)
 Frame = -3

Query: 1086 DMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFVDHQSAM 916
            D    L V+ LP ++   E  +LF      ESC+L   K TG+      F  ++D + A 
Sbjct: 43   DSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQS-LGYGFVNYIDPKDAE 101

Query: 915  AALHSLNGVKFDPQTGSTLHIEIARSNS 832
             A+++LNG++   +   T+ +  AR +S
Sbjct: 102  KAINTLNGLRLQTK---TIKVSYARPSS 126



>gb:AL583843_1929040 Human DNA sequence from clone RP11-492I2 on
            chromosome 1 Contains the 5' end of the ELAVL4 gene for
            ELAV (embryonic lethal, abnormal vision, Drosophila)-like
            4 ((Hu antigen D) and a novel pseudogene, complete
            sequence.>gb:AL592182_1930377 Human DNA sequence from
            clone RP11-567C20 on chromosome 1 Contains the 3' end of
            the ELAVL4 gene for ELAV (embryonic lethal, abnormal
            vision, Drosophila)-like 4 ((Hu antigen D) and two novel
            genes, complete sequence.
          Length = 371

 Score = 36.6 bits (83), Expect = 1.2
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 3/88 (3%)
 Frame = -3

Query: 1086 DMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFVDHQSAM 916
            D    L V+ LP ++   E  +LF      ESC+L   K TG+      F  ++D + A 
Sbjct: 48   DSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQS-LGYGFVNYIDPKDAE 106

Query: 915  AALHSLNGVKFDPQTGSTLHIEIARSNS 832
             A+++LNG++   +   T+ +  AR +S
Sbjct: 107  KAINTLNGLRLQTK---TIKVSYARPSS 131



>gb:AL583843_1929039 Human DNA sequence from clone RP11-492I2 on
            chromosome 1 Contains the 5' end of the ELAVL4 gene for
            ELAV (embryonic lethal, abnormal vision, Drosophila)-like
            4 ((Hu antigen D) and a novel pseudogene, complete
            sequence.>gb:AL592182_1930374 Human DNA sequence from
            clone RP11-567C20 on chromosome 1 Contains the 3' end of
            the ELAVL4 gene for ELAV (embryonic lethal, abnormal
            vision, Drosophila)-like 4 ((Hu antigen D) and two novel
            genes, complete sequence.
          Length = 385

 Score = 36.6 bits (83), Expect = 1.2
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 3/88 (3%)
 Frame = -3

Query: 1086 DMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFVDHQSAM 916
            D    L V+ LP ++   E  +LF      ESC+L   K TG+      F  ++D + A 
Sbjct: 48   DSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQS-LGYGFVNYIDPKDAE 106

Query: 915  AALHSLNGVKFDPQTGSTLHIEIARSNS 832
             A+++LNG++   +   T+ +  AR +S
Sbjct: 107  KAINTLNGLRLQTK---TIKVSYARPSS 131



>gb:AL583843_1929038 Human DNA sequence from clone RP11-492I2 on
            chromosome 1 Contains the 5' end of the ELAVL4 gene for
            ELAV (embryonic lethal, abnormal vision, Drosophila)-like
            4 ((Hu antigen D) and a novel pseudogene, complete
            sequence.>gb:AL592182_1930378 Human DNA sequence from
            clone RP11-567C20 on chromosome 1 Contains the 3' end of
            the ELAVL4 gene for ELAV (embryonic lethal, abnormal
            vision, Drosophila)-like 4 ((Hu antigen D) and two novel
            genes, complete sequence.>gb:AY033997_1934697 Homo
            sapiens HUD1 mRNA, complete cds.
          Length = 366

 Score = 36.6 bits (83), Expect = 1.2
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 3/88 (3%)
 Frame = -3

Query: 1086 DMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFVDHQSAM 916
            D    L V+ LP ++   E  +LF      ESC+L   K TG+      F  ++D + A 
Sbjct: 43   DSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQS-LGYGFVNYIDPKDAE 101

Query: 915  AALHSLNGVKFDPQTGSTLHIEIARSNS 832
             A+++LNG++   +   T+ +  AR +S
Sbjct: 102  KAINTLNGLRLQTK---TIKVSYARPSS 126



>gb:AL583843_1929037 Human DNA sequence from clone RP11-492I2 on
            chromosome 1 Contains the 5' end of the ELAVL4 gene for
            ELAV (embryonic lethal, abnormal vision, Drosophila)-like
            4 ((Hu antigen D) and a novel pseudogene, complete
            sequence.>gb:AL592182_1930373 Human DNA sequence from
            clone RP11-567C20 on chromosome 1 Contains the 3' end of
            the ELAVL4 gene for ELAV (embryonic lethal, abnormal
            vision, Drosophila)-like 4 ((Hu antigen D) and two novel
            genes, complete sequence.
          Length = 380

 Score = 36.6 bits (83), Expect = 1.2
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 3/88 (3%)
 Frame = -3

Query: 1086 DMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFVDHQSAM 916
            D    L V+ LP ++   E  +LF      ESC+L   K TG+      F  ++D + A 
Sbjct: 43   DSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQS-LGYGFVNYIDPKDAE 101

Query: 915  AALHSLNGVKFDPQTGSTLHIEIARSNS 832
             A+++LNG++   +   T+ +  AR +S
Sbjct: 102  KAINTLNGLRLQTK---TIKVSYARPSS 126



>gb:AL583843_1929036 Human DNA sequence from clone RP11-492I2 on
            chromosome 1 Contains the 5' end of the ELAVL4 gene for
            ELAV (embryonic lethal, abnormal vision, Drosophila)-like
            4 ((Hu antigen D) and a novel pseudogene, complete
            sequence.>gb:AL592182_1930376 Human DNA sequence from
            clone RP11-567C20 on chromosome 1 Contains the 3' end of
            the ELAVL4 gene for ELAV (embryonic lethal, abnormal
            vision, Drosophila)-like 4 ((Hu antigen D) and two novel
            genes, complete sequence.>gb:AY033996_1934696 Homo
            sapiens HUD4 mRNA, complete cds.
          Length = 383

 Score = 36.6 bits (83), Expect = 1.2
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 3/88 (3%)
 Frame = -3

Query: 1086 DMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFVDHQSAM 916
            D    L V+ LP ++   E  +LF      ESC+L   K TG+      F  ++D + A 
Sbjct: 60   DSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQS-LGYGFVNYIDPKDAE 118

Query: 915  AALHSLNGVKFDPQTGSTLHIEIARSNS 832
             A+++LNG++   +   T+ +  AR +S
Sbjct: 119  KAINTLNGLRLQTK---TIKVSYARPSS 143



>gb:AL583843_1929035 Human DNA sequence from clone RP11-492I2 on
            chromosome 1 Contains the 5' end of the ELAVL4 gene for
            ELAV (embryonic lethal, abnormal vision, Drosophila)-like
            4 ((Hu antigen D) and a novel pseudogene, complete
            sequence.>gb:AL592182_1930375 Human DNA sequence from
            clone RP11-567C20 on chromosome 1 Contains the 3' end of
            the ELAVL4 gene for ELAV (embryonic lethal, abnormal
            vision, Drosophila)-like 4 ((Hu antigen D) and two novel
            genes, complete sequence.>gb:AY033995_1934695 Homo
            sapiens HUD3 mRNA, complete cds.
          Length = 366

 Score = 36.6 bits (83), Expect = 1.2
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 3/88 (3%)
 Frame = -3

Query: 1086 DMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFVDHQSAM 916
            D    L V+ LP ++   E  +LF      ESC+L   K TG+      F  ++D + A 
Sbjct: 43   DSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQS-LGYGFVNYIDPKDAE 101

Query: 915  AALHSLNGVKFDPQTGSTLHIEIARSNS 832
             A+++LNG++   +   T+ +  AR +S
Sbjct: 102  KAINTLNGLRLQTK---TIKVSYARPSS 126



>gb:AY074319_1567476 Arabidopsis thaliana putative DNA binding
           protein ACBF (At5g19350) mRNA, complete
           cds.>gb:AY114004_1578415 Arabidopsis thaliana putative
           DNA binding protein ACBF (At5g19350) mRNA, complete cds.
          Length = 425

 Score = 36.6 bits (83), Expect = 1.2
 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 1/57 (1%)
 Frame = -3

Query: 573 CSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMP-VAFADFEGVEEATQVM 406
           C+T+ +ANL  N TE+EL+K  SQ      +K+ A  G   V F      EEA Q M
Sbjct: 236 CTTISVANLDQNVTEEELKKAFSQLGEVIYVKIPATKGYGYVQFKTRPSAEEAVQRM 292



>gb:AB025622_1516449 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MFH8.>gb:BT015760_1642378 Arabidopsis thaliana
           At5g53180 mRNA, complete cds.>gb:BT020199_1642594
           Arabidopsis thaliana At5g53180 mRNA, complete cds.
          Length = 429

 Score = 36.6 bits (83), Expect = 1.2
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 1/79 (1%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGGMPVAFADFEGVEEATQVMNAL 397
           P   L + NL   CTE+EL ++   +      K         AF +FE + +A Q+++  
Sbjct: 16  PSKVLHLRNLPWECTEEELIELGKPFGTVVNTKCNVGANRNQAFIEFEDLNQAIQMISYY 75

Query: 396 QGSSLPSSDRG-GMHIEYA 343
             SS P+  RG  ++++Y+
Sbjct: 76  ASSSEPAQVRGKTVYLQYS 94



>gb:AK079088_1172583 Mus musculus adult male diencephalon cDNA, RIKEN
            full-length enriched library, clone:9330166O05
            product:ELAV (embryonic lethal, abnormal vision,
            Drosophila)-like 4 (Hu antigen D), full insert sequence.
          Length = 380

 Score = 36.6 bits (83), Expect = 1.2
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 3/88 (3%)
 Frame = -3

Query: 1086 DMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFVDHQSAM 916
            D    L V+ LP ++   E  +LF      ESC+L   K TG+      F  ++D + A 
Sbjct: 43   DSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQS-LGYGFVNYIDPKDAE 101

Query: 915  AALHSLNGVKFDPQTGSTLHIEIARSNS 832
             A+++LNG++   +   T+ +  AR +S
Sbjct: 102  KAINTLNGLRLQTK---TIKVSYARPSS 126



>gb:AK014133_1157801 Mus musculus 13 days embryo head cDNA, RIKEN
            full-length enriched library, clone:3110037G03
            product:ELAV (embryonic lethal, abnormal vision,
            Drosophila)-like 4 (Hu antigen D), full insert sequence.
          Length = 371

 Score = 36.6 bits (83), Expect = 1.2
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 3/88 (3%)
 Frame = -3

Query: 1086 DMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFVDHQSAM 916
            D    L V+ LP ++   E  +LF      ESC+L   K TG+      F  ++D + A 
Sbjct: 48   DSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQS-LGYGFVNYIDPKDAE 106

Query: 915  AALHSLNGVKFDPQTGSTLHIEIARSNS 832
             A+++LNG++   +   T+ +  AR +S
Sbjct: 107  KAINTLNGLRLQTK---TIKVSYARPSS 131



>pir|I51678|I51678 ribonucleoprotein - African clawed
            frog>gb:XLU17599_2583253 Xenopus laevis ribonucleoprotein
            (elrD) mRNA, complete cds.
          Length = 366

 Score = 36.6 bits (83), Expect = 1.2
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 3/88 (3%)
 Frame = -3

Query: 1086 DMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFVDHQSAM 916
            D    L V+ LP ++   E  +LF      ESC+L   K TG+      F  ++D + A 
Sbjct: 43   DSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQS-LGYGFVNYIDPKDAE 101

Query: 915  AALHSLNGVKFDPQTGSTLHIEIARSNS 832
             A+++LNG++   +   T+ +  AR +S
Sbjct: 102  KAINTLNGLRLQTK---TIKVSYARPSS 126



>pir|S59118|S59118 small nuclear ribonucleoprotein U1A [imported] -
           Arabidopsis thaliana>gb:AC002535_1530832 Arabidopsis
           thaliana chromosome 2 clone T30B22 map CIC06C03,
           complete sequence.>gb:ATU1A_1556818 A.thaliana mRNA for
           U1snRNP-specific protein (U1A).>gb:AY052663_1562823
           Arabidopsis thaliana At2g47580/T30B22.12 mRNA, complete
           cds.>gb:AY059875_1564719 Arabidopsis thaliana small
           nuclear ribonucleoprotein U1A (At2g47580; T30B22.12)
           mRNA, complete cds.>gb:AY093341_1575295 Arabidopsis
           thaliana small nuclear ribonucleoprotein U1A (At2g47580)
           mRNA, complete cds.>gb:AY142070_1582907 Arabidopsis
           thaliana At2g47580/T30B22.12 mRNA, complete cds.
          Length = 250

 Score = 36.6 bits (83), Expect = 1.2
 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = -3

Query: 576 PCSTLFIANLGPNCTEDELRKILSQYPGFNTLK-VRARGGMPVAFADFEGVEEATQVMNA 400
           P + LF+ NL    T   L+ +  QY GF  ++ + A+ G  +AF +F    ++T  M  
Sbjct: 175 PNNILFVQNLPHETTPMVLQMLFCQYQGFKEVRMIEAKPG--IAFVEFADEMQSTVAMQG 232

Query: 399 LQGSSLPSSDRGGMHIEYAR 340
           LQG  +  +    M I YA+
Sbjct: 233 LQGFKIQQNQ---MLITYAK 249



>sp|O09032|ELV4_RAT ELAV-like protein 4 (Paraneoplastic
            encephalomyelitis antigen HuD) (Hu-antigen
            D).>gb:BC052451_2101123 Mus musculus ELAV (embryonic
            lethal, abnormal vision, Drosophila)-like 4 (Hu antigen
            D), mRNA (cDNA clone MGC:64643 IMAGE:6409658), complete
            cds.>gb:S83320_2139817 r-HuD=HuD [rats, hypothalamus,
            mRNA, 1444 nt].
          Length = 373

 Score = 36.6 bits (83), Expect = 1.2
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 3/88 (3%)
 Frame = -3

Query: 1086 DMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFVDHQSAM 916
            D    L V+ LP ++   E  +LF      ESC+L   K TG+      F  ++D + A 
Sbjct: 36   DSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQS-LGYGFVNYIDPKDAE 94

Query: 915  AALHSLNGVKFDPQTGSTLHIEIARSNS 832
             A+++LNG++   +   T+ +  AR +S
Sbjct: 95   KAINTLNGLRLQTK---TIKVSYARPSS 119



>sp|Q61701|ELV4_MOUSE ELAV-like protein 4 (Paraneoplastic
            encephalomyelitis antigen HuD) (Hu-antigen
            D).>pir|JC2298|JC2298 RNA-binding protein HuD homolog -
            mouse>gb:MUSHUD_2126305 Mus musculus mRNA for HuD,
            complete cds.
          Length = 385

 Score = 36.6 bits (83), Expect = 1.2
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 3/88 (3%)
 Frame = -3

Query: 1086 DMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFVDHQSAM 916
            D    L V+ LP ++   E  +LF      ESC+L   K TG+      F  ++D + A 
Sbjct: 48   DSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQS-LGYGFVNYIDPKDAE 106

Query: 915  AALHSLNGVKFDPQTGSTLHIEIARSNS 832
             A+++LNG++   +   T+ +  AR +S
Sbjct: 107  KAINTLNGLRLQTK---TIKVSYARPSS 131



>sp|P26378|ELV4_HUMAN ELAV-like protein 4 (Paraneoplastic
            encephalomyelitis antigen HuD) (Hu-antigen
            D).>pir|A40348|A40348 Elav/Sex-lethal related protein,
            brain - human>gb:AX463225_1469036 Sequence 26 from Patent
            WO0249625.>gb:AY033998_1934698 Homo sapiens HUDPRO1 mRNA,
            complete cds.>gb:HUMBRAINPR_2029658 Human brain protein
            recognized by the sera of patients with paraneoplastic
            sensory neuronopathy mRNA, complete cds.
          Length = 380

 Score = 36.6 bits (83), Expect = 1.2
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 3/88 (3%)
 Frame = -3

Query: 1086 DMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFVDHQSAM 916
            D    L V+ LP ++   E  +LF      ESC+L   K TG+      F  ++D + A 
Sbjct: 43   DSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQS-LGYGFVNYIDPKDAE 101

Query: 915  AALHSLNGVKFDPQTGSTLHIEIARSNS 832
             A+++LNG++   +   T+ +  AR +S
Sbjct: 102  KAINTLNGLRLQTK---TIKVSYARPSS 126



>gb:BC076956_2559695 Xenopus tropicalis MGC89376 protein, mRNA (cDNA
           clone MGC:89376 IMAGE:6988840), complete cds.
          Length = 629

 Score = 36.2 bits (82), Expect = 1.5
 Identities = 24/80 (30%), Positives = 35/80 (43%), Gaps = 2/80 (2%)
 Frame = -3

Query: 624 LAAQSEQIEKIGDGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARGG--MPV 451
           L  + EQI++     +    L++ NL     +D LRK  S Y    + KV   GG     
Sbjct: 276 LKRKFEQIKQERINRYQGVNLYVKNLDDGIDDDRLRKEFSPYGTITSAKVMTEGGHSKGF 335

Query: 450 AFADFEGVEEATQVMNALQG 391
            F  F   EEAT+ +  + G
Sbjct: 336 GFVCFSSPEEATKAVTEMNG 355



>gb:AY170627_2516509 Oncorhynchus mykiss RNA-binding protein HU mRNA,
            partial cds.
          Length = 77

 Score = 36.2 bits (82), Expect = 1.5
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 3/75 (4%)
 Frame = -3

Query: 1086 DMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQL---KYTGRGDQVVAFATFVDHQSAM 916
            D    L V+ LP ++   E  +LF      ESC+L   K TG+      F  +VD   A 
Sbjct: 1    DSKTNLIVNYLPQNMTQEEFKSLFGSIGEIESCKLVRDKITGQS-LGYGFVNYVDPNDAD 59

Query: 915  AALHSLNGVKFDPQT 871
             A+++LNG+K   +T
Sbjct: 60   KAINTLNGLKLQTKT 74



>gb:CR382128_1660845 Yarrowia lipolytica chromosome B of strain CLIB99
            of Yarrowia lipolytica.
          Length = 248

 Score = 36.2 bits (82), Expect = 1.5
 Identities = 25/89 (28%), Positives = 42/89 (47%), Gaps = 2/89 (2%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQV--VAFATFVDHQSAMAALH 904
            RTL+V+G   ++ ARE+   F        C +    R  +    AF  F + + A  A  
Sbjct: 4    RTLYVTGFAPEISARELAYEFEEIGNIFRCDVISPARSGRQHGYAFVEFENARDAEYAYR 63

Query: 903  SLNGVKFDPQTGSTLHIEIARSNSRRTKR 817
             ++ ++    +G  LHIE A++  R T+R
Sbjct: 64   DMHNLRI--ASGDILHIEWAKTPLRETRR 90



>gb:CR382127_1660263 Yarrowia lipolytica chromosome A of strain CLIB99
            of Yarrowia lipolytica.
          Length = 823

 Score = 36.2 bits (82), Expect = 1.5
 Identities = 22/70 (31%), Positives = 34/70 (48%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAALHSL 898
            R+L++  LP     + +H++F      ES ++       +   F  F D QSA+ AL  L
Sbjct: 315  RSLWLGKLPPTATPQALHHIFSAYGTVESARILT----HKNCGFINFADSQSALHALQQL 370

Query: 897  NGVKFDPQTG 868
            NG +F P  G
Sbjct: 371  NGKEFFPGAG 380



>gb:AE014185_937605 Plasmodium falciparum 3D7 chromosome 10 complete
            sequence.>gb:AE014829_1228339 Plasmodium falciparum 3D7
            chromosome 10 section 1 of 7 of the complete sequence.
          Length = 248

 Score = 36.2 bits (82), Expect = 1.5
 Identities = 25/104 (24%), Positives = 47/104 (45%), Gaps = 2/104 (1%)
 Frame = -3

Query: 1074 TLFVSGLPDDVKAREIHNLFRRRPGFESCQL--KYTGRGDQVVAFATFVDHQSAMAALHS 901
            TL+VS L   +   ++ ++F +    E C +      +  +   F TF + + A  A++ 
Sbjct: 21   TLYVSNLSSKITTAKLQDIFEKYGNIEKCYVISNPITKESRNFGFVTFNNSEDAENAMNK 80

Query: 900  LNGVKFDPQTGSTLHIEIARSNSRRTKRPGSGPYVVIDNRSKSN 769
             N ++ +   G  +++EIA+ N      PG   Y  + N  K N
Sbjct: 81   ANKMEIE---GREINVEIAKRNEPHEPTPGE--YKGVQNIVKRN 119



>gb:OSJN00106_1695021 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0060E08, complete sequence.
          Length = 414

 Score = 35.8 bits (81), Expect = 2.0
 Identities = 28/106 (26%), Positives = 46/106 (43%)
 Frame = -3

Query: 642 GDGDNVLAAQSEQIEKIGDGTHPCSTLFIANLGPNCTEDELRKILSQYPGFNTLKVRARG 463
           G  + V  AQ  Q E   + T    T+F+  L PN TED L+++ + Y     + V+   
Sbjct: 253 GVQERVPNAQGAQSENDPNNT----TIFVGGLDPNVTEDVLKQVFAPYG--EVVHVKIPV 306

Query: 462 GMPVAFADFEGVEEATQVMNALQGSSLPSSDRGGMHIEYARSKMRK 325
           G    F  +     A Q +  LQG+ +   +   + + + RS   K
Sbjct: 307 GKRCGFVQYVNRPSAEQALAVLQGTLIGGQN---VRLSWGRSLSNK 349



>gb:AY118564_1300286 Drosophila melanogaster LD40028 full insert
           cDNA.
          Length = 578

 Score = 35.8 bits (81), Expect = 2.0
 Identities = 27/91 (29%), Positives = 45/91 (49%), Gaps = 3/91 (3%)
 Frame = -3

Query: 636 GDNVLAAQSEQIEKIGDGTHPCSTLFIANLGPNCTEDELRKILSQY---PGFNTLKVRAR 466
           G  V A  ++Q E+  D T+    L+IANL P+  E +L  +LS+Y        L+ +  
Sbjct: 294 GKGVQAQMAKQQEQ--DPTN----LYIANLPPHFKETDLEAMLSKYGQVVSTRILRDQQM 347

Query: 465 GGMPVAFADFEGVEEATQVMNALQGSSLPSS 373
               V FA  E  E+  Q++    G+++P +
Sbjct: 348 NSKGVGFARMESREKCEQIIQMFNGNTIPGA 378



>gb:AE014296_1134835 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003567_1215871 Drosophila melanogaster
           chromosome 3L, section 18 of 83 of the complete
           sequence.
          Length = 368

 Score = 35.8 bits (81), Expect = 2.0
 Identities = 27/91 (29%), Positives = 45/91 (49%), Gaps = 3/91 (3%)
 Frame = -3

Query: 636 GDNVLAAQSEQIEKIGDGTHPCSTLFIANLGPNCTEDELRKILSQY---PGFNTLKVRAR 466
           G  V A  ++Q E+  D T+    L+IANL P+  E +L  +LS+Y        L+ +  
Sbjct: 84  GKGVQAQMAKQQEQ--DPTN----LYIANLPPHFKETDLEAMLSKYGQVVSTRILRDQQM 137

Query: 465 GGMPVAFADFEGVEEATQVMNALQGSSLPSS 373
               V FA  E  E+  Q++    G+++P +
Sbjct: 138 NSKGVGFARMESREKCEQIIQMFNGNTIPGA 168



>gb:AE014296_1134832 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003567_1215868 Drosophila melanogaster
           chromosome 3L, section 18 of 83 of the complete
           sequence.
          Length = 481

 Score = 35.8 bits (81), Expect = 2.0
 Identities = 27/91 (29%), Positives = 45/91 (49%), Gaps = 3/91 (3%)
 Frame = -3

Query: 636 GDNVLAAQSEQIEKIGDGTHPCSTLFIANLGPNCTEDELRKILSQY---PGFNTLKVRAR 466
           G  V A  ++Q E+  D T+    L+IANL P+  E +L  +LS+Y        L+ +  
Sbjct: 197 GKGVQAQMAKQQEQ--DPTN----LYIANLPPHFKETDLEAMLSKYGQVVSTRILRDQQM 250

Query: 465 GGMPVAFADFEGVEEATQVMNALQGSSLPSS 373
               V FA  E  E+  Q++    G+++P +
Sbjct: 251 NSKGVGFARMESREKCEQIIQMFNGNTIPGA 281



>gb:OUU35661_1698571 Ophiostoma ulmi colony 1 (col1) gene, complete
            cds.
          Length = 826

 Score = 35.4 bits (80), Expect = 2.6
 Identities = 19/56 (33%), Positives = 26/56 (46%)
 Frame = -3

Query: 1074 TLFVSGLPDDVKAREIHNLFRRRPGFESCQLKYTGRGDQVVAFATFVDHQSAMAAL 907
            ++FVS LP DV   ++   FR      + QLK+   G   VA   F   + A  AL
Sbjct: 311  SVFVSNLPSDVTITKVRQYFREYGHVNNIQLKHEENGKSTVALVEFRSVEDAQTAL 366



>gb:AY094948_1298122 Drosophila melanogaster RH63980 full insert
           cDNA.
          Length = 379

 Score = 35.4 bits (80), Expect = 2.6
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 3/69 (4%)
 Frame = -3

Query: 570 STLFIANLGPNCTEDELRKILSQY---PGFNTLKVRARGGMPVAFADFEGVEEATQVMNA 400
           + L+IANL P+  E +L  +LS+Y        L+ +      V FA  E  E+  Q++  
Sbjct: 111 TNLYIANLPPHFKETDLEAMLSKYGQVVSTRILRDQQMNSKGVGFARMESREKCEQIIQM 170

Query: 399 LQGSSLPSS 373
             G+++P +
Sbjct: 171 FNGNTIPGA 179



>gb:AY060995_1292798 Drosophila melanogaster HL01227 full length
           cDNA.
          Length = 322

 Score = 35.4 bits (80), Expect = 2.6
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 3/69 (4%)
 Frame = -3

Query: 570 STLFIANLGPNCTEDELRKILSQY---PGFNTLKVRARGGMPVAFADFEGVEEATQVMNA 400
           + L+IANL P+  E +L  +LS+Y        L+ +      V FA  E  E+  Q++  
Sbjct: 224 TNLYIANLPPHFKETDLEAMLSKYGQVVSTRILRDQQMNSKGVGFARMESREKCEQIIQM 283

Query: 399 LQGSSLPSS 373
             G+++P +
Sbjct: 284 FNGNTIPGA 292



>gb:AK084514_1174257 Mus musculus 13 days embryo heart cDNA, RIKEN
            full-length enriched library, clone:D330010N23
            product:BB383K5.1 homolog [Homo sapiens], full insert
            sequence.>gb:AK084629_1174286 Mus musculus 13 days embryo
            heart cDNA, RIKEN full-length enriched library,
            clone:D330023I21 product:BB383K5.1 homolog [Homo
            sapiens], full insert sequence.>gb:BC037024_2097948 Mus
            musculus RIKEN cDNA D330023I21 gene, mRNA (cDNA clone
            MGC:47195 IMAGE:5368185), complete cds.
          Length = 413

 Score = 35.4 bits (80), Expect = 2.6
 Identities = 28/88 (31%), Positives = 45/88 (51%), Gaps = 3/88 (3%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQLKY---TGRGDQVVAFATFVDHQSAMAAL 907
            + L++  L   VK R++ +LF R    +   +++   TGR  +  AF TF +   A  AL
Sbjct: 309  KVLYLKNLSPRVKERDLISLFARFQEKKGPPIQFRMMTGRM-RGQAFLTFPNKDIAWQAL 367

Query: 906  HSLNGVKFDPQTGSTLHIEIARSNSRRT 823
            H +NG K     G  L IE A+S  +++
Sbjct: 368  HQINGYKL---YGKILVIEFAKSKKQQS 392



>gb:AE014296_1134833 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE014296_1134834 Drosophila melanogaster
           chromosome 3L, complete sequence.>gb:AE003567_1215869
           Drosophila melanogaster chromosome 3L, section 18 of 83
           of the complete sequence.>gb:AE003567_1215870 Drosophila
           melanogaster chromosome 3L, section 18 of 83 of the
           complete sequence.
          Length = 499

 Score = 35.4 bits (80), Expect = 2.6
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 3/69 (4%)
 Frame = -3

Query: 570 STLFIANLGPNCTEDELRKILSQY---PGFNTLKVRARGGMPVAFADFEGVEEATQVMNA 400
           + L+IANL P+  E +L  +LS+Y        L+ +      V FA  E  E+  Q++  
Sbjct: 224 TNLYIANLPPHFKETDLEAMLSKYGQVVSTRILRDQQMNSKGVGFARMESREKCEQIIQM 283

Query: 399 LQGSSLPSS 373
             G+++P +
Sbjct: 284 FNGNTIPGA 292



>sp|Q62504|MINT_MOUSE Msx2-interacting protein (SMART/HDAC1 associated
            repressor protein).
          Length = 3644

 Score = 35.4 bits (80), Expect = 2.6
 Identities = 24/62 (38%), Positives = 34/62 (54%), Gaps = 1/62 (1%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQ-LKYTGRGDQVVAFATFVDHQSAMAALHS 901
            R L+V  LP++V+  +I   F+R    ES + L   G    V AF  FVD +SA  A +S
Sbjct: 6    RHLWVGNLPENVREEKIIEHFKRYGRVESVKILPKRGSEGGVAAFVDFVDIKSAQKAHNS 65

Query: 900  LN 895
            +N
Sbjct: 66   VN 67



>sp|Q96T58|MINT_HUMAN Msx2-interacting protein (SMART/HDAC1 associated
            repressor protein).>gb:AF356524_1898840 Homo sapiens
            nuclear receptor transcription cofactor (SHARP) mRNA,
            complete cds.>gb:AL450998_1928084 Human DNA sequence from
            clone RP11-169K16 on chromosome 1 Contains the 3' end of
            the gene for a novel RUN and PH domain-containing protein
            (KIAA0842), the 5' end of a novel gene, two genes for a
            novel proteins, a novel gene, the gene for
            filamin-binding LIM protein-1 (FBLP-1), a ribosomal
            protein L12 (RPL12) pseudogene, a ubiquinol-cytochrome c
            reductase hinge protein (UQCRH) pseudogene, a ribosomal
            protein S16 (RPS16) pseudogene, a novel gene (FLJ42024),
            the 5' end of the gene for SMART/HDAC1 associated
            repressor protein (SHARP) and three CpG islands, complete
            sequence.>gb:HS134O19_1997084 Human DNA sequence from
            clone RP1-134O19 on chromosome 1p36.11-36.33 Contains the
            3' end of the gene for SMART/HDAC1 associated repressor
            protein (SHARP), the 3' end of the ZNF151 gene for zinc
            finger protein 151 (pHZ-67) and a CpG island, complete
            sequence.
          Length = 3664

 Score = 35.4 bits (80), Expect = 2.6
 Identities = 24/62 (38%), Positives = 34/62 (54%), Gaps = 1/62 (1%)
 Frame = -3

Query: 1077 RTLFVSGLPDDVKAREIHNLFRRRPGFESCQ-LKYTGRGDQVVAFATFVDHQSAMAALHS 901
            R L+V  LP++V+  +I   F+R    ES + L   G    V AF  FVD +SA  A +S
Sbjct: 6    RHLWVGNLPENVREEKIIEHFKRYGRVESVKILPKRGSEGGVAAFVDFVDIKSAQKAHNS 65

Query: 900  LN 895
            +N
Sbjct: 66   VN 67



>gb:BC045039_2548994 Xenopus laevis developmentally regulated RNA
            binding protein 1, mRNA (cDNA clone MGC:53228
            IMAGE:5543418), complete cds.
          Length = 476

 Score = 35.0 bits (79), Expect = 3.4
 Identities = 27/91 (29%), Positives = 44/91 (48%), Gaps = 9/91 (9%)
 Frame = -3

Query: 1122 DYGYTVGNKN------ERDMIRTLFVSGLPDDVKAREIHNLFRRRPGFESCQLK---YTG 970
            +Y Y+  +KN      E    R + VS LP  +   ++HNLF   PG E C+++   Y  
Sbjct: 226  EYDYSSYDKNTDARTQETISKRLIVVSRLP--MIQEQVHNLFDLIPGLEYCEVQRDPYNS 283

Query: 969  RGDQVVAFATFVDHQSAMAALHSLNGVKFDP 877
             G  +V +       SA+ A + L+G ++ P
Sbjct: 284  FGHAIVQYQNI---SSAIYAKYKLHGFEYPP 311



>gb:HSJ1069P2_2015681 Human DNA sequence from clone RP5-1069P2 on
           chromosome 20 Contains the 5' end of the STK4 gene for
           serine/threonine kinase 4, the gene for outer
           mitochondrial membrane translocase HTOM34P, the gene for
           a novel PABPC1 (poly(A)-binding protein, cytoplasmic 1)
           (PABPL1) like protein. ESTs, STSs, GSSs and a putative
           CpG island, complete sequence.
          Length = 328

 Score = 35.0 bits (79), Expect = 3.4
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 2/60 (3%)
 Frame = -3

Query: 564 LFIANLGPNCTEDELRKILSQYPGFNTLKVRARGG--MPVAFADFEGVEEATQVMNALQG 391
           L++ NL  +  +D+LRK  S Y    + KV   GG      F  F   EEAT+ +  + G
Sbjct: 4   LYVKNLDDSIDDDKLRKEFSPYGVITSAKVMTEGGHSKGFGFVCFSSPEEATKAVTEMNG 63



>gb:HSJ1069P2_2015680 Human DNA sequence from clone RP5-1069P2 on
           chromosome 20 Contains the 5' end of the STK4 gene for
           serine/threonine kinase 4, the gene for outer
           mitochondrial membrane translocase HTOM34P, the gene for
           a novel PABPC1 (poly(A)-binding protein, cytoplasmic 1)
           (PABPL1) like protein. ESTs, STSs, GSSs and a putative
           CpG island, complete sequence.
          Length = 322

 Score = 35.0 bits (79), Expect = 3.4
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 2/60 (3%)
 Frame = -3

Query: 564 LFIANLGPNCTEDELRKILSQYPGFNTLKVRARGG--MPVAFADFEGVEEATQVMNALQG 391
           L++ NL  +  +D+LRK  S Y    + KV   GG      F  F   EEAT+ +  + G
Sbjct: 4   LYVKNLDDSIDDDKLRKEFSPYGVITSAKVMTEGGHSKGFGFVCFSSPEEATKAVTEMNG 63



>gb:HSJ1069P2_2015679 Human DNA sequence from clone RP5-1069P2 on
           chromosome 20 Contains the 5' end of the STK4 gene for
           serine/threonine kinase 4, the gene for outer
           mitochondrial membrane translocase HTOM34P, the gene for
           a novel PABPC1 (poly(A)-binding protein, cytoplasmic 1)
           (PABPL1) like protein. ESTs, STSs, GSSs and a putative
           CpG island, complete sequence.
          Length = 347

 Score = 35.0 bits (79), Expect = 3.4
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 2/60 (3%)
 Frame = -3

Query: 564 LFIANLGPNCTEDELRKILSQYPGFNTLKVRARGG--MPVAFADFEGVEEATQVMNALQG 391
           L++ NL  +  +D+LRK  S Y    + KV   GG      F  F   EEAT+ +  + G
Sbjct: 4   LYVKNLDDSIDDDKLRKEFSPYGVITSAKVMTEGGHSKGFGFVCFSSPEEATKAVTEMNG 63


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,229,549,547
Number of Sequences: 1806583
Number of extensions: 23982775
Number of successful extensions: 52737
Number of sequences better than 10.0: 321
Number of HSP's better than 10.0 without gapping: 50208
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 52610
length of database: 581,917,975
effective HSP length: 128
effective length of database: 350,675,351
effective search space used: 107306657406
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)