BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10124
         (1067 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP005292_1850008 Oryza sativa (japonica cultivar-group) genom...   452   e-126   
pir|T47701|T47701 translation initiation factor eIF-6-like prote...   452   e-126   Arabidopsis thaliana [mouse-ear cress]
gb:AP000815_1820628 Oryza sativa (japonica cultivar-group) genom...   389   e-107   
sp|O55135|IF6_MOUSE|IF6_MOUSE Eukaryotic translation initiation factor 6 (...   376   e-103   Mus musculus [mouse]
gb:AF108462_2054760 Mus musculus b4 integrin interactor homolog ...   375   e-102   
gb:BT019757_2151525 Synthetic construct Homo sapiens integrin be...   374   e-102   
sp|P56537|IF6_HUMAN|IF6_HUMAN Eukaryotic translation initiation factor 6 (...   374   e-102   Homo sapiens [man]
gb:BC077665_2560360 Xenopus tropicalis integrin beta 4 binding p...   370   e-101   
gb:BC071088_2555951 Xenopus laevis cDNA clone MGC:80073 IMAGE:46...   369   e-101   
gb:AY383654_2531043 Xenopus laevis p27BBP/eIF6 mRNA, complete cds.    368   e-100   
sp|Q12522|IF6_YEAST|IF6_YEAST Eukaryotic translation initiation factor 6 (...   367   e-100   Saccharomyces cerevisiae [brewer's yeast]
gb:AP002862_1823259 Oryza sativa (japonica cultivar-group) genom...   365   1e-99   
gb:CR382124_1656422 Kluyveromyces lactis strain NRRL Y-1140 chro...   365   1e-99   
gb:AF289540S2_1895171 Homo sapiens p27BBP protein (ITGB4BP) gene...   364   1e-99   
gb:CR380957_1652621 Candida glabrata strain CBS138 chromosome K ...   364   2e-99   
gb:BC071374_2556116 Danio rerio integrin beta 4 binding protein,...   363   2e-99   
gb:AJ719842_2502029 Gallus gallus mRNA for hypothetical protein,...   363   2e-99   
gb:BC049488_2550289 Danio rerio integrin beta 4 binding protein,...   363   3e-99   
gb:AL929108_2504780 Zebrafish DNA sequence from clone CH211-239J...   363   3e-99   
gb:CR382137_1669710 Debaryomyces hansenii chromosome E of strain...   363   3e-99   
sp|O94476|IF6_SCHPO|IF6_SCHPO Eukaryotic translation initiation factor 6 (...   363   4e-99   Schizosaccharomyces pombe
gb:AE016817_1747355 Ashbya gossypii (= Eremothecium gossypii) AT...   362   5e-99   
gb:AE017350_1759001 Cryptococcus neoformans var. neoformans JEC2...   362   9e-99   
pir|JC7273|JC7273 inducible mast cell-415 protein - bovine>gb:AF...   360   3e-98   Bos taurus [bovine]
sp|P56538|IF6_DROME|IF6_DROME Probable eukaryotic translation initiation f...   352   9e-96   Drosophila melanogaster
sp|O22290|IF6_ARATH|IF6_ARATH Eukaryotic translation initiation factor 6 (...   342   7e-93   Arabidopsis thaliana [mouse-ear cress]
pir|T14618|T14618 probable translation initiation factor 6 - bee...   340   2e-92   Beta vulgaris [beet]
sp|O81920|IF6_BETVU|IF6_BETVU Eukaryotic translation initiation factor 6 (...   340   2e-92   Beta vulgaris [beet]
gb:AY542967_1334423 Bigelowiella natans translation initiation f...   337   2e-91   
gb:CR382131_1664610 Yarrowia lipolytica chromosome E of strain C...   337   3e-91   
gb:AY223380_1176840 Schistosoma japonicum clone ZZZ251 mRNA sequ...   315   1e-84   
gb:PFMAL13_1191395 Plasmodium falciparum 3D7 chromosome 13, *** ...   308   9e-83   
sp|O62106|IF6_CAEEL|IF6_CAEEL Eukaryotic translation initiation factor 6 (...   301   1e-80   Caenorhabditis elegans [roundworm]
gb:AF228511_1252890 Trypanosoma cruzi putative DEAH-box RNA heli...   296   4e-79   
gb:AY123141_1580009 Griffithsia japonica translation initiation ...   293   5e-78   
gb:CNS07EGB_1373148 chromosome IV of strain GB-M1 of Encephalito...   235   1e-60   
gb:HSDJ614O4_2012285 Human DNA sequence from clone RP4-614O4 on ...   231   1e-59   
gb:AF179902_1248003 Biomphalaria glabrata integrin interactor pr...   166   6e-40   
pir|H90098|H90098 translation initiation factor eIF6 [imported] ...   166   6e-40   Guillardia theta
gb:HSDJ614O4_2012286 Human DNA sequence from clone RP4-614O4 on ...   163   5e-39   
gb:MMY11460_2124435 Mus musculus mRNA for b4 integrin interactor...   135   1e-30   
sp|Q9YD27|IF6_AERPE|IF6_AERPE Translation initiation factor 6 (aIF-6).>pir...   129   1e-28   Aeropyrum pernix
sp|Q8U3S8|IF6_PYRFU|IF6_PYRFU Translation initiation factor 6 (aIF-6).>gb:...   128   2e-28   Pyrococcus furiosus
sp|O58264|IF6_PYRHO|IF6_PYRHO Translation initiation factor 6 (aIF-6).>pir...   127   5e-28   Pyrococcus horikoshii
gb:AP006878_576473 Thermococcus kodakaraensis strain KOD1 DNA, c...   123   5e-27   
sp|Q9UYI6|IF6_PYRAB|IF6_PYRAB Translation initiation factor 6 (aIF-6).>pir...   123   7e-27   Pyrococcus abyssi
sp|Q8PYQ3|IF6_METMA|IF6_METMA Translation initiation factor 6 (aIF-6).>gb:...   120   5e-26   Methanosarcina mazei
gb:AJ627421_527920 Uncultured crenarchaeote genomic fragment 68f19.   119   8e-26   
sp|Q9XYP3|IF6_TRYCR|IF6_TRYCR Eukaryotic translation initiation factor 6 (...   119   8e-26   Trypanosoma cruzi
sp|Q8TUY5|IF6_METKA|IF6_METKA Translation initiation factor 6 (aIF-6).>gb:...   119   8e-26   Methanopyrus kandleri
sp|Q980G0|IF6_SULSO|IF6_SULSO Translation initiation factor 6 (aIF-6).>pir...   113   6e-24   Saccharolobus solfataricus
sp|O27648|IF6_METTH|IF6_METTH Translation initiation factor 6 (aIF-6).>pir...   111   2e-23   Methanothermobacter thermautotrophicus
sp|Q8TIN4|IF6_METAC|IF6_METAC Translation initiation factor 6 (aIF-6).>gb:...   108   2e-22   Methanosarcina acetivorans
sp|Q60357|IF6_METJA|IF6_METJA Translation initiation factor 6 (aIF-6).>pir...   104   3e-21   Methanocaldococcus jannaschii
gb:AX970956_1486265 Sequence 1759 from Patent EP1104808.              103   6e-21   
sp|O28214|IF6_ARCFU|IF6_ARCFU Translation initiation factor 6 (aIF-6).>pir...   102   1e-20   Archaeoglobus fulgidus
sp|Q9HM16|IF6_THEAC|IF6_THEAC Translation initiation factor 6 (aIF-6).          102   1e-20   Thermoplasma acidophilum
sp|Q97CU0|IF6_THEVO|IF6_THEVO Translation initiation factor 6 (aIF-6).>gb:...   100   5e-20   Thermoplasma volcanium
gb:AE017261_419224 Picrophilus torridus DSM 9790, complete genome.     99   1e-19   
sp|Q971I4|IF6_SULTO|IF6_SULTO Translation initiation factor 6 (aIF-6).>gb:...    99   1e-19   Sulfurisphaera tokodaii
sp|P38619|IF6_SULAC|IF6_SULAC Translation initiation factor 6 (aIF-6).           99   1e-19   Sulfolobus acidocaldarius
sp|Q8ZTU1|IF6_PYRAE|IF6_PYRAE Translation initiation factor 6 (aIF-6).>gb:...    99   2e-19   Pyrobaculum aerophilum
gb:TACID1_195833 Thermoplasma acidophilum complete genome; segme...    97   7e-19   
gb:AF268611_494103 Uncultured marine group II euryarchaeote EBAC...    94   4e-18   
gb:BX957219_843314 Methanococcus maripaludis S2 complete genome;...    92   2e-17   
pir|S53700|S53700 hypothetical protein 1 - Sulfolobus acidocalda...    90   9e-17   Sulfolobus acidocaldarius
gb:AB182929_1529247 Citrullus lanatus mRNA for eukaryotic transl...    69   1e-10   
gb:AE017199_403337 Nanoarchaeum equitans Kin4-M, complete genome.      50   8e-05   
gb:AB197305_17854 Uncultured bacterium C23O gene for catechol 2,...    38   0.30    
gb:BX572094_797226 Prochlorococcus marinus MED4 complete genome;...    36   1.5     
gb:AE017332_445843 Mycoplasma hyopneumoniae 232, complete genome.      36   1.5     
gb:BA000030_698079 Streptomyces avermitilis MA-4680 genomic DNA,...    35   3.3     
gb:AB197297_17846 Uncultured bacterium C23O gene for catechol 2,...    35   3.3     
gb:AB195033_17615 Uncultured bacterium gene for catechol 2,3-dio...    33   7.4     
pir|F95043|F95043 DNA-binding response regulator [imported] - St...    33   9.7     Streptococcus pneumoniae


>gb:AP005292_1850008 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1340_C08.
          Length = 245

 Score =  452 bits (1163), Expect = e-126
 Identities = 220/245 (89%), Positives = 235/245 (95%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MATR+QFEN+CE+GVFSKLTNAYCLVAIGGSENFYS FE+ELAD IPV+KTSIGGTRI+G
Sbjct: 1   MATRIQFENNCEVGVFSKLTNAYCLVAIGGSENFYSAFESELADVIPVVKTSIGGTRIIG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           RLC GNKNGL+LPHTTTDQELQHLRN LPD VVVQR DERLSALGNC+ACNDHVALTH D
Sbjct: 61  RLCVGNKNGLLLPHTTTDQELQHLRNCLPDQVVVQRIDERLSALGNCVACNDHVALTHPD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           LD+ TEELIADVLGVEVFRQTIAGNILVGSYCA +NRGGLVHPHTS+EDLDELSTLLQVP
Sbjct: 121 LDKATEELIADVLGVEVFRQTIAGNILVGSYCAITNRGGLVHPHTSIEDLDELSTLLQVP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 181
           LVAGTVNRGS+VIAAG+TVNDWTAFCGSDTTATELSVIESVFKLRE QP+AIVD+MRKSL
Sbjct: 181 LVAGTVNRGSEVIAAGMTVNDWTAFCGSDTTATELSVIESVFKLREGQPAAIVDDMRKSL 240

Query: 180 IDSYV 166
           IDSYV
Sbjct: 241 IDSYV 245



>pir|T47701|T47701 translation initiation factor eIF-6-like protein
           [imported] - Arabidopsis thaliana>gb:ATF1I16_1549355
           Arabidopsis thaliana DNA chromosome 3, BAC clone
           F1I16.>gb:AY128351_1580650 Arabidopsis thaliana
           eukaryotic translation initiation factor 6 (EIF-6)-like
           protein (At3g55620) mRNA, complete
           cds.>gb:BT009656_1640117 Arabidopsis thaliana At3g55620
           mRNA, complete cds.
          Length = 245

 Score =  452 bits (1162), Expect = e-126
 Identities = 218/245 (88%), Positives = 239/245 (97%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MATRLQFEN+CE+GVFSKLTNAYCLVAIGGSENFYS FE+ELAD IP++KTSIGGTRI+G
Sbjct: 1   MATRLQFENNCEVGVFSKLTNAYCLVAIGGSENFYSAFESELADVIPIVKTSIGGTRIIG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           RLCAGNKNGL++PHTTTDQELQHLRNSLPD VVVQR DERLSALGNCIACND+VAL HTD
Sbjct: 61  RLCAGNKNGLLVPHTTTDQELQHLRNSLPDQVVVQRIDERLSALGNCIACNDYVALAHTD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           LD+ETEE+IADVLGVEVFRQTIAGNILVGSYCA SN+GG+VHPHTSVEDL+ELSTLLQVP
Sbjct: 121 LDKETEEIIADVLGVEVFRQTIAGNILVGSYCALSNKGGMVHPHTSVEDLEELSTLLQVP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 181
           LVAGTVNRGS+VIAAG+TVNDWT+FCGSDTTATELSVI+S+FKLREAQPS+IVDEMRKSL
Sbjct: 181 LVAGTVNRGSEVIAAGMTVNDWTSFCGSDTTATELSVIDSIFKLREAQPSSIVDEMRKSL 240

Query: 180 IDSYV 166
           ID+YV
Sbjct: 241 IDTYV 245



>gb:AP000815_1820628 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0003H10.>gb:AP003103_1824693
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 1, BAC clone:B1085F09.
          Length = 246

 Score =  389 bits (998), Expect = e-107
 Identities = 182/243 (74%), Positives = 221/243 (90%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MA+R++FENS EIGVF++LTNAYC++  GG+ENF+S FE+ELAD +PV++TSIGGTRI+G
Sbjct: 1   MASRVRFENSSEIGVFARLTNAYCVLPDGGAENFFSVFESELADVVPVVRTSIGGTRIIG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           R+C GNKNGL+LPHTTTDQELQHL+NSLPD VVVQR +ERLSALGNC+ACNDHVALTH D
Sbjct: 61  RMCVGNKNGLLLPHTTTDQELQHLKNSLPDQVVVQRIEERLSALGNCVACNDHVALTHPD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           LD+ TEE+I+DVLGVEVFRQTIAGNILVGS+CAFSN+GGLVHP TSVED  ELSTLL+VP
Sbjct: 121 LDQGTEEIISDVLGVEVFRQTIAGNILVGSFCAFSNKGGLVHPQTSVEDQAELSTLLEVP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 181
           L AG++NRGS+V+AAG+ VNDW AFCG+DTTATELSV+ESVF+LR+ +P A+  +M +SL
Sbjct: 181 LAAGSINRGSEVVAAGMAVNDWAAFCGADTTATELSVVESVFRLRDGRPGALGADMSRSL 240

Query: 180 IDS 172
           + S
Sbjct: 241 VVS 243



>sp|O55135|IF6_MOUSE Eukaryotic translation initiation factor 6
           (eIF-6) (B4 integrin interactor) (CAB)
           (p27(BBP)).>gb:AK003447_1151866 Mus musculus 18-day
           embryo whole body cDNA, RIKEN full-length enriched
           library, clone:1110004P11 product:integrin beta 4
           binding protein, full insert
           sequence.>gb:AK007594_1154078 Mus musculus 10 day old
           male pancreas cDNA, RIKEN full-length enriched library,
           clone:1810023N17 product:integrin beta 4 binding
           protein, full insert sequence.>gb:AK012218_1156843 Mus
           musculus 11 days embryo whole body cDNA, RIKEN
           full-length enriched library, clone:2700008E01
           product:integrin beta 4 binding protein, full insert
           sequence.>gb:AK088707_1175568 Mus musculus 2 days
           neonate thymus thymic cells cDNA, RIKEN full-length
           enriched library, clone:E430024C20 product:integrin beta
           4 binding protein, full insert
           sequence.>gb:AF047046_2052391 Mus musculus translation
           initiation factor eIF6 mRNA, complete
           cds.>gb:BC015274_2092117 Mus musculus integrin beta 4
           binding protein, mRNA (cDNA clone MGC:18715
           IMAGE:4219358), complete cds.>gb:BC024442_2094510 Mus
           musculus integrin beta 4 binding protein, mRNA (cDNA
           clone MGC:37280 IMAGE:4973875), complete
           cds.>gb:BC083964_2563377 Xenopus laevis hypothetical
           LOC495867, mRNA (cDNA clone MGC:97996 IMAGE:7198526),
           complete cds.>gb:BC087191_2565048 Xenopus laevis
           hypothetical LOC495867, mRNA (cDNA clone MGC:98075
           IMAGE:7199543), complete cds.
          Length = 245

 Score =  376 bits (965), Expect = e-103
 Identities = 180/243 (74%), Positives = 209/243 (86%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MA R  FEN+CE+G F+KLTNAYCLVAIGGSENFYS FE EL+DAIPV+  SI G RI+G
Sbjct: 1   MAVRASFENNCEVGCFAKLTNAYCLVAIGGSENFYSVFEGELSDAIPVVHASIAGCRIIG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           R+C GN++GL++P+ TTDQELQH+RNSLPDSV ++R +ERLSALGN   CND+VAL H D
Sbjct: 61  RMCVGNRHGLLVPNNTTDQELQHIRNSLPDSVQIRRVEERLSALGNVTTCNDYVALVHPD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           LDRETEE++ADVL VEVFRQT+A  +LVGSYC FSN+GGLVHP TS+ED DELS+LLQVP
Sbjct: 121 LDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 181
           LVAGTVNRGS+VIAAG+ VNDW AFCG DTT+TELSV+ESVFKL EA+PS I   MR SL
Sbjct: 181 LVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAKPSTIATSMRDSL 240

Query: 180 IDS 172
           IDS
Sbjct: 241 IDS 243



>gb:AF108462_2054760 Mus musculus b4 integrin interactor homolog
           mRNA, complete cds.
          Length = 245

 Score =  375 bits (962), Expect = e-102
 Identities = 180/243 (74%), Positives = 208/243 (85%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MA R  FEN+CE+G F+KLTNAYCLVAIGGSENFYS FE EL+DAIPV+  SI G RI+G
Sbjct: 1   MAVRASFENNCEVGCFAKLTNAYCLVAIGGSENFYSVFEGELSDAIPVVHASIAGCRIIG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           R+C GN++GL++P+ TTDQELQH+RNSLPDSV + R +ERLSALGN   CND+VAL H D
Sbjct: 61  RMCVGNRHGLLVPNNTTDQELQHIRNSLPDSVQIWRVEERLSALGNVTTCNDYVALVHPD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           LDRETEE++ADVL VEVFRQT+A  +LVGSYC FSN+GGLVHP TS+ED DELS+LLQVP
Sbjct: 121 LDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 181
           LVAGTVNRGS+VIAAG+ VNDW AFCG DTT+TELSV+ESVFKL EA+PS I   MR SL
Sbjct: 181 LVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAKPSTIATSMRDSL 240

Query: 180 IDS 172
           IDS
Sbjct: 241 IDS 243



>gb:BT019757_2151525 Synthetic construct Homo sapiens integrin beta
           4 binding protein mRNA, partial cds.
          Length = 246

 Score =  374 bits (959), Expect = e-102
 Identities = 179/243 (73%), Positives = 207/243 (85%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MA R  FEN+CEIG F+KLTN YCLVAIGGSENFYS FE EL+D IPV+  SI G RI+G
Sbjct: 1   MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           R+C GN++GL++P+ TTDQELQH+RNSLPD+V ++R +ERLSALGN   CND+VAL H D
Sbjct: 61  RMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           LDRETEE++ADVL VEVFRQT+A  +LVGSYC FSN+GGLVHP TS+ED DELS+LLQVP
Sbjct: 121 LDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 181
           LVAGTVNRGS+VIAAG+ VNDW AFCG DTT+TELSV+ESVFKL EAQPS I   MR SL
Sbjct: 181 LVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSL 240

Query: 180 IDS 172
           IDS
Sbjct: 241 IDS 243



>sp|P56537|IF6_HUMAN Eukaryotic translation initiation factor 6
           (eIF-6) (B4 integrin interactor) (CAB) (p27(BBP))
           (B(2)GCN homolog) (OK/SW-cl.27).>gb:AF047433_1149659
           Homo sapiens b(2)gcn homolog mRNA, complete
           cds.>gb:AB062289_1868872 Homo sapiens OK/SW-cl.27 mRNA
           for integrin beta 4 binding protein, complete
           cds.>gb:AF022229_1877087 Homo sapiens translation
           initiation factor 6 (eIF6) mRNA, complete
           cds.>gb:BC001119_1967310 Homo sapiens integrin beta 4
           binding protein, transcript variant 1, mRNA (cDNA clone
           MGC:1959 IMAGE:2989973), complete
           cds.>gb:BC011845_1973254 Homo sapiens integrin beta 4
           binding protein, transcript variant 1, mRNA (cDNA clone
           MGC:20289 IMAGE:4120463), complete
           cds.>gb:BC019305_1976818 Homo sapiens integrin beta 4
           binding protein, transcript variant 1, mRNA (cDNA clone
           MGC:4200 IMAGE:2823211), complete
           cds.>gb:CR456764_1992971 Homo sapiens full open reading
           frame cDNA clone RZPDo834D044D for gene ITGB4BP,
           integrin beta 4 binding protein; complete cds, incl.
           stopcodon.>gb:HSB4INTIN_2010821 H.sapiens mRNA for b4
           integrin interactor.>gb:HSDJ614O4_2012284 Human DNA
           sequence from clone RP4-614O4 on chromosome 20q11.1-12
           Contains the C20orf127 locus for a metallothionein
           protein pseudogene, the MMP24 gene for matrix
           metalloproteinase 24 (membrane-inserted), a novel gene,
           the ITGB4BP gene for integrin beta 4 binding protein,
           the C20orf120 gene for chromosome 20 open reading frame
           120, the C20orf128 gene for chromosome 20 open reading
           frame 128, the 3' end of the C20orf44 gene for
           chromosome 20 open reading frame 44 and three CpG
           islands, complete sequence.
          Length = 245

 Score =  374 bits (959), Expect = e-102
 Identities = 179/243 (73%), Positives = 207/243 (85%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MA R  FEN+CEIG F+KLTN YCLVAIGGSENFYS FE EL+D IPV+  SI G RI+G
Sbjct: 1   MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           R+C GN++GL++P+ TTDQELQH+RNSLPD+V ++R +ERLSALGN   CND+VAL H D
Sbjct: 61  RMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           LDRETEE++ADVL VEVFRQT+A  +LVGSYC FSN+GGLVHP TS+ED DELS+LLQVP
Sbjct: 121 LDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 181
           LVAGTVNRGS+VIAAG+ VNDW AFCG DTT+TELSV+ESVFKL EAQPS I   MR SL
Sbjct: 181 LVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSL 240

Query: 180 IDS 172
           IDS
Sbjct: 241 IDS 243



>gb:BC077665_2560360 Xenopus tropicalis integrin beta 4 binding
           protein, mRNA (cDNA clone MGC:89760 IMAGE:7027465),
           complete cds.
          Length = 245

 Score =  370 bits (949), Expect = e-101
 Identities = 180/243 (74%), Positives = 208/243 (85%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MA R  FEN+ EIG F+KLTN YCLVAIGGSENFYS FE EL++ IPV+  SI G RI+G
Sbjct: 1   MAVRASFENNNEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSETIPVVHASIAGCRIIG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           R+C GN++GL++P+ TTDQELQH+RNSLPDSV +QR +ERLSALGN IACND+VAL H D
Sbjct: 61  RMCVGNRHGLMVPNNTTDQELQHIRNSLPDSVRIQRVEERLSALGNVIACNDYVALVHPD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           LDRETEE++ADVL VEVFRQTIA  +LVGSYCAFSN+GGL+HP TS+ED DELS+LLQVP
Sbjct: 121 LDRETEEILADVLKVEVFRQTIADQVLVGSYCAFSNQGGLLHPKTSIEDQDELSSLLQVP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 181
           LV GTVNRGS+VIAAG+ VNDW+AFCG DTT+TELSVIESVFKL +A PS I   MR SL
Sbjct: 181 LVTGTVNRGSEVIAAGMVVNDWSAFCGLDTTSTELSVIESVFKLSDAHPSTIATSMRDSL 240

Query: 180 IDS 172
           IDS
Sbjct: 241 IDS 243



>gb:BC071088_2555951 Xenopus laevis cDNA clone MGC:80073
           IMAGE:4679943, complete cds.
          Length = 245

 Score =  369 bits (946), Expect = e-101
 Identities = 180/243 (74%), Positives = 207/243 (85%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MA R  FEN+ EIG F+KLTN YCLVAIGGSENFYS FE EL++ IPV+  SI G RI+G
Sbjct: 1   MAVRASFENNNEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSETIPVVHASIAGCRIIG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           R+C GN++GL++P+ TTDQELQH+RNSLPDSV +QR +ERLSALGN IACND+VAL H D
Sbjct: 61  RMCVGNRHGLMVPNNTTDQELQHMRNSLPDSVRIQRVEERLSALGNVIACNDYVALVHPD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           LDRETEE++ADVL VEVFRQTIA  +LVGSYCAFSN+GGL+HP TS+ED DELS+LLQVP
Sbjct: 121 LDRETEEILADVLKVEVFRQTIAEQVLVGSYCAFSNQGGLLHPKTSIEDQDELSSLLQVP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 181
           LV GTVNRGS+VIAAG+ VNDW AFCG DTT+TELSVIESVFKL +A PS I   MR SL
Sbjct: 181 LVTGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVIESVFKLSDAHPSTIATSMRDSL 240

Query: 180 IDS 172
           IDS
Sbjct: 241 IDS 243



>gb:AY383654_2531043 Xenopus laevis p27BBP/eIF6 mRNA, complete cds.
          Length = 245

 Score =  368 bits (945), Expect = e-100
 Identities = 180/243 (74%), Positives = 207/243 (85%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MA R  FEN+ EIG F+KLTN YCLVAIGGSENFYS FE EL++ IPV+  SI G RI+G
Sbjct: 1   MAVRASFENNNEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSETIPVVHASIAGCRIIG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           R+C GN++GL++P+ TTDQELQH+RNSLPDSV +QR +ERLSALGN IACND+VAL H D
Sbjct: 61  RMCVGNRHGLMVPNNTTDQELQHMRNSLPDSVRIQRVEERLSALGNVIACNDYVALVHPD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           LDRETEE++ADVL VEVFRQTIA  +LVGSYCAFSN+GGL+HP TS+ED DELS+LLQVP
Sbjct: 121 LDRETEEILADVLKVEVFRQTIAEQVLVGSYCAFSNQGGLLHPKTSIEDQDELSSLLQVP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 181
           LV GTVNRGS+VIAAG+ VNDW AFCG DTT+TELSVIESVFKL +A PS I   MR SL
Sbjct: 181 LVTGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVIESVFKLSDAHPSTIATSMRGSL 240

Query: 180 IDS 172
           IDS
Sbjct: 241 IDS 243



>sp|Q12522|IF6_YEAST Eukaryotic translation initiation factor 6
           (eIF-6).>pir|S57550|S57550 hypothetical protein YPR016c
           - yeast (Saccharomyces cerevisiae)>gb:AY692916_1622963
           Saccharomyces cerevisiae clone FLH158334.01X YPR016C
           gene, complete cds.>gb:SC9531X_1705986 S.cerevisiae
           chromosome XVI cosmid 9531.>gb:SCCHRXVI_1707089
           S.cerevisiae chromosome XVI 165536 bp sequence, cen
           rightwards.>gb:SCU31900_1710144 Saccharomyces cerevisiae
           chromosome XVI cosmid 9723/71015.
          Length = 245

 Score =  367 bits (941), Expect = e-100
 Identities = 179/244 (73%), Positives = 211/244 (86%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MATR QFENS EIGVFSKLTN YCLVA+GGSENFYS FEAEL DAIP++ T+I GTRI+G
Sbjct: 1   MATRTQFENSNEIGVFSKLTNTYCLVAVGGSENFYSAFEAELGDAIPIVHTTIAGTRIIG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           R+ AGN+ GL++P  TTDQELQHLRNSLPDSV +QR +ERLSALGN I CND+VAL H D
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           +DRETEELI+DVLGVEVFRQTI+GNILVGSYC+ SN+GGLVHP TSV+D +ELS+LLQVP
Sbjct: 121 IDRETEELISDVLGVEVFRQTISGNILVGSYCSLSNQGGLVHPQTSVQDQEELSSLLQVP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 181
           LVAGTVNRGS V+ AG+ VND+ A  G DTTA ELSVIES+F+L++AQP +I   +R +L
Sbjct: 181 LVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTL 240

Query: 180 IDSY 169
           I++Y
Sbjct: 241 IETY 244



>gb:AP002862_1823259 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBa0036E02.
          Length = 236

 Score =  365 bits (936), Expect = 1e-99
 Identities = 174/243 (71%), Positives = 212/243 (87%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MA+R++FENS EIGVF++LTNAYC++  GG+ENF+S FE+ELAD +PV++TSIGGTRI+G
Sbjct: 1   MASRVRFENSSEIGVFARLTNAYCVLPDGGAENFFSVFESELADVVPVVRTSIGGTRIIG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           R+C GNKNGL+LPHTTTDQELQHL+NSLPD VVVQR +ERLSALGNC+ACNDH       
Sbjct: 61  RMCVGNKNGLLLPHTTTDQELQHLKNSLPDQVVVQRIEERLSALGNCVACNDH------- 113

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
               TEE+I+DVLGVEVFRQTIAGNILVGS+CAFSN+GGLVHP TSVED  ELSTLL+VP
Sbjct: 114 ---GTEEIISDVLGVEVFRQTIAGNILVGSFCAFSNKGGLVHPQTSVEDQAELSTLLEVP 170

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 181
           L AG++NRGS+V+AAG+ VNDW AFCG+DTTATELSV+ESVF+LR+ +P A+  +M +SL
Sbjct: 171 LAAGSINRGSEVVAAGMAVNDWAAFCGADTTATELSVVESVFRLRDGRPGALGADMSRSL 230

Query: 180 IDS 172
           + S
Sbjct: 231 VVS 233



>gb:CR382124_1656422 Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 245

 Score =  365 bits (936), Expect = 1e-99
 Identities = 180/244 (73%), Positives = 210/244 (86%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MATR QFENS EIGVFSKLTN+YCLVA+GGSENFYS FEAEL DAIP+  T+I GTRIVG
Sbjct: 1   MATRTQFENSNEIGVFSKLTNSYCLVALGGSENFYSAFEAELGDAIPIAHTTIAGTRIVG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           R+ AGN+ GL++P  TTDQELQHLRN LPD+V VQR +ERLSALGN I CND+VAL H D
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNCLPDAVKVQRVEERLSALGNVICCNDYVALVHPD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           +DRETEELIADVLGVEVFRQTI+GN+LVGSYCA SN+GGLVHP T+V+D +ELS+LLQVP
Sbjct: 121 IDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTTVQDQEELSSLLQVP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 181
           LVAGTVNRGS V+ AG+ VND+ A  G DTTA ELSVIES+F+L++AQP AI   +R +L
Sbjct: 181 LVAGTVNRGSQVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPEAISGNLRDTL 240

Query: 180 IDSY 169
           I++Y
Sbjct: 241 IETY 244



>gb:AF289540S2_1895171 Homo sapiens p27BBP protein (ITGB4BP) gene,
           exons 4, 5, 6, 7, and complete cds.
          Length = 243

 Score =  364 bits (935), Expect = 1e-99
 Identities = 177/243 (72%), Positives = 205/243 (84%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MA R  FEN+CEIG F+KLTN YCLVAIGGSENF   FE EL+D IPV+  SI G RI+G
Sbjct: 1   MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENF--VFEGELSDTIPVVHASIAGCRIIG 58

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           R+C GN++GL++P+ TTDQELQH+RNSLPD+V ++R +ERLSALGN   CND+VAL H D
Sbjct: 59  RMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPD 118

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           LDRETEE++ADVL VEVFRQT+A  +LVGSYC FSN+GGLVHP TS+ED DELS+LLQVP
Sbjct: 119 LDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVP 178

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 181
           LVAGTVNRGS+VIAAG+ VNDW AFCG DTT+TELSV+ESVFKL EAQPS I   MR SL
Sbjct: 179 LVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSL 238

Query: 180 IDS 172
           IDS
Sbjct: 239 IDS 241



>gb:CR380957_1652621 Candida glabrata strain CBS138 chromosome K
           complete sequence.
          Length = 245

 Score =  364 bits (934), Expect = 2e-99
 Identities = 178/244 (72%), Positives = 210/244 (86%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MATR QFENS E+GVFSKLTN YCLVA+GGSENFYS FEAEL D+IP+  T+I GTRIVG
Sbjct: 1   MATRTQFENSNEVGVFSKLTNTYCLVAVGGSENFYSAFEAELGDSIPIAHTTIAGTRIVG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           R+ AGN+ GL++P  TTDQELQHLRNSLPDSV +QR +ERLSALGN I CND+VAL H D
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           +DRETEELI+DVLGVEVFRQTI+GNILVGSYCA SN+GGLVHP T+++D +ELS+LLQVP
Sbjct: 121 IDRETEELISDVLGVEVFRQTISGNILVGSYCALSNQGGLVHPQTTIQDQEELSSLLQVP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 181
           LVAGTVNRGS V+ AG+ VND+ A  G DTTA ELSVIES+F+L++AQP AI   +R +L
Sbjct: 181 LVAGTVNRGSAVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPDAISGNLRDTL 240

Query: 180 IDSY 169
           I++Y
Sbjct: 241 IETY 244



>gb:BC071374_2556116 Danio rerio integrin beta 4 binding protein,
           mRNA (cDNA clone MGC:86693 IMAGE:6895784), complete cds.
          Length = 245

 Score =  363 bits (933), Expect = 2e-99
 Identities = 178/243 (73%), Positives = 205/243 (84%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MA R  FE + EIG F+KLTN YCLVAIGGSENFYS FE EL++ +PVI  SI G RI+G
Sbjct: 1   MAVRASFEKNNEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSETMPVIHASIAGCRIIG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           R+C GN++GL++P+ TTDQELQH+RN LPDSV +QR +ERLSALGN IACND+VAL H D
Sbjct: 61  RMCVGNRHGLLVPNNTTDQELQHIRNCLPDSVRIQRVEERLSALGNVIACNDYVALVHPD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           LDRETEE++AD L VEVFRQT+A  +LVGSYCAFSN+GGLVH  TS+ED DELS+LLQVP
Sbjct: 121 LDRETEEILADTLKVEVFRQTVAEQVLVGSYCAFSNQGGLVHAKTSIEDQDELSSLLQVP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 181
           LVAGTVNRGS+VIAAG+ VNDW AFCG DTT+TELSVIESVF+L E QPSAI   MR SL
Sbjct: 181 LVAGTVNRGSEVIAAGMVVNDWCAFCGRDTTSTELSVIESVFRLSETQPSAIATTMRDSL 240

Query: 180 IDS 172
           IDS
Sbjct: 241 IDS 243



>gb:AJ719842_2502029 Gallus gallus mRNA for hypothetical protein,
           clone 7b21.
          Length = 245

 Score =  363 bits (933), Expect = 2e-99
 Identities = 176/243 (72%), Positives = 204/243 (83%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MA R  FEN+ E+G F+KLTNAYCLVAIGGSE+FYS FE EL   IPV+  SI G RI+G
Sbjct: 1   MAVRASFENNNELGCFAKLTNAYCLVAIGGSEDFYSVFEGELFGTIPVVHASIAGCRIIG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           R+C GN++GL++P +TTDQELQH+RNSLPDSV +QR +ERLSALGN   CND+VAL H D
Sbjct: 61  RMCVGNRHGLLVPSSTTDQELQHIRNSLPDSVRIQRVEERLSALGNVTTCNDYVALVHPD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           LDRETEE++ADVL VEVFRQT+A  +LVGSYC FSN+GG+VHP TS+ED DELS+LLQVP
Sbjct: 121 LDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGIVHPKTSIEDQDELSSLLQVP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 181
           LVAGTVNRGS+VI AG+ VNDW AFCG DTT+TELSVIES+FKL EAQPS I   MR SL
Sbjct: 181 LVAGTVNRGSEVIGAGMVVNDWCAFCGLDTTSTELSVIESIFKLNEAQPSTIATNMRDSL 240

Query: 180 IDS 172
           IDS
Sbjct: 241 IDS 243



>gb:BC049488_2550289 Danio rerio integrin beta 4 binding protein,
           mRNA (cDNA clone MGC:56562 IMAGE:5914749), complete cds.
          Length = 245

 Score =  363 bits (932), Expect = 3e-99
 Identities = 178/243 (73%), Positives = 205/243 (84%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MA R  FE + EIG F+KLTN YCLVAIGGSENFYS FE EL++ +PVI  SI G RI+G
Sbjct: 1   MAVRASFEKNNEIGCFAKLTNTYCLVAIGGSENFYSAFEGELSETMPVIHASIAGCRIIG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           R+C GN++GL++P+ TTDQELQH+RN LPDSV +QR +ERLSALGN IACND+VAL H D
Sbjct: 61  RMCVGNRHGLLVPNNTTDQELQHIRNCLPDSVRIQRVEERLSALGNVIACNDYVALVHPD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           LDRETEE++AD L VEVFRQT+A  +LVGSYCAFSN+GGLVH  TS+ED DELS+LLQVP
Sbjct: 121 LDRETEEILADTLKVEVFRQTVAEQVLVGSYCAFSNQGGLVHAKTSIEDQDELSSLLQVP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 181
           LVAGTVNRGS+VIAAG+ VNDW AFCG DTT+TELSVIESVF+L E QPSAI   MR SL
Sbjct: 181 LVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVIESVFRLSETQPSAIATTMRDSL 240

Query: 180 IDS 172
           IDS
Sbjct: 241 IDS 243



>gb:AL929108_2504780 Zebrafish DNA sequence from clone CH211-239J9
           in linkage group 6 Contains the 3' part of a novel gene
           similar to human and mouse SPAG1 (sperm associated
           antigen 1), a novel gene similar to human and mouse
           COX6C (cytochrome c oxidase, subunit VIc), a novel gene,
           a novel gene similar to mouse and human MBC2 (membrane
           bound C2 domain containing protein), a novel gene
           similar to vertebrate ITGB4BP (integrin beta 4 binding
           protein), the 3' part of novel gene similar to
           vertebrate MMP24 (membrane-inserted matrix
           metalloproteinase 24) and two predicted CpG islands,
           complete sequence.>gb:AY398366_2531896 Danio rerio clone
           RK150A4A01 integrin beta 4 binding protein (ITGB4BP)
           mRNA, complete cds.
          Length = 245

 Score =  363 bits (932), Expect = 3e-99
 Identities = 178/243 (73%), Positives = 205/243 (84%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MA R  FE + EIG F+KLTN YCLVAIGGSENFYS FE EL++ +PVI  SI G RI+G
Sbjct: 1   MAVRASFEKNNEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSETMPVIHASIAGCRIIG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           R+C GN++GL++P+ TTDQELQH+RN LPDSV +QR +ERLSALGN IACND+VAL H D
Sbjct: 61  RMCVGNRHGLLVPNNTTDQELQHIRNCLPDSVRIQRVEERLSALGNVIACNDYVALVHPD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           LDRETEE++AD L VEVFRQT+A  +LVGSYCAFSN+GGLVH  TS+ED DELS+LLQVP
Sbjct: 121 LDRETEEILADTLKVEVFRQTVAEQVLVGSYCAFSNQGGLVHAKTSIEDQDELSSLLQVP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 181
           LVAGTVNRGS+VIAAG+ VNDW AFCG DTT+TELSVIESVF+L E QPSAI   MR SL
Sbjct: 181 LVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVIESVFRLSETQPSAIATTMRDSL 240

Query: 180 IDS 172
           IDS
Sbjct: 241 IDS 243



>gb:CR382137_1669710 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 245

 Score =  363 bits (932), Expect = 3e-99
 Identities = 174/244 (71%), Positives = 210/244 (86%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MA+R QFENS E+GVFSKLTN+YCLVA+GGSENFYS FEAEL D IP++ T+I GTRIVG
Sbjct: 1   MASRTQFENSNEVGVFSKLTNSYCLVAVGGSENFYSAFEAELGDVIPIVHTTIAGTRIVG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           R+ AGN+ GL++P  TTDQEL HLRNSLPD+V +QR +ERLSALGN I CND+VAL H D
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELMHLRNSLPDTVKIQRVEERLSALGNVICCNDYVALVHPD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           ++RETEELIADVLGVEVFRQTIAGN+LVGSYC+ SN+GGLVHP TS++D +ELS+LLQVP
Sbjct: 121 IERETEELIADVLGVEVFRQTIAGNVLVGSYCSLSNQGGLVHPQTSIQDQEELSSLLQVP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 181
           LVAGTVNRGS V+ AG+ VNDW A  G DTTA ELSV+ES+F+L++AQP +I   +R +L
Sbjct: 181 LVAGTVNRGSAVVGAGMVVNDWLAVTGLDTTAPELSVVESIFRLQDAQPDSISGNLRDTL 240

Query: 180 IDSY 169
           I++Y
Sbjct: 241 IETY 244



>sp|O94476|IF6_SCHPO Eukaryotic translation initiation factor 6
           (eIF-6).>pir|T41234|T41234 translation initiation factor
           eIF-6 [imported] - fission yeast (Schizosaccharomyces
           pombe)>gb:SPCC1919_1721169 S.pombe chromosome III cosmid
           1919.
          Length = 244

 Score =  363 bits (931), Expect = 4e-99
 Identities = 176/244 (72%), Positives = 208/244 (85%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MA R QFENS EIGVFS LTN+Y LVA+GGSENFYS FEAEL D +PV+ T+IGGTRI+G
Sbjct: 1   MALRAQFENSNEIGVFSNLTNSYALVALGGSENFYSVFEAELGDVVPVVHTTIGGTRIIG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           RL  GN+ GL++P +TTD ELQHLRNSLPD V +QR DERLSALGN +ACND+VAL H D
Sbjct: 61  RLTCGNRKGLLVPSSTTDNELQHLRNSLPDPVKIQRVDERLSALGNIVACNDYVALVHPD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           ++RETEE+IADVL VEVFRQT+AGN+L GSYCA SN+G LVHP TS+++ DELS+LLQVP
Sbjct: 121 IERETEEIIADVLDVEVFRQTVAGNVLTGSYCALSNQGALVHPRTSIQEQDELSSLLQVP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 181
           LVAGT+NRGSDVI AGL VNDW AF G DTTATEL+V ES+FKL++AQPSAI+   R +L
Sbjct: 181 LVAGTINRGSDVIGAGLVVNDWCAFAGLDTTATELAVCESIFKLQDAQPSAIISN-RDTL 239

Query: 180 IDSY 169
           ++SY
Sbjct: 240 VESY 243



>gb:AE016817_1747355 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 245

 Score =  362 bits (930), Expect = 5e-99
 Identities = 176/244 (72%), Positives = 208/244 (85%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MATR QFENS E+GVFSKLTN YCLV IGGSENFYS FEAEL DAIP++ T+I GTRIVG
Sbjct: 1   MATRTQFENSNEVGVFSKLTNTYCLVTIGGSENFYSAFEAELGDAIPIVHTTIAGTRIVG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           R+ AGN+ GL++P  TTDQELQHLRNSLPDSV +QR +ERLSALGN I CND+VAL H D
Sbjct: 61  RMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRIEERLSALGNVICCNDYVALVHPD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           +D ETEELIADVLGVEVFRQTI+GN+LVGSYCA SN+GGLVHP T+++D +ELS+LLQVP
Sbjct: 121 IDNETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGLVHPQTTIQDQEELSSLLQVP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 181
           LVAGT+NRGS V+ AG+ VND+ A  G DTTA ELSVIES+F+L++A P AI   +R +L
Sbjct: 181 LVAGTINRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDANPDAISGNLRDTL 240

Query: 180 IDSY 169
           I++Y
Sbjct: 241 IETY 244



>gb:AE017350_1759001 Cryptococcus neoformans var. neoformans JEC21
           chromosome 10, complete sequence.
          Length = 245

 Score =  362 bits (928), Expect = 9e-99
 Identities = 176/244 (72%), Positives = 208/244 (85%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MA R QFENS +IGVFSKLTN+YCL A+  S NFYS FEAELAD +P++ T+IGGTRI+G
Sbjct: 1   MAVRTQFENSTDIGVFSKLTNSYCLTALASSTNFYSVFEAELADVVPIVHTTIGGTRIIG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           RL AGN++GL++P +TTDQELQHLRNSLP +V +QR +ERLSALGN IACND+VAL H D
Sbjct: 61  RLTAGNRHGLLVPSSTTDQELQHLRNSLPPTVAIQRVEERLSALGNVIACNDYVALVHPD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           +DRETEE+IAD L VEVFRQTIAGN+LVGSYCA SN+GGLVHP TS  +LDELS+LLQVP
Sbjct: 121 IDRETEEIIADTLKVEVFRQTIAGNVLVGSYCALSNQGGLVHPKTSRSELDELSSLLQVP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 181
           LVAGTVNRGS+VI AGL VNDW AF G DTTATE+SVIE+ F+L+    +A+++EMR SL
Sbjct: 181 LVAGTVNRGSEVIGAGLVVNDWCAFTGLDTTATEVSVIEATFRLQGQTSTAVINEMRDSL 240

Query: 180 IDSY 169
           ID Y
Sbjct: 241 IDHY 244



>pir|JC7273|JC7273 inducible mast cell-415 protein -
           bovine>gb:AF141872_1415034 Bos taurus imc-415 homolog
           mRNA, complete cds.
          Length = 245

 Score =  360 bits (923), Expect = 3e-98
 Identities = 174/243 (71%), Positives = 201/243 (82%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MA R  FEN+CEIG F+KLTN+YCLVAIGGSENFYS FE ELA  IPV+  SI G RI+G
Sbjct: 1   MAVRASFENNCEIGCFAKLTNSYCLVAIGGSENFYSVFEGELAGTIPVVHASIAGCRIIG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           R+C GN++GL++P+ TTDQELQH+RN LPDSV ++R +ERLSALGN   CND+VAL H D
Sbjct: 61  RMCVGNRHGLLVPNNTTDQELQHIRNCLPDSVQIRRVEERLSALGNVTTCNDYVALVHPD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           LDRETEE++ADVL VEVFRQ +A  +LVGSYC FSN+GGLVHP TS+ED DELS+LLQVP
Sbjct: 121 LDRETEEILADVLKVEVFRQKVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 181
           LVAGTVNRGS+VIAAG+ VNDW AFCG D T+TELSV+ESV K  EAQPS I   MR SL
Sbjct: 181 LVAGTVNRGSEVIAAGMAVNDWCAFCGLDATSTELSVVESVSKPNEAQPSTIATSMRDSL 240

Query: 180 IDS 172
            DS
Sbjct: 241 TDS 243



>sp|P56538|IF6_DROME Probable eukaryotic translation initiation
           factor 6 (eIF-6).>gb:AE013599_1133608 Drosophila
           melanogaster chromosome 2R, complete
           sequence.>gb:AE003462_1210907 Drosophila melanogaster
           chromosome 2R, section 70 of 74 of the complete
           sequence.>gb:AY094688_1297862 Drosophila melanogaster
           GH08760 full insert cDNA.
          Length = 245

 Score =  352 bits (902), Expect = 9e-96
 Identities = 169/242 (69%), Positives = 207/242 (85%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MA R+QFEN+ +IGVF+KLTN YCLVAIGGSE FYS FEAEL D IPV+  ++GG RI+G
Sbjct: 1   MALRVQFENNDDIGVFTKLTNTYCLVAIGGSETFYSAFEAELGDTIPVVHANVGGCRIIG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           RL  GN+NGL++P++TTD+ELQHLRNSLPD+V + R +ERLSALGN IACND+VAL H D
Sbjct: 61  RLTVGNRNGLLVPNSTTDEELQHLRNSLPDAVKIYRVEERLSALGNVIACNDYVALVHPD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           LD+ETEE+IADVL VEVFRQTIA N LVGSY   SN+GG+VHP TS++D DELS+LLQVP
Sbjct: 121 LDKETEEIIADVLKVEVFRQTIADNSLVGSYAVLSNQGGMVHPKTSIQDQDELSSLLQVP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 181
           LVAGTVNRGS+V+AAG+ VNDW +F G +TTATE+SVIESVFKL +AQP+ +  ++R +L
Sbjct: 181 LVAGTVNRGSEVLAAGMVVNDWLSFVGMNTTATEISVIESVFKLNQAQPATVTTKLRAAL 240

Query: 180 ID 175
           I+
Sbjct: 241 IE 242



>sp|O22290|IF6_ARATH Eukaryotic translation initiation factor 6
           (eIF-6).>pir|T01012|T01012 probable translation
           initiation factor [imported] - Arabidopsis
           thaliana>gb:AC003000_1530927 Arabidopsis thaliana
           chromosome 2 clone T5I7 map CIC10A06, complete sequence.
          Length = 247

 Score =  342 bits (877), Expect = 7e-93
 Identities = 168/247 (68%), Positives = 207/247 (83%), Gaps = 2/247 (0%)
 Frame = -3

Query: 900 MATRLQFENS-CEIGVFSKLTNAYCLV-AIGGSENFYSTFEAELADAIPVIKTSIGGTRI 727
           MATRLQ++N+ CEIGVFSKLTNAYCLV A   S NF++ +E++L   IP++ TSIGG+  
Sbjct: 1   MATRLQYDNNNCEIGVFSKLTNAYCLVSATSASANFFTGYESKLKGVIPIVTTSIGGSGT 60

Query: 726 VGRLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTH 547
           +G LC GNKNGL+L HT TDQELQHLR+SLPD VVVQR +E + ALGN IACND+VAL H
Sbjct: 61  IGSLCVGNKNGLLLSHTITDQELQHLRDSLPDEVVVQRIEEPICALGNAIACNDYVALVH 120

Query: 546 TDLDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQ 367
             L+++TEE+I+DVLGVEV+RQTIA N LVGSYC+ SN GG+VH +T+VE++ EL+ L+Q
Sbjct: 121 PKLEKDTEEIISDVLGVEVYRQTIANNELVGSYCSLSNNGGMVHSNTNVEEMVELANLVQ 180

Query: 366 VPLVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRK 187
           VPLVAGTVNRGS VI+AGLTVNDWTAFCGSDTTA ELSV+ ++FKL ++QP  +  EMRK
Sbjct: 181 VPLVAGTVNRGSQVISAGLTVNDWTAFCGSDTTAVELSVVNNIFKLVQSQPDFVGSEMRK 240

Query: 186 SLIDSYV 166
           SLID+YV
Sbjct: 241 SLIDTYV 247



>pir|T14618|T14618 probable translation initiation factor 6 - beet
           (fragment)
          Length = 193

 Score =  340 bits (873), Expect = 2e-92
 Identities = 167/193 (86%), Positives = 181/193 (93%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MATRLQFEN+CE+GVFSKLTNAYCLVAIGGSENFYSTFE ELAD IPV+KTSI GTRI+G
Sbjct: 1   MATRLQFENNCEVGVFSKLTNAYCLVAIGGSENFYSTFETELADYIPVVKTSIAGTRIIG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
                NKNGL++PHTTTDQELQHLRN LPDSVVVQR +E+LSALGNCIACND+VALTHTD
Sbjct: 61  PNVCRNKNGLLVPHTTTDQELQHLRNCLPDSVVVQRIEEKLSALGNCIACNDYVALTHTD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           LD+ETEELIADVLGVEVF QTIAGNILVGSYCA +N+GGLVHPHTS+EDLDELSTLLQVP
Sbjct: 121 LDKETEELIADVLGVEVFGQTIAGNILVGSYCAITNKGGLVHPHTSIEDLDELSTLLQVP 180

Query: 360 LVAGTVNRGSDVI 322
           LVAGTVNRGS+VI
Sbjct: 181 LVAGTVNRGSEVI 193



>sp|O81920|IF6_BETVU Eukaryotic translation initiation factor 6
           (eIF-6) (Fragment).>gb:BVU9737_1643234 Beta vulgaris
           mRNA for eukaryotic translation initiation factor 6,
           partial.
          Length = 193

 Score =  340 bits (873), Expect = 2e-92
 Identities = 167/193 (86%), Positives = 181/193 (93%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MATRLQFEN+CE+GVFSKLTNAYCLVAIGGSENFYSTFE ELAD IPV+KTSI GTRI+G
Sbjct: 1   MATRLQFENNCEVGVFSKLTNAYCLVAIGGSENFYSTFETELADYIPVVKTSIAGTRIIG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
                NKNGL++PHTTTDQELQHLRN LPDSVVVQR +E+LSALGNCIACND+VALTHTD
Sbjct: 61  PNVCRNKNGLLVPHTTTDQELQHLRNCLPDSVVVQRIEEKLSALGNCIACNDYVALTHTD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           LD+ETEELIADVLGVEVF QTIAGNILVGSYCA +N+GGLVHPHTS+EDLDELSTLLQVP
Sbjct: 121 LDKETEELIADVLGVEVFGQTIAGNILVGSYCAITNKGGLVHPHTSIEDLDELSTLLQVP 180

Query: 360 LVAGTVNRGSDVI 322
           LVAGTVNRGS+VI
Sbjct: 181 LVAGTVNRGSEVI 193



>gb:AY542967_1334423 Bigelowiella natans translation initiation
           factor 6 (eIF6) mRNA, complete cds.
          Length = 245

 Score =  337 bits (865), Expect = 2e-91
 Identities = 166/242 (68%), Positives = 198/242 (81%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MATR  FENS EIGVF+KLTN+YCLV  GGS+NFYSTF++EL D IPVI  SIGG RIVG
Sbjct: 1   MATRASFENSNEIGVFAKLTNSYCLVGTGGSQNFYSTFQSELGDHIPVIHASIGGMRIVG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           R+  GNKNGL++P TT + EL+HLRNSLPD V VQR +E+LSALGNC+  NDHVAL H D
Sbjct: 61  RMVVGNKNGLLVPSTTRENELKHLRNSLPDKVKVQRIEEKLSALGNCVVANDHVALVHPD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           +D+ TEELIADVLGVEVFRQ IA N LVGSYCA SN+G LVHP T+V +  E+S+LLQVP
Sbjct: 121 IDQNTEELIADVLGVEVFRQAIAKNTLVGSYCALSNQGCLVHPKTTVPEQKEISSLLQVP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 181
           + AGTVNRGS+VI AGL VNDWTAF G DTT+TELSVIE++F L++ +   +V +M+ SL
Sbjct: 181 VCAGTVNRGSNVIGAGLVVNDWTAFSGMDTTSTELSVIENIFNLQDKEQEKMVKDMQSSL 240

Query: 180 ID 175
           I+
Sbjct: 241 IE 242



>gb:CR382131_1664610 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 246

 Score =  337 bits (863), Expect = 3e-91
 Identities = 163/228 (71%), Positives = 193/228 (84%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MATR QFENS EIGVFSKLTN+YCLVA+GGSENFYS+FEAEL D IP++ ++IGGTR+VG
Sbjct: 1   MATRAQFENSDEIGVFSKLTNSYCLVAVGGSENFYSSFEAELQDTIPIVYSTIGGTRLVG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           RL AGN+ GL++P TT+D ELQHLRNSLPD V +QR +ERLSALGN I  ND+ AL H D
Sbjct: 61  RLTAGNRRGLLVPSTTSDVELQHLRNSLPDEVKIQRVEERLSALGNVICTNDYAALVHPD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           ++RETEELIADVLGVEVFRQT+AGN+LVGSYCA SN+GG+VHP TS+ED DELS+LLQVP
Sbjct: 121 IERETEELIADVLGVEVFRQTVAGNVLVGSYCALSNQGGIVHPQTSIEDQDELSSLLQVP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQ 217
           L+AG+VNRGS V+ AG  VNDW A  G  TT+ EL+V+ S+FKL   Q
Sbjct: 181 LIAGSVNRGSPVVGAGCVVNDWMAVAGYATTSFELTVMSSIFKLNNDQ 228



>gb:AY223380_1176840 Schistosoma japonicum clone ZZZ251 mRNA
           sequence.
          Length = 243

 Score =  315 bits (806), Expect = 1e-84
 Identities = 151/242 (62%), Positives = 189/242 (78%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MA R QFE   +IGVFSKLTN YCLV++GGSENFYS FEAEL++ IPV+ T+I G R VG
Sbjct: 1   MALRTQFEGHNDIGVFSKLTNKYCLVSVGGSENFYSVFEAELSENIPVVHTTIAGIRTVG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           RL  GN +GL++PHTTTDQEL HL NSLPD++ V R +ERLSALGN +ACND+VAL H D
Sbjct: 61  RLTVGNSHGLLVPHTTTDQELLHLTNSLPDNIRVMRIEERLSALGNTMACNDYVALVHPD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           LD+ET EL++DVL V+VFR  +A   LVG+YC  +N+GGLVHP  +V++LD+LS+LLQ+P
Sbjct: 121 LDKETAELVSDVLNVDVFRGVVANQSLVGTYCVLTNQGGLVHPRVTVDELDQLSSLLQLP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSL 181
           L AGTVNRGS +IAAGL VNDW  FCG +TT+TE+ VIES+FKL       +V     +L
Sbjct: 181 LTAGTVNRGSPLIAAGLVVNDWAGFCGLETTSTEIQVIESIFKLDGEMNIPVVGSAHDAL 240

Query: 180 ID 175
           ++
Sbjct: 241 VE 242



>gb:PFMAL13_1191395 Plasmodium falciparum 3D7 chromosome 13, ***
           SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 247

 Score =  308 bits (790), Expect = 9e-83
 Identities = 146/247 (59%), Positives = 195/247 (78%), Gaps = 2/247 (0%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MA R+QFENS E+GVFS+LTN+Y LVA+GGSENF S FE+EL+  IP++ T+IGGTR++G
Sbjct: 1   MAIRVQFENSNEVGVFSRLTNSYALVALGGSENFSSVFESELSQHIPLVYTTIGGTRVIG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           R+C GN+ GL++    TDQEL HLRN LP++V ++R +ERLSALGNCI  ND+V L HTD
Sbjct: 61  RVCVGNRKGLLVSSICTDQELLHLRNCLPENVKIKRIEERLSALGNCITTNDYVGLIHTD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           +D+ETEE+I DVL +EVFR +IAGN+LVG+Y  F+N GGL+H  TS ++++ELS LLQ+P
Sbjct: 121 IDKETEEIIQDVLDIEVFRTSIAGNLLVGTYSYFTNNGGLLHAMTSSQEIEELSELLQIP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVD--EMRK 187
           L+ GT+NRGSD+I +GL  NDW+AFCG DTTA ELS+IE VFKL     + + D  + + 
Sbjct: 181 LITGTINRGSDLIGSGLVANDWSAFCGMDTTAIELSIIEKVFKLNNITDNNMEDTFKYKS 240

Query: 186 SLIDSYV 166
           S+I + +
Sbjct: 241 SIIQTMI 247



>sp|O62106|IF6_CAEEL Eukaryotic translation initiation factor 6
           (eIF-6).>pir|T19988|T19988 hypothetical protein C47B2.5
           - Caenorhabditis elegans>gb:CEC47B2_1361313
           Caenorhabditis elegans cosmid C47B2, complete sequence.
          Length = 246

 Score =  301 bits (772), Expect = 1e-80
 Identities = 146/244 (59%), Positives = 190/244 (77%), Gaps = 1/244 (0%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MA R+ +E S ++GVF  LTN+YCLV +GG++NFYS  EAEL+D IPV+ TSI  TRIVG
Sbjct: 1   MALRVDYEGSNDVGVFCTLTNSYCLVGVGGTQNFYSILEAELSDLIPVVHTSIASTRIVG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           RL  GN++GL++P+ TTDQELQHLRNSLPD V ++R DERLSALGN IACNDHVA+ H +
Sbjct: 61  RLTVGNRHGLLVPNATTDQELQHLRNSLPDEVAIRRVDERLSALGNVIACNDHVAIVHAE 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           +  ETE+ + +VL VEVFR ++A N LVGSYC  S+ G LV   T  E   E++ LLQ+P
Sbjct: 121 ISAETEQALVEVLKVEVFRVSLAQNSLVGSYCILSSNGCLVAARTPPETQREIAALLQIP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLRE-AQPSAIVDEMRKS 184
           +VAGT NRGS++I AG+ VNDW AFCG D+T+TELSV+ES+FKL E   P++I +++R +
Sbjct: 181 VVAGTCNRGSELIGAGMVVNDWVAFCGLDSTSTELSVVESIFKLGEQGAPTSISNQLRDT 240

Query: 183 LIDS 172
           LI+S
Sbjct: 241 LIES 244



>gb:AF228511_1252890 Trypanosoma cruzi putative DEAH-box RNA
           helicase (RH1) gene, partial cds; and NU1 (NU1) and
           putative translation factor (eIF6) genes, complete cds.
          Length = 244

 Score =  296 bits (759), Expect = 4e-79
 Identities = 142/225 (63%), Positives = 180/225 (80%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           M  R  FE+S ++GVFS LTNA  LV  GGS+NFYS FE ELA+ IPV+ TSIGG+R++G
Sbjct: 1   MILRNTFESSDDVGVFSTLTNAM-LVTAGGSQNFYSVFEQELANHIPVVYTSIGGSRVIG 59

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           RL  GN++GL++P   TDQELQHLRNSLPDSV VQR +ERL+ALGNC+ CNDHVAL HTD
Sbjct: 60  RLTCGNRHGLVVPSIATDQELQHLRNSLPDSVKVQRVEERLNALGNCVVCNDHVALIHTD 119

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           L RETEE++ D L V+ FR +IA N LVGSY   +N+G +VHP T  +D+DE+++LLQVP
Sbjct: 120 LSRETEEILRDTLQVQTFRTSIAENALVGSYAVVNNKGCMVHPKTPAQDMDEIASLLQVP 179

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLR 226
           +VAGT+NRG+  I +GL VNDW AFCG +TTATE++V+E +F+LR
Sbjct: 180 VVAGTINRGNAAIGSGLVVNDWAAFCGLNTTATEITVVERIFQLR 224



>gb:AY123141_1580009 Griffithsia japonica translation initiation
           factor 6 mRNA, partial cds.
          Length = 198

 Score =  293 bits (749), Expect = 5e-78
 Identities = 136/197 (69%), Positives = 169/197 (85%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           M+ R QFENS ++GVF+ LTN Y LVA+G SENFYSTFEAEL+D +PV+  +I GTRI+G
Sbjct: 1   MSIRCQFENSNDVGVFAALTNTYALVAVGASENFYSTFEAELSDHVPVVHATIAGTRIIG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
           R+C GNKNGL+LP++TTDQE+QH++NSLPD VVV R D+RLSALGNC+A ND+V+L HTD
Sbjct: 61  RMCVGNKNGLLLPNSTTDQEMQHIKNSLPDRVVVHRVDDRLSALGNCVATNDYVSLVHTD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           LDRETE+++ DVLG EVFR +IAG +LVGS+C F+N+GGLVHP TSV D DELS+LLQ+P
Sbjct: 121 LDRETEDIVTDVLGTEVFRHSIAGELLVGSFCKFTNQGGLVHPMTSVSDQDELSSLLQIP 180

Query: 360 LVAGTVNRGSDVIAAGL 310
           LVAGTVN GS ++ AGL
Sbjct: 181 LVAGTVNCGSHLVGAGL 197



>gb:CNS07EGB_1373148 chromosome IV of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 248

 Score =  235 bits (600), Expect = 1e-60
 Identities = 118/247 (47%), Positives = 164/247 (66%)
 Frame = -3

Query: 906 LTMATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRI 727
           + M+ R+ FE S EIG +  LTN YC++    S N     +  +A  IP+++T+I   R 
Sbjct: 6   MPMSYRIDFEGSSEIGAYMSLTNTYCVIGRSQSNNVLKFLQENVA--IPIVETTINSIRS 63

Query: 726 VGRLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTH 547
           VG  C GN++GL++PHT TDQE+ H+RNSLP+ VVV+R +ERL+ALGN I CNDH+A+ H
Sbjct: 64  VGSQCRGNRHGLLVPHTITDQEIMHIRNSLPEDVVVRRIEERLNALGNVILCNDHIAIIH 123

Query: 546 TDLDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQ 367
            DLD+E+E+LI DVL V V+RQ I    LVG++ A +N+G LVHP TS E   ELS LL+
Sbjct: 124 GDLDKESEDLIRDVLQVHVYRQNIGQEPLVGTFGALNNQGMLVHPFTSTECQKELSELLE 183

Query: 366 VPLVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRK 187
           V +VAGT+N GS  +  G+  NDW    G  TT  E++VIE VF L   Q    ++  R+
Sbjct: 184 VNVVAGTINGGSQCVGGGVVANDWMCIAGIKTTNVEMAVIEGVFDLTGDQD---LEARRR 240

Query: 186 SLIDSYV 166
           +++D+ V
Sbjct: 241 AIVDAIV 247



>gb:HSDJ614O4_2012285 Human DNA sequence from clone RP4-614O4 on
           chromosome 20q11.1-12 Contains the C20orf127 locus for a
           metallothionein protein pseudogene, the MMP24 gene for
           matrix metalloproteinase 24 (membrane-inserted), a novel
           gene, the ITGB4BP gene for integrin beta 4 binding
           protein, the C20orf120 gene for chromosome 20 open
           reading frame 120, the C20orf128 gene for chromosome 20
           open reading frame 128, the 3' end of the C20orf44 gene
           for chromosome 20 open reading frame 44 and three CpG
           islands, complete sequence.
          Length = 226

 Score =  231 bits (590), Expect = 1e-59
 Identities = 139/251 (55%), Positives = 159/251 (63%), Gaps = 8/251 (3%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MA R  FEN+CEIG F+KLTN YCLVAIGGSENFY    +  A          GG    G
Sbjct: 1   MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYRCGGSPGA---------YGG----G 47

Query: 720 RLCAGNKNGLI--LPHTTTDQELQHL-----RNSLP-DSVVVQRADERLSALGNCIACND 565
             CAG K+     +P         H+     R S P  S    R     ++ G C+    
Sbjct: 48  EACAGVKSSGSGRVPAPLPRHHRVHVPTVCSRASSPIPSPWCTRLSPAAASSGACVW--- 104

Query: 564 HVALTHTDLDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDE 385
                      ETEE++ADVL VEVFRQT+A  +LVGSYC FSN+GGLVHP TS+ED DE
Sbjct: 105 -----------ETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDE 153

Query: 384 LSTLLQVPLVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAI 205
           LS+LLQVPLVAGTVNRGS+VIAAG+ VNDW AFCG DTT+TELSV+ESVFKL EAQPS I
Sbjct: 154 LSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTI 213

Query: 204 VDEMRKSLIDS 172
              MR SLIDS
Sbjct: 214 ATSMRDSLIDS 224



>gb:AF179902_1248003 Biomphalaria glabrata integrin interactor
           protein mRNA, partial cds.
          Length = 113

 Score =  166 bits (421), Expect = 6e-40
 Identities = 74/111 (66%), Positives = 95/111 (85%)
 Frame = -3

Query: 744 IGGTRIVGRLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACND 565
           I G R++GR+C GN++GL++P+TTTDQELQH+RN+LPD+V + RA+E+LSALGN IACND
Sbjct: 3   IAGCRVIGRMCVGNRHGLLVPNTTTDQELQHIRNALPDTVKIYRAEEKLSALGNVIACND 62

Query: 564 HVALTHTDLDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHP 412
           +VAL H DLDRETE+L+ D L VEVFR T+A N+LVGSY  FSN+GG+V P
Sbjct: 63  YVALVHPDLDRETEDLLVDTLNVEVFRHTVANNVLVGSYTVFSNQGGMVSP 113



>pir|H90098|H90098 translation initiation factor eIF6 [imported] -
           Guillardia theta nucleomorph>gb:AF165818_1773873
           Guillardia theta nucleomorph chromosome 1, complete
           sequence.
          Length = 228

 Score =  166 bits (421), Expect = 6e-40
 Identities = 86/223 (38%), Positives = 131/223 (58%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           M  +L      +IG +  LTN+YC+V    +   Y+  ++EL + I +I T++  +  VG
Sbjct: 1   MTIKLNLYGKEDIGNYILLTNSYCIVPHDINSKNYNIIKSELDNKINIICTNVSESICVG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
            L  GN  GLI+P+T T  E   L N LP+ V+V++ +E L+ LGN +A N+   L+  D
Sbjct: 61  NLLIGNSKGLIVPNTITFHEQNELLNFLPEKVLVKKFNENLTNLGNLLAHNELYGLSSPD 120

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
           L + + ELI+DVLGVE+ + T+    ++G+YC F+  GG+V P  S+ED DEL  +  VP
Sbjct: 121 LSQSSCELISDVLGVEILKLTLGEEKMIGTYCKFNINGGIVQPFLSIEDHDELVEITGVP 180

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFK 232
            + GTVN G   +  G+  ND   FCG  T  TE+ +I ++ K
Sbjct: 181 FIGGTVNSGCSNVGKGIVCNDNLVFCGYKTNQTEMHIINNIMK 223



>gb:HSDJ614O4_2012286 Human DNA sequence from clone RP4-614O4 on
           chromosome 20q11.1-12 Contains the C20orf127 locus for a
           metallothionein protein pseudogene, the MMP24 gene for
           matrix metalloproteinase 24 (membrane-inserted), a novel
           gene, the ITGB4BP gene for integrin beta 4 binding
           protein, the C20orf120 gene for chromosome 20 open
           reading frame 120, the C20orf128 gene for chromosome 20
           open reading frame 128, the 3' end of the C20orf44 gene
           for chromosome 20 open reading frame 44 and three CpG
           islands, complete sequence.
          Length = 108

 Score =  163 bits (413), Expect = 5e-39
 Identities = 74/106 (69%), Positives = 90/106 (84%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MA R  FEN+CEIG F+KLTN YCLVAIGGSENFYS FE EL+D IPV+  SI G RI+G
Sbjct: 1   MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGN 583
           R+C GN++GL++P+ TTDQELQH+RNSLPD+V ++R +ERLSALGN
Sbjct: 61  RMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGN 106



>gb:MMY11460_2124435 Mus musculus mRNA for b4 integrin interactor,
           partial.
          Length = 84

 Score =  135 bits (341), Expect = 1e-30
 Identities = 63/84 (75%), Positives = 73/84 (86%)
 Frame = -3

Query: 663 ELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTDLDRETEELIADVLGVEVFR 484
           ELQH+RNSLPDSV ++R +ERLSALGN   CND+VAL H DLDRETEE++ADVL VEVFR
Sbjct: 1   ELQHIRNSLPDSVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFR 60

Query: 483 QTIAGNILVGSYCAFSNRGGLVHP 412
           QT+A  +LVGSYC FSN+GGLVHP
Sbjct: 61  QTVADQVLVGSYCVFSNQGGLVHP 84



>sp|Q9YD27|IF6_AERPE Translation initiation factor 6
           (aIF-6).>pir|F72708|F72708 probable translation
           initiation factor aIF-6 APE1085 [imported] - Aeropyrum
           pernix (strain K1)>gb:BA000002_651814 Aeropyrum pernix
           K1 DNA, complete genome.
          Length = 233

 Score =  129 bits (324), Expect = 1e-28
 Identities = 78/217 (35%), Positives = 117/217 (53%), Gaps = 1/217 (0%)
 Frame = -3

Query: 891 RLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIP-VIKTSIGGTRIVGRL 715
           +L    +  IGV+   +++Y L       +   T    L  A+  V++  + G R+VG L
Sbjct: 11  KLSLYGNPNIGVYLTASDSYVLAPDDIGADDVRTISEVLGVAMERVVRLRVLGMRLVGVL 70

Query: 714 CAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTDLD 535
             GN  G++LP    D+E++ +R +L + V V     R +ALGN I CND   L    L+
Sbjct: 71  TTGNSRGILLPEGV-DREVELVRKAL-EGVEVGIVPTRSNALGNVIVCNDRACLASPGLE 128

Query: 534 RETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVPLV 355
           +E  + ++D LGVEV   ++AG   VGS    +NRGGL HP  S E+L  LS + +VP  
Sbjct: 129 KEALKTVSDTLGVEVVEGSVAGVYTVGSAIVVTNRGGLAHPDASEEELKFLSDVFKVPFE 188

Query: 354 AGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIE 244
           AGT+N G + +  GL  N + A  G DTT  E++ I+
Sbjct: 189 AGTINFGVEFVRTGLVANSYGALVGEDTTGPEIARIQ 225



>sp|Q8U3S8|IF6_PYRFU Translation initiation factor 6
           (aIF-6).>gb:AE010161_259944 Pyrococcus furiosus DSM
           3638, section 36 of 173 of the complete
           genome.>gb:AE009950_900725 Pyrococcus furiosus DSM 3638,
           complete genome.
          Length = 227

 Score =  128 bits (321), Expect = 2e-28
 Identities = 80/219 (36%), Positives = 116/219 (52%), Gaps = 3/219 (1%)
 Frame = -3

Query: 891 RLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVGRLC 712
           +L FENS  +GVF   T+   L+  G  E         L   +PV++ S+  +RI+G L 
Sbjct: 5   KLDFENSPYLGVFGIATDKVVLIREGLQEKKLEVIREVLK--VPVVEASLMKSRIIGVLG 62

Query: 711 AGNKNGLILPHTTTDQELQHLRNSLPDSVV---VQRADERLSALGNCIACNDHVALTHTD 541
           AGN N +I+P    D EL+ ++N+  +  +   V     + +ALGN I  ND  AL  + 
Sbjct: 63  AGNSNAIIVPWYVWDSELEKIKNAFREYGIDTEVVPFQTKYTALGNLILTNDKGALVSSK 122

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
             RE  + I D+LGVEV R  IAG + VGS    +N+GGLVHP  + E+L+ LS L +V 
Sbjct: 123 FSREEAKKIGDILGVEVERGVIAGIVAVGSAGVVTNKGGLVHPEATDEELEWLSDLFKVD 182

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIE 244
           +  GT N G   + + +  N +    G  TT  E+  IE
Sbjct: 183 VYVGTANMGVPYVGSCMLANSYGVVVGHLTTGPEIVKIE 221



>sp|O58264|IF6_PYRHO Translation initiation factor 6
           (aIF-6).>pir|D71166|D71166 hypothetical protein PH0528 -
           Pyrococcus horikoshii>gb:BA000001_649179 Pyrococcus
           horikoshii OT3 DNA, complete genome.
          Length = 227

 Score =  127 bits (318), Expect = 5e-28
 Identities = 81/219 (36%), Positives = 112/219 (51%), Gaps = 3/219 (1%)
 Frame = -3

Query: 891 RLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVGRLC 712
           RL FENS  +GVF   T+   L+  G  E         L   +PVI+ S+  +RI+G L 
Sbjct: 5   RLDFENSPYLGVFGVATDRVVLIREGLQEKKLEVIRETLK--VPVIEVSVMKSRIIGTLA 62

Query: 711 AGNKNGLILPHTTTDQELQHLRNSLPD---SVVVQRADERLSALGNCIACNDHVALTHTD 541
            GN N +ILP    D E++ ++ +L +    + V     + +ALGN I  ND  AL    
Sbjct: 63  TGNSNAIILPWYVWDAEIERIKKALSEYGIDMEVVPFRSKYTALGNLILTNDKAALVSAK 122

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
             R+  + I ++LGVEV R  IAG   VGS    +N+GGLVHP TS E+L+ LS L +V 
Sbjct: 123 FSRKEAQEIGEILGVEVERGVIAGLHAVGSAGVVTNKGGLVHPETSDEELEWLSDLFKVD 182

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIE 244
           +  GT N G   +   +  N      G  TT  E+  IE
Sbjct: 183 VYVGTANMGVPYVGTCMLANSNGVVVGHLTTGPEIVKIE 221



>gb:AP006878_576473 Thermococcus kodakaraensis strain KOD1 DNA,
           complete genome.
          Length = 229

 Score =  123 bits (309), Expect = 5e-27
 Identities = 82/220 (37%), Positives = 114/220 (51%), Gaps = 4/220 (1%)
 Frame = -3

Query: 891 RLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVGRLC 712
           RL FENS  +GV+ + T+   L+  G  E         L   +P+I+TSI  +RIVG   
Sbjct: 5   RLDFENSPYLGVYGRATDRVLLLREGLGEKKLEVLREVLK--VPIIETSIMKSRIVGIFA 62

Query: 711 AGNKNGLILPHTTTDQELQHLRNSLPDSVV---VQRADERLSALGNCIACNDHVALTHTD 541
           AGN N +I+P    D EL+ ++ +L +  +   V     RL+ALGN I  ND  AL   +
Sbjct: 63  AGNSNAIIVPWYIWDAELERIKTALNEFGIDMDVVPFKSRLTALGNLILTNDKAALVSKE 122

Query: 540 LDRETEELIADVLGV-EVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQV 364
             RE    I ++LGV EV R  IA    VGS    +N+GGLVHP  + E+L+ LS L  V
Sbjct: 123 FTREEANAIGEILGVDEVERGMIASYRSVGSVGVVTNKGGLVHPEATDEELEWLSDLFGV 182

Query: 363 PLVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIE 244
            +  GT N G   + + +  N +    G  TT  E+  IE
Sbjct: 183 DIYVGTANMGVPFVGSCMLANSYGVVVGHLTTGPEIVKIE 222



>sp|Q9UYI6|IF6_PYRAB Translation initiation factor 6
           (aIF-6).>pir|E75066|E75066 probable translation
           initiation factor aIF-6 PAB1005 [imported] - Pyrococcus
           abyssi (strain Orsay)>gb:CNSPAX05_850284 Pyrococcus
           abyssi complete genome; segment 5/6.
          Length = 227

 Score =  123 bits (308), Expect = 7e-27
 Identities = 80/224 (35%), Positives = 112/224 (50%), Gaps = 3/224 (1%)
 Frame = -3

Query: 891 RLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVGRLC 712
           RL FENS  +GVF   T+   LV  G  E         L   +PVI+ SI  +RI+G L 
Sbjct: 5   RLDFENSPYLGVFGVATDRVVLVREGLQEKKLEVIREVLK--VPVIEASIMKSRIIGTLA 62

Query: 711 AGNKNGLILPHTTTDQELQHLRNSLPDSVV---VQRADERLSALGNCIACNDHVALTHTD 541
            GN N +++P    D E++ ++++  +  +   +     + +ALGN I  ND  AL    
Sbjct: 63  TGNSNAILVPWYVWDTEIERIKSAFKEYGIETEIVPFRTKYTALGNLILTNDKAALVSAK 122

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
             R+  + I D+LGVEV R  IAG   VGS    +N+GGLVHP  S E+L+ LS L +V 
Sbjct: 123 FSRDEAKEIGDILGVEVERGLIAGLHAVGSAGVVTNKGGLVHPEASDEELEWLSELFKVD 182

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKL 229
           +  GT N G   +   +  N      G  TT  E+  IE    L
Sbjct: 183 VYVGTANMGVPYVGTCMLANSNGVVVGHLTTGPEIVKIEEALGL 226



>sp|Q8PYQ3|IF6_METMA Translation initiation factor 6
           (aIF-6).>gb:AE013306_291137 Methanosarcina mazei strain
           Goe1, section 88 of 379 of the complete
           genome.>gb:AE008384_965246 Methanosarcina mazei strain
           Goe1, complete genome.
          Length = 219

 Score =  120 bits (301), Expect = 5e-26
 Identities = 76/214 (35%), Positives = 112/214 (52%)
 Frame = -3

Query: 864 IGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVGRLCAGNKNGLIL 685
           IGVF+  T    LV         +  E  L   + V++T I G+ +VG L  GN NG +L
Sbjct: 13  IGVFATCTEDLALVPPLTKPEVCTILEEALD--VRVVETLINGSTVVGALSRGNSNGFLL 70

Query: 684 PHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTDLDRETEELIADV 505
           P+ ++ +E+Q  R  +P  ++     +RL+A+GN +  ND  AL H +L     E+IA  
Sbjct: 71  PYGSSVEEMQK-RTGVPAGIL----PDRLNAVGNIVLANDSAALVHPELSDRALEIIART 125

Query: 504 LGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVPLVAGTVNRGSDV 325
           L VEV+R TIAG   VG     +N+G LVHP  +V + + L  +  +P+  GT N G+ +
Sbjct: 126 LKVEVYRGTIAGIKNVGMAGVVTNKGLLVHPKVTVSEREALEEIFGLPVNIGTTNFGTQM 185

Query: 324 IAAGLTVNDWTAFCGSDTTATELSVIESVFKLRE 223
           + +GL  N      GS+TT  EL  IE      E
Sbjct: 186 LGSGLLANSKNFVAGSETTGPELGRIEEALGFLE 219



>gb:AJ627421_527920 Uncultured crenarchaeote genomic fragment 68f19.
          Length = 221

 Score =  119 bits (299), Expect = 8e-26
 Identities = 67/215 (31%), Positives = 117/215 (54%)
 Frame = -3

Query: 873 SCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVGRLCAGNKNG 694
           S  +G+F++  +   L+  G ++      + E  D   +I  SI GTR++G +   N NG
Sbjct: 11  SPNVGLFTRTNDKTLLLPFGFADTKTKKLK-EYLDVEEIIHVSIAGTRLIGPMTVMNNNG 69

Query: 693 LILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTDLDRETEELI 514
           ++LP T +D+E+Q L+ +    + V+R + + +A+GN I+ ND  A+       E ++ I
Sbjct: 70  ILLPSTVSDEEIQILKQT---GLNVERLNSKFTAIGNLISANDKGAIVSNLFSEEVDQDI 126

Query: 513 ADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVPLVAGTVNRG 334
            D LGV + + +I G + VGS    +N G +VHP+ +  +++ +S  LQ+     TVN G
Sbjct: 127 KDTLGVPIQKMSIGGFVQVGSMVVATNAGAIVHPNANDAEVNRISETLQIEAEPATVNGG 186

Query: 333 SDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKL 229
           S  +++GL  N  +   G+ TT  EL +I    K+
Sbjct: 187 SPFLSSGLIANFSSVIVGNLTTGPELIMISRALKV 221



>sp|Q9XYP3|IF6_TRYCR Eukaryotic translation initiation factor 6
           (eIF-6) (Fragment).>gb:AF117890_1242660 Trypanosoma
           cruzi putative eukaryotic translation initiation factor
           6 (EIF-6) gene, partial cds.
          Length = 114

 Score =  119 bits (299), Expect = 8e-26
 Identities = 55/108 (50%), Positives = 81/108 (75%), Gaps = 3/108 (2%)
 Frame = -3

Query: 489 FRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVPLVAGTVNRGSDVIAAGL 310
           FR +IA N LVGSY   +N+G +VHP T  +D+DE+++LLQVP+VAGT+NRG+  I +GL
Sbjct: 4   FRTSIAENALVGSYAVVNNKGCMVHPKTPAQDMDEIASLLQVPVVAGTINRGNAAIGSGL 63

Query: 309 TVNDWTAFCGSDTTATELSVIESVFKLRE---AQPSAIVDEMRKSLID 175
            VNDW AFCG +TTATE++V+E +F+LR       + ++ ++R +L+D
Sbjct: 64  VVNDWAAFCGLNTTATEITVVERIFQLRRDLGGGRANLLQQLRDTLVD 111



>sp|Q8TUY5|IF6_METKA Translation initiation factor 6
           (aIF-6).>gb:AE010451_263248 Methanopyrus kandleri AV19
           section 150 of 157 of the complete
           genome.>gb:AE009439_904029 Methanopyrus kandleri AV19,
           complete genome.
          Length = 221

 Score =  119 bits (299), Expect = 8e-26
 Identities = 71/212 (33%), Positives = 111/212 (52%)
 Frame = -3

Query: 864 IGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVGRLCAGNKNGLIL 685
           IG +   +  Y +VA    ++     +  L   + V++T++ G+ +VG L A N NG + 
Sbjct: 14  IGAWIAASEEYAVVAPKVPDDIVERVKEALD--VEVVRTTVAGSNLVGALLAVNSNGALF 71

Query: 684 PHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTDLDRETEELIADV 505
           P    + E++ +R      V V     +++A+GN +  NDH AL H DLD    E+I  V
Sbjct: 72  PRHAREHEIRVVREL---GVEVDVLPSKMNAVGNLVLTNDHGALVHPDLDDHALEVIESV 128

Query: 504 LGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVPLVAGTVNRGSDV 325
           LG  V R  + G   VGS    +++G +VHP  + E+++ +S +L V +  GTVNRGS  
Sbjct: 129 LGGRVVRGELGGVKTVGSAGVANSKGAVVHPGATEEEMERVSEVLGVDVEVGTVNRGSPY 188

Query: 324 IAAGLTVNDWTAFCGSDTTATELSVIESVFKL 229
           +  G+ VN   A  G DTT  EL+ +E    L
Sbjct: 189 VGVGIVVNSKGAVVGEDTTGPELARLEDALYL 220



>sp|Q980G0|IF6_SULSO Translation initiation factor 6
           (aIF-6).>pir|B90178|B90178 translation initiation factor
           6 (eiF 6) (eiF6) [imported] - Sulfolobus
           solfataricus>gb:AE006669_221279 Sulfolobus solfataricus
           P2 section 28 of 272 of the complete
           genome.>gb:AE006641_1107127 Sulfolobus solfataricus P2,
           complete genome.
          Length = 223

 Score =  113 bits (283), Expect = 6e-24
 Identities = 78/221 (35%), Positives = 115/221 (52%), Gaps = 5/221 (2%)
 Frame = -3

Query: 891 RLQFENSCEIGVFSKLTNAYCLVAIG----GSENFYSTFEAELADAIPVIKTSIGGTRIV 724
           RL    +  IGV+    N Y ++  G      EN       EL +A       I  + ++
Sbjct: 5   RLSVFGTDNIGVYIYTNNKYTIIPRGLDSETKENIAQVLGTELLEA------EISRSFLL 58

Query: 723 GRLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHT 544
           G   +GN NG++LP +T D E + L+ +L D  V +  + +++ALGN I  N+  AL + 
Sbjct: 59  GIFISGNDNGILLPKSTIDDEFRFLKENLRDCRV-EILNSKVTALGNTILANNKAALIYP 117

Query: 543 DLDRETEELIADVLGVE-VFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQ 367
           + +   E++I + LGVE + R  IA  I VGS    +N+GGLVH  TS ++L EL  L  
Sbjct: 118 EFNDIEEKIIKETLGVEDIKRGKIAQMITVGSVGVITNKGGLVHVDTSEKELKELEKLFG 177

Query: 366 VPLVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIE 244
           V +  GTVN GS  I +GL  ND     G+ TT  E+  I+
Sbjct: 178 VKIDIGTVNFGSVFIKSGLVANDKGTLVGASTTGPEILRIQ 218



>sp|O27648|IF6_METTH Translation initiation factor 6
           (aIF-6).>pir|C69082|C69082 conserved hypothetical
           protein MTH1611 - Methanobacterium thermoautotrophicum
           (strain Delta H)>gb:AE000920_29280 Methanobacterium
           thermoautotrophicum from bases 1471880 to 1482686
           (section 126 of 148) of the complete
           genome.>gb:AE000666_926362 Methanobacterium
           thermoautotrophicum str. Delta H complete genome.
          Length = 222

 Score =  111 bits (278), Expect = 2e-23
 Identities = 74/228 (32%), Positives = 116/228 (50%), Gaps = 2/228 (0%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADA--IPVIKTSIGGTRI 727
           M  R+    +  +GV+  +T++  L+     +N    FE  L +A  + V+K SI G+ +
Sbjct: 1   MIRRINLSGNPNLGVYISVTDSVALIP----QNTPEKFEGVLREALEVEVLKVSISGSSL 56

Query: 726 VGRLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTH 547
            G L  GN NG ++ +   D+E+  L  +  ++V   R  ER +A+GN +  ND+ A+  
Sbjct: 57  NGALAVGNSNGFVVSNQAMDREIDALAAAGVEAV---RIPERFTAVGNLVLANDNGAVAS 113

Query: 546 TDLDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQ 367
             L  +  ++I DVL V+V   T+AG  +VGS  A +NRG L++P  S E++  +   L 
Sbjct: 114 PLLSDDALQVIGDVLEVDVKVSTLAGLNIVGSMGAATNRGALLNPQASSEEIGIIEDTLG 173

Query: 366 VPLVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKLRE 223
           V    GTVN G  +I A    N      G +TT  EL+ IE      E
Sbjct: 174 VEADVGTVNHGVTLIGACSVANSNGVLVGEETTGPELARIEEALGFLE 221



>sp|Q8TIN4|IF6_METAC Translation initiation factor 6
           (aIF-6).>gb:AE011123_269396 Methanosarcina acetivorans
           str. C2A, section 468 of 534 of the complete
           genome.>gb:AE010299_909955 Methanosarcina acetivorans
           str. C2A, complete genome.
          Length = 218

 Score =  108 bits (269), Expect = 2e-22
 Identities = 75/214 (35%), Positives = 107/214 (50%)
 Frame = -3

Query: 864 IGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVGRLCAGNKNGLIL 685
           IGVF+  T    LV         +  E E+ D + VI+T + G+ +VG L  GN NG +L
Sbjct: 13  IGVFATCTEDVVLVPPLTKPEVCALLE-EVLD-VRVIETLVNGSIVVGALSRGNSNGFML 70

Query: 684 PHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTDLDRETEELIADV 505
           P+     E+Q   +     + V    +RL+A+GN +  ND  AL H DL  +  E IA  
Sbjct: 71  PYGAR-AEMQRFTD-----IPVGILPDRLNAVGNIVFANDSAALVHPDLSDKALEAIART 124

Query: 504 LGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVPLVAGTVNRGSDV 325
           L V+V+R TIAG   VG     +N+G LVHP  +  + + L  +   P+  GT N G+ +
Sbjct: 125 LKVDVYRGTIAGIKNVGMAGVVTNKGLLVHPKVTASEREVLEKIFGFPVNIGTTNFGTQM 184

Query: 324 IAAGLTVNDWTAFCGSDTTATELSVIESVFKLRE 223
           + +GL  N      GS+TT  EL  IE      E
Sbjct: 185 LGSGLLANSKNFVAGSETTGPELGRIEEALGFLE 218



>sp|Q60357|IF6_METJA Translation initiation factor 6
           (aIF-6).>pir|H64305|H64305 hypothetical protein homolog
           MJ0048 - Methanococcus jannaschii>gb:U67463_206134
           Methanocaldococcus jannaschii DSM 2661 section 5 of 150
           of the complete genome.>gb:L77117_1098892
           Methanocaldococcus jannaschii DSM 2661, complete genome.
          Length = 228

 Score =  104 bits (259), Expect = 3e-21
 Identities = 77/230 (33%), Positives = 116/230 (50%), Gaps = 4/230 (1%)
 Frame = -3

Query: 906 LTMATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRI 727
           +TM  R  F     IGV +  T    L+ I   ++  +     L      ++T+IGG+ +
Sbjct: 1   MTMIIRKYFSGIPTIGVLALTTEEITLLPIFLDKDDVNEVSEVLETKC--LQTNIGGSSL 58

Query: 726 VGRLCAGNKNGLILPHTTTDQELQHLRNSLPDS---VVVQRADERLSALGNCIACNDHVA 556
           VG L   NK GL+LP    D+EL  ++N L ++   + V+    + +ALGN I  ND  A
Sbjct: 59  VGSLSVANKYGLLLPKIVEDEELDRIKNFLKENNLDLNVEIIKSKNTALGNLILTNDKGA 118

Query: 555 LTHTDLDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELST 376
           L   +L ++ ++ I D L VEV   TIA    VGS    +N+G L HP    ++L+ L +
Sbjct: 119 LISPEL-KDFKKDIEDSLNVEVEIGTIAELPTVGSNAVVTNKGCLTHPLVEDDELEFLKS 177

Query: 375 LLQVPLVA-GTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKL 229
           L +V  +  GT N+G+  + A +  N   A  G DTT  EL +IE    L
Sbjct: 178 LFKVEYIGKGTANKGTTSVGACIIANSKGAVVGGDTTGPELLIIEDALGL 227



>gb:AX970956_1486265 Sequence 1759 from Patent EP1104808.
          Length = 108

 Score =  103 bits (257), Expect = 6e-21
 Identities = 46/67 (68%), Positives = 54/67 (80%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           MA R  FEN+CEIG F+KLTN YCLVAIGGSENFYS FE EL+D IPV+  SI G RI+G
Sbjct: 1   MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIG 60

Query: 720 RLCAGNK 700
           R+C G++
Sbjct: 61  RMCVGDR 67



>sp|O28214|IF6_ARCFU Translation initiation factor 6
           (aIF-6).>pir|H69507|H69507 conserved hypothetical
           protein AF2065 - Archaeoglobus
           fulgidus>gb:AE000961_29867 Archaeoglobus fulgidus DSM
           4304 section 146 of 172 of the complete
           genome.>gb:AE000782_975941 Archaeoglobus fulgidus DSM
           4304 complete genome.
          Length = 215

 Score =  102 bits (255), Expect = 1e-20
 Identities = 60/207 (28%), Positives = 108/207 (52%)
 Frame = -3

Query: 864 IGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVGRLCAGNKNGLIL 685
           IG+++K++  Y +V +   E      + +L   + VI T I G+ +VG + A N  G ++
Sbjct: 11  IGLYAKVSEEYAVVGVN-HEPLIDAIQEKLD--VDVIVTKIAGSELVGAMMALNSRGAVV 67

Query: 684 PHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTDLDRETEELIADV 505
                  EL+ L  SL D +V++     ++  GN +  ND   + + +++    E +AD 
Sbjct: 68  SDQVLSSELRELEKSL-DVLVIETP---MTCFGNNLLINDRGGIANPEMESSVVEKVADF 123

Query: 504 LGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVPLVAGTVNRGSDV 325
           + +E+ + T+ G   VG     +NRGGL +P+ +  +  +L  +  V ++ GTVN G+D+
Sbjct: 124 MDIELVKGTVGGIKTVGMAAVVTNRGGLANPNINEWEAKKLQEVAGVEVLTGTVNFGTDM 183

Query: 324 IAAGLTVNDWTAFCGSDTTATELSVIE 244
           + +GL  N      G DTT  EL ++E
Sbjct: 184 VGSGLVANSKGYVVGRDTTGFELGIVE 210



>sp|Q9HM16|IF6_THEAC Translation initiation factor 6 (aIF-6).
          Length = 216

 Score =  102 bits (254), Expect = 1e-20
 Identities = 63/209 (30%), Positives = 105/209 (50%)
 Frame = -3

Query: 864 IGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVGRLCAGNKNGLIL 685
           IG+++K  +    + +   E   + F+  L   + V + SI  + ++G +   N NGLI+
Sbjct: 13  IGIYAKAWDDVAFITMMADEKTVADFQEVLQ--VDVRRISIDNSSLIGTMMVMNSNGLIV 70

Query: 684 PHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTDLDRETEELIADV 505
           P+ +    L  L     D   V +  ++++A+GN I  NDH A+ H +    + + I D 
Sbjct: 71  PYGSEITGLGDL-----DGRNVLQLKDKINAIGNDIIANDHGAIIHKNFSNRSRKEIEDT 125

Query: 504 LGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVPLVAGTVNRGSDV 325
           LGVE  R TI   + VGS    +++G LV+P T  ++L+ L    +V + +GT N GS  
Sbjct: 126 LGVETIRTTIGNILTVGSAGILTSKGMLVNPETDDDELEFLRDFFKVSVKSGTANFGSIY 185

Query: 324 IAAGLTVNDWTAFCGSDTTATELSVIESV 238
           + A +  N      G DTT  E+  I+ V
Sbjct: 186 VGASIVANSKGVLVGKDTTPIEMDRIDDV 214



>sp|Q97CU0|IF6_THEVO Translation initiation factor 6
           (aIF-6).>gb:BA000011_664453 Thermoplasma volcanium GSS1
           DNA, complete genome.
          Length = 218

 Score =  100 bits (249), Expect = 5e-20
 Identities = 61/209 (29%), Positives = 103/209 (49%)
 Frame = -3

Query: 864 IGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVGRLCAGNKNGLIL 685
           IG+++K  +    +     E   + F   L   + + + SI G+ ++G + A N NG++L
Sbjct: 15  IGIYAKAWDDVAFITKMADEKTVNEFREVLQ--VDIKRISIDGSTLIGTMIAVNSNGIVL 72

Query: 684 PHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTDLDRETEELIADV 505
           P+ +    L  +     D   V    ++++A+GN I  NDH A+ H     +  + I D 
Sbjct: 73  PYGSNIDGLDGI-----DGRNVLYLKDKINAVGNDIIANDHGAIIHKAFSNKARKEIEDT 127

Query: 504 LGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVPLVAGTVNRGSDV 325
           LGVE  R +I   + VGS    +++G LV+P T  ++L+ L    +V + +GT N GS  
Sbjct: 128 LGVETIRTSIGNILTVGSASVLTSKGMLVNPETDDDELEFLKDFFKVSVKSGTANFGSIY 187

Query: 324 IAAGLTVNDWTAFCGSDTTATELSVIESV 238
           + A +  N      G DTT  E+  I+ V
Sbjct: 188 VGASIVANSKGILVGRDTTPIEIDRIDDV 216



>gb:AE017261_419224 Picrophilus torridus DSM 9790, complete genome.
          Length = 217

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 66/219 (30%), Positives = 107/219 (48%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           M  ++   NS  IGV+++  N    + +  S+     FE  L     V K SIG + ++G
Sbjct: 1   MIKKVSILNSNFIGVYARTWNDVTFLPVNISDEEKRIFEETLKTE--VYKISIGNSFLIG 58

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
            + + N NG+++     D  + +L++   +   +   + +L+A GN I  NDH AL H  
Sbjct: 59  SMLSMNSNGIVV----ADHGIDNLKSLNINGRNILSINNKLNAAGNNIIANDHAALIHKS 114

Query: 540 LDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVP 361
                 + I DVLGVE  + +IAG   VGS    ++RG LV      +++  LS L ++ 
Sbjct: 115 FPDSIRKKIEDVLGVETVKGSIAGIKTVGSVAVLNDRGMLVTSEADEDEIKYLSDLFKIN 174

Query: 360 LVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIE 244
           +  GT N GS+ + A +  N      G  TT+ EL  I+
Sbjct: 175 VKTGTANFGSNYVGASIIANSNGILVGEATTSIELGRID 213



>sp|Q971I4|IF6_SULTO Translation initiation factor 6
           (aIF-6).>gb:BA000023_692019 Sulfolobus tokodaii str. 7
           DNA, complete genome.
          Length = 223

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 70/215 (32%), Positives = 114/215 (53%), Gaps = 5/215 (2%)
 Frame = -3

Query: 864 IGVFSKLTNAYCLVA----IGGSENFYSTFEAELADAIPVIKTSIGGTRIVGRLCAGNKN 697
           IG++    + Y +V     +   +    TF+ E      +I+T+I  + ++G   AGN N
Sbjct: 14  IGIYIFTNDKYTIVPKNLDVETIQKIQETFKTE------IIQTTIAKSFLIGIFVAGNNN 67

Query: 696 GLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTDLDRETEEL 517
            ++LP    D+E++ +++   D V V+  D R +ALGN I  N + AL + +L     + 
Sbjct: 68  VILLPRNVDDEEVKKIKDIARD-VRVEILDIRPTALGNIILTNSYGALIYPELSSIEFKK 126

Query: 516 IADVLGVE-VFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVPLVAGTVN 340
           I + L ++ + + +IA  I VGS    +++ GLVH  T+ E+LD+LS L +V +  GTVN
Sbjct: 127 IKESLQIDNIEKGSIANIITVGSVGVITDKAGLVHIDTTEEELDKLSKLFRVKIDTGTVN 186

Query: 339 RGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVF 235
            GS  I +GL  N      GS TT  E+  I+  F
Sbjct: 187 FGSAFIHSGLIANRNGVLVGSATTGPEILRIQRAF 221



>sp|P38619|IF6_SULAC Translation initiation factor 6 (aIF-6).
          Length = 223

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 64/176 (36%), Positives = 94/176 (53%), Gaps = 1/176 (0%)
 Frame = -3

Query: 759 VIKTSIGGTRIVGRLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNC 580
           +I+T+I  + +VG L  GN + ++LP T    E++ ++    D V V+  D R +ALGN 
Sbjct: 47  IIQTTISKSVLVGILVTGNNDVILLPRTALADEIKVIKEQAKD-VRVEVVDIRPTALGNI 105

Query: 579 IACNDHVALTHTDLDRETEELIADVLGVEV-FRQTIAGNILVGSYCAFSNRGGLVHPHTS 403
           I  N H AL + DL       +   L ++   + TIA  I VGS    +++ GLVH   +
Sbjct: 106 ILSNTHGALIYQDLSEAEINKVKKALQIDTAIKGTIANIITVGSVAVITDKAGLVHIDAT 165

Query: 402 VEDLDELSTLLQVPLVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVF 235
            E+L +LS L +V L +GTVN GS  I +GL  N      GS TT  E+  I+  F
Sbjct: 166 EEELKKLSELFKVKLDSGTVNFGSVFIRSGLVANRNGVLVGSSTTGAEILRIQRAF 221



>sp|Q8ZTU1|IF6_PYRAE Translation initiation factor 6
           (aIF-6).>gb:AE009911_257293 Pyrobaculum aerophilum
           strain IM2 section 166 of 201 of the complete
           genome.>gb:AE009441_899919 Pyrobaculum aerophilum strain
           IM2 complete genome.
          Length = 220

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 66/219 (30%), Positives = 107/219 (48%)
 Frame = -3

Query: 894 TRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVGRL 715
           T ++   +  IGVF    N    +     E         L  +  V + ++  + ++G  
Sbjct: 5   TPIRVFGTSSIGVFIATNNTVTFIPPDVPEKIDDAVRNTLRTS--VARFTVARSPLLGIF 62

Query: 714 CAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTDLD 535
              N NG++LP    ++E++  +      + V   + + +A+ N I   + VAL    L+
Sbjct: 63  TVVNDNGVLLPPLVLEEEVRLFKAL---GLNVDIINTKYTAISNLILAGNKVALVSPLLE 119

Query: 534 RETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVPLV 355
               +++ADVLGVEV   TIAGN LVG+    ++RG LV P  + +DL +LS   +V + 
Sbjct: 120 PSARKVVADVLGVEVIVDTIAGNPLVGALAVLNSRGLLVAPEATDDDLKKLSEYFKVRVD 179

Query: 354 AGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESV 238
            GTVNRG   +  G+ VND  A  G +T   EL  ++ V
Sbjct: 180 VGTVNRGKSFLRGGIVVNDNGALVGDETAGPELMRMQQV 218



>gb:TACID1_195833 Thermoplasma acidophilum complete genome; segment
           1/5.
          Length = 189

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 57/176 (32%), Positives = 91/176 (51%)
 Frame = -3

Query: 765 IPVIKTSIGGTRIVGRLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALG 586
           + V + SI  + ++G +   N NGLI+P+ +    L  L     D   V +  ++++A+G
Sbjct: 17  VDVRRISIDNSSLIGTMMVMNSNGLIVPYGSEITGLGDL-----DGRNVLQLKDKINAIG 71

Query: 585 NCIACNDHVALTHTDLDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHT 406
           N I  NDH A+ H +    + + I D LGVE  R TI   + VGS    +++G LV+P T
Sbjct: 72  NDIIANDHGAIIHKNFSNRSRKEIEDTLGVETIRTTIGNILTVGSAGILTSKGMLVNPET 131

Query: 405 SVEDLDELSTLLQVPLVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESV 238
             ++L+ L    +V + +GT N GS  + A +  N      G DTT  E+  I+ V
Sbjct: 132 DDDELEFLRDFFKVSVKSGTANFGSIYVGASIVANSKGVLVGKDTTPIEMDRIDDV 187



>gb:AF268611_494103 Uncultured marine group II euryarchaeote
           EBAC37F11, BAC clone 37F11, partial sequence.
          Length = 220

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 53/173 (30%), Positives = 97/173 (56%)
 Frame = -3

Query: 747 SIGGTRIVGRLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACN 568
           SIGG+ ++G L AGN  G+ +    T+ ++  L  +  D VV++     ++  GN +  N
Sbjct: 51  SIGGSNLIGALLAGNTKGMAVADIATESDIDAL-TAYGDVVVMEGG---VNTAGNLLLVN 106

Query: 567 DHVALTHTDLDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLD 388
           +   +    + ++  +++++VLGV++   TI G  +VGS    +++G L+HP  + E++ 
Sbjct: 107 EQGCVASPSIPKDGLDILSEVLGVDIISTTIGGQDVVGSLGVVNSQGVLLHPDVAPEEVL 166

Query: 387 ELSTLLQVPLVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKL 229
            +  +L VP + GTV+ GS  + AG+  ++  A  GS+TT  EL+ IE    L
Sbjct: 167 LIEEILGVPPMVGTVSFGSPYVGAGICASNNGALAGSETTGPELNRIEDALGL 219



 Score = 35.0 bits (79), Expect = 2.6
 Identities = 23/90 (25%), Positives = 45/90 (50%)
 Frame = -3

Query: 591 LGNCIACNDHVALTHTDLDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHP 412
           +G  +A   +V     +L   T E +  V+G+E+   +I G+ L+G+  A + +G  V  
Sbjct: 14  IGIHLASVGNVLFHPRELPTPTIEKLEQVVGLELAPISIGGSNLIGALLAGNTKGMAVAD 73

Query: 411 HTSVEDLDELSTLLQVPLVAGTVNRGSDVI 322
             +  D+D L+    V ++ G VN   +++
Sbjct: 74  IATESDIDALTAYGDVVVMEGGVNTAGNLL 103



>gb:BX957219_843314 Methanococcus maripaludis S2 complete genome;
           segment 1/5.
          Length = 227

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 69/228 (30%), Positives = 109/228 (47%), Gaps = 4/228 (1%)
 Frame = -3

Query: 900 MATRLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIPVIKTSIGGTRIVG 721
           M  +  F     +GV S  T  Y    +   +      +  L   IP  + +I  + ++G
Sbjct: 1   MIMKTYFSGVSTLGVHSLATEDYGFFPLSVDQKTMERMKNVLD--IPATQLNISNSSLIG 58

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDS---VVVQRADERLSALGNCIACNDHVALT 550
            LC GN NGL++P+ TT++EL+ ++  L ++   V ++R   + +A GN I  N+   + 
Sbjct: 59  SLCVGNSNGLLVPNITTEKELELIKMFLKENSLDVNLERLKAKNTAFGNLILTNNKGCII 118

Query: 549 HTDLDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLL 370
             +L R   + I DVL VE      A    VGS    +++G LVHP T   +L+ +  +L
Sbjct: 119 SEELSR-FRKTIEDVLDVESGVGNYAELPTVGSNGVATDKGCLVHPLTDELELEWIQDIL 177

Query: 369 QVPLV-AGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVFKL 229
           +V  V  GT NRG   + A +  N   A  G DT+  E+  IE    L
Sbjct: 178 RVDYVERGTANRGVTSVGACILANTKGAVVGGDTSGPEILKIEEALDL 225



>pir|S53700|S53700 hypothetical protein 1 - Sulfolobus
           acidocaldarius>gb:SARL46_171843 S.acidocaldarius RL46,
           RL31, RL33, SRalpha, AO2, AO3, secE and AO5 SAC genes.
          Length = 203

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 57/154 (37%), Positives = 85/154 (55%), Gaps = 1/154 (0%)
 Frame = -3

Query: 759 VIKTSIGGTRIVGRLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNC 580
           +I+T+I  + +VG L  GN + ++LP T    E++ ++    D V V+  D R +ALGN 
Sbjct: 47  IIQTTISKSVLVGILVTGNNDVILLPRTALADEIKVIKEQAKD-VRVEVVDIRPTALGNI 105

Query: 579 IACNDHVALTHTDLDRETEELIADVLGVEV-FRQTIAGNILVGSYCAFSNRGGLVHPHTS 403
           I  N H AL + DL       +   L ++   + TIA  I VGS    +++ GLVH   +
Sbjct: 106 ILSNTHGALIYQDLSEAEINKVKKALQIDTAIKGTIANIITVGSVAVITDKAGLVHIDAT 165

Query: 402 VEDLDELSTLLQVPLVAGTVNRGSDVIAAGLTVN 301
            E+L +LS L +V L +GTVN GS  I +GL  N
Sbjct: 166 EEELKKLSELFKVKLDSGTVNFGSVFIRSGLVAN 199



>gb:AB182929_1529247 Citrullus lanatus mRNA for eukaryotic
           translation initiation factor 6, partial cds.
          Length = 38

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 35/37 (94%), Positives = 37/37 (100%)
 Frame = -3

Query: 279 SDTTATELSVIESVFKLREAQPSAIVDEMRKSLIDSY 169
           SDTTATELSVIESVFKLREAQPS+IV+EMRKSLIDSY
Sbjct: 1   SDTTATELSVIESVFKLREAQPSSIVEEMRKSLIDSY 37



>gb:AE017199_403337 Nanoarchaeum equitans Kin4-M, complete genome.
          Length = 208

 Score = 50.1 bits (118), Expect = 8e-05
 Identities = 58/223 (26%), Positives = 96/223 (43%), Gaps = 4/223 (1%)
 Frame = -3

Query: 891 RLQFENSCEIGVFSKLTNAYCLVAIGGSENFYSTFEAELADAIP---VIKTSIGGTRIVG 721
           +++   S  IG+F  + N   ++    SE      E  + D +    ++KT+I GT  VG
Sbjct: 5   KIKIYGSDSIGLFGYIANDIAVL----SEVISKEEEKIIKDTLGLEGIVKTTIAGTPTVG 60

Query: 720 RLCAGNKNGLILPHTTTDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTD 541
               G K+ +I+P +  ++EL+ L       VV    D   +ALGN         L    
Sbjct: 61  SFIIGKKDLIIVPSSIYEEELKKLEELFRVEVV----DVVNNALGNNYYYWPKKNLLFAA 116

Query: 540 LDRETE-ELIADVLGVEVFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQV 364
            D + E +L+A  L  +++   I  +I VGS     N   L+H      D+++   +   
Sbjct: 117 EDTKKEAKLLAKKLNADLY--LIDTDIEVGS-SLIGNSKMLLHNPDIYIDIEDAKPV--- 170

Query: 363 PLVAGTVNRGSDVIAAGLTVNDWTAFCGSDTTATELSVIESVF 235
                T+N G   + A   +ND     GS TT  EL  ++ +F
Sbjct: 171 -----TLNMGDKFVGAAALLNDKGIVVGSKTTGIELIELQDLF 208



>gb:AB197305_17854 Uncultured bacterium C23O gene for catechol
           2,3-dioxygenase, partial cds, clone: R2-375-69.
          Length = 125

 Score = 38.1 bits (87), Expect = 0.30
 Identities = 19/46 (41%), Positives = 29/46 (63%)
 Frame = -3

Query: 567 DHVALTHTDLDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNR 430
           DH  L   DLD  T +L  DVLG +V  Q +AG++++G++   SN+
Sbjct: 9   DHCLLYGDDLDG-TVKLFRDVLGFKVAEQVVAGDLMIGAFLTCSNK 53



>gb:BX572094_797226 Prochlorococcus marinus MED4 complete genome;
           segment 5/5.
          Length = 455

 Score = 35.8 bits (81), Expect = 1.5
 Identities = 60/227 (26%), Positives = 89/227 (39%), Gaps = 20/227 (8%)
 Frame = -3

Query: 813 GSENFYSTFEAELADAIPVIKTSIGGTRIVGRLCAGNKNG-----LILP---HTTTDQEL 658
           G   F   F A  A A  +++ S+    IVG L AG   G     L++P   HT  +Q L
Sbjct: 21  GVIRFLLIFLAARALAEVLVRLSL--PTIVGELLAGVVIGASGFHLLIPPSAHTELNQGL 78

Query: 657 QHLRNSL---PDSVVVQRADERLSALGNCIACNDHVALTHTDLDRETEELIADVLGVEVF 487
            ++ +SL   P  VV     E   +L        +  L  T L+ E EEL+A  +G + F
Sbjct: 79  VNVISSLASIPPEVVPDVYFESFPSLQAVATLGLYALLFLTGLESELEELVA--VGAQAF 136

Query: 486 RQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVPLVAGTVNRGSDVIAAGLT 307
              +AG IL  ++  F                  L  + QV L+                
Sbjct: 137 TVAMAGVILPFAFGTFG-----------------LMFIFQVDLIP--------------- 164

Query: 306 VNDWTAFCGSDTTATELSVIESVF------KLREAQ---PSAIVDEM 193
                 F G+  TAT + +  SVF      K RE Q    +A++D++
Sbjct: 165 ----AVFAGASMTATSIGITASVFGELGYLKTREGQIVIGAAVLDDI 207



>gb:AE017332_445843 Mycoplasma hyopneumoniae 232, complete genome.
          Length = 384

 Score = 35.8 bits (81), Expect = 1.5
 Identities = 21/78 (26%), Positives = 39/78 (50%)
 Frame = +1

Query: 364 NLEERRKFIQVFDGCMRMHQATSVRKSTIAANKYIPSYCLPKDFNSENIRNQLFSFPIKI 543
           NL++  KF   F+GC           + I  +K   ++ +    +S +I+N    F IK 
Sbjct: 202 NLKKYYKFTHFFNGCSNFDHRKQSLVNLIFESKLPKNFLVELITDSLHIKNSTLKFTIK- 260

Query: 544 SVRKSNMVIASNAVSQSG 597
           +++K N V  S++++Q G
Sbjct: 261 NIKKENWVAVSDSLAQKG 278



>gb:BA000030_698079 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 606

 Score = 34.7 bits (78), Expect = 3.3
 Identities = 30/96 (31%), Positives = 41/96 (42%), Gaps = 4/96 (4%)
 Frame = -3

Query: 453 SYCAFSNRGGLVHPH----TSVEDLDELSTLLQVPLVAGTVNRGSDVIAAGLTVNDWTAF 286
           ++C    R G  HP     T V  L E   + Q+P    TV R   +  +GLTV DW   
Sbjct: 144 TWCTLPLRKGSDHPMQRTATPVPSLREYPAI-QLPGNPNTVTRARTIARSGLTVLDWQ-- 200

Query: 285 CGSDTTATELSVIESVFKLREAQPSAIVDEMRKSLI 178
            G    ATE+  I      R  QP+ ++ E  K  +
Sbjct: 201 -GDVHAATEVVAIR-----RTPQPATLLTEEAKGTV 230



>gb:AB197297_17846 Uncultured bacterium C23O gene for catechol
           2,3-dioxygenase, partial cds, clone: R2-375-37.
          Length = 125

 Score = 34.7 bits (78), Expect = 3.3
 Identities = 17/46 (36%), Positives = 29/46 (63%)
 Frame = -3

Query: 567 DHVALTHTDLDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNR 430
           DH  L   D+D +T +L  +VLG ++  Q +AG++LVG++   S +
Sbjct: 9   DHCLLYGDDVD-DTVKLFTEVLGFKMAEQVMAGDVLVGAFLTCSTK 53



>gb:AB195033_17615 Uncultured bacterium gene for catechol
           2,3-dioxygenase, partial cds, clone: R1-375-44d.
          Length = 125

 Score = 33.5 bits (75), Expect = 7.4
 Identities = 17/46 (36%), Positives = 29/46 (63%)
 Frame = -3

Query: 567 DHVALTHTDLDRETEELIADVLGVEVFRQTIAGNILVGSYCAFSNR 430
           DH  L   D+D  T +L+ +VLG ++  Q +AG++LVG++   S +
Sbjct: 9   DHCLLYGDDVDG-TVKLLIEVLGFKMAEQVMAGDVLVGAFLTCSTK 53



>pir|F95043|F95043 DNA-binding response regulator [imported] -
           Streptococcus pneumoniae (strain
           TIGR4)>gb:AE007349_225604 Streptococcus pneumoniae TIGR4
           section 32 of 194 of the complete
           genome.>gb:AE005672_1103372 Streptococcus pneumoniae
           TIGR4, complete genome.
          Length = 229

 Score = 33.1 bits (74), Expect = 9.7
 Identities = 37/159 (23%), Positives = 66/159 (41%), Gaps = 1/159 (0%)
 Frame = -3

Query: 672 TDQELQHLRNSLPDSVVVQRADERLSALGNCIACNDHVALTHTDLDRETEELIADVLGVE 493
           TD +L  L  +L D +    A++    L      +  + L H +  +E  E++       
Sbjct: 45  TDYDLMLLNVNLGDMMAQDFAEK----LSRTKPASVIMILDHWEDLQEELEVVQRFAVSY 100

Query: 492 VFRQTIAGNILVGSYCAFSNRGGLVHPHTSVEDLDELSTLLQVPLVAGTVNRGSDVIAAG 313
           +++  +  N++      F  R   +  H S+  +      L++ +   TV RG ++IA  
Sbjct: 101 IYKPVLIENLVARISAIFRGRD-FIDQHCSLMKVPRTYRNLRIDVEHHTVYRGEEMIALT 159

Query: 312 LTVNDWTA-FCGSDTTATELSVIESVFKLREAQPSAIVD 199
               D  A   GS    T   ++ESV+K   A  + IVD
Sbjct: 160 RREYDLLATLMGSKKVLTREQLLESVWKYESATETNIVD 198


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,008,588,905
Number of Sequences: 1806583
Number of extensions: 19835827
Number of successful extensions: 49840
Number of sequences better than 10.0: 75
Number of HSP's better than 10.0 without gapping: 48025
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 49738
length of database: 581,917,975
effective HSP length: 126
effective length of database: 354,288,517
effective search space used: 81132070393
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)