BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10089
         (826 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB124647_1528079 Nicotiana tabacum NtTPC1B mRNA for two-pore ...   291   7e-81   
gb:AB124646_1528078 Nicotiana tabacum NtTPC1A mRNA for two-pore ...   285   6e-80   
gb:AF360372_1791301 Arabidopsis thaliana putative calcium channe...   244   3e-66   
pir|B85045|B85045 probable calcium channel [imported] - Arabidop...   244   3e-66   Arabidopsis thaliana [mouse-ear cress]
gb:AB053952_1521302 Arabidopsis thaliana AtTPC1 mRNA for two-por...   242   2e-65   
gb:AY114121_1578501 Triticum aestivum putative calcium channel m...   226   7e-60   
gb:AB100696_1526267 Oryza sativa (japonica cultivar-group) OsTPC...   221   1e-58   
gb:AB071014_1522718 Oryza sativa OsTPC1 mRNA for putative two-po...   221   1e-58   
gb:AP003335_1828159 Oryza sativa (japonica cultivar-group) genom...   221   1e-58   
gb:AY465119_1607950 Hordeum vulgare two-pore calcium channel (TP...   223   2e-58   
gb:HSM802204_2017433 Homo sapiens mRNA; cDNA DKFZp434M0223 (from...    70   5e-11   
gb:AY029200_1934466 Homo sapiens two-pore calcium channel protei...    70   5e-11   
pir|T46421|T46421 hypothetical protein DKFZp434M0223.1 - human (...    70   5e-11   Homo sapiens [man]
gb:BC069857_2106144 Mus musculus cDNA clone MGC:78039 IMAGE:4500...    69   8e-11   
gb:BC043472_2098918 Mus musculus two pore segment channel 2, mRN...    69   8e-11   
gb:BC025890_2095203 Mus musculus two pore segment channel 2, mRN...    69   8e-11   
gb:AK052930_1170255 Mus musculus 16 days neonate heart cDNA, RIK...    69   8e-11   
gb:BC062072_2104845 Rattus norvegicus two pore channel 1, mRNA (...    65   2e-09   
gb:AK129303_2069534 Mus musculus mRNA for mKIAA1169 protein.           65   2e-09   
gb:AF217002_2059399 Mus musculus calcium channel mRNA, complete ...    65   2e-09   
gb:AB032995_1866175 Homo sapiens mRNA for KIAA1169 protein, part...    65   2e-09   
gb:AX235888_1464490 Sequence 1 from Patent WO0164881.>gb:AX23589...    65   2e-09   
gb:CR548612_1375530 Paramecium tetraurelia macronuclear largest ...    64   3e-09   
pir|JC7240|JC7240 two-pore calcium channel protein - rat>gb:AB01...    64   3e-09   Rattus norvegicus [brown rat]
pir|T43048|T43048 calcium channel alpha-1 chain - Cyanea capilla...    60   6e-08   Cyanea capillata [lion's mane]
gb:AY319303_2526675 Oncorhynchus mykiss neuroendocrine-type volt...    58   2e-07   
gb:AF450282_2495530 Oncorhynchus mykiss voltage-gated calcium ch...    58   2e-07   
sp|O57483|CCAS_RANCA|CCAS_RANCA Voltage-dependent L-type calcium channel al...    58   2e-07   Rana catesbeiana [bullfrog]
gb:RABALP1A_1443562 Rabbit dihydropyridine-sensitive calcium cha...    57   4e-07   
sp|P07293|CCAS_RABIT|CCAS_RABIT Voltage-dependent L-type calcium channel al...    57   4e-07   Oryctolagus cuniculus [domestic rabbit]
gb:AL139159_1920369 Human DNA sequence from clone RP5-894H24 on ...    57   5e-07   
gb:AL139159_1920368 Human DNA sequence from clone RP5-894H24 on ...    57   5e-07   
gb:AX546808_1470184 Sequence 9 from Patent WO02063000.                 57   5e-07   
gb:AX546800_1470179 Sequence 1 from Patent WO02063000.                 57   5e-07   
pir|A55645|A55645 calcium channel, voltage-dependent, protein al...    57   5e-07   Homo sapiens [man]
sp|Q13698|CCAS_HUMAN|CCAS_HUMAN Voltage-dependent L-type calcium channel al...    57   5e-07   Homo sapiens [man]
gb:AX546804_1470181 Sequence 5 from Patent WO02063000.                 55   1e-06   
sp|Q02485|CCAS_RAT|CCAS_RAT Voltage-dependent L-type calcium channel alph...    55   1e-06   Rattus norvegicus [brown rat]
gb:AY528225_2536340 Danio rerio L-type calcium channel pore subu...    53   6e-06   
gb:AF484081_1275755 Lymnaea stagnalis voltage-dependent L-type c...    53   6e-06   
gb:AF484080_1275754 Lymnaea stagnalis voltage-dependent L-type c...    53   6e-06   
gb:AF484079_1275753 Lymnaea stagnalis voltage-dependent L-type c...    53   6e-06   
gb:AF026198_2469209 Fugu rubripes neural cell adhesion molecule ...    53   8e-06   
pir|T30535|T30535 calcium channel alpha-1 chain homolog - Fugu r...    53   8e-06   Takifugu rubripes [tiger puffer]
gb:HSCACNLA42_2011225 Human dihydropyridine receptor alpha 1 sub...    52   1e-05   
gb:AY528224_2536339 Danio rerio L-type calcium channel pore subu...    52   2e-05   
gb:AL714030_2504395 Zebrafish DNA sequence from clone BUSM1-223C...    52   2e-05   
gb:AL713850_2504385 Zebrafish DNA sequence from clone BUSM1-136D...    52   2e-05   
gb:MMU579852_2122613 Mus musculus mRNA for L-type dihydropyridin...    51   2e-05   
pir|T43262|T43262 calcium channel alpha-1 chain, L-type - Stylop...    51   3e-05   Stylophora pistillata
gb:AY495698_2534966 Danio rerio skeletal muscle L-type calcium c...    50   4e-05   
sp|Q25452|CCAM_MUSDO|CCAM_MUSDO Muscle calcium channel alpha-1 subunit (MDL...    50   4e-05   Musca domestica
sp|Q9JIS7|CCAF_MOUSE|CCAF_MOUSE Voltage-dependent L-type calcium channel al...    50   4e-05   Mus musculus [mouse]
gb:AB013604_1193456 Halocynthia roretzi mRNA for ascidian calciu...    50   5e-05   
pir|T30890|T30890 calcium channel alpha1-chain - sea squirt (Hal...    50   5e-05   Halocynthia roretzi
gb:AX880433_1478276 Sequence 15338 from Patent EP1074617.              50   7e-05   
gb:DROCA1_1381791 Drosophila melanogaster calcium channel alpha-...    50   7e-05   
gb:AE014134_1129355 Drosophila melanogaster chromosome 2L, compl...    50   7e-05   
gb:AE014134_1129353 Drosophila melanogaster chromosome 2L, compl...    50   7e-05   
gb:AE014134_1129352 Drosophila melanogaster chromosome 2L, compl...    50   7e-05   
sp|P22316|CCAS_CYPCA|CCAS_CYPCA Dihydropyridine-sensitive L-type, skeletal ...    50   7e-05   Cyprinus carpio [carp]
sp|Q24270|CCAD_DROME|CCAD_DROME Voltage-dependent calcium channel type D al...    50   7e-05   Drosophila melanogaster
sp|O73700|CCAD_CHICK|CCAD_CHICK Voltage-dependent L-type calcium channel al...    49   9e-05   Gallus gallus [bantam]
gb:RATRCACN4B_2133682 Rat rCACN4B mRNA for L-type voltage-depend...    49   1e-04   
gb:MMU437292_2121468 Mus musculus mRNA for L-type voltage-gated ...    49   1e-04   
gb:MMU437291_2121467 Mus musculus mRNA for L-type voltage-gated ...    49   1e-04   
gb:MAU311617_2113373 Mesocricetus auratus mRNA for neuroendocrin...    49   1e-04   
gb:BC058783_2103488 Mus musculus cDNA clone MGC:65542 IMAGE:6310...    49   1e-04   
gb:AF370009_2064309 Rattus norvegicus voltage-gated calcium chan...    49   1e-04   
gb:AB086123_2047791 Mus musculus mRNA for calcium channel alpha ...    49   1e-04   
gb:D43705S43_1994657 Homo sapiens CACN4 gene for voltage-depende...    49   1e-04   
gb:AX546814_1470187 Sequence 15 from Patent WO02063000.                49   1e-04   
gb:AX546802_1470180 Sequence 3 from Patent WO02063000.                 49   1e-04   
gb:D31718_1376121 Blattella germanica mRNA for voltage-dependent...    49   1e-04   
pir|JH0422|JH0422 voltage-dependent calcium channel complex alph...    49   1e-04   Rattus norvegicus [brown rat]
pir|A38198|A38198 calcium channel alpha-1 chain, pancreatic - hu...    49   1e-04   Homo sapiens [man]
pir|JH0564|JH0564 calcium channel alpha-1D chain - human               49   1e-04   Homo sapiens [man]
sp|P27732|CCAD_RAT|CCAD_RAT Voltage-dependent L-type calcium channel alph...    49   1e-04   Rattus norvegicus [brown rat]
sp|Q99244|CCAD_MESAU|CCAD_MESAU Voltage-dependent L-type calcium channel al...    49   1e-04   Mesocricetus auratus [Syrian golden hamster]
sp|Q01668|CCAD_HUMAN|CCAD_HUMAN Voltage-dependent L-type calcium channel al...    49   1e-04   Homo sapiens [man]
gb:HSU93305_2027608 Homo sapiens A4 differentiation-dependent pr...    49   1e-04   
gb:AF201304_1889785 Homo sapiens voltage-gated L-type calcium ch...    49   1e-04   
gb:AF067227_1880527 Homo sapiens voltage-gated L-type calcium ch...    49   1e-04   
sp|O60840|CCAF_HUMAN|CCAF_HUMAN Voltage-dependent L-type calcium channel al...    49   1e-04   Homo sapiens [man]
gb:AF365975_2064220 Rattus norvegicus alpha 1F calcium channel s...    48   2e-04   
gb:RATRBCII_2133667 Rat brain calcium channel alpha-1 subunit (r...    48   3e-04   
gb:AF227748_1891556 Homo sapiens voltage-dependent calcium chann...    48   3e-04   
gb:AF227747_1891555 Homo sapiens voltage-dependent calcium chann...    48   3e-04   
gb:AF227746_1891554 Homo sapiens voltage-dependent calcium chann...    48   3e-04   
gb:AF134985_1885667 Homo sapiens T calcium channel alpha1G subun...    48   3e-04   
gb:AF126966_1885183 Homo sapiens voltage-dependent calcium chann...    48   3e-04   
gb:AF126965_1885182 Homo sapiens voltage-dependent calcium chann...    48   3e-04   
gb:AF124351_1885006 Homo sapiens T-type calcium channel alpha 1G...    48   3e-04   
gb:BC057399_2102751 Mus musculus calcium channel, voltage-depend...    47   3e-04   
gb:AL645965_2072054 Mouse DNA sequence from clone RP23-65I14 on ...    47   3e-04   
gb:AL645965_2072053 Mouse DNA sequence from clone RP23-65I14 on ...    47   3e-04   
gb:AL645965_2072052 Mouse DNA sequence from clone RP23-65I14 on ...    47   3e-04   
gb:AL645965_2072051 Mouse DNA sequence from clone RP23-65I14 on ...    47   3e-04   
gb:AL645965_2072050 Mouse DNA sequence from clone RP23-65I14 on ...    47   3e-04   
sp|O54898|CCAG_RAT|CCAG_RAT Voltage-dependent T-type calcium channel alph...    47   3e-04   Rattus norvegicus [brown rat]
sp|Q15878|CCAE_HUMAN|CCAE_HUMAN Voltage-dependent R-type calcium channel al...    47   3e-04   Homo sapiens [man]
gb:AB016287_2043895 Cavia porcellus mRNA for L-type calcium chan...    47   4e-04   
gb:AL160059_1921716 Human DNA sequence from clone RP11-94G15 on ...    47   4e-04   
gb:AF239258S3_1892431 Homo sapiens calcium channel alpha1E subun...    47   4e-04   
gb:AF199511_1415930 Oryctolagus cuniculus calcium channel mRNA, ...    47   4e-04   
gb:U37548_1402917 Caenorhabditis elegans cosmid C54D2, complete ...    47   4e-04   
gb:AY322480_1319475 Caenorhabditis elegans T-type voltage sensit...    47   4e-04   
gb:AY313900_1318671 Caenorhabditis elegans T-type calcium channe...    47   4e-04   
gb:AY313899_1318670 Caenorhabditis elegans T-type calcium channe...    47   4e-04   
gb:AF368920_1266270 Caenorhabditis elegans voltage-dependent cal...    47   4e-04   
gb:AF361884_1265570 Schistosoma mansoni high voltage-activated c...    47   4e-04   
gb:AB042806_1195638 Halocynthia roretzi mRNA for sodium channel,...    47   4e-04   
pir|S29237|S29237 calcium channel protein BII-2, brain - rabbit>...    47   4e-04   Oryctolagus cuniculus [domestic rabbit]
pir|B54972|B54972 voltage-dependent calcium channel alpha 1E-1 -...    47   4e-04   Homo sapiens [man]
sp|Q02343|CCAE_RABIT|CCAE_RABIT Voltage-dependent R-type calcium channel al...    47   4e-04   Oryctolagus cuniculus [domestic rabbit]
gb:U17869_2140213 Mus musculus murine erythroleukemia cardiac ca...    47   6e-04   
gb:RATRBCI_2133666 Rat brain calcium channel alpha-1 subunit (rb...    47   6e-04   
gb:AY728090_2088247 Mus musculus neuronal voltage-gated calcium ...    47   6e-04   
gb:AY029412_2074071 Rattus norvegicus calcium channel isoform al...    47   6e-04   
gb:AF394940_2064795 Rattus norvegicus clone 12 L-type calcium ch...    47   6e-04   
gb:AF394939_2064794 Rattus norvegicus clone 5 L-type calcium cha...    47   6e-04   
gb:AF394938_2064793 Rattus norvegicus clone 15 L-type calcium ch...    47   6e-04   
gb:HUMLVDCCB_2034119 Homo sapiens (clone hHT-1) L-type voltage-d...    47   6e-04   
gb:HUMCALCHAA_2029805 Human L-type calcium channel HFCC mRNA, co...    47   6e-04   
gb:HUMCACNL1G_2029779 Homo sapiens calcium channel L-type alpha ...    47   6e-04   
gb:HUMCACNL1E_2029778 Homo sapiens cardiac L-type voltage-depend...    47   6e-04   
gb:HUMCACN_2029777 Homo sapiens (clone HHT-1 variant harboring H...    47   6e-04   
gb:HSZ74996_2028566 H.sapiens mRNA for voltage-dependent L-type ...    47   6e-04   
gb:HSLCC1NE3_2016959 H.sapiens mRNA for L-type calcium channel i...    47   6e-04   
gb:HSLCC1NE1_2016958 H.sapiens mRNA for L-type calcium channel i...    47   6e-04   
gb:HSCACHA9_2011223 H.sapiens (HLCC85) mRNA for voltage-dependen...    47   6e-04   
gb:HSCACHA8_2011222 H.sapiens (HLCC78) mRNA for voltage-dependen...    47   6e-04   
gb:HSCACHA7_2011221 H.sapiens (HLCC77) mRNA for voltage-dependen...    47   6e-04   
gb:HSCACHA6_2011220 H.sapiens (HLCC76) mRNA for voltage-dependen...    47   6e-04   
gb:HSCACHA5_2011219 H.sapiens (HLCC74) mRNA for voltage-dependen...    47   6e-04   
gb:HSCACHA4_2011218 H.sapiens (HLCC73) mRNA for voltage-dependen...    47   6e-04   
gb:HSCACHA3_2011217 H.sapiens (HLCC71) mRNA for voltage-dependen...    47   6e-04   
gb:HSCACHA2_2011216 H.sapiens (HLCC70) mRNA for voltage-dependen...    47   6e-04   
gb:HSCACHA14_2011215 H.sapiens (HLCC90) mRNA for voltage-depende...    47   6e-04   
gb:HSCACHA13_2011214 H.sapiens (HLCC89) mRNA for voltage-depende...    47   6e-04   
gb:HSCACHA12_2011213 H.sapiens (HLCC88) mRNA for voltage-depende...    47   6e-04   
gb:HSCACHA11_2011212 H.sapiens (HLCC87) mRNA for voltage-depende...    47   6e-04   
gb:HSCACHA10_2011211 H.sapiens (HLCC86) mRNA for voltage-depende...    47   6e-04   
gb:HSCACHA1_2011210 H.sapiens (HLCC69) mRNA for voltage-dependen...    47   6e-04   
gb:HSAJ4873_2010375 Homo sapiens (HLCC105) mRNA for voltage-depe...    47   6e-04   
gb:AL160059_1921718 Human DNA sequence from clone RP11-94G15 on ...    47   6e-04   
gb:AL160059_1921717 Human DNA sequence from clone RP11-94G15 on ...    47   6e-04   
gb:AF465484_1903468 Homo sapiens jejunum L-type calcium channel ...    47   6e-04   
gb:AF239258S3_1892430 Homo sapiens calcium channel alpha1E subun...    47   6e-04   
gb:AF252384_1416856 Bos taurus calcium channel subunit alpha 1D ...    47   6e-04   
pir|JH0427|JH0427 voltage-dependent calcium channel complex alph...    47   6e-04   Rattus norvegicus [brown rat]
pir|S11339|S11339 calcium channel protein - rabbit>gb:OCCACBRE_1...    47   6e-04   Oryctolagus cuniculus [domestic rabbit]
pir|A54972|A54972 voltage-dependent calcium channel alpha 1E-3 -...    47   6e-04   Homo sapiens [man]
pir|A45290|A45290 calcium channel protein type L - human               47   6e-04   Homo sapiens [man]
sp|Q07652|CCAE_RAT|CCAE_RAT Voltage-dependent R-type calcium channel alph...    47   6e-04   Rattus norvegicus [brown rat]
sp|Q61290|CCAE_MOUSE|CCAE_MOUSE Voltage-dependent R-type calcium channel al...    47   6e-04   Mus musculus [mouse]
sp|P22002|CCAC_RAT|CCAC_RAT Voltage-dependent L-type calcium channel alph...    47   6e-04   Rattus norvegicus [brown rat]
sp|P15381|CCAC_RABIT|CCAC_RABIT Voltage-dependent L-type calcium channel al...    47   6e-04   Oryctolagus cuniculus [domestic rabbit]
sp|Q01815|CCAC_MOUSE|CCAC_MOUSE Voltage-dependent L-type calcium channel al...    47   6e-04   Mus musculus [mouse]
sp|Q13936|CCAC_HUMAN|CCAC_HUMAN Voltage-dependent L-type calcium channel al...    47   6e-04   Homo sapiens [man]
gb:BX248410_2567111 Zebrafish DNA sequence from clone DKEY-65M5 ...    46   7e-04   
gb:AF305689_2486449 Danio rerio voltage-gated L-type calcium cha...    46   7e-04   
gb:HS172B20_1997286 Human DNA sequence from clone RP1-172B20 on ...    46   7e-04   
gb:AF393329_1900570 Homo sapiens voltage-dependent calcium chann...    46   7e-04   
gb:AF211189_1890180 Homo sapiens T-type calcium channel alpha1 s...    46   7e-04   
gb:AF129133_1885313 Homo sapiens T-type calcium channel alpha1I ...    46   7e-04   
sp|Q9P0X4|CCAI_HUMAN|CCAI_HUMAN Voltage-dependent T-type calcium channel al...    46   7e-04   Homo sapiens [man]
gb:MMU012569_2117922 Mus musculus mRNA for voltage-gated calcium...    46   0.001   
gb:AL645965_2072059 Mouse DNA sequence from clone RP23-65I14 on ...    46   0.001   
gb:AL645965_2072058 Mouse DNA sequence from clone RP23-65I14 on ...    46   0.001   
gb:AL645965_2072057 Mouse DNA sequence from clone RP23-65I14 on ...    46   0.001   
gb:AL645965_2072056 Mouse DNA sequence from clone RP23-65I14 on ...    46   0.001   
gb:AL645965_2072055 Mouse DNA sequence from clone RP23-65I14 on ...    46   0.001   
gb:AF290214_2061702 Rattus norvegicus calcium channel alpha-1-I ...    46   0.001   
gb:AF125161_2055455 Rattus norvegicus T-type calcium channel iso...    46   0.001   
gb:AF227751_1891559 Homo sapiens voltage-dependent calcium chann...    46   0.001   
gb:AF227750_1891558 Homo sapiens voltage-dependent calcium chann...    46   0.001   
gb:AF227749_1891557 Homo sapiens voltage-dependent calcium chann...    46   0.001   
gb:AF227745_1891553 Homo sapiens voltage-dependent calcium chann...    46   0.001   
gb:AF227744_1891552 Homo sapiens voltage-dependent calcium chann...    46   0.001   
gb:AB032949_1866130 Homo sapiens mRNA for KIAA1123 protein, part...    46   0.001   
gb:AB012043_1864376 Homo sapiens mRNA for NBR13, complete cds.         46   0.001   
gb:AF361885_1265571 Schistosoma mansoni high voltage-activated c...    46   0.001   
sp|Q9Z0Y8|CCAI_RAT|CCAI_RAT Voltage-dependent T-type calcium channel alph...    46   0.001   Rattus norvegicus [brown rat]
sp|O43497|CCAG_HUMAN|CCAG_HUMAN Voltage-dependent T-type calcium channel al...    46   0.001   Homo sapiens [man]
sp|P56699|CCAE_DISOM|CCAE_DISOM Probable voltage-dependent R-type calcium c...    46   0.001   
gb:AY172332_1426468 Canis familiaris T-type calcium channel alph...    45   0.001   
pir|S05011|S05011 calcium channel alpha-1 chain, dihydropyridine...    45   0.001   Oryctolagus cuniculus [domestic rabbit]
gb:RNU31816_2137125 Rattus norvegicus calcium channel alpha-1S s...    45   0.002   
gb:HSA420779_2006800 Homo sapiens mRNA for calcium channel, volt...    45   0.002   
gb:AH009202S4_1906681 Homo sapiens low-voltage-activated calcium...    45   0.002   
gb:AF073931_1880955 Homo sapiens low-voltage activated calcium c...    45   0.002   
gb:AF051946_1879195 Homo sapiens T-type calcium channel alpha 1H...    45   0.002   
gb:AE006466_1875651 Homo sapiens 16p13.3 sequence section 5 of 8.      45   0.002   
sp|O95180|CCAH_HUMAN|CCAH_HUMAN Voltage-dependent T-type calcium channel al...    45   0.002   Homo sapiens [man]
gb:BX548009_2567645 Zebrafish DNA sequence from clone CH211-237K...    45   0.002   
gb:BX548009_2567644 Zebrafish DNA sequence from clone CH211-237K...    45   0.002   
gb:AL831748_2504562 Zebrafish DNA sequence from clone DKEY-70P6 ...    45   0.002   
gb:AF051526_2052504 Rattus norvegicus class A calcium channel va...    45   0.002   
pir|T15838|T15838 hypothetical protein C54D2.5 - Caenorhabditis ...    45   0.002   Caenorhabditis elegans [roundworm]
sp|P54282|CCAA_RAT|CCAA_RAT Voltage-dependent P/Q-type calcium channel al...    45   0.002   Rattus norvegicus [brown rat]
gb:AK122452_2069117 Mus musculus mRNA for mKIAA1120 protein.           44   0.003   
gb:AF055477_2052652 Rattus norvegicus pore-forming calcium chann...    44   0.003   
gb:AB031389_2044747 Mus musculus mRNA for voltage-gated sodium c...    44   0.003   
gb:AF244126_1416673 Bos taurus calcium channel subunit alpha 1E ...    44   0.003   
gb:U61951_1405503 Caenorhabditis elegans cosmid C48A7, complete ...    44   0.003   
gb:D86600_1376364 Loligo bleekeri mRNA for voltage-dependent cal...    44   0.003   
gb:AF484084_1275758 Lymnaea stagnalis voltage-dependent T-type c...    44   0.003   
pir|A45386|A45386 omega-conotoxin-sensitive calcium channel alph...    44   0.003   Rattus norvegicus [brown rat]
pir|C88728|C88728 protein C48A7.1 [imported] - Caenorhabditis el...    44   0.003   Caenorhabditis elegans [roundworm]
pir|T37258|T37258 probable voltage-dependent calcium channel com...    44   0.003   Caenorhabditis elegans [roundworm]
sp|Q9EQ60|CCAH_RAT|CCAH_RAT Voltage-dependent T-type calcium channel alph...    44   0.003   Rattus norvegicus [brown rat]
sp|O88427|CCAH_MOUSE|CCAH_MOUSE Voltage-dependent T-type calcium channel al...    44   0.003   Mus musculus [mouse]
sp|Q02294|CCAB_RAT|CCAB_RAT Voltage-dependent N-type calcium channel alph...    44   0.003   Rattus norvegicus [brown rat]
gb:AF361883_1265569 Schistosoma mansoni high voltage-activated c...    44   0.004   
pir|JC5280|JC5280 voltage-dependent calcium channel alpha 1 chai...    44   0.004   
gb:AF422930S1_2065458 Rattus norvegicus voltage-gated calcium ch...    44   0.005   
gb:AF118044_2055114 Mus musculus voltage-gated sodium channel Na...    44   0.005   
gb:AX546806_1470183 Sequence 7 from Patent WO02063000.                 44   0.005   
gb:AK129294_2069525 Mus musculus mRNA for mKIAA1123 protein.           43   0.006   
gb:AB066609_2047131 Mus musculus Cacna1a mRNA for CaV2.1, comple...    43   0.006   
gb:AB066608_2047130 Mus musculus Cacna1a mRNA for CaV2.1, comple...    43   0.006   
gb:HSU79666_2026277 Homo sapiens alpha1A-voltage-dependent calci...    43   0.006   
gb:HSPQCCA1_2019694 H.sapiens mRNA for P/Q-type calcium channel ...    43   0.006   
gb:AF004884_1875919 Homo sapiens neuronal calcium channel alpha ...    43   0.006   
gb:AF004883_1875918 Homo sapiens neuronal calcium channel alpha ...    43   0.006   
gb:AB035727_1866406 Homo sapiens CACNA1A mRNA for alpha1A-voltag...    43   0.006   
gb:OCCCBI1CB_1442131 Rabbit mRNA for calcium channel BI-1 (lambd...    43   0.006   
gb:AE014298_1125337 Drosophila melanogaster chromosome X, comple...    43   0.006   
gb:AE014298_1125336 Drosophila melanogaster chromosome X, comple...    43   0.006   
gb:AE014298_1125335 Drosophila melanogaster chromosome X, comple...    43   0.006   
gb:AE014298_1125334 Drosophila melanogaster chromosome X, comple...    43   0.006   
gb:AE014298_1125332 Drosophila melanogaster chromosome X, comple...    43   0.006   
pir|I46477|I46477 calcium channel BI-1 - rabbit>gb:OCCCBI1_14421...    43   0.006   Oryctolagus cuniculus [domestic rabbit]
pir|I46480|I46480 calcium channel BI-2 - rabbit>gb:OCCCBI2CB_144...    43   0.006   Oryctolagus cuniculus [domestic rabbit]
pir|T13980|T13980 calcium channel alpha-1 chain - fruit fly (Dro...    43   0.006   Drosophila melanogaster
sp|P27884|CCAA_RABIT|CCAA_RABIT Voltage-dependent P/Q-type calcium channel ...    43   0.006   Oryctolagus cuniculus [domestic rabbit]
sp|P97445|CCAA_MOUSE|CCAA_MOUSE Voltage-dependent P/Q-type calcium channel ...    43   0.006   Mus musculus [mouse]
sp|O00555|CCAA_HUMAN|CCAA_HUMAN Voltage-dependent P/Q-type calcium channel ...    43   0.006   Homo sapiens [man]
sp|P91645|CCAA_DROME|CCAA_DROME Voltage-dependent calcium channel type A al...    43   0.006   Drosophila melanogaster
gb:AF173019_2478479 Gallus gallus N-type calcium channel alpha-1...    43   0.008   
gb:AF173018_2478478 Gallus gallus N-type calcium channel alpha-1...    43   0.008   
gb:AF173017_2478477 Gallus gallus N-type calcium channel alpha-1...    43   0.008   
gb:AF173016_2478476 Gallus gallus N-type calcium channel alpha-1...    43   0.008   
gb:AF173015_2478475 Gallus gallus N-type calcium channel alpha-1...    43   0.008   
gb:AF173014_2478474 Gallus gallus N-type calcium channel alpha-1...    43   0.008   
gb:AF173013_2478473 Gallus gallus N-type calcium channel alpha-1...    43   0.008   
gb:AF173012_2478472 Gallus gallus N-type calcium channel alpha-1...    43   0.008   
gb:AX017217_1456549 Sequence 1 from Patent WO9947670.                  43   0.008   
gb:AF098944_1240865 Stylophora pistillata P-type calcium channel...    43   0.008   
pir|T42388|T42388 sodium channel alpha chain - rat>gb:AF059030_2...    43   0.008   Rattus norvegicus [brown rat]
gb:AE014298_1124488 Drosophila melanogaster chromosome X, comple...    42   0.011   
gb:AY392138_615861 Hyphomonas neptunium putative voltage-gated c...    42   0.011   
pir|T31092|T31092 probable voltage-gated sodium channel - Aiptas...    42   0.011   
gb:AB035726_1866405 Homo sapiens CACNA1A mRNA for alpha1A-voltag...    42   0.014   
gb:AF484083_1275757 Lymnaea stagnalis voltage-dependent non-L-ty...    42   0.014   
gb:AF484082_1275756 Lymnaea stagnalis voltage-dependent non-L-ty...    42   0.014   
gb:AE017340_457198 Idiomarina loihiensis L2TR, complete genome.        42   0.014   
sp|O73707|CCAC_CHICK|CCAC_CHICK Voltage-dependent L-type calcium channel al...    42   0.014   Gallus gallus [bantam]
sp|P56698|CCAB_DISOM|CCAB_DISOM Probable voltage-dependent N-type calcium c...    42   0.014   
gb:AL591424_1930068 Human DNA sequence from clone RP11-424E7 on ...    42   0.018   
gb:AL591424_1930066 Human DNA sequence from clone RP11-424E7 on ...    42   0.018   
gb:AL591424_1930065 Human DNA sequence from clone RP11-424E7 on ...    42   0.018   
gb:AF173882_1415511 Bos taurus N-type calcium channel alpha1B su...    42   0.018   
gb:AF391290_1267438 Branchiostoma floridae cosmid MPMGc117C0475,...    42   0.018   
pir|T45115|T45115 N-type calcium channel alpha-1 chain, omega-co...    42   0.018   Homo sapiens [man]
pir|A42566|A42566 omega-conotoxin-sensitive N-type calcium chann...    42   0.018   Homo sapiens [man]
sp|O55017|CCAB_MOUSE|CCAB_MOUSE Voltage-dependent N-type calcium channel al...    42   0.018   Mus musculus [mouse]
sp|Q00975|CCAB_HUMAN|CCAB_HUMAN Voltage-dependent N-type calcium channel al...    42   0.018   Homo sapiens [man]
gb:MUSCACHB_2125356 Mus musculus dihydropyridine sensitive skele...    41   0.024   
gb:MMU04999_2118039 Mus musculus N-type calcium channel alpha1 s...    41   0.024   
gb:U55374_1405104 Caenorhabditis elegans cosmid T02C5, complete ...    41   0.024   
gb:U55374_1405102 Caenorhabditis elegans cosmid T02C5, complete ...    41   0.024   
gb:CEU25119_1368470 Caenorhabditis elegans calcium channel alpha...    41   0.024   
gb:AY264781_1314119 Caenorhabditis elegans high voltage activate...    41   0.024   
pir|T16779|T16779 hypothetical protein unc-2 - Caenorhabditis el...    41   0.024   Caenorhabditis elegans [roundworm]
pir|S58883|S58883 calcium-channel homolog - Caenorhabditis elega...    41   0.024   Caenorhabditis elegans [roundworm]
pir|S41080|S41080 calcium channel alpha-1 chain - mouse                41   0.024   Mus musculus [mouse]
sp|Q05152|CCAB_RABIT|CCAB_RABIT Voltage-dependent N-type calcium channel al...    41   0.024   Oryctolagus cuniculus [domestic rabbit]
gb:AY319304_2526676 Oncorhynchus mykiss neuronal-type voltage-ga...    41   0.031   
gb:AF461708_2495993 Oncorhynchus mykiss voltage-gated calcium ch...    41   0.031   
gb:AF461707_2495992 Oncorhynchus mykiss voltage-gated calcium ch...    41   0.031   
gb:HSA417790_2006760 Homo sapiens mRNA for voltage-gated sodium ...    41   0.031   
gb:AF188679_1888721 Homo sapiens voltage-gated sodium channel ty...    41   0.031   
gb:AF109737_1884203 Homo sapiens voltage-gated sodium channel al...    41   0.031   
pir|T31340|T31340 voltage-gated sodium channel homolog - Bdellou...    41   0.031   
gb:HSU79668_2026279 Human alpha1A-voltage-dependent calcium chan...    40   0.041   
gb:HSU79667_2026278 Human alpha1A-voltage-dependent calcium chan...    40   0.041   
gb:HSU79665_2026276 Human alpha1A-voltage-sensitive calcium chan...    40   0.041   
gb:HSU79664_2026275 Human alpha1A-voltage-dependent calcium chan...    40   0.041   
gb:HSU79663_2026274 Human alpha1A-voltage-dependent calcium chan...    40   0.041   
gb:AF100774_1883054 Homo sapiens voltage-dependent P/Q type calc...    40   0.041   
gb:CYYNACHANN_1376090 Cyanea capillata sodium channel (putative)...    40   0.041   
pir|A48298|A48298 sodium channel homolog - jellyfish (Cyanea cap...    40   0.041   
pir|JE0084|JE0084 voltage-gated sodium channel alpha subunit - h...    40   0.041   
gb:AF411819_1901534 Homo sapiens putative ion channel protein CA...    40   0.053   
gb:AF411818_1901533 Homo sapiens putative ion channel protein CA...    40   0.053   
gb:AF411817_1901532 Homo sapiens putative ion channel protein CA...    40   0.053   
gb:AX546805_1470182 Sequence 6 from Patent WO02063000.                 40   0.053   
gb:AB032946_1866127 Homo sapiens mRNA for KIAA1120 protein, part...    40   0.069   
gb:RNU49126_2137370 Rattus norvegicus neuroendocrine calcium cha...    39   0.091   
gb:U37548_1402918 Caenorhabditis elegans cosmid C54D2, complete ...    39   0.12    
gb:DMSCHSD_1380141 Drosophila put. sodium channel gene part 5 (A...    39   0.12    
pir|S04029|A60165 sodium channel protein - fruit fly (Drosophila...    39   0.12    
gb:AF297658_2485788 Danio rerio sodium channel protein Scn8a (sc...    39   0.15    
gb:RATCCASA_2131737 Rattus norvegicus pore-forming calcium chann...    39   0.15    
gb:AY178183_1426794 Canis familiaris L-type Ca channel alpha 1 s...    39   0.15    
gb:AJ621050_1422658 Bos taurus partial mRNA for L-type voltage-g...    39   0.15    
gb:AY259834_1313704 Varroa destructor sodium channel protein mRN...    39   0.15    
gb:AY144351_1303438 Varroa destructor sodium channel mRNA, parti...    39   0.15    
gb:AF484086_1275760 Lymnaea stagnalis U-type voltage-gated catio...    39   0.15    
pir|S05006|S05006 calcium channel alpha-1 chain, dihydropyridine...    39   0.15    
gb:AY160083_1305287 Drosophila melanogaster alpha1U protein (na)...    38   0.20    
gb:AE014298_1125626 Drosophila melanogaster chromosome X, comple...    38   0.20    
gb:AE014298_1125625 Drosophila melanogaster chromosome X, comple...    38   0.20    
gb:RATCCAS_2131736 Rattus norvegicus pore-forming calcium channe...    38   0.26    
pir|A46422|A46422 calcium channel alpha-1 subunit - rat (fragment)     38   0.26    
sp|O73706|CCAB_CHICK|CCAB_CHICK Voltage-dependent N-type calcium channel al...    38   0.26    
gb:AF378143_2490318 Sternopygus macrurus sodium channel 5 mRNA, ...    37   0.34    
gb:D31719_1376122 Blattella germanica mRNA for voltage-dependent...    37   0.34    
gb:AK044695_1167083 Mus musculus adult retina cDNA, RIKEN full-l...    37   0.34    
pir|T30902|T30902 sodium channel SCAP1 alpha chain - California ...    37   0.34    
sp|Q05973|CIN1_LOLBL|CIN1_LOLBL Sodium channel protein I, brain.>pir|JC1101...    37   0.34    
gb:FRBSCAS2_2572015 Takifugu rubripes mRNA for sodium channel al...    37   0.45    
gb:RNU49128_2137372 Rattus norvegicus neuroendocrine calcium cha...    37   0.45    
gb:RNU49127_2137371 Rattus norvegicus neuroendocrine calcium cha...    37   0.45    
gb:AF252381_1416853 Bos taurus clone 1 calcium channel subunit a...    37   0.45    
gb:DMDIC60_1378636 D.melanogaster DIC60 gene.                          37   0.45    
gb:AE013599_1133879 Drosophila melanogaster chromosome 2R, compl...    37   0.45    
gb:AE013599_1133878 Drosophila melanogaster chromosome 2R, compl...    37   0.45    
gb:AE017333_446669 Bacillus licheniformis DSM 13, complete genom...    37   0.45    
gb:RNY17153_2138069 Rattus norvegicus mRNA for skeletal muscle t...    37   0.59    
gb:U40419_1403339 Caenorhabditis elegans cosmid C27F2, complete ...    37   0.59    
gb:AY555272_1335225 Caenorhabditis elegans four domain-type volt...    37   0.59    
gb:AY392141_615864 Colwellia psychrerythraea strain 34H putative...    37   0.59    
sp|P15390|CIN4_RAT|CIN4_RAT Sodium channel protein type IV alpha subunit ...    37   0.59    
gb:AB030482_2461358 Fugu pardalis mRNA for voltage-gated sodium ...    36   0.77    
gb:MMU278787_2120169 Mus musculus mRNA for voltage-gated sodium ...    36   0.77    
gb:CFA555547_1438568 Canis familiaris mRNA for voltage-gated sod...    36   0.77    
gb:BTA251721_1436549 Bos taurus mRNA for voltage-gated sodium ch...    36   0.77    
gb:AF301594_1260291 Triatoma dimidiata mitochondrial DNA, comple...    36   0.77    
sp|O73705|CCAA_CHICK|CCAA_CHICK Voltage-dependent P/Q-type calcium channel ...    36   0.77    
gb:AY148488_1937144 Homo sapiens cardiac sodium channel alpha su...    36   1.0     
gb:AY038064_1934808 Homo sapiens voltage-gated sodium channel ty...    36   1.0     
gb:AF482988_1904679 Homo sapiens cardiac sodium channel alpha su...    36   1.0     
gb:AF150882_1886244 Homo sapiens voltage-gated sodium channel al...    36   1.0     
gb:AB158470_1874081 Homo sapiens Nav1.5 mRNA for TTX-resistant s...    36   1.0     
gb:AB158469_1874080 Homo sapiens Nav1.5 mRNA for TTX-resistant s...    36   1.0     
gb:AX449278_1468720 Sequence 3 from Patent WO0208381.                  36   1.0     
gb:AF312365_1261470 Blattella germanica putative BSC1 sodium cha...    36   1.0     
pir|S12955|S12955 calcium channel protein type L - rabbit              36   1.0     
sp|Q14524|CIN5_HUMAN|CIN5_HUMAN Sodium channel protein type V alpha subunit...    36   1.0     
gb:RNU31815_2137124 Rattus norvegicus calcium channel alpha-1C s...    35   1.3     
gb:MMU271477_2119981 Mus musculus mRNA for voltage-gated sodium ...    35   1.3     
gb:MMU26707_2119901 Mus musculus voltage-gated sodium channel al...    35   1.3     
gb:AF353637_2063974 Rattus norvegicus sodium channel Nav1.5a mRN...    35   1.3     
gb:CQ891319_1454994 Sequence 5 from Patent WO2004087956.               35   1.3     
gb:CQ891317_1454993 Sequence 3 from Patent WO2004087956.>gb:AX71...    35   1.3     
gb:CNS07EGD_1373570 chromosome VI of strain GB-M1 of Encephalito...    35   1.3     
gb:AY324425_1319651 Hirudo medicinalis voltage-gated sodium chan...    35   1.3     
gb:AY392140_615863 Colwellia psychrerythraea strain 34H putative...    35   1.3     
pir|T43167|T43167 sodium channel protein - California market squ...    35   1.3     
sp|P15389|CIN5_RAT|CIN5_RAT Sodium channel protein type V alpha subunit (...    35   1.3     
gb:AF123593_2475154 Cynops pyrrhogaster voltage-dependent sodium...    35   1.7     
gb:AF049240_2052445 Rattus norvegicus voltage-gated sodium chann...    35   1.7     
gb:AF049239_2052444 Rattus norvegicus voltage-gated sodium chann...    35   1.7     
gb:HSSCN8A26_2020284 Homo sapiens voltage-gated sodium channel a...    35   1.7     
gb:AY268438_1941509 Macaca fascicularis voltage-gated T-type cal...    35   1.7     
gb:AF225988_1891447 Homo sapiens voltage-gated sodium channel al...    35   1.7     
pir|I56555|I56555 sodium channel protein 6 - rat>gb:RATSCP6A_213...    35   1.7     
sp|Q9WTU3|CIN8_MOUSE|CIN8_MOUSE Sodium channel protein type VIII alpha subu...    35   1.7     
sp|Q9UQD0|CIN8_HUMAN|CIN8_HUMAN Sodium channel protein type VIII alpha subu...    35   1.7     
gb:AY555273_2086521 Rattus norvegicus four domain-type voltage-g...    35   2.2     
gb:AY538273_2086385 Mus musculus tetrodotoxin resistant sodium c...    35   2.2     
gb:AF411816_2065259 Mus musculus putative ion channel protein CA...    35   2.2     
gb:AB037528_1866489 Pongo pygmaeus SCN8A gene for voltage-gated ...    35   2.2     
gb:AB037525_1866486 Homo sapiens SCN8A gene for voltage-gated so...    35   2.2     
gb:AX504843_1469686 Sequence 4 from Patent WO0246404.>gb:AL13870...    35   2.2     
gb:AX319778_1465703 Sequence 1 from Patent WO0183752.>gb:AX31978...    35   2.2     
gb:CFU60590_1438794 Canis familiaris TTX-resistant sodium channe...    35   2.2     
gb:DMSCHSC1_1380139 Drosophila put. sodium channel gene part 3 (...    35   2.2     
gb:AK044431_1166961 Mus musculus adult retina cDNA, RIKEN full-l...    35   2.2     
gb:AE016861_351143 Pseudomonas syringae pv. tomato str. DC3000 s...    35   2.2     
pir|T17101|T17101 probable voltage-activated cation channel - ra...    35   2.2     
pir|A46269|A46269 sodium channel alpha chain HBA - human               35   2.2     
gb:RATNACH_2133064 Rat Na+ channel mRNA, 3' end.                       34   2.9     
gb:MUSSC21R_2129962 Mus musculus sodium channel 21 mRNA, complet...    34   2.9     
gb:BC079422_2107533 Rattus norvegicus cation channel, sperm asso...    34   2.9     
gb:F330116S20_1995717 Homo sapiens voltage-gated sodium channel ...    34   2.9     
gb:F330116S20_1995716 Homo sapiens voltage-gated sodium channel ...    34   2.9     
gb:AF225987_1891446 Homo sapiens voltage-gated sodium channel al...    34   2.9     
gb:AF225986_1891445 Homo sapiens voltage-gated sodium channel al...    34   2.9     
gb:AF049618_1879085 Homo sapiens voltage-gated sodium channel al...    34   2.9     
gb:AF035686_1877966 Homo sapiens voltage-gated sodium channel, s...    34   2.9     
gb:AF035685_1877965 Homo sapiens voltage-gated sodium channel, s...    34   2.9     
gb:AE017344_1756289 Cryptococcus neoformans var. neoformans JEC2...    34   2.9     
gb:AJ621048_1422656 Bos taurus partial mRNA for L-type voltage-g...    34   2.9     
pir|A45752|A45752 sodium channel protein pCSC-1 - rat (fragment)       34   2.9     
sp|Q9NY46|CIN3_HUMAN|CIN3_HUMAN Sodium channel protein type III alpha subun...    34   2.9     
gb:AY121368_2513741 Xenopus laevis voltage-gated sodium channel ...    34   3.8     
gb:AB098335_1872467 Homo sapiens SCN1A mRNA for Voltage-gated so...    34   3.8     
gb:AB093549_1872189 Homo sapiens SCN1A mRNA for Voltage-gated so...    34   3.8     
gb:AB093548_1872188 Homo sapiens SCN1A mRNA for voltage-gated so...    34   3.8     
sp|P35498|CIN1_HUMAN|CIN1_HUMAN Sodium channel protein type I alpha subunit...    34   3.8     
gb:AF378144_2490319 Sternopygus macrurus sodium channel 6 mRNA, ...    33   5.0     
gb:CR382125_1657936 Kluyveromyces lactis strain NRRL Y-1140 chro...    33   5.0     
gb:OCU35238_1442598 Oryctolagus cuniculus sodium channel alpha-s...    33   5.0     
pir|A60054|A60054 sodium channel protein IIIb, long form - rat         33   5.0     
pir|S54771|S54771 sodium channel alpha subunit - human>gb:HSVASC...    33   5.0     
sp|P08104|CIN3_RAT|CIN3_RAT Sodium channel protein type III alpha subunit...    33   5.0     
gb:RNU53833_2137443 Rattus norvegicus sodium channel PN3 gene, c...    33   6.5     
gb:MMSNS_2117391 M.musculus mRNA for SNS-TTXi sodium channel.          33   6.5     
gb:AF393474_1795390 Aspergillus nidulans calcium channel (cch1) ...    33   6.5     
gb:CQ891331_1454997 Sequence 17 from Patent WO2004087956.              33   6.5     
gb:A58859_1449873 Sequence 7 from Patent WO9701577.                    33   6.5     
gb:A58857_1449872 Sequence 5 from Patent WO9701577.                    33   6.5     
gb:A58853_1449870 Sequence 1 from Patent WO9701577.                    33   6.5     
pir|S68453|S68453 sodium channel protein SNS - rat>gb:CQ891315_1...    33   6.5     
pir|T43161|T43161 sodium channel protein TuNaI - sea squirt (Hal...    33   6.5     
sp|P02719|CINA_ELEEL|CINA_ELEEL Sodium channel protein (Na(+) channel).>pir...    33   6.5     
gb:AY183895_2517424 Sternopygus macrurus sodium channel 7 (Na7) ...    33   8.5     
gb:AF000368_2049975 Rattus norvegicus voltage-gated sodium chann...    33   8.5     
gb:HUMHBAX_2031786 Human voltage-gated sodium channel mRNA, comp...    33   8.5     
gb:F327224S23_1995713 Homo sapiens voltage-gated sodium channel ...    33   8.5     
gb:BC032950_1980740 Homo sapiens cation channel, sperm associate...    33   8.5     
gb:AY212253_1939420 Homo sapiens skeletal muscle voltage-depende...    33   8.5     
gb:AF407333_1901236 Homo sapiens sperm ion channel mRNA, complet...    33   8.5     
gb:AY324424_1319650 Hirudo medicinalis voltage-gated sodium chan...    33   8.5     
gb:AF134216_1243880 Boophilus microplus putative sodium channel ...    33   8.5     
gb:AB084920_1198352 Halocynthia roretzi mRNA for HrTRPV, complet...    33   8.5     
gb:CR926480_1185637 Pongo pygmaeus mRNA; cDNA DKFZp468H2113 (fro...    33   8.5     
gb:BX842643_822612 Mycoplasma mycoides subsp. mycoides SC genomi...    33   8.5     
gb:CP000031_84101 Silicibacter pomeroyi DSS-3, complete genome.>...    33   8.5     
pir|B25019|B25019 sodium channel protein II - rat                      33   8.5     
pir|I51964|I51964 sodium channel alpha chain SCN4A, skeletal mus...    33   8.5     
pir|JS0648|JS0648 sodium channel alpha chain - human                   33   8.5     
pir|I64893|I64893 sodium channel alpha subunit - human>gb:HUMSKM...    33   8.5     
pir|I54323|I54323 sodium channel alpha subunit - human>gb:HUMSCN...    33   8.5     
sp|P23268|OLF2_RAT|OLF2_RAT Olfactory receptor-like protein F12.>pir|D237...    33   8.5     
sp|P35499|CIN4_HUMAN|CIN4_HUMAN Sodium channel protein type IV alpha subuni...    33   8.5     
sp|Q99250|CIN2_HUMAN|CIN2_HUMAN Sodium channel protein type II alpha subuni...    33   8.5     
sp|P04774|CIN1_RAT|CIN1_RAT Sodium channel protein type I alpha subunit (...    33   8.5     


>gb:AB124647_1528079 Nicotiana tabacum NtTPC1B mRNA for two-pore
            calcium channel, complete cds.
          Length = 735

 Score =  291 bits (744), Expect(2) = 7e-81
 Identities = 139/173 (80%), Positives = 153/173 (88%)
 Frame = -2

Query: 777  FLTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYP 598
            FLTLIPSLMPYLGTIFC+LCFYCSLGLQIFGG+VN GNPNL  TDL+ NDYLLFNFNDYP
Sbjct: 561  FLTLIPSLMPYLGTIFCILCFYCSLGLQIFGGIVNTGNPNLAQTDLAGNDYLLFNFNDYP 620

Query: 597  NGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQT 418
            NGMVTLFN+LVMGNWQ+WMQSYKELTGTSW+Y YF+SFY+I+VLWLLNLIVAFVLEAFQ 
Sbjct: 621  NGMVTLFNILVMGNWQVWMQSYKELTGTSWTYAYFVSFYLISVLWLLNLIVAFVLEAFQA 680

Query: 417  EMDMETSAICVDGENKXXXXXXXXRKYGTKTRSQRVDALLHHMLSSELTQCSS 259
            EMD+E SA CVDG++K        R  GTKTRSQRVD LLHHML SELT+CS+
Sbjct: 681  EMDLEASARCVDGDDK-EAKRERRRNVGTKTRSQRVDFLLHHMLRSELTECSN 732



 Score = 37.0 bits (84), Expect = 0.45
 Identities = 17/62 (27%), Positives = 39/62 (62%), Gaps = 4/62 (6%)
 Frame = -2

Query: 585 TLFNLLVM----GNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQT 418
           TL+ + V+     N  +W+ +YK+   + W  ++F+ + ++ V ++ NLI+A V ++F++
Sbjct: 257 TLYQMFVLFTTSNNPDVWIPAYKD---SRWYCLFFVLYVLLGVYFVTNLILAVVYDSFKS 313

Query: 417 EM 412
           E+
Sbjct: 314 EL 315



 Score = 33.1 bits (74), Expect(2) = 7e-81
 Identities = 15/17 (88%), Positives = 15/17 (88%)
 Frame = -1

Query: 826 IRLLMHVRSYRAFVATF 776
           IRLLMHV  YRAFVATF
Sbjct: 545 IRLLMHVERYRAFVATF 561



>gb:AB124646_1528078 Nicotiana tabacum NtTPC1A mRNA for two-pore
            calcium channel, complete cds.
          Length = 735

 Score =  285 bits (730), Expect(2) = 6e-80
 Identities = 135/173 (78%), Positives = 152/173 (87%)
 Frame = -2

Query: 777  FLTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYP 598
            F TLIPSL+PYLGTIFC+LCFYCSLGLQIFGG+VN GNPNL  TDL+ NDYLLFNFNDYP
Sbjct: 561  FFTLIPSLVPYLGTIFCILCFYCSLGLQIFGGIVNTGNPNLAQTDLAGNDYLLFNFNDYP 620

Query: 597  NGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQT 418
            NGMVTLFN+LVMGNWQ+WMQSYKELTGT+W+Y YF+SFY+I+VLWLLNLIVAFVLEAFQ 
Sbjct: 621  NGMVTLFNILVMGNWQVWMQSYKELTGTAWTYAYFVSFYLISVLWLLNLIVAFVLEAFQA 680

Query: 417  EMDMETSAICVDGENKXXXXXXXXRKYGTKTRSQRVDALLHHMLSSELTQCSS 259
            E+D+E SA CVDG++K        R  GTKTRSQRVD LLHHML SELT+CS+
Sbjct: 681  EVDLEASARCVDGDDK-EAKSERRRNVGTKTRSQRVDFLLHHMLRSELTECSN 732



 Score = 37.0 bits (84), Expect = 0.45
 Identities = 17/62 (27%), Positives = 39/62 (62%), Gaps = 4/62 (6%)
 Frame = -2

Query: 585 TLFNLLVM----GNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQT 418
           TL+ + V+     N  +W+ +YK+   + W  ++F+ + ++ V ++ NLI+A V ++F++
Sbjct: 257 TLYQMFVLFTTSNNPDVWIPAYKD---SRWYCLFFVLYVLLGVYFVTNLILAVVYDSFKS 313

Query: 417 EM 412
           E+
Sbjct: 314 EL 315



 Score = 35.4 bits (80), Expect(2) = 6e-80
 Identities = 16/18 (88%), Positives = 16/18 (88%)
 Frame = -1

Query: 826 IRLLMHVRSYRAFVATFF 773
           IRLLMHV  YRAFVATFF
Sbjct: 545 IRLLMHVERYRAFVATFF 562



>gb:AF360372_1791301 Arabidopsis thaliana putative calcium channel
            mRNA, complete cds.
          Length = 733

 Score =  244 bits (624), Expect(2) = 3e-66
 Identities = 117/175 (66%), Positives = 142/175 (81%), Gaps = 2/175 (1%)
 Frame = -2

Query: 777  FLTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYP 598
            F+TLIPSLMPYLGTIFCVLC YCS+G+Q+FGG+VNAGN  L  T+L+++DYLLFNFNDYP
Sbjct: 558  FITLIPSLMPYLGTIFCVLCIYCSIGVQVFGGLVNAGNKKLFETELAEDDYLLFNFNDYP 617

Query: 597  NGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQT 418
            NGMVTLFNLLVMGNWQ+WM+SYK+LTGT WS  YF+SFYVIT+L LLNL+VAFVLEAF T
Sbjct: 618  NGMVTLFNLLVMGNWQVWMESYKDLTGTWWSITYFVSFYVITILLLLNLVVAFVLEAFFT 677

Query: 417  EMDMETSAICVDGENKXXXXXXXXRKYGTKTRSQRVDALLHHMLSSELT--QCSS 259
            E+D+E    C   +++           G+K+RSQRVD LLHHML  EL+  +CS+
Sbjct: 678  ELDLEEEEKCQGQDSQEKRNRRRSA--GSKSRSQRVDTLLHHMLGDELSKPECST 730



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 19/69 (27%), Positives = 41/69 (59%), Gaps = 4/69 (5%)
 Frame = -2

Query: 585 TLFNLLVM----GNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQT 418
           TL+ + ++     N  +W+ +YK    + WS V+F+ + +I V ++ NLI+A V ++F+ 
Sbjct: 254 TLYQMFILFTTSNNPDVWIPAYKS---SRWSSVFFVLYVLIGVYFVTNLILAVVYDSFKE 310

Query: 417 EMDMETSAI 391
           ++  + S +
Sbjct: 311 QLAKQVSGM 319



 Score = 30.4 bits (67), Expect(2) = 3e-66
 Identities = 13/17 (76%), Positives = 16/17 (94%)
 Frame = -1

Query: 826 IRLLMHVRSYRAFVATF 776
           IRLLM+V+ YRAF+ATF
Sbjct: 542 IRLLMNVQRYRAFIATF 558



>pir|B85045|B85045 probable calcium channel [imported] - Arabidopsis
            thaliana>gb:AC005142_1532197 Arabidopsis thaliana BAC
            T5L23 from chromosome IV, near 19 cM, complete
            sequence.>gb:ATCHRIV9_1547836 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 9.>gb:AF071527_1765782
            Arabidopsis thaliana BAC F9H3, from chromosome IV near
            18.8 cM, complete sequence.
          Length = 724

 Score =  244 bits (624), Expect(2) = 3e-66
 Identities = 117/175 (66%), Positives = 142/175 (81%), Gaps = 2/175 (1%)
 Frame = -2

Query: 777  FLTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYP 598
            F+TLIPSLMPYLGTIFCVLC YCS+G+Q+FGG+VNAGN  L  T+L+++DYLLFNFNDYP
Sbjct: 549  FITLIPSLMPYLGTIFCVLCIYCSIGVQVFGGLVNAGNKKLFETELAEDDYLLFNFNDYP 608

Query: 597  NGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQT 418
            NGMVTLFNLLVMGNWQ+WM+SYK+LTGT WS  YF+SFYVIT+L LLNL+VAFVLEAF T
Sbjct: 609  NGMVTLFNLLVMGNWQVWMESYKDLTGTWWSITYFVSFYVITILLLLNLVVAFVLEAFFT 668

Query: 417  EMDMETSAICVDGENKXXXXXXXXRKYGTKTRSQRVDALLHHMLSSELT--QCSS 259
            E+D+E    C   +++           G+K+RSQRVD LLHHML  EL+  +CS+
Sbjct: 669  ELDLEEEEKCQGQDSQEKRNRRRSA--GSKSRSQRVDTLLHHMLGDELSKPECST 721



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 19/69 (27%), Positives = 41/69 (59%), Gaps = 4/69 (5%)
 Frame = -2

Query: 585 TLFNLLVM----GNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQT 418
           TL+ + ++     N  +W+ +YK    + WS V+F+ + +I V ++ NLI+A V ++F+ 
Sbjct: 245 TLYQMFILFTTSNNPDVWIPAYKS---SRWSSVFFVLYVLIGVYFVTNLILAVVYDSFKE 301

Query: 417 EMDMETSAI 391
           ++  + S +
Sbjct: 302 QLAKQVSGM 310



 Score = 30.4 bits (67), Expect(2) = 3e-66
 Identities = 13/17 (76%), Positives = 16/17 (94%)
 Frame = -1

Query: 826 IRLLMHVRSYRAFVATF 776
           IRLLM+V+ YRAF+ATF
Sbjct: 533 IRLLMNVQRYRAFIATF 549



>gb:AB053952_1521302 Arabidopsis thaliana AtTPC1 mRNA for two-pore
            calcium channel, complete cds.
          Length = 733

 Score =  242 bits (618), Expect(2) = 2e-65
 Identities = 116/175 (66%), Positives = 141/175 (80%), Gaps = 2/175 (1%)
 Frame = -2

Query: 777  FLTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYP 598
            F+TLIPSLMPYLGTIFCVLC YCS+G+Q+FGG+VNAGN  L  T+L+++DYLLF FNDYP
Sbjct: 558  FITLIPSLMPYLGTIFCVLCIYCSIGVQVFGGLVNAGNKKLFETELAEDDYLLFTFNDYP 617

Query: 597  NGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQT 418
            NGMVTLFNLLVMGNWQ+WM+SYK+LTGT WS  YF+SFYVIT+L LLNL+VAFVLEAF T
Sbjct: 618  NGMVTLFNLLVMGNWQVWMESYKDLTGTWWSITYFVSFYVITILLLLNLVVAFVLEAFFT 677

Query: 417  EMDMETSAICVDGENKXXXXXXXXRKYGTKTRSQRVDALLHHMLSSELT--QCSS 259
            E+D+E    C   +++           G+K+RSQRVD LLHHML  EL+  +CS+
Sbjct: 678  ELDLEEEEKCQGQDSQEKRNRRRSA--GSKSRSQRVDTLLHHMLGDELSKPECST 730



 Score = 40.8 bits (94), Expect = 0.031
 Identities = 20/69 (28%), Positives = 41/69 (59%), Gaps = 4/69 (5%)
 Frame = -2

Query: 585 TLFNLLVM----GNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQT 418
           TLF + ++     N  +W+ +YK    + WS V+F+ + +I V ++ NLI+A V ++F+ 
Sbjct: 254 TLFQMFILFTTSNNPDVWIPAYKS---SRWSSVFFVLYVLIGVYFVTNLILAVVYDSFKE 310

Query: 417 EMDMETSAI 391
           ++  + S +
Sbjct: 311 QLAKQVSGM 319



 Score = 30.4 bits (67), Expect(2) = 2e-65
 Identities = 13/17 (76%), Positives = 16/17 (94%)
 Frame = -1

Query: 826 IRLLMHVRSYRAFVATF 776
           IRLLM+V+ YRAF+ATF
Sbjct: 542 IRLLMNVQRYRAFIATF 558



>gb:AY114121_1578501 Triticum aestivum putative calcium channel mRNA,
            complete cds.
          Length = 742

 Score =  226 bits (576), Expect(2) = 7e-60
 Identities = 110/168 (65%), Positives = 132/168 (78%)
 Frame = -2

Query: 777  FLTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYP 598
            F TL+ SLMPYLG +FCVLC YCS+GLQIFGG+V AGNP L+ TDL +NDYLLFNFNDYP
Sbjct: 570  FFTLMSSLMPYLGIVFCVLCMYCSIGLQIFGGIVYAGNPTLEETDLFNNDYLLFNFNDYP 629

Query: 597  NGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQT 418
            +GMVTLFNLLVMGNWQ+WM+SY +LTGTSWS +YF+SFY+I++L LLNLIVAFVLEAF  
Sbjct: 630  SGMVTLFNLLVMGNWQVWMESYWQLTGTSWSLIYFVSFYLISILLLLNLIVAFVLEAFFA 689

Query: 417  EMDMETSAICVDGENKXXXXXXXXRKYGTKTRSQRVDALLHHMLSSEL 274
            EM++E     VD +N         R    +++   VD LLHHMLS+EL
Sbjct: 690  EMELEKGEE-VDIQNPTSGGIKKRRSMRVRSKGTMVDILLHHMLSNEL 736



 Score = 36.2 bits (82), Expect = 0.77
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 11/77 (14%)
 Frame = -2

Query: 612 FNDYPNGM-------VTLFNLLVM----GNWQLWMQSYKELTGTSWSYVYFISFYVITVL 466
           F D P G        VTL+ + V+     N  +W+ +YK      W  ++FI + ++ V 
Sbjct: 251 FEDTPQGKTIFSSYGVTLYQMFVLFTTSNNPDVWVHAYKI---PRWYSLFFIVYVLLGVY 307

Query: 465 WLLNLIVAFVLEAFQTE 415
           +L NLI+A + ++F+ +
Sbjct: 308 FLTNLILAVIYDSFKEQ 324



 Score = 27.7 bits (60), Expect(2) = 7e-60
 Identities = 11/17 (64%), Positives = 15/17 (88%)
 Frame = -1

Query: 823 RLLMHVRSYRAFVATFF 773
           R+L+ V+ +RAFVATFF
Sbjct: 555 RILLQVQRFRAFVATFF 571



>gb:AB100696_1526267 Oryza sativa (japonica cultivar-group) OsTPC1
            mRNA for calcium channel, complete cds.
          Length = 757

 Score =  221 bits (562), Expect(2) = 1e-58
 Identities = 108/168 (64%), Positives = 128/168 (76%)
 Frame = -2

Query: 777  FLTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYP 598
            F TL+ SLMPYLG +FC LC YCSLGLQIFGG+V AGNP L+ TDL  NDYLLFNFNDYP
Sbjct: 583  FFTLMSSLMPYLGIVFCTLCIYCSLGLQIFGGIVYAGNPTLEETDLFSNDYLLFNFNDYP 642

Query: 597  NGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQT 418
            +GMVTLFNLLVMGNWQ WM+SY++LTG+ WS +YF+SFY+I+VL LLNLIVAFVLEAF  
Sbjct: 643  SGMVTLFNLLVMGNWQAWMESYRQLTGSYWSLIYFVSFYLISVLLLLNLIVAFVLEAFFA 702

Query: 417  EMDMETSAICVDGENKXXXXXXXXRKYGTKTRSQRVDALLHHMLSSEL 274
            EM++E      D ++         R    +T+   VD LLHHMLS+EL
Sbjct: 703  EMELEKDGE-ADIQDPTLEGRNRRRSVRVRTKGTMVDILLHHMLSNEL 749



 Score = 40.0 bits (92), Expect = 0.053
 Identities = 22/83 (26%), Positives = 44/83 (53%), Gaps = 11/83 (13%)
 Frame = -2

Query: 612 FNDYPNGMV-------TLFNLLVM----GNWQLWMQSYKELTGTSWSYVYFISFYVITVL 466
           F D P G         TL+ + ++     N  +W+ +YK    + WS ++FI + ++ V 
Sbjct: 263 FEDTPQGKTVFSSYGTTLYQMFILFTTSNNPDVWVPAYKS---SRWSSLFFIVYVLLGVY 319

Query: 465 WLLNLIVAFVLEAFQTEMDMETS 397
           +L NLI+A + ++F+ ++  + S
Sbjct: 320 FLTNLILAVIYDSFKEQLAKQVS 342



 Score = 29.3 bits (64), Expect(2) = 1e-58
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 823 RLLMHVRSYRAFVATFF 773
           R+L+ VR +RAFVATFF
Sbjct: 568 RILLQVRRFRAFVATFF 584



>gb:AB071014_1522718 Oryza sativa OsTPC1 mRNA for putative two-pore
            calcium channel, complete cds.>gb:AP003335_1828158 Oryza
            sativa (japonica cultivar-group) genomic DNA, chromosome
            1, BAC clone:B1144G04.
          Length = 757

 Score =  221 bits (562), Expect(2) = 1e-58
 Identities = 108/168 (64%), Positives = 128/168 (76%)
 Frame = -2

Query: 777  FLTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYP 598
            F TL+ SLMPYLG +FC LC YCSLGLQIFGG+V AGNP L+ TDL  NDYLLFNFNDYP
Sbjct: 583  FFTLMSSLMPYLGIVFCTLCIYCSLGLQIFGGIVYAGNPTLEETDLFSNDYLLFNFNDYP 642

Query: 597  NGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQT 418
            +GMVTLFNLLVMGNWQ WM+SY++LTG+ WS +YF+SFY+I+VL LLNLIVAFVLEAF  
Sbjct: 643  SGMVTLFNLLVMGNWQAWMESYRQLTGSYWSLIYFVSFYLISVLLLLNLIVAFVLEAFFA 702

Query: 417  EMDMETSAICVDGENKXXXXXXXXRKYGTKTRSQRVDALLHHMLSSEL 274
            EM++E      D ++         R    +T+   VD LLHHMLS+EL
Sbjct: 703  EMELEKDGE-ADIQDPTLEGRNRRRSVRVRTKGTMVDILLHHMLSNEL 749



 Score = 40.0 bits (92), Expect = 0.053
 Identities = 22/83 (26%), Positives = 44/83 (53%), Gaps = 11/83 (13%)
 Frame = -2

Query: 612 FNDYPNGMV-------TLFNLLVM----GNWQLWMQSYKELTGTSWSYVYFISFYVITVL 466
           F D P G         TL+ + ++     N  +W+ +YK    + WS ++FI + ++ V 
Sbjct: 263 FEDTPQGKTVFSSYGTTLYQMFILFTTSNNPDVWVPAYKS---SRWSSLFFIVYVLLGVY 319

Query: 465 WLLNLIVAFVLEAFQTEMDMETS 397
           +L NLI+A + ++F+ ++  + S
Sbjct: 320 FLTNLILAVIYDSFKEQLAKQVS 342



 Score = 29.3 bits (64), Expect(2) = 1e-58
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 823 RLLMHVRSYRAFVATFF 773
           R+L+ VR +RAFVATFF
Sbjct: 568 RILLQVRRFRAFVATFF 584



>gb:AP003335_1828159 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1144G04.
          Length = 665

 Score =  221 bits (562), Expect(2) = 1e-58
 Identities = 108/168 (64%), Positives = 128/168 (76%)
 Frame = -2

Query: 777 FLTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYP 598
           F TL+ SLMPYLG +FC LC YCSLGLQIFGG+V AGNP L+ TDL  NDYLLFNFNDYP
Sbjct: 491 FFTLMSSLMPYLGIVFCTLCIYCSLGLQIFGGIVYAGNPTLEETDLFSNDYLLFNFNDYP 550

Query: 597 NGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQT 418
           +GMVTLFNLLVMGNWQ WM+SY++LTG+ WS +YF+SFY+I+VL LLNLIVAFVLEAF  
Sbjct: 551 SGMVTLFNLLVMGNWQAWMESYRQLTGSYWSLIYFVSFYLISVLLLLNLIVAFVLEAFFA 610

Query: 417 EMDMETSAICVDGENKXXXXXXXXRKYGTKTRSQRVDALLHHMLSSEL 274
           EM++E      D ++         R    +T+   VD LLHHMLS+EL
Sbjct: 611 EMELEKDGE-ADIQDPTLEGRNRRRSVRVRTKGTMVDILLHHMLSNEL 657



 Score = 40.0 bits (92), Expect = 0.053
 Identities = 22/83 (26%), Positives = 44/83 (53%), Gaps = 11/83 (13%)
 Frame = -2

Query: 612 FNDYPNGMV-------TLFNLLVM----GNWQLWMQSYKELTGTSWSYVYFISFYVITVL 466
           F D P G         TL+ + ++     N  +W+ +YK    + WS ++FI + ++ V 
Sbjct: 171 FEDTPQGKTVFSSYGTTLYQMFILFTTSNNPDVWVPAYKS---SRWSSLFFIVYVLLGVY 227

Query: 465 WLLNLIVAFVLEAFQTEMDMETS 397
           +L NLI+A + ++F+ ++  + S
Sbjct: 228 FLTNLILAVIYDSFKEQLAKQVS 250



 Score = 29.3 bits (64), Expect(2) = 1e-58
 Identities = 12/17 (70%), Positives = 15/17 (88%)
 Frame = -1

Query: 823 RLLMHVRSYRAFVATFF 773
           R+L+ VR +RAFVATFF
Sbjct: 476 RILLQVRRFRAFVATFF 492



>gb:AY465119_1607950 Hordeum vulgare two-pore calcium channel (TPC1)
            mRNA, complete cds.
          Length = 742

 Score =  223 bits (567), Expect(2) = 2e-58
 Identities = 108/168 (64%), Positives = 131/168 (77%)
 Frame = -2

Query: 777  FLTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYP 598
            F TL+ SLMPYLG +FC+LC YCSLGLQIFGG+V AGNP L+ TDL  NDYLLFNFNDYP
Sbjct: 570  FFTLMSSLMPYLGIVFCILCMYCSLGLQIFGGIVYAGNPTLEETDLFSNDYLLFNFNDYP 629

Query: 597  NGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQT 418
            +GMVTLFNLLVMGNWQ+WM+SY +LTG+SWS +YF+SFY+I++L LLNLIVAFVLEAF  
Sbjct: 630  SGMVTLFNLLVMGNWQVWMESYWQLTGSSWSLIYFVSFYLISILLLLNLIVAFVLEAFFA 689

Query: 417  EMDMETSAICVDGENKXXXXXXXXRKYGTKTRSQRVDALLHHMLSSEL 274
            EM++E     VD ++         R    +++   VD LLHHMLS+EL
Sbjct: 690  EMELEKGEE-VDIQSPTSGGIKKRRSMRVRSKGTMVDILLHHMLSNEL 736



 Score = 36.6 bits (83), Expect = 0.59
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 11/77 (14%)
 Frame = -2

Query: 612 FNDYPNGM-------VTLFNLLVM----GNWQLWMQSYKELTGTSWSYVYFISFYVITVL 466
           F D P G        VTL+ + V+     N  +W+ +YK    + W  ++FI + ++ V 
Sbjct: 251 FEDTPQGKTIFSSYGVTLYQMFVLFTTSNNPDVWVPAYKI---SRWYSLFFIVYVLLGVY 307

Query: 465 WLLNLIVAFVLEAFQTE 415
           +L NLI+A + ++F+ +
Sbjct: 308 FLTNLILAVIYDSFKEQ 324



 Score = 26.2 bits (56), Expect(2) = 2e-58
 Identities = 10/17 (58%), Positives = 14/17 (82%)
 Frame = -1

Query: 823 RLLMHVRSYRAFVATFF 773
           R+L+ V+ +R FVATFF
Sbjct: 555 RILLQVQRFRVFVATFF 571



>gb:HSM802204_2017433 Homo sapiens mRNA; cDNA DKFZp434M0223 (from
           clone DKFZp434M0223); partial cds.
          Length = 371

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 38/131 (29%), Positives = 76/131 (58%), Gaps = 9/131 (6%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNA--GNPNLDGTDLS-------DNDYL 622
           L L+ ++  + G +  V   +  +G+ +F G++ A  GN +L   + S         +Y 
Sbjct: 192 LGLVQNMRAFGGILVVVYYVFAIIGINLFRGVIVALPGNSSLAPANGSAPCGSFEQLEYW 251

Query: 621 LFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVA 442
             NF+D+   +VTL+NL+V+ NWQ+++ +Y+  +G  WS +YF+ +++++ +  +NL +A
Sbjct: 252 ANNFDDFAAALVTLWNLMVVNNWQVFLDAYRRYSG-PWSKIYFVLWWLVSSVIWVNLFLA 310

Query: 441 FVLEAFQTEMD 409
            +LE F  + D
Sbjct: 311 LILENFLHKWD 321



>gb:AY029200_1934466 Homo sapiens two-pore calcium channel protein 2
           mRNA, complete cds.>gb:BC063008_1986070 Homo sapiens two
           pore segment channel 2, mRNA (cDNA clone MGC:70581
           IMAGE:5214862), complete cds.
          Length = 752

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 38/131 (29%), Positives = 76/131 (58%), Gaps = 9/131 (6%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNA--GNPNLDGTDLS-------DNDYL 622
           L L+ ++  + G +  V   +  +G+ +F G++ A  GN +L   + S         +Y 
Sbjct: 573 LGLVQNMRAFGGILVVVYYVFAIIGINLFRGVIVALPGNSSLAPANGSAPCGSFEQLEYW 632

Query: 621 LFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVA 442
             NF+D+   +VTL+NL+V+ NWQ+++ +Y+  +G  WS +YF+ +++++ +  +NL +A
Sbjct: 633 ANNFDDFAAALVTLWNLMVVNNWQVFLDAYRRYSG-PWSKIYFVLWWLVSSVIWVNLFLA 691

Query: 441 FVLEAFQTEMD 409
            +LE F  + D
Sbjct: 692 LILENFLHKWD 702



 Score = 36.2 bits (82), Expect = 0.77
 Identities = 29/112 (25%), Positives = 53/112 (47%), Gaps = 1/112 (0%)
 Frame = -2

Query: 753 MPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFN 574
           +P + ++  +L  +  L   +FG ++ AG    DG D     Y    F + P  + +L  
Sbjct: 213 LPEMASVGLLLAIHLCL-FTMFGMLLFAGGKQDDGQDRERLTY----FQNLPESLTSLLV 267

Query: 573 LLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQ 421
           LL   N   + + +Y +    +   ++FI F VI  L+L+NL+ A +   F+
Sbjct: 268 LLTTANNPDVMIPAYSKNRAYA---IFFIVFTVIGSLFLMNLLTAIIYSQFR 316



>pir|T46421|T46421 hypothetical protein DKFZp434M0223.1 - human
           (fragment)
          Length = 371

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 38/131 (29%), Positives = 76/131 (58%), Gaps = 9/131 (6%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNA--GNPNLDGTDLS-------DNDYL 622
           L L+ ++  + G +  V   +  +G+ +F G++ A  GN +L   + S         +Y 
Sbjct: 192 LGLVQNMRAFGGILVVVYYVFAIIGINLFRGVIVALPGNSSLAPANGSAPCGSFEQLEYW 251

Query: 621 LFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVA 442
             NF+D+   +VTL+NL+V+ NWQ+++ +Y+  +G  WS +YF+ +++++ +  +NL +A
Sbjct: 252 ANNFDDFAAALVTLWNLMVVNNWQVFLDAYRRYSG-PWSKIYFVLWWLVSSVIWVNLFLA 310

Query: 441 FVLEAFQTEMD 409
            +LE F  + D
Sbjct: 311 LILENFLHKWD 321



>gb:BC069857_2106144 Mus musculus cDNA clone MGC:78039
           IMAGE:4500997, complete cds.
          Length = 276

 Score = 69.3 bits (168), Expect = 8e-11
 Identities = 41/134 (30%), Positives = 74/134 (55%), Gaps = 12/134 (8%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGM-VNAGNPNLDGTDLSDND---------- 628
           L LIP+L  + G +      +  +G+ +F G+ V  GN +L    + DN+          
Sbjct: 102 LGLIPNLRAFGGILVVAYYVFAMIGINLFRGVIVPPGNSSL----VPDNNSAVCGSFEQL 157

Query: 627 -YLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
            Y   NF+D+   ++TL+N++V+ NWQ+ +++YK   G  WS VYF+ +++++ +  +NL
Sbjct: 158 GYWPNNFDDFAAALITLWNVMVVNNWQVILEAYKRYAG-PWSMVYFVLWWLVSSVIWINL 216

Query: 450 IVAFVLEAFQTEMD 409
            +A +LE F    D
Sbjct: 217 FLALLLENFLHRWD 230



>gb:BC043472_2098918 Mus musculus two pore segment channel 2, mRNA
           (cDNA clone IMAGE:5252399), partial cds.
          Length = 595

 Score = 69.3 bits (168), Expect = 8e-11
 Identities = 41/134 (30%), Positives = 74/134 (55%), Gaps = 12/134 (8%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGM-VNAGNPNLDGTDLSDND---------- 628
           L LIP+L  + G +      +  +G+ +F G+ V  GN +L    + DN+          
Sbjct: 421 LGLIPNLRAFGGILVVAYYVFAMIGINLFRGVIVPPGNSSL----VPDNNSAVCGSFEQL 476

Query: 627 -YLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
            Y   NF+D+   ++TL+N++V+ NWQ+ +++YK   G  WS VYF+ +++++ +  +NL
Sbjct: 477 GYWPNNFDDFAAALITLWNVMVVNNWQVILEAYKRYAG-PWSMVYFVLWWLVSSVIWINL 535

Query: 450 IVAFVLEAFQTEMD 409
            +A +LE F    D
Sbjct: 536 FLALLLENFLHRWD 549



>gb:BC025890_2095203 Mus musculus two pore segment channel 2, mRNA
           (cDNA clone IMAGE:5039277), complete cds.
          Length = 205

 Score = 69.3 bits (168), Expect = 8e-11
 Identities = 41/134 (30%), Positives = 74/134 (55%), Gaps = 12/134 (8%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGM-VNAGNPNLDGTDLSDND---------- 628
           L LIP+L  + G +      +  +G+ +F G+ V  GN +L    + DN+          
Sbjct: 31  LGLIPNLRAFGGILVVAYYVFAMIGINLFRGVIVPPGNSSL----VPDNNSAVCGSFEQL 86

Query: 627 -YLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
            Y   NF+D+   ++TL+N++V+ NWQ+ +++YK   G  WS VYF+ +++++ +  +NL
Sbjct: 87  GYWPNNFDDFAAALITLWNVMVVNNWQVILEAYKRYAG-PWSMVYFVLWWLVSSVIWINL 145

Query: 450 IVAFVLEAFQTEMD 409
            +A +LE F    D
Sbjct: 146 FLALLLENFLHRWD 159



>gb:AK052930_1170255 Mus musculus 16 days neonate heart cDNA, RIKEN
           full-length enriched library, clone:D830047E22
           product:hypothetical Calcium and sodium channel pore
           region (S4-S6)/Cation channels TM region (not
           potassium)/Cation channels (non-ligand gated) containing
           protein, full insert sequence.
          Length = 731

 Score = 69.3 bits (168), Expect = 8e-11
 Identities = 41/134 (30%), Positives = 74/134 (55%), Gaps = 12/134 (8%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGM-VNAGNPNLDGTDLSDND---------- 628
           L LIP+L  + G +      +  +G+ +F G+ V  GN +L    + DN+          
Sbjct: 557 LGLIPNLRAFGGILVVAYYVFAMIGINLFRGVIVPPGNSSL----VPDNNSAVCGSFEQL 612

Query: 627 -YLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
            Y   NF+D+   ++TL+N++V+ NWQ+ +++YK   G  WS VYF+ +++++ +  +NL
Sbjct: 613 GYWPNNFDDFAAALITLWNVMVVNNWQVILEAYKRYAG-PWSMVYFVLWWLVSSVIWINL 671

Query: 450 IVAFVLEAFQTEMD 409
            +A +LE F    D
Sbjct: 672 FLALLLENFLHRWD 685



>gb:BC062072_2104845 Rattus norvegicus two pore channel 1, mRNA
           (cDNA clone MGC:72293 IMAGE:5599545), complete cds.
          Length = 817

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 42/135 (31%), Positives = 73/135 (54%), Gaps = 19/135 (14%)
 Frame = -2

Query: 756 LMPYLGTI-FCVLCFYCS---LGLQIFGGMVNAGNPNL---------------DGTDLSD 634
           L+P + ++   +L FY S   +G++ F G ++    N                + T + +
Sbjct: 564 LLPRMASLGLTLLTFYYSFAIVGMEFFSGRLSPNCCNSSTVADAYRFINHTVGNKTKVEE 623

Query: 633 NDYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLN 454
             Y L NF++  N  VTLF L V+ NW + M+     T + WS +YF++FY++T++ ++ 
Sbjct: 624 GYYYLNNFDNILNSFVTLFELTVVNNWYIIMEGVTSQT-SHWSRLYFMTFYIVTMV-VMT 681

Query: 453 LIVAFVLEAFQTEMD 409
           +IVAF+LEAF   M+
Sbjct: 682 IIVAFILEAFVFRMN 696



 Score = 41.6 bits (96), Expect = 0.018
 Identities = 33/119 (27%), Positives = 53/119 (44%), Gaps = 4/119 (3%)
 Frame = -2

Query: 768 LIPSLMPYLGTIFCVLCF---YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYP 598
           +  SL P++  +  +L F   +  LG  +F    N  +P                FN   
Sbjct: 226 IFQSLPPFMDILLLLLFFMIIFAILGFYLFS--TNPSDPY---------------FNTLE 268

Query: 597 NGMVTLFNLLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAF 424
           N +V LF LL   N+  + M SY       WS V+FI +  I + +++NL++A V + F
Sbjct: 269 NSIVNLFVLLTTANFPDVMMPSYSR---NPWSCVFFIVYLSIELYFIMNLLLAVVFDTF 324



>gb:AK129303_2069534 Mus musculus mRNA for mKIAA1169 protein.
          Length = 590

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 42/135 (31%), Positives = 72/135 (53%), Gaps = 19/135 (14%)
 Frame = -2

Query: 756 LMPYLGTI-FCVLCFYCS---LGLQIFGGMVNAGNPNL---------------DGTDLSD 634
           L+P + ++   +L FY S   +G++ F G +     N                + T + +
Sbjct: 337 LLPRMASLGLTLLTFYYSFAIVGMEFFNGRLTPNCCNTSTVADAYRFINHTVGNKTKVEE 396

Query: 633 NDYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLN 454
             Y L NF++  N  VTLF L V+ NW + M+     T + WS +YF++FY++T++ ++ 
Sbjct: 397 GYYYLNNFDNILNSFVTLFELTVVNNWYIIMEGVTSQT-SHWSRLYFMTFYIVTMV-VMT 454

Query: 453 LIVAFVLEAFQTEMD 409
           +IVAF+LEAF   M+
Sbjct: 455 IIVAFILEAFVFRMN 469



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 32/116 (27%), Positives = 52/116 (44%), Gaps = 4/116 (3%)
 Frame = -2

Query: 759 SLMPYLGTIFCVLCF---YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGM 589
           SL P++  +  +L F   +  LG  +F    N  +P                F+   N +
Sbjct: 2   SLPPFMDILLLLLFFMIIFAILGFYLFS--TNPSDPY---------------FSTLENSI 44

Query: 588 VTLFNLLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAF 424
           V LF LL   N+  + M SY       WS V+FI +  I + +++NL++A V + F
Sbjct: 45  VNLFVLLTTANFPDVMMPSYSR---NPWSCVFFIVYLSIELYFIMNLLLAVVFDTF 97



>gb:AF217002_2059399 Mus musculus calcium channel mRNA, complete
           cds.>gb:BC058951_2103530 Mus musculus two pore channel
           1, mRNA (cDNA clone MGC:66697 IMAGE:6821376), complete
           cds.
          Length = 817

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 42/135 (31%), Positives = 72/135 (53%), Gaps = 19/135 (14%)
 Frame = -2

Query: 756 LMPYLGTI-FCVLCFYCS---LGLQIFGGMVNAGNPNL---------------DGTDLSD 634
           L+P + ++   +L FY S   +G++ F G +     N                + T + +
Sbjct: 564 LLPRMASLGLTLLTFYYSFAIVGMEFFNGRLTPNCCNTSTVADAYRFINHTVGNKTKVEE 623

Query: 633 NDYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLN 454
             Y L NF++  N  VTLF L V+ NW + M+     T + WS +YF++FY++T++ ++ 
Sbjct: 624 GYYYLNNFDNILNSFVTLFELTVVNNWYIIMEGVTSQT-SHWSRLYFMTFYIVTMV-VMT 681

Query: 453 LIVAFVLEAFQTEMD 409
           +IVAF+LEAF   M+
Sbjct: 682 IIVAFILEAFVFRMN 696



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 32/119 (26%), Positives = 53/119 (44%), Gaps = 4/119 (3%)
 Frame = -2

Query: 768 LIPSLMPYLGTIFCVLCF---YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYP 598
           +  SL P++  +  +L F   +  LG  +F    N  +P                F+   
Sbjct: 226 IFQSLPPFMDILLLLLFFMIIFAILGFYLFS--TNPSDPY---------------FSTLE 268

Query: 597 NGMVTLFNLLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAF 424
           N +V LF LL   N+  + M SY       WS V+FI +  I + +++NL++A V + F
Sbjct: 269 NSIVNLFVLLTTANFPDVMMPSYSR---NPWSCVFFIVYLSIELYFIMNLLLAVVFDTF 324



>gb:AB032995_1866175 Homo sapiens mRNA for KIAA1169 protein, partial
            cds.
          Length = 857

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 44/135 (32%), Positives = 75/135 (55%), Gaps = 19/135 (14%)
 Frame = -2

Query: 756  LMPYLGTI-FCVLCFYCS---LGLQIFGGMV--NAGNPNL-------------DGTDLSD 634
            L+P + ++   +L FY S   +G++ F G+V  N  N +              + T + +
Sbjct: 604  LLPRMASLGLTLLIFYYSFAIVGMEFFCGIVFPNCCNTSTVADAYRWRNHTVGNRTVVEE 663

Query: 633  NDYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLN 454
              Y L NF++  N  VTLF L V+ NW + M+     T + WS +YF++FY++T++ ++ 
Sbjct: 664  GYYYLNNFDNILNSFVTLFELTVVNNWYIIMEGVTSQT-SHWSRLYFMTFYIVTMV-VMT 721

Query: 453  LIVAFVLEAFQTEMD 409
            +IVAF+LEAF   M+
Sbjct: 722  IIVAFILEAFVFRMN 736



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 32/119 (26%), Positives = 54/119 (45%), Gaps = 4/119 (3%)
 Frame = -2

Query: 768 LIPSLMPYLGTIFCVLCF---YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYP 598
           +  SL P++  +  +L F   +  LG  +F    N  +P                F+   
Sbjct: 266 IFQSLPPFMDILLLLLFFMIIFAILGFYLFSP--NPSDPY---------------FSTLE 308

Query: 597 NGMVTLFNLLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAF 424
           N +V+LF LL   N+  + M SY       WS V+FI +  I + +++NL++A V + F
Sbjct: 309 NSIVSLFVLLTTANFPDVMMPSYSR---NPWSCVFFIVYLSIELYFIMNLLLAVVFDTF 364



>gb:AX235888_1464490 Sequence 1 from Patent
           WO0164881.>gb:AX235890_1464491 Sequence 3 from Patent
           WO0164881.>gb:AY083666_1936171 Homo sapiens two-pore
           channel 1 (TPC1) mRNA, complete cds.
          Length = 816

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 44/135 (32%), Positives = 75/135 (55%), Gaps = 19/135 (14%)
 Frame = -2

Query: 756 LMPYLGTI-FCVLCFYCS---LGLQIFGGMV--NAGNPNL-------------DGTDLSD 634
           L+P + ++   +L FY S   +G++ F G+V  N  N +              + T + +
Sbjct: 563 LLPRMASLGLTLLIFYYSFAIVGMEFFCGIVFPNCCNTSTVADAYRWRNHTVGNRTVVEE 622

Query: 633 NDYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLN 454
             Y L NF++  N  VTLF L V+ NW + M+     T + WS +YF++FY++T++ ++ 
Sbjct: 623 GYYYLNNFDNILNSFVTLFELTVVNNWYIIMEGVTSQT-SHWSRLYFMTFYIVTMV-VMT 680

Query: 453 LIVAFVLEAFQTEMD 409
           +IVAF+LEAF   M+
Sbjct: 681 IIVAFILEAFVFRMN 695



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 32/119 (26%), Positives = 54/119 (45%), Gaps = 4/119 (3%)
 Frame = -2

Query: 768 LIPSLMPYLGTIFCVLCF---YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYP 598
           +  SL P++  +  +L F   +  LG  +F    N  +P                F+   
Sbjct: 225 IFQSLPPFMDILLLLLFFMIIFAILGFYLFSP--NPSDPY---------------FSTLE 267

Query: 597 NGMVTLFNLLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAF 424
           N +V+LF LL   N+  + M SY       WS V+FI +  I + +++NL++A V + F
Sbjct: 268 NSIVSLFVLLTTANFPDVMMPSYSR---NPWSCVFFIVYLSIELYFIMNLLLAVVFDTF 323



>gb:CR548612_1375530 Paramecium tetraurelia macronuclear largest
           chromosome, complete sequence.
          Length = 519

 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 34/122 (27%), Positives = 64/122 (52%), Gaps = 1/122 (0%)
 Frame = -2

Query: 756 LMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
           L+   GT+   +  + S+G  IFGG +N    +L       ++Y   NFND+ +G  T +
Sbjct: 376 LLQLFGTLIVTITIFNSIGQLIFGGKINYNQQHL-------SNYQWVNFNDFLSGFCTCW 428

Query: 576 NLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQTEM-DMET 400
            LL++ NW +    +     + + Y++FI +Y+I VL   ++ +A ++E     + D+ +
Sbjct: 429 FLLIVNNWNVMSYDFSLSLQSDFIYLFFIFYYIIVVLLAQSVTIALLIEYLVNHVKDLSS 488

Query: 399 SA 394
           SA
Sbjct: 489 SA 490



>pir|JC7240|JC7240 two-pore calcium channel protein -
           rat>gb:AB018253_2044055 Rattus norvegicus mRNA for
           voltage-gated ca channel, complete cds.
          Length = 819

 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 44/137 (32%), Positives = 72/137 (52%), Gaps = 21/137 (15%)
 Frame = -2

Query: 756 LMPYLGTI-FCVLCFYCS---LGLQIFGGMV--NAGNPNLDGTDLSDND----------- 628
           L+P + ++   +L FY S   +G++ F G +  N   P   G    D+            
Sbjct: 564 LLPRMASLGLTLLTFYYSFAIVGMEFFSGRLSPNCSTPARWGLTPIDSSITRLGNKTKFG 623

Query: 627 ----YLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWL 460
               Y L NF++  N  VTLF L V+ NW + M+     T + WS +YF++FY++T++ +
Sbjct: 624 RKGYYYLNNFDNILNSFVTLFELTVVNNWYIIMEGVTSQT-SHWSRLYFMTFYIVTMV-V 681

Query: 459 LNLIVAFVLEAFQTEMD 409
           + +IVAF+LEAF   M+
Sbjct: 682 MTIIVAFILEAFVFRMN 698



 Score = 41.6 bits (96), Expect = 0.018
 Identities = 33/119 (27%), Positives = 53/119 (44%), Gaps = 4/119 (3%)
 Frame = -2

Query: 768 LIPSLMPYLGTIFCVLCF---YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYP 598
           +  SL P++  +  +L F   +  LG  +F    N  +P                FN   
Sbjct: 226 IFQSLPPFMDILLLLLFFMIIFAILGFYLFS--TNPSDPY---------------FNTLE 268

Query: 597 NGMVTLFNLLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAF 424
           N +V LF LL   N+  + M SY       WS V+FI +  I + +++NL++A V + F
Sbjct: 269 NSIVNLFVLLTTANFPDVMMPSYSR---NPWSCVFFIVYLSIELYFIMNLLLAVVFDTF 324



>pir|T43048|T43048 calcium channel alpha-1 chain - Cyanea
            capillata>gb:CCU93075_1359530 Cyanea capillata
            voltage-gated calcium channel alpha-1 subunit mRNA,
            complete cds.
          Length = 1911

 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 37/124 (29%), Positives = 64/124 (51%), Gaps = 14/124 (11%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLD-GTDLSDNDYLLFNFNDYPNGMVTL 580
            +P++G +  +L F Y  +G+Q+FG +       LD GT ++ N+    NF  +P  ++ L
Sbjct: 1316 LPFVGLLILLLFFIYAVIGMQVFGTI------RLDSGTVINSNN----NFQTFPQALIVL 1365

Query: 579  FNLLVMGNWQLWMQSY------------KELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
            F      NWQ  M +              +  GT ++Y+YF+SFY+I    ++NL VA +
Sbjct: 1366 FRSATGENWQQIMMACVNSESVKCEVDPSKTCGTDFAYLYFMSFYMICSFLIINLFVAVI 1425

Query: 435  LEAF 424
            ++ F
Sbjct: 1426 MDNF 1429



 Score = 38.5 bits (88), Expect = 0.15
 Identities = 17/79 (21%), Positives = 37/79 (46%)
 Frame = -2

Query: 630 DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
           +Y + NF++     +T+F    +  W   +     ++G  W ++YF++       ++LNL
Sbjct: 316 NYGITNFDNVALAALTVFQCTTLEGWTDVLYDINNVSGGGWPWIYFVTLITFGSFFVLNL 375

Query: 450 IVAFVLEAFQTEMDMETSA 394
           I+  +   F  E   +T +
Sbjct: 376 ILGVLSGEFAKEKARQTKS 394



 Score = 37.7 bits (86), Expect = 0.26
 Identities = 31/132 (23%), Positives = 59/132 (44%), Gaps = 6/132 (4%)
 Frame = -2

Query: 807 YEVIVPL*QHFLTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDND 628
           +E +  L Q  +  I S+   L  +   +  +  LG+QIFGG  N          L +  
Sbjct: 607 WESLSNLVQSLVNSIKSIGSLLLLLSLFILIFSLLGMQIFGGRFN----------LDEQA 656

Query: 627 YLLFNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTS--WSYVYFISFYVITVL 466
               NF+ +   ++T+F +L   +W   M    QS+  +   S   + +YF++  ++   
Sbjct: 657 PPRTNFDSFWRSLITVFQILTGEDWNAVMYVGIQSWGGIKNPSSIIAIIYFVALVIVGNY 716

Query: 465 WLLNLIVAFVLE 430
            LLN+ +A  ++
Sbjct: 717 ILLNVFLAIAVD 728



>gb:AY319303_2526675 Oncorhynchus mykiss neuroendocrine-type
            voltage-gated calcium channel subunit Cav1.3 mRNA,
            complete cds.
          Length = 2150

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 37/127 (29%), Positives = 65/127 (51%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +       +DGT ++ N+    NF  +P  ++ LF
Sbjct: 1293 LPYVALLIAMLFFIYAVIGMQVFGKVAM-----VDGTHINRNN----NFQTFPQAVLLLF 1343

Query: 576  NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  M +                +E+T G S++Y+YFISFY++    ++NL V
Sbjct: 1344 RCATGEAWQEIMLACVSGKLCDPESDYNPGEEMTCGASFAYIYFISFYMLCAFLIINLFV 1403

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1404 AVIMDNF 1410



 Score = 37.7 bits (86), Expect = 0.26
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            FNF++    M+ LF +     W   +     S +E  G  ++Y     ++FI + +I   
Sbjct: 1040 FNFDNVLMAMMALFTVSTFEGWPSLLYKAIDSNRENLGPIYNYRIEISIFFIIYIIIIAF 1099

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1100 FMMNIFVGFVIVTFQEQGEKE 1120



 Score = 37.7 bits (86), Expect = 0.26
 Identities = 29/120 (24%), Positives = 52/120 (43%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N      D T    +      F+++P 
Sbjct: 647 LNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFN-----FDETQTKRS-----TFDNFPQ 696

Query: 594 GMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVL-----WLLNLIVAFVLE 430
            ++T+F ++   +W   M       G   S    +SFY I +       LLN+ +A  ++
Sbjct: 697 ALLTVFQIMTGEDWNAVMYDGIMAYGGPSSSGMIVSFYFIILFICGNYILLNVFLAIAVD 756



 Score = 37.7 bits (86), Expect = 0.26
 Identities = 32/153 (20%), Positives = 65/153 (42%), Gaps = 32/153 (20%)
 Frame = -2

Query: 771 TLIPSLMPYLGT---IFCVLCFYCSLGLQIF------------GGMVNAGNPN------- 658
           ++I +++P L     +  V+  Y  +GL++F             GM+    P        
Sbjct: 266 SIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCFFPSTGMIAEDEPAPCAISGH 325

Query: 657 -----LDGTDLSD-----NDYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSW 508
                ++GT+  +     ND +  NF+++   M+T+F  + M  W   +    +  G   
Sbjct: 326 GRQCPINGTECREGWHGPNDGIT-NFDNFLFAMLTVFQCITMEGWTDVLYWMNDAMGLEL 384

Query: 507 SYVYFISFYVITVLWLLNLIVAFVLEAFQTEMD 409
            +VYF+S  +    ++LNL++  +   F  E +
Sbjct: 385 PWVYFVSLVIFGSFFVLNLVLGVLSGEFSKERE 417



>gb:AF450282_2495530 Oncorhynchus mykiss voltage-gated calcium channel
            subunit Cav1.3 mRNA, complete cds.
          Length = 2155

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 37/127 (29%), Positives = 65/127 (51%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +       +DGT ++ N+    NF  +P  ++ LF
Sbjct: 1344 LPYVALLIAMLFFIYAVIGMQVFGKVAM-----VDGTHINRNN----NFQTFPQAVLLLF 1394

Query: 576  NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  M +                +E+T G S++Y+YFISFY++    ++NL V
Sbjct: 1395 RCATGEAWQEIMLACVSGKLCDPESDYNPGEEMTCGASFAYIYFISFYMLCAFLIINLFV 1454

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1455 AVIMDNF 1461



 Score = 37.7 bits (86), Expect = 0.26
 Identities = 28/110 (25%), Positives = 47/110 (42%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N      D T    +      F+++P 
Sbjct: 665 LNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFN-----FDETQTKRS-----TFDNFPQ 714

Query: 594 GMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIV 445
            ++T+F +L   +W   M       G   S    +SFY I +    N I+
Sbjct: 715 ALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVSFYFIILFICGNYIL 764



 Score = 37.0 bits (84), Expect = 0.45
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            FNF++    M+ LF +     W   +     S +E  G  ++Y     ++FI + +I   
Sbjct: 1059 FNFDNVLMAMMALFTVSTFEGWPSLLYKAIDSNRENLGPIYNYRIEISIFFIIYIIIIAF 1118

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1119 FMMNIFVGFVIVNFQEQGEKE 1139



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 16/69 (23%), Positives = 34/69 (49%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G     +YF+S  ++   ++LNL++  +
Sbjct: 349 NFDNFLFAMLTVFQCITMEGWTDVLYWVNDAIGFGTPAIYFVSLIILGSFFVLNLVLGVL 408

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 409 SGEFSKERE 417



>sp|O57483|CCAS_RANCA Voltage-dependent L-type calcium channel
            alpha-1S subunit (Voltage- gated calcium channel alpha
            subunit Cav1.1) (FGalpha1S).>gb:AF037625_2469926 Rana
            catesbeiana dihydropyridine receptor mRNA, complete cds.
          Length = 1688

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 39/127 (30%), Positives = 63/127 (49%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +       +DGT ++ N     NF  +P  ++ LF
Sbjct: 1254 LPYVALLIVMLFFIYAVIGMQVFGKIAL-----VDGTHINRNS----NFQTFPQAVLLLF 1304

Query: 576  NLLVMGNWQ--LWMQSYKELT--------------GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  L   SY +L               GTS++Y YFISFY++    ++NL V
Sbjct: 1305 RCATGEAWQEILLACSYGKLCDPMSDFQPGEEYTCGTSFAYFYFISFYMLCAFLIINLFV 1364

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1365 AVIMDNF 1371



 Score = 40.4 bits (93), Expect = 0.041
 Identities = 30/120 (25%), Positives = 53/120 (44%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG            D  D +     F+ +P 
Sbjct: 552 LNSVRSIASLLLLLFLFMIIFALLGMQMFGGKF----------DFEDLEVRRSTFDTFPQ 601

Query: 594 GMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-VYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M     +Y   T +  S  +YFI  +V     LLN+ +A  ++
Sbjct: 602 ALITVFQILTGEDWTAVMYNGIMAYGGPTYSGMSVCIYFIILFVCGNYILLNVFLAIAVD 661



 Score = 40.0 bits (92), Expect = 0.053
 Identities = 21/81 (25%), Positives = 43/81 (53%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++  +GM++LF +     W   +     S+ E  G  ++Y     V+FI + ++   
Sbjct: 993  FHFDNVLSGMMSLFTISTFEGWPQLLYRAIDSHAEDMGPIYNYRIEIAVFFIVYIILIAF 1052

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1053 FMMNIFVGFVIVTFQEQGEQE 1073



 Score = 40.0 bits (92), Expect = 0.053
 Identities = 16/73 (21%), Positives = 37/73 (50%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           +F+++   M+T++  + M  W   +    +  G  W ++YF+S  ++   ++LNL++  +
Sbjct: 272 HFDNFGFAMLTVYQCITMEGWTEVLYWVNDAIGNEWPWIYFVSLILLGSFFVLNLVLGVL 331

Query: 435 LEAFQTEMDMETS 397
              F  E +   S
Sbjct: 332 SGEFTKEREKAKS 344



>gb:RABALP1A_1443562 Rabbit dihydropyridine-sensitive calcium channel
            alpha-1 subunit mRNA, complete cds.
          Length = 1873

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 38/127 (29%), Positives = 64/127 (50%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +       +DGT ++ N+    NF  +P  ++ LF
Sbjct: 1267 LPYVALLIVMLFFIYAVIGMQMFGKIAL-----VDGTQINRNN----NFQTFPQAVLLLF 1317

Query: 576  NLLVMGNWQ--LWMQSYKELT--------------GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  L   SY +L               GT+++Y YFISFY++    ++NL V
Sbjct: 1318 RCATGEAWQEILLACSYGKLCDPESDYAPGEEYTCGTNFAYYYFISFYMLCAFLIINLFV 1377

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1378 AVIMDNF 1384



 Score = 42.4 bits (98), Expect = 0.011
 Identities = 34/132 (25%), Positives = 58/132 (43%), Gaps = 5/132 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  I S+   L  +F  +  +  LG+Q+FGG            D  D +    NF+++P 
Sbjct: 553 LNSIRSIASLLLLLFLFIIIFALLGMQLFGGRY----------DFEDTEVRRSNFDNFPQ 602

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++++F +L   +W   M        G S+      +YFI  +V     LLN+ +A  ++
Sbjct: 603 ALISVFQVLTGEDWNSVMYNGIMAYGGPSYPGVLVCIYFIILFVCGNYILLNVFLAIAVD 662

Query: 429 AFQTEMDMETSA 394
               E +  TSA
Sbjct: 663 NL-AEAESLTSA 673



 Score = 38.9 bits (89), Expect = 0.12
 Identities = 15/73 (20%), Positives = 37/73 (50%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           +F+++   M+T++  + M  W   +    +  G  W ++YF++  ++   ++LNL++  +
Sbjct: 274 HFDNFGFSMLTVYQCITMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVL 333

Query: 435 LEAFQTEMDMETS 397
              F  E +   S
Sbjct: 334 SGEFTKEREKAKS 346



>sp|P07293|CCAS_RABIT Voltage-dependent L-type calcium channel
            alpha-1S subunit (Voltage- gated calcium channel alpha
            subunit Cav1.1) (Calcium channel, L type, alpha-1
            polypeptide, isoform 3, skeletal
            muscle).>pir|A30063|A30063 dihydropyridine receptor -
            rabbit>gb:OCDHPR_1442151 Rabbit mRNA for dihydropyridine
            (DHP) receptor (from skeletal
            muscle).>gb:AX546820_1470190 Sequence 21 from Patent
            WO02063000.
          Length = 1873

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 38/127 (29%), Positives = 64/127 (50%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +       +DGT ++ N+    NF  +P  ++ LF
Sbjct: 1267 LPYVALLIVMLFFIYAVIGMQMFGKIAL-----VDGTQINRNN----NFQTFPQAVLLLF 1317

Query: 576  NLLVMGNWQ--LWMQSYKELT--------------GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  L   SY +L               GT+++Y YFISFY++    ++NL V
Sbjct: 1318 RCATGEAWQEILLACSYGKLCDPESDYAPGEEYTCGTNFAYYYFISFYMLCAFLIINLFV 1377

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1378 AVIMDNF 1384



 Score = 42.4 bits (98), Expect = 0.011
 Identities = 34/132 (25%), Positives = 58/132 (43%), Gaps = 5/132 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  I S+   L  +F  +  +  LG+Q+FGG            D  D +    NF+++P 
Sbjct: 553 LNSIRSIASLLLLLFLFIIIFALLGMQLFGGRY----------DFEDTEVRRSNFDNFPQ 602

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++++F +L   +W   M        G S+      +YFI  +V     LLN+ +A  ++
Sbjct: 603 ALISVFQVLTGEDWNSVMYNGIMAYGGPSYPGVLVCIYFIILFVCGNYILLNVFLAIAVD 662

Query: 429 AFQTEMDMETSA 394
               E +  TSA
Sbjct: 663 NL-AEAESLTSA 673



 Score = 38.9 bits (89), Expect = 0.12
 Identities = 15/73 (20%), Positives = 37/73 (50%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           +F+++   M+T++  + M  W   +    +  G  W ++YF++  ++   ++LNL++  +
Sbjct: 274 HFDNFGFSMLTVYQCITMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVL 333

Query: 435 LEAFQTEMDMETS 397
              F  E +   S
Sbjct: 334 SGEFTKEREKAKS 346



>gb:AL139159_1920369 Human DNA sequence from clone RP5-894H24 on
            chromosome 1 Contains the 5' end of the CACNA1S gene for
            calcium channel voltage-dependent L type alpha 1S
            subunit, the TMEM9 gene for transmembrane protein 9 and a
            CpG island, complete sequence.>gb:AL358473_1925181 Human
            DNA sequence from clone RP11-168O16 on chromosome 1
            Contains the 5' end of the KIF21B gene for kinesin family
            member 21B, two novel genes and the 3' end of the CACNA1S
            gene for calcium channel voltage-dependent L type alpha
            1S subunit, complete sequence.
          Length = 1854

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 38/127 (29%), Positives = 64/127 (50%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +       +DGT ++ N+    NF  +P  ++ LF
Sbjct: 1248 LPYVALLIVMLFFIYAVIGMQMFGKIAL-----VDGTQINRNN----NFQTFPQAVLLLF 1298

Query: 576  NLLVMGNWQ--LWMQSYKELT--------------GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  L   SY +L               GT+++Y YFISFY++    ++NL V
Sbjct: 1299 RCATGEAWQEILLACSYGKLCDPESDYAPGEEYTCGTNFAYYYFISFYMLCAFLVINLFV 1358

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1359 AVIMDNF 1365



 Score = 43.9 bits (102), Expect = 0.004
 Identities = 36/140 (25%), Positives = 60/140 (42%), Gaps = 5/140 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  I S+   L  +F  +  +  LG+Q+FGG            D  D +    NF+++P 
Sbjct: 553 LNSIRSIASLLLLLFLFIVIFALLGMQLFGGRY----------DFEDTEVRRSNFDNFPQ 602

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++++F +L   +W   M        G S+      +YFI  +V     LLN+ +A  ++
Sbjct: 603 ALISVFQVLTGEDWTSMMYNGIMAYGGPSYPGMLVCIYFIILFVCGNYILLNVFLAIAVD 662

Query: 429 AFQTEMDMETSAICVDGENK 370
               E +  TSA     E K
Sbjct: 663 NL-AEAESLTSAQKAKAEEK 681



 Score = 38.9 bits (89), Expect = 0.12
 Identities = 15/73 (20%), Positives = 37/73 (50%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           +F+++   M+T++  + M  W   +    +  G  W ++YF++  ++   ++LNL++  +
Sbjct: 274 HFDNFGFSMLTVYQCITMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVL 333

Query: 435 LEAFQTEMDMETS 397
              F  E +   S
Sbjct: 334 SGEFTKEREKAKS 346



>gb:AL139159_1920368 Human DNA sequence from clone RP5-894H24 on
            chromosome 1 Contains the 5' end of the CACNA1S gene for
            calcium channel voltage-dependent L type alpha 1S
            subunit, the TMEM9 gene for transmembrane protein 9 and a
            CpG island, complete sequence.>gb:AL358473_1925182 Human
            DNA sequence from clone RP11-168O16 on chromosome 1
            Contains the 5' end of the KIF21B gene for kinesin family
            member 21B, two novel genes and the 3' end of the CACNA1S
            gene for calcium channel voltage-dependent L type alpha
            1S subunit, complete sequence.
          Length = 1873

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 38/127 (29%), Positives = 64/127 (50%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +       +DGT ++ N+    NF  +P  ++ LF
Sbjct: 1267 LPYVALLIVMLFFIYAVIGMQMFGKIAL-----VDGTQINRNN----NFQTFPQAVLLLF 1317

Query: 576  NLLVMGNWQ--LWMQSYKELT--------------GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  L   SY +L               GT+++Y YFISFY++    ++NL V
Sbjct: 1318 RCATGEAWQEILLACSYGKLCDPESDYAPGEEYTCGTNFAYYYFISFYMLCAFLVINLFV 1377

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1378 AVIMDNF 1384



 Score = 43.9 bits (102), Expect = 0.004
 Identities = 36/140 (25%), Positives = 60/140 (42%), Gaps = 5/140 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  I S+   L  +F  +  +  LG+Q+FGG            D  D +    NF+++P 
Sbjct: 553 LNSIRSIASLLLLLFLFIVIFALLGMQLFGGRY----------DFEDTEVRRSNFDNFPQ 602

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++++F +L   +W   M        G S+      +YFI  +V     LLN+ +A  ++
Sbjct: 603 ALISVFQVLTGEDWTSMMYNGIMAYGGPSYPGMLVCIYFIILFVCGNYILLNVFLAIAVD 662

Query: 429 AFQTEMDMETSAICVDGENK 370
               E +  TSA     E K
Sbjct: 663 NL-AEAESLTSAQKAKAEEK 681



 Score = 38.9 bits (89), Expect = 0.12
 Identities = 15/73 (20%), Positives = 37/73 (50%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           +F+++   M+T++  + M  W   +    +  G  W ++YF++  ++   ++LNL++  +
Sbjct: 274 HFDNFGFSMLTVYQCITMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVL 333

Query: 435 LEAFQTEMDMETS 397
              F  E +   S
Sbjct: 334 SGEFTKEREKAKS 346



>gb:AX546808_1470184 Sequence 9 from Patent WO02063000.
          Length = 1338

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 38/127 (29%), Positives = 64/127 (50%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753 MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
           +PY+  +  +L F Y  +G+Q+FG +       +DGT ++ N+    NF  +P  ++ LF
Sbjct: 632 LPYVALLIVMLFFIYAVIGMQMFGKIAL-----VDGTQINRNN----NFQTFPQAVLLLF 682

Query: 576 NLLVMGNWQ--LWMQSYKELT--------------GTSWSYVYFISFYVITVLWLLNLIV 445
                  WQ  L   SY +L               GT+++Y YFISFY++    ++NL V
Sbjct: 683 RCATGEAWQEILLACSYGKLCDPESDYAPGEEYTCGTNFAYYYFISFYMLCAFLVINLFV 742

Query: 444 AFVLEAF 424
           A +++ F
Sbjct: 743 AVIMDNF 749



>gb:AX546800_1470179 Sequence 1 from Patent WO02063000.
          Length = 1854

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 38/127 (29%), Positives = 64/127 (50%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +       +DGT ++ N+    NF  +P  ++ LF
Sbjct: 1248 LPYVALLIVMLFFIYAVIGMQMFGKIAL-----VDGTQINRNN----NFQTFPQAVLLLF 1298

Query: 576  NLLVMGNWQ--LWMQSYKELT--------------GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  L   SY +L               GT+++Y YFISFY++    ++NL V
Sbjct: 1299 RCATGEAWQEILLACSYGKLCDPESDYAPGEEYTCGTNFAYYYFISFYMLCAFLVINLFV 1358

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1359 AVIMDNF 1365



 Score = 43.9 bits (102), Expect = 0.004
 Identities = 38/142 (26%), Positives = 63/142 (44%), Gaps = 7/142 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  I S+   L  +F  +  +  LG+Q+FGG            D  D +    NF+++P 
Sbjct: 553 LNSIRSIASLLLLLFLFIVIFRLLGMQLFGGRY----------DFEDTEVRRSNFDNFPQ 602

Query: 594 GMVTLFNLLVMGNWQLWMQSYKELTGTSW-SY------VYFISFYVITVLWLLNLIVAFV 436
            ++++F +L   +W   M  Y  +  +S  SY      +YFI  +V     LLN+ +A  
Sbjct: 603 ALISVFQVLTGEDWTSMM--YNGIMASSGPSYPGMLVCIYFIILFVCGNYILLNVFLAIA 660

Query: 435 LEAFQTEMDMETSAICVDGENK 370
           ++    E +  TSA     E K
Sbjct: 661 VDNL-AEAESLTSAQKAKAEEK 681



 Score = 38.9 bits (89), Expect = 0.12
 Identities = 15/73 (20%), Positives = 37/73 (50%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           +F+++   M+T++  + M  W   +    +  G  W ++YF++  ++   ++LNL++  +
Sbjct: 274 HFDNFGFSMLTVYQCITMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVL 333

Query: 435 LEAFQTEMDMETS 397
              F  E +   S
Sbjct: 334 SGEFTKEREKAKS 346



>pir|A55645|A55645 calcium channel, voltage-dependent, protein alpha-1
            chain, skeletal muscle, dihydropyridine-sensitive -
            human>gb:AX546810_1470185 Sequence 11 from Patent
            WO02063000.>gb:AX546812_1470186 Sequence 13 from Patent
            WO02063000.>gb:HUMCACNLA_2029780 Human
            dihydropyridine-sensitive L-type calcium channel alpha-1
            subunit (CACNL1A3) mRNA, complete cds.
          Length = 1873

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 38/127 (29%), Positives = 64/127 (50%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +       +DGT ++ N+    NF  +P  ++ LF
Sbjct: 1267 LPYVALLIVMLFFIYAVIGMQMFGKIAL-----VDGTQINRNN----NFQTFPQAVLLLF 1317

Query: 576  NLLVMGNWQ--LWMQSYKELT--------------GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  L   SY +L               GT+++Y YFISFY++    ++NL V
Sbjct: 1318 RCATGEAWQEILLACSYGKLCDPESDYAPGEEYTCGTNFAYYYFISFYMLCAFLVINLFV 1377

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1378 AVIMDNF 1384



 Score = 43.9 bits (102), Expect = 0.004
 Identities = 38/142 (26%), Positives = 63/142 (44%), Gaps = 7/142 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  I S+   L  +F  +  +  LG+Q+FGG            D  D +    NF+++P 
Sbjct: 553 LNSIRSIASLLLLLFLFIVIFRLLGMQLFGGRY----------DFEDTEVRRSNFDNFPQ 602

Query: 594 GMVTLFNLLVMGNWQLWMQSYKELTGTSW-SY------VYFISFYVITVLWLLNLIVAFV 436
            ++++F +L   +W   M  Y  +  +S  SY      +YFI  +V     LLN+ +A  
Sbjct: 603 ALISVFQVLTGEDWTSMM--YNGIMASSGPSYPGMLVCIYFIILFVCGNYILLNVFLAIA 660

Query: 435 LEAFQTEMDMETSAICVDGENK 370
           ++    E +  TSA     E K
Sbjct: 661 VDNL-AEAESLTSAQKAKAEEK 681



 Score = 38.9 bits (89), Expect = 0.12
 Identities = 15/73 (20%), Positives = 37/73 (50%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           +F+++   M+T++  + M  W   +    +  G  W ++YF++  ++   ++LNL++  +
Sbjct: 274 HFDNFGFSMLTVYQCITMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVL 333

Query: 435 LEAFQTEMDMETS 397
              F  E +   S
Sbjct: 334 SGEFTKEREKAKS 346



>sp|Q13698|CCAS_HUMAN Voltage-dependent L-type calcium channel
            alpha-1S subunit (Voltage- gated calcium channel alpha
            subunit Cav1.1) (Calcium channel, L type, alpha-1
            polypeptide, isoform 3, skeletal muscle).
          Length = 1873

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 38/127 (29%), Positives = 64/127 (50%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +       +DGT ++ N+    NF  +P  ++ LF
Sbjct: 1267 LPYVALLIVMLFFIYAVIGMQMFGKIAL-----VDGTQINRNN----NFQTFPQAVLLLF 1317

Query: 576  NLLVMGNWQ--LWMQSYKELT--------------GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  L   SY +L               GT+++Y YFISFY++    ++NL V
Sbjct: 1318 RCATGEAWQEILLACSYGKLCDPESDYAPGEEYTCGTNFAYYYFISFYMLCAFLVINLFV 1377

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1378 AVIMDNF 1384



 Score = 43.9 bits (102), Expect = 0.004
 Identities = 36/140 (25%), Positives = 60/140 (42%), Gaps = 5/140 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  I S+   L  +F  +  +  LG+Q+FGG            D  D +    NF+++P 
Sbjct: 553 LNSIRSIASLLLLLFLFIVIFALLGMQLFGGRY----------DFEDTEVRRSNFDNFPQ 602

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++++F +L   +W   M        G S+      +YFI  +V     LLN+ +A  ++
Sbjct: 603 ALISVFQVLTGEDWTSMMYNGIMAYGGPSYPGMLVCIYFIILFVCGNYILLNVFLAIAVD 662

Query: 429 AFQTEMDMETSAICVDGENK 370
               E +  TSA     E K
Sbjct: 663 NL-AEAESLTSAQKAKAEEK 681



 Score = 38.9 bits (89), Expect = 0.12
 Identities = 15/73 (20%), Positives = 37/73 (50%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           +F+++   M+T++  + M  W   +    +  G  W ++YF++  ++   ++LNL++  +
Sbjct: 274 HFDNFGFSMLTVYQCITMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVL 333

Query: 435 LEAFQTEMDMETS 397
              F  E +   S
Sbjct: 334 SGEFTKEREKAKS 346



>gb:AX546804_1470181 Sequence 5 from Patent WO02063000.
          Length = 186

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 37/127 (29%), Positives = 62/127 (48%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753 MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
           +PY+  +  +L F Y  +G+Q+FG +       +DGT ++ N+    NF  +P  ++ LF
Sbjct: 61  LPYVALLIVMLFFIYAVIGMQMFGKIAM-----VDGTQINRNN----NFQTFPQAVLLLF 111

Query: 576 NLLVMGNWQ--LWMQSYKELT--------------GTSWSYVYFISFYVITVLWLLNLIV 445
                  WQ  L    Y +L               GT ++Y YFISFY++    ++NL V
Sbjct: 112 RCATGEAWQEILLACRYGQLCDPESDYLPGEEYTCGTDFAYYYFISFYMLCAFLIINLFV 171

Query: 444 AFVLEAF 424
           A +++ F
Sbjct: 172 AVIMDNF 178



>sp|Q02485|CCAS_RAT Voltage-dependent L-type calcium channel
           alpha-1S subunit (Voltage- gated calcium channel alpha
           subunit Cav1.1) (Calcium channel, L type, alpha-1
           polypeptide, isoform 3, skeletal muscle) (ROB1)
           (Fragment).>gb:RATCACAI_2131661 Rat
           dihydropyridine-sensitive L-type calcium channel alpha-1
           subunit (CCHL1A3) mRNA, 3' end.
          Length = 1146

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 37/127 (29%), Positives = 63/127 (49%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753 MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
           +PY+  +  +L F Y  +G+Q+FG +       +DGT ++ N+    NF  +P  ++ LF
Sbjct: 554 LPYVALLIVMLFFIYAVIGMQMFGKIAM-----VDGTQINRNN----NFQTFPQAVLLLF 604

Query: 576 NLLVMGNWQ--LWMQSYKE--------------LTGTSWSYVYFISFYVITVLWLLNLIV 445
                  WQ  L   SY +                GT+++Y YFISFY++    ++NL V
Sbjct: 605 RCATGEAWQEILLACSYGKRCDPESDYAPGEEYACGTNFAYYYFISFYMLCAFLIINLFV 664

Query: 444 AFVLEAF 424
           A +++ F
Sbjct: 665 AVIMDNF 671



 Score = 34.7 bits (78), Expect = 2.2
 Identities = 19/81 (23%), Positives = 42/81 (51%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618 FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
           F+F++  + M++LF +     W   +     S +E TG  ++      ++FI + ++   
Sbjct: 282 FHFDNVLSAMMSLFTVSTFEGWPQLLYKAIDSNEEDTGPVYNNRVEMAIFFIIYIILIAF 341

Query: 465 WLLNLIVAFVLEAFQTEMDME 403
           +++N+ V FV+  FQ + + E
Sbjct: 342 FMMNIFVGFVIVTFQEQGETE 362



>gb:AY528225_2536340 Danio rerio L-type calcium channel pore subunit
            isoform 1.3b (cav1.3b) mRNA, partial cds.
          Length = 2040

 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 33/127 (25%), Positives = 63/127 (49%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +       +DGT ++ N+    NF  +P  ++ LF
Sbjct: 1312 LPYVALLIAMLFFIYAVIGMQVFGKIAM-----VDGTSINRNN----NFQTFPQAVLLLF 1362

Query: 576  NLLVMGNWQLWMQSY----------------KELTGTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  M +                 ++  G++++ +YFISFY++    ++NL V
Sbjct: 1363 RCATGEAWQQIMLACLPGKLCDSESDYNPGEEKSCGSNFAILYFISFYMLCAFLIINLFV 1422

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1423 AVIMDNF 1429



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 22/81 (27%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            FNF++    M+ LF +     W   +     S KE  G  ++Y     ++FI + +I   
Sbjct: 1059 FNFDNVLMAMMALFTVSTFEGWPALLYKAIDSSKENIGPIYNYRVEISIFFIIYIIIIAF 1118

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1119 FMMNIFVGFVIVTFQEQGEKE 1139



 Score = 37.0 bits (84), Expect = 0.45
 Identities = 17/69 (24%), Positives = 34/69 (49%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G    +VYF+S  +    ++LNL++  +
Sbjct: 345 NFDNFLFAMLTVFQCITMEGWTDVLYWMNDAMGFELPWVYFVSLVIFGSFFVLNLVLGVL 404

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 405 SGEFSKERE 413



>gb:AF484081_1275755 Lymnaea stagnalis voltage-dependent L-type
           calcium channel alpha-1 subunit isoform c mRNA, complete
           cds, alternatively spliced.
          Length = 538

 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 36/149 (24%), Positives = 65/149 (43%), Gaps = 29/149 (19%)
 Frame = -2

Query: 768 LIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVN-----------AGNPNLDGTDLSDND-- 628
           ++P L   L  IF V+  Y  +GL++F G ++           +G+P + G   S +D  
Sbjct: 277 MVPLLHIALLVIF-VIIIYAIIGLELFYGKLHNACYKINSTEFSGDPRICGQGYSCDDIA 335

Query: 627 ----------------YLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVY 496
                           Y + NF+++   M+T+F  + M  W   +       G  W ++Y
Sbjct: 336 SGGEKGECREGWEGPNYGITNFDNFGLAMLTVFQCITMEGWTTVLYDVNNALGNEWPWIY 395

Query: 495 FISFYVITVLWLLNLIVAFVLEAFQTEMD 409
           FIS  +I   ++LNL++  +   F  E +
Sbjct: 396 FISLIIIGSFFVLNLVLGVLSGEFSKERE 424



>gb:AF484080_1275754 Lymnaea stagnalis voltage-dependent L-type
           calcium channel alpha-1 subunit isoform b mRNA, complete
           cds.
          Length = 2186

 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 36/149 (24%), Positives = 65/149 (43%), Gaps = 29/149 (19%)
 Frame = -2

Query: 768 LIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVN-----------AGNPNLDGTDLSDND-- 628
           ++P L   L  IF V+  Y  +GL++F G ++           +G+P + G   S +D  
Sbjct: 277 MVPLLHIALLVIF-VIIIYAIIGLELFYGKLHNACYKINSTEFSGDPRICGQGYSCDDIA 335

Query: 627 ----------------YLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVY 496
                           Y + NF+++   M+T+F  + M  W   +       G  W ++Y
Sbjct: 336 SGGEKGECREGWEGPNYGITNFDNFGLAMLTVFQCITMEGWTTVLYDVNNALGNEWPWIY 395

Query: 495 FISFYVITVLWLLNLIVAFVLEAFQTEMD 409
           FIS  +I   ++LNL++  +   F  E +
Sbjct: 396 FISLIIIGSFFVLNLVLGVLSGEFSKERE 424



 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 36/135 (26%), Positives = 62/135 (45%), Gaps = 25/135 (18%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLD-GTDLSDNDYLLFNFNDYPNGMVTL 580
            +PY+  +  +L F Y  +G+Q+FG +       LD  T +  N+    NF  +P+ ++ L
Sbjct: 1400 LPYVALLIVMLFFIYAVIGMQMFGRI------KLDYNTQIHPNN----NFQTFPHAVLVL 1449

Query: 579  FNLLVMGNWQLWMQSYKELT-----------------------GTSWSYVYFISFYVITV 469
            F      +WQ  M +  + T                       G  ++YVYFISFY++  
Sbjct: 1450 FRSATGESWQEIMLACSDKTAVKCDPAVIEHGVNVTDAEANRCGNDFAYVYFISFYILCS 1509

Query: 468  LWLLNLIVAFVLEAF 424
              ++NL VA +++ F
Sbjct: 1510 FLIINLFVAVIMDNF 1524



 Score = 45.8 bits (107), Expect = 0.001
 Identities = 28/97 (28%), Positives = 47/97 (48%), Gaps = 9/97 (9%)
 Frame = -2

Query: 666  NPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLLVMGNW----QLWMQSYKELTGTSWS-- 505
            +PN++      ND   FNF+D  NGM+TLF +     W       + S+ E  G   +  
Sbjct: 1136 SPNIEERKWKKND---FNFDDVSNGMLTLFTVSTFEGWPGLLYKSIDSHAEGKGPIQNSK 1192

Query: 504  ---YVYFISFYVITVLWLLNLIVAFVLEAFQTEMDME 403
                V++  F ++   +++N+ V FV+  FQ E + E
Sbjct: 1193 PAVAVFYFIFIIVIAFFMMNIFVGFVIVTFQNEGEQE 1229



 Score = 33.5 bits (75), Expect = 5.0
 Identities = 25/120 (20%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N              +    NF+ +  
Sbjct: 646 LNSMRSIASLLLLLFLFIVIFALLGMQLFGGKFN----------FPQGEKPRSNFDTFWP 695

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWSYV----YFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M    +   G  +  +    YF+  +++    LLN+ +A  ++
Sbjct: 696 SLLTVFQILTGEDWNAVMYDGIRAYDGVKFPGILVCLYFVVLFIVGNYILLNVFLAIAVD 755



>gb:AF484079_1275753 Lymnaea stagnalis voltage-dependent L-type
           calcium channel alpha-1 subunit isoform a mRNA, complete
           cds.
          Length = 2078

 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 36/149 (24%), Positives = 65/149 (43%), Gaps = 29/149 (19%)
 Frame = -2

Query: 768 LIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVN-----------AGNPNLDGTDLSDND-- 628
           ++P L   L  IF V+  Y  +GL++F G ++           +G+P + G   S +D  
Sbjct: 165 MVPLLHIALLVIF-VIIIYAIIGLELFYGKLHNACYKINSTEFSGDPRICGQGYSCDDIA 223

Query: 627 ----------------YLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVY 496
                           Y + NF+++   M+T+F  + M  W   +       G  W ++Y
Sbjct: 224 SGGEKGECREGWEGPNYGITNFDNFGLAMLTVFQCITMEGWTTVLYDVNNALGNEWPWIY 283

Query: 495 FISFYVITVLWLLNLIVAFVLEAFQTEMD 409
           FIS  +I   ++LNL++  +   F  E +
Sbjct: 284 FISLIIIGSFFVLNLVLGVLSGEFSKERE 312



 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 36/135 (26%), Positives = 62/135 (45%), Gaps = 25/135 (18%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLD-GTDLSDNDYLLFNFNDYPNGMVTL 580
            +PY+  +  +L F Y  +G+Q+FG +       LD  T +  N+    NF  +P+ ++ L
Sbjct: 1288 LPYVALLIVMLFFIYAVIGMQMFGRI------KLDYNTQIHPNN----NFQTFPHAVLVL 1337

Query: 579  FNLLVMGNWQLWMQSYKELT-----------------------GTSWSYVYFISFYVITV 469
            F      +WQ  M +  + T                       G  ++YVYFISFY++  
Sbjct: 1338 FRSATGESWQEIMLACSDKTAVKCDPAVIEHGVNVTDAEANRCGNDFAYVYFISFYILCS 1397

Query: 468  LWLLNLIVAFVLEAF 424
              ++NL VA +++ F
Sbjct: 1398 FLIINLFVAVIMDNF 1412



 Score = 45.8 bits (107), Expect = 0.001
 Identities = 28/97 (28%), Positives = 47/97 (48%), Gaps = 9/97 (9%)
 Frame = -2

Query: 666  NPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLLVMGNW----QLWMQSYKELTGTSWS-- 505
            +PN++      ND   FNF+D  NGM+TLF +     W       + S+ E  G   +  
Sbjct: 1024 SPNIEERKWKKND---FNFDDVSNGMLTLFTVSTFEGWPGLLYKSIDSHAEGKGPIQNSK 1080

Query: 504  ---YVYFISFYVITVLWLLNLIVAFVLEAFQTEMDME 403
                V++  F ++   +++N+ V FV+  FQ E + E
Sbjct: 1081 PAVAVFYFIFIIVIAFFMMNIFVGFVIVTFQNEGEQE 1117



 Score = 33.5 bits (75), Expect = 5.0
 Identities = 25/120 (20%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N              +    NF+ +  
Sbjct: 534 LNSMRSIASLLLLLFLFIVIFALLGMQLFGGKFN----------FPQGEKPRSNFDTFWP 583

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWSYV----YFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M    +   G  +  +    YF+  +++    LLN+ +A  ++
Sbjct: 584 SLLTVFQILTGEDWNAVMYDGIRAYDGVKFPGILVCLYFVVLFIVGNYILLNVFLAIAVD 643



>gb:AF026198_2469209 Fugu rubripes neural cell adhesion molecule L1
            homolog (L1-CAM) gene, complete cds; putative protein 1
            (PUT1) gene, partial cds; mitosis-specific chromosome
            segregation protein SMC1 homolog (SMC1) gene, complete
            cds; and calcium channel alpha-1 subunit homolog (CCA1)
            and putative protein 2 (PUT2) genes, partial cds,
            complete sequence.
          Length = 1559

 Score = 52.8 bits (125), Expect = 8e-06
 Identities = 36/127 (28%), Positives = 63/127 (49%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +P++  +  +L F Y  +G+QIFG +       LDGT +  N+    NF  +P  ++ LF
Sbjct: 1273 LPHVALLIVMLFFIYAVIGMQIFGKVAL-----LDGTQIHRNN----NFQTFPQAVLMLF 1323

Query: 576  NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                  +WQ  M +                +E T G++++ +YF+SFY +    +LNL V
Sbjct: 1324 RCATGEDWQEVMMASMYGKKCDPKSDFLPGEEYTCGSNFAVIYFLSFYCLCAFLILNLFV 1383

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1384 AVIMDNF 1390



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 35/140 (25%), Positives = 59/140 (42%), Gaps = 5/140 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N           SD+     NF+++P 
Sbjct: 561 LNSVRSIASLLLLLFLFIVIFSLLGMQVFGGKFN----------FSDHRPRRSNFDNFPQ 610

Query: 594 GMVTLFNLLVMGNWQLWMQSYKELTGTS-----WSYVYFISFYVITVLWLLNLIVAFVLE 430
            ++++F +L    W   M +     G          +YFI  +V     LLN+ +A  ++
Sbjct: 611 ALISVFQILTGEEWTNIMYNGIMAYGGPVIPGILVSIYFIVLFVCGNYILLNVFLAIAVD 670

Query: 429 AFQTEMDMETSAICVDGENK 370
               E +  TSA     E K
Sbjct: 671 NL-AEAESLTSAQKEKAEEK 689



 Score = 36.2 bits (82), Expect = 0.77
 Identities = 21/81 (25%), Positives = 41/81 (50%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            FNF++   GM+ LF +  +  W   +     S KE  G  ++      ++FI + ++   
Sbjct: 1005 FNFDNVLYGMLALFTVSTIEGWPELLYRAIDSDKEDMGPVFNNRVDVSIFFIVYIILIAF 1064

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1065 FMMNIFVGFVIVTFQEQGEQE 1085



 Score = 36.2 bits (82), Expect = 0.77
 Identities = 15/73 (20%), Positives = 35/73 (47%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           +F++    M+T++  + M  W   +    +  G  W ++YF+   ++   ++LNL++  +
Sbjct: 282 HFDNIGFAMLTVYQCITMEGWTKVLYWVNDAIGNEWPWLYFVPLILLGSFFVLNLVLGVL 341

Query: 435 LEAFQTEMDMETS 397
              F  E +   S
Sbjct: 342 SGEFTKEREKARS 354



>pir|T30535|T30535 calcium channel alpha-1 chain homolog - Fugu
            rubripes  (fragment)
          Length = 1559

 Score = 52.8 bits (125), Expect = 8e-06
 Identities = 36/127 (28%), Positives = 63/127 (49%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +P++  +  +L F Y  +G+QIFG +       LDGT +  N+    NF  +P  ++ LF
Sbjct: 1273 LPHVALLIVMLFFIYAVIGMQIFGKVAL-----LDGTQIHRNN----NFQTFPQAVLMLF 1323

Query: 576  NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                  +WQ  M +                +E T G++++ +YF+SFY +    +LNL V
Sbjct: 1324 RCATGEDWQEVMMASMYGKKCDPKSDFLPGEEYTCGSNFAVIYFLSFYCLCAFLILNLFV 1383

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1384 AVIMDNF 1390



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 35/140 (25%), Positives = 59/140 (42%), Gaps = 5/140 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N           SD+     NF+++P 
Sbjct: 561 LNSVRSIASLLLLLFLFIVIFSLLGMQVFGGKFN----------FSDHRPRRSNFDNFPQ 610

Query: 594 GMVTLFNLLVMGNWQLWMQSYKELTGTS-----WSYVYFISFYVITVLWLLNLIVAFVLE 430
            ++++F +L    W   M +     G          +YFI  +V     LLN+ +A  ++
Sbjct: 611 ALISVFQILTGEEWTNIMYNGIMAYGGPVIPGILVSIYFIVLFVCGNYILLNVFLAIAVD 670

Query: 429 AFQTEMDMETSAICVDGENK 370
               E +  TSA     E K
Sbjct: 671 NL-AEAESLTSAQKEKAEEK 689



 Score = 36.2 bits (82), Expect = 0.77
 Identities = 21/81 (25%), Positives = 41/81 (50%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            FNF++   GM+ LF +  +  W   +     S KE  G  ++      ++FI + ++   
Sbjct: 1005 FNFDNVLYGMLALFTVSTIEGWPELLYRAIDSDKEDMGPVFNNRVDVSIFFIVYIILIAF 1064

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1065 FMMNIFVGFVIVTFQEQGEQE 1085



 Score = 36.2 bits (82), Expect = 0.77
 Identities = 15/73 (20%), Positives = 35/73 (47%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           +F++    M+T++  + M  W   +    +  G  W ++YF+   ++   ++LNL++  +
Sbjct: 282 HFDNIGFAMLTVYQCITMEGWTKVLYWVNDAIGNEWPWLYFVPLILLGSFFVLNLVLGVL 341

Query: 435 LEAFQTEMDMETS 397
              F  E +   S
Sbjct: 342 SGEFTKEREKARS 354



>gb:HSCACNLA42_2011225 Human dihydropyridine receptor alpha 1 subunit
            (CACNL1A3) gene, exon 44, and complete cds.
          Length = 1871

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 39/129 (30%), Positives = 66/129 (51%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +       +DGT ++ N+    NF  +P  ++ LF
Sbjct: 1263 LPYVALLIVMLFFIYAVIGMQMFGKIAL-----VDGTQINRNN----NFQTFPQAVLLLF 1313

Query: 576  -NLLVMGN-WQ--LWMQSYKELT--------------GTSWSYVYFISFYVITVLWLLNL 451
             +    G  WQ  L   SY +L               GT+++Y YFISFY++    ++NL
Sbjct: 1314 RHACATGEAWQEILLACSYGKLCDPESDYAPGEEYTCGTNFAYYYFISFYMLCAFLVINL 1373

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1374 FVAVIMDNF 1382



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 36/140 (25%), Positives = 60/140 (42%), Gaps = 5/140 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  I S+   L  +F  +  +  LG+Q+FGG            D  D +    NF+++P 
Sbjct: 553 LNSIRSIASLLLLLFLFIVIFRLLGMQLFGGRY----------DFEDTEVRRSNFDNFPQ 602

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++++F +L   +W   M        G S+      +YFI  +V     LLN+ +A  ++
Sbjct: 603 ALISVFQVLTGEDWTSMMYNGIMAYRGPSYPGMLVCIYFIILFVCGNYILLNVFLAIAVD 662

Query: 429 AFQTEMDMETSAICVDGENK 370
               E +  TSA     E K
Sbjct: 663 NL-AEAESLTSAQKAKAEEK 681



 Score = 38.9 bits (89), Expect = 0.12
 Identities = 15/73 (20%), Positives = 37/73 (50%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           +F+++   M+T++  + M  W   +    +  G  W ++YF++  ++   ++LNL++  +
Sbjct: 274 HFDNFGFSMLTVYQCITMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVL 333

Query: 435 LEAFQTEMDMETS 397
              F  E +   S
Sbjct: 334 SGEFTKEREKAKS 346



>gb:AY528224_2536339 Danio rerio L-type calcium channel pore subunit
            isoform 1.3a (cav1.3a) mRNA, complete cds.
          Length = 2082

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 34/127 (26%), Positives = 64/127 (50%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +       +D T ++ N+    NF  +P  ++ LF
Sbjct: 1278 LPYVALLIAMLFFIYAVIGMQVFGKIAM-----VDHTQINRNN----NFQTFPQAVLLLF 1328

Query: 576  NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  M +                +E+T G+S++ +YFI+FY++    ++NL V
Sbjct: 1329 RCATGEAWQEIMLACMPGKLCDPESDYNPGEEMTCGSSFAIIYFITFYMLCAFLIINLFV 1388

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1389 AVIMDNF 1395



 Score = 40.0 bits (92), Expect = 0.053
 Identities = 30/152 (19%), Positives = 65/152 (42%), Gaps = 31/152 (20%)
 Frame = -2

Query: 771 TLIPSLMPYLGT---IFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYL------- 622
           ++I +++P L     +  V+  Y  +GL++F G ++A +    GTD+ +++         
Sbjct: 224 SIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHA-SCYFQGTDILEDEPAPCAVNGH 282

Query: 621 ---------------------LFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWS 505
                                + NF+++   M+T+F  + M  W   +    +  G    
Sbjct: 283 GRTCPINGTLCKEGWQGPNGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMNDAMGLELP 342

Query: 504 YVYFISFYVITVLWLLNLIVAFVLEAFQTEMD 409
           +VYF+S  +    ++LNL++  +   F  E +
Sbjct: 343 WVYFVSLVIFGSFFVLNLVLGVLSGEFSKERE 374



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            FNF++    M+ LF +     W   +     S +E  G  ++Y     ++FI + +I   
Sbjct: 1025 FNFDNVLMAMMALFTVSTFEGWPALLYKAIDSNRENMGPIYNYRVEISIFFIIYIIIIAF 1084

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1085 FMMNIFVGFVIVTFQEQGEKE 1105



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 30/120 (25%), Positives = 53/120 (44%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N      D T    +      F+++P 
Sbjct: 628 LNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFN-----FDETQTKRS-----TFDNFPQ 677

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S S     +YFI  ++     LLN+ +A  ++
Sbjct: 678 ALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVD 737



>gb:AL714030_2504395 Zebrafish DNA sequence from clone BUSM1-223C6 in
            linkage group 11 Contains part of a novel gene similar to
            CACNA1D (voltage-dependent calcium channel L type, alpha
            1D subunit) and a CpG island, complete sequence.
          Length = 1374

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 34/127 (26%), Positives = 64/127 (50%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +       +D T ++ N+    NF  +P  ++ LF
Sbjct: 912  LPYVALLIAMLFFIYAVIGMQVFGKIAM-----VDHTQINRNN----NFQTFPQAVLLLF 962

Query: 576  NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  M +                +E+T G+S++ +YFI+FY++    ++NL V
Sbjct: 963  RCATGEAWQEIMLACMPGKLCDPESDYNPGEEMTCGSSFAIIYFITFYMLCAFLIINLFV 1022

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1023 AVIMDNF 1029



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618 FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
           FNF++    M+ LF +     W   +     S +E  G  ++Y     ++FI + +I   
Sbjct: 631 FNFDNVLMAMMALFTVSTFEGWPALLYKAIDSNRENMGPIYNYRVEISIFFIIYIIIIAF 690

Query: 465 WLLNLIVAFVLEAFQTEMDME 403
           +++N+ V FV+  FQ + + E
Sbjct: 691 FMMNIFVGFVIVTFQEQGEKE 711



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 30/120 (25%), Positives = 53/120 (44%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N      D T    +      F+++P 
Sbjct: 252 LNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFN-----FDETQTKRS-----TFDNFPQ 301

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S S     +YFI  ++     LLN+ +A  ++
Sbjct: 302 ALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVD 361



>gb:AL713850_2504385 Zebrafish DNA sequence from clone BUSM1-136D19
           in linkage group 11 Contains a novel gene for an opsin,
           part of a novel gene similar to sil ( voltage-gated
           L-type calcium channel subunit), part of a novel gene
           for a protein similar to calcium channel proteins and
           two CpG islands, complete sequence.
          Length = 810

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 34/127 (26%), Positives = 64/127 (50%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753 MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
           +PY+  +  +L F Y  +G+Q+FG +       +D T ++ N+    NF  +P  ++ LF
Sbjct: 258 LPYVALLIAMLFFIYAVIGMQVFGKIAM-----VDHTQINRNN----NFQTFPQAVLLLF 308

Query: 576 NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                  WQ  M +                +E+T G+S++ +YFI+FY++    ++NL V
Sbjct: 309 RCATGEAWQEIMLACMPGKLCDPESDYNPGEEMTCGSSFAIIYFITFYMLCAFLIINLFV 368

Query: 444 AFVLEAF 424
           A +++ F
Sbjct: 369 AVIMDNF 375



>gb:MMU579852_2122613 Mus musculus mRNA for L-type
            dihydropyridine-sensitive calcium channel alpha-1f
            subunit (Cav1.4 gene), strain C57Bl6.
          Length = 1984

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 35/127 (27%), Positives = 63/127 (49%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  ++ F Y  +G+Q+FG +        DGT ++ N+    NF  +P  ++ LF
Sbjct: 1330 LPYVALLIAMIFFIYAVIGMQMFGKVALQ-----DGTQINRNN----NFQTFPQAVLLLF 1380

Query: 576  NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  M +                +E T G+S++ VYFISF+++    ++NL V
Sbjct: 1381 RCATGEAWQEIMLASLPGNRCDPESDFGPGEEFTCGSSFAIVYFISFFMLCAFLIINLFV 1440

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1441 AVIMDNF 1447



 Score = 37.4 bits (85), Expect = 0.34
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQ---LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIV 445
           NF+++   M+T+F  + M  W     WMQ   +  G    +VYF+S  +    ++LNL++
Sbjct: 312 NFDNFFFAMLTVFQCITMEGWTDVLYWMQ---DAMGYELPWVYFVSLVIFGSFFVLNLVL 368

Query: 444 AFVLEAFQTEMD 409
             +   F  E +
Sbjct: 369 GVLSGEFSKERE 380



 Score = 36.6 bits (83), Expect = 0.59
 Identities = 29/120 (24%), Positives = 52/120 (43%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG       N D T    +      F+ +P 
Sbjct: 650 LNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKF-----NFDQTHTKRS-----TFDTFPQ 699

Query: 594 GMVTLFNLLVMGNWQLWMQSYKELTGTSW-----SYVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W + M       G  +       VYFI  ++     LLN+ +A  ++
Sbjct: 700 ALLTVFQILTGEDWNVVMYDGIMAYGGPFFPGMLVCVYFIILFICGNYILLNVFLAIAVD 759



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            FNF++  + M+ LF +     W   +     +  E  G  ++Y     V+FI + +I   
Sbjct: 1070 FNFDNVLSAMMALFTVSTFEGWPALLYKAIDANAEDEGPIYNYHVEISVFFIVYIIIIAF 1129

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  F+ + + E
Sbjct: 1130 FMMNIFVGFVIITFRAQGEQE 1150



>pir|T43262|T43262 calcium channel alpha-1 chain, L-type - Stylophora
            pistillata>gb:SPU64465_1398026 Stylophora pistillata
            L-type calcium channel alpha-1 subunit (STPCACHL) mRNA,
            complete cds.
          Length = 1891

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 34/128 (26%), Positives = 59/128 (46%), Gaps = 18/128 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  ++ F Y  +G+Q+FG +    +     T ++ N+    NF  +P  ++ LF
Sbjct: 1296 LPYVALLIVMMFFIYAVIGMQMFGRIAINSD-----TAINRNN----NFQTFPQSLMVLF 1346

Query: 576  NLLVMGNWQLWM-----------------QSYKELTGTSWSYVYFISFYVITVLWLLNLI 448
                  NWQ  M                 Q    L G+ ++Y YF+SFY I    ++NL 
Sbjct: 1347 RSATGENWQQIMLACTHRDDVKCDQNADPQEPSGLCGSDFAYFYFVSFYSICSFLIINLF 1406

Query: 447  VAFVLEAF 424
            VA +++ F
Sbjct: 1407 VAVIMDNF 1414



 Score = 45.8 bits (107), Expect = 0.001
 Identities = 29/132 (21%), Positives = 58/132 (43%), Gaps = 11/132 (8%)
 Frame = -2

Query: 777  FLTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLL--FNFND 604
            FL  +  +  + GT F           +  G  ++   P L    + + ++    FNF++
Sbjct: 991  FLFAVIGVQLFKGTFFSCNDEKILTAEECQGNYIDFKGPGLSNPVVKEREWRRHDFNFDN 1050

Query: 603  YPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYVITVLWLLNL 451
              N M+TLF ++    W   +++  + T            W  +Y+I + +I   +++N+
Sbjct: 1051 VGNAMLTLFTVMTFEGWPGILENSIDSTEVDKGPNQNNRPWVAIYYIIYIIIIAFFMVNI 1110

Query: 450  IVAFVLEAFQTE 415
             V FV+  FQ+E
Sbjct: 1111 FVGFVIVTFQSE 1122



 Score = 37.4 bits (85), Expect = 0.34
 Identities = 31/123 (25%), Positives = 55/123 (44%), Gaps = 11/123 (8%)
 Frame = -2

Query: 738 TIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLLVMG 559
           ++F ++C    LG+QIFGG  N            D++    NF+ +   ++T+F +L   
Sbjct: 604 SLFMLICSL--LGMQIFGGKFNT----------DDDEIPRSNFDSFWRALITVFQILTGE 651

Query: 558 NWQLWMQSYKEL------TGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQ-----TEM 412
           +W   M             G++ + +YFI   V+    LLN+ +A  ++        TEM
Sbjct: 652 DWNAVMYDGIRAWGGIGEGGSAIAILYFIFLVVVGNYILLNVFLAIAVDNLADAENLTEM 711

Query: 411 DME 403
           + E
Sbjct: 712 EEE 714



 Score = 37.0 bits (84), Expect = 0.45
 Identities = 16/67 (23%), Positives = 33/67 (49%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF++     +T+F  + +  W   +    +  G SW +VYF++  +    ++LNL++  +
Sbjct: 291 NFDNIGLACMTVFQCITLEGWTDVLYWINDAVGNSWPWVYFVTLIIWGSFFVLNLVLGVL 350

Query: 435 LEAFQTE 415
              F  E
Sbjct: 351 SGEFAKE 357



>gb:AY495698_2534966 Danio rerio skeletal muscle L-type calcium
            channel alpha1S subunit mRNA, complete cds.
          Length = 1847

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 34/127 (26%), Positives = 64/127 (50%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +P++G +  +L F Y  +G+Q+FG +       +DGT+++ N+    NF  +P  ++ LF
Sbjct: 1292 LPHVGLLIVMLFFIYAVIGMQMFGKIAL-----VDGTEINRNN----NFQTFPQAVLLLF 1342

Query: 576  NLLVMGNWQLWMQS--YKELT--------------GTSWSYVYFISFYVITVLWLLNLIV 445
             +     W   M +  Y +L               G+S +  YF+SFY++    ++NL V
Sbjct: 1343 RVATGEQWPKIMLASMYGKLCDPKSDYGPGEEYTCGSSIAVCYFLSFYMLCAFLVINLFV 1402

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1403 AIIMDNF 1409



 Score = 42.7 bits (99), Expect = 0.008
 Identities = 30/120 (25%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            D      NF+++P 
Sbjct: 572 LNSVKSIASLLLLLFLFIVIFALLGMQVFGGKFN----------FPDRPIQRSNFDNFPQ 621

Query: 594 GMVTLFNLLVMGNWQLWMQSYKELTGTSWS-----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++++F +L    W   M +     G   S      +YFI  YV     LLN+ +A  ++
Sbjct: 622 ALISVFQVLTGEEWDTIMYNGIMAHGGPKSPGILVSIYFIILYVCGNFVLLNVFLAIAVD 681



 Score = 41.6 bits (96), Expect = 0.018
 Identities = 20/97 (20%), Positives = 47/97 (48%), Gaps = 4/97 (4%)
 Frame = -2

Query: 675 NAGNPNLDGTDLSDN----DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSW 508
           N     ++GT+  D     ++ + +F+++   M+T+F  +   +W   +    +  G  W
Sbjct: 270 NGRRCTINGTECRDGWPGPNFGITHFDNFGFAMLTVFQCITTESWTDVLYWINDAMGNDW 329

Query: 507 SYVYFISFYVITVLWLLNLIVAFVLEAFQTEMDMETS 397
            ++YF+S  ++   ++LNL++  +   F  E +   S
Sbjct: 330 PWIYFLSLIMLGSFFILNLVLGVLSGEFTKEREKSRS 366



 Score = 41.2 bits (95), Expect = 0.024
 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            FNF++  NGM+ LF +     W   +     SY   TG  ++      ++FI + +I   
Sbjct: 1015 FNFDNVLNGMLALFTISTFEGWPEILYKAIDSYDVDTGPLYNNRVGISIFFIIYIIIIAF 1074

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1075 FMMNIFVGFVIVTFQRQGEQE 1095



>sp|Q25452|CCAM_MUSDO Muscle calcium channel alpha-1 subunit
            (MDL-alpha1).>pir|S41742|S41742 calcium channel
            alpha-1-chain - house fly>gb:MDVDCCA1_1389547 M.domestica
            mRNA for voltage dependent calcium channel alpha1
            subunit.
          Length = 1687

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 34/125 (27%), Positives = 59/125 (47%), Gaps = 15/125 (12%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG ++       +GT +  N+    NF  +P  ++ LF
Sbjct: 1255 LPYVALLIVMLFFIYAVIGMQVFGKIMLE-----EGTSIDRNN----NFQTFPQAVLVLF 1305

Query: 576  NLLVMGNWQLWMQSYKELT--------------GTSWSYVYFISFYVITVLWLLNLIVAF 439
                   WQ  M +                   G+S ++ YFISFYV+    ++NL VA 
Sbjct: 1306 RSATGEAWQEIMMACSPRDDVKCDPESDAVNNCGSSIAFPYFISFYVLCSFLIINLFVAV 1365

Query: 438  VLEAF 424
            +++ F
Sbjct: 1366 IMDNF 1370



 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 28/105 (26%), Positives = 52/105 (49%)
 Frame = -2

Query: 729 CVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLLVMGNWQ 550
           C + F C  G + F   V    PN DG         + NF+++   M+T+F  + +  W 
Sbjct: 242 CGVGFKCPSGYECFDDWVG---PN-DG---------ITNFDNFGLSMLTVFQCITLEGWT 288

Query: 549 LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQTE 415
             + S ++  G+SW ++YF+S  ++   +++NLI+  +   F  E
Sbjct: 289 DVLYSIQDAMGSSWEWIYFVSMVILGAFFVMNLILGVLSGEFSKE 333



 Score = 42.0 bits (97), Expect = 0.014
 Identities = 28/109 (25%), Positives = 49/109 (44%), Gaps = 9/109 (8%)
 Frame = -2

Query: 702  GLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLLVMGNWQLWM----QS 535
            G  +F    +   P L   +  +N    F+F+D    M+TLF +     W   +     S
Sbjct: 961  GTYLFYENGDINKPRLKEREWKNNK---FHFDDVAKAMLTLFTVSTFEGWPTLLYVSIDS 1017

Query: 534  YKELTGTSWSY-----VYFISFYVITVLWLLNLIVAFVLEAFQTEMDME 403
             KE  G  +++      Y+I + +I   +++N+ V FV+  FQ E + E
Sbjct: 1018 NKENGGPIYNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTFQNEGEQE 1066



 Score = 37.0 bits (84), Expect = 0.45
 Identities = 27/120 (22%), Positives = 53/120 (44%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  I S+   L  +F  +  +  LG+Q+FGG           T   + +    NF+ +  
Sbjct: 555 LNSIQSIASLLLLLFLFIVIFGLLGMQVFGGRF---------TFKPEEEKPRSNFDSFYQ 605

Query: 594 GMVTLFNLLVMGNWQLWMQSYKELTGTSWSY-----VYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W + M       G  +S+     +Y+I  ++     LLN+ +A  ++
Sbjct: 606 SLLTVFQILTGEDWNVVMYDGIRAYGGVFSFGIVACIYYIILFICGNYILLNVFLAIAVD 665



>sp|Q9JIS7|CCAF_MOUSE Voltage-dependent L-type calcium channel
            alpha-1F subunit (Voltage- gated calcium channel alpha
            subunit Cav1.4).>gb:AF192497_2058549 Mus musculus L-type
            dihydropyridine-sensitive calcium channel alpha-1f
            subunit (Cacna1f) mRNA, complete cds.
          Length = 1985

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 35/127 (27%), Positives = 63/127 (49%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  ++ F Y  +G+Q+FG +        DGT ++ N+    NF  +P  ++ LF
Sbjct: 1332 LPYVALLIAMIFFIYAVIGMQMFGLVALQ-----DGTQINRNN----NFQTFPQAVLLLF 1382

Query: 576  NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  M +                +E T G+S++ VYFISF+++    ++NL V
Sbjct: 1383 RCATGEAWQEIMLASLPGNRCDPESDFGPGEEFTCGSSFAIVYFISFFMLCAFLIINLFV 1442

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1443 AVIMDNF 1449



 Score = 37.4 bits (85), Expect = 0.34
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQ---LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIV 445
           NF+++   M+T+F  + M  W     WMQ   +  G    +VYF+S  +    ++LNL++
Sbjct: 312 NFDNFFFAMLTVFQCITMEGWTDVLYWMQ---DAMGYELPWVYFVSLVIFGSFFVLNLVL 368

Query: 444 AFVLEAFQTEMD 409
             +   F  E +
Sbjct: 369 GVLSGEFSKERE 380



 Score = 36.6 bits (83), Expect = 0.59
 Identities = 29/120 (24%), Positives = 52/120 (43%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG       N D T    +      F+ +P 
Sbjct: 650 LNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKF-----NFDQTHTKRS-----TFDTFPQ 699

Query: 594 GMVTLFNLLVMGNWQLWMQSYKELTGTSW-----SYVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W + M       G  +       VYFI  ++     LLN+ +A  ++
Sbjct: 700 ALLTVFQILTGEDWNVVMYDGIMAYGGPFFPGMLVCVYFIILFICGNYILLNVFLAIAVD 759



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            FNF++  + M+ LF +     W   +     +  E  G  ++Y     V+FI + +I   
Sbjct: 1072 FNFDNVLSAMMALFTVSTFEGWPALLYKAIDANAEDEGPIYNYHVEISVFFIVYIIIIAF 1131

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  F+ + + E
Sbjct: 1132 FMMNIFVGFVIITFRAQGEQE 1152



>gb:AB013604_1193456 Halocynthia roretzi mRNA for ascidian calcium
            channel alpha1-subunit, complete cds.
          Length = 2125

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 38/141 (26%), Positives = 65/141 (46%), Gaps = 23/141 (16%)
 Frame = -2

Query: 777  FLTLIPSLMPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDY 601
            F+   P+L PY+  +  +L F Y  +G+QIFG +     PN DG+ ++ N+    NF  +
Sbjct: 1246 FIKSFPAL-PYVALLIIMLFFIYAVIGMQIFGKI----KPN-DGSQINRNN----NFQTF 1295

Query: 600  PNGMVTLFNLLVMGNWQLWMQ----------------------SYKELTGTSWSYVYFIS 487
               ++ LF      +WQ  M                       S K   G  ++Y YF++
Sbjct: 1296 LQAVLLLFRCATGESWQEVMLACASGNECDDESDWNYYGDKDISAKFTCGNDFAYTYFLT 1355

Query: 486  FYVITVLWLLNLIVAFVLEAF 424
            FY++    ++NL VA +++ F
Sbjct: 1356 FYMLCAFLIINLFVAVIMDNF 1376



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 33/149 (22%), Positives = 63/149 (42%), Gaps = 29/149 (19%)
 Frame = -2

Query: 768 LIPSLMPYLGTIFCVLCFYCSLGLQIFGG---------------MVNAGNPNLD------ 652
           ++P L   L  IF V+  Y  +GL++F G               M +   P  D      
Sbjct: 178 MVPLLHIALLVIF-VIIIYAVVGLELFKGKLHKTCYHNEVAVLIMEDEAKPCADSDSWGR 236

Query: 651 ---GTDLSDNDYL-----LFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVY 496
              G  + ++D+      + NF+ +   ++T+F  + M  W   +    +  G  W ++Y
Sbjct: 237 HCSGGMICESDWAGPSKGIINFDTFYFAVITVFQCITMEGWTDVLYYMNDAVGNLWPWIY 296

Query: 495 FISFYVITVLWLLNLIVAFVLEAFQTEMD 409
           F+S  +I   +++NLI+  +   F  E +
Sbjct: 297 FVSLIIIGSFFVMNLILGVLSGEFSKERE 325



 Score = 41.6 bits (96), Expect = 0.018
 Identities = 29/120 (24%), Positives = 56/120 (46%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  I S+   L  +F  +  +  LG+Q+FGG  +         ++   D +  NF+ +  
Sbjct: 550 LNSIRSIASLLVLLFLFIIIFALLGMQMFGGRFS---------EIEQEDKIRSNFDTFLQ 600

Query: 594 GMVTLFNLLVMGNWQLWMQSYKELTGTS-----WSYVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W + M +  E  G +      + VYFI  ++     LLN+ +A  ++
Sbjct: 601 ALLTVFQILTGEDWNVVMYNGIEAYGGASTIGLLTSVYFIVLFIGGNYILLNVFLAIAVD 660



 Score = 35.4 bits (80), Expect = 1.3
 Identities = 21/85 (24%), Positives = 40/85 (47%), Gaps = 13/85 (15%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWS-------------YVYFISFYV 478
            FN+++  N M+TLF +     W   +  YK +   SWS              +++  F +
Sbjct: 1001 FNYDNVMNAMLTLFVVATFEGWPGLL--YKSI--DSWSENHGPRYDARQAVALFYFVFII 1056

Query: 477  ITVLWLLNLIVAFVLEAFQTEMDME 403
            +   +++N+ V FV+  FQ + + E
Sbjct: 1057 VIAFFMMNIFVGFVIVTFQEQGEQE 1081



>pir|T30890|T30890 calcium channel alpha1-chain - sea squirt
            (Halocynthia roretzi)
          Length = 2262

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 38/141 (26%), Positives = 65/141 (46%), Gaps = 23/141 (16%)
 Frame = -2

Query: 777  FLTLIPSLMPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDY 601
            F+   P+L PY+  +  +L F Y  +G+QIFG +     PN DG+ ++ N+    NF  +
Sbjct: 1383 FIKSFPAL-PYVALLIIMLFFIYAVIGMQIFGKI----KPN-DGSQINRNN----NFQTF 1432

Query: 600  PNGMVTLFNLLVMGNWQLWMQ----------------------SYKELTGTSWSYVYFIS 487
               ++ LF      +WQ  M                       S K   G  ++Y YF++
Sbjct: 1433 LQAVLLLFRCATGESWQEVMLACASGNECDDESDWNYYGDKDISAKFTCGNDFAYTYFLT 1492

Query: 486  FYVITVLWLLNLIVAFVLEAF 424
            FY++    ++NL VA +++ F
Sbjct: 1493 FYMLCAFLIINLFVAVIMDNF 1513



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 33/149 (22%), Positives = 63/149 (42%), Gaps = 29/149 (19%)
 Frame = -2

Query: 768 LIPSLMPYLGTIFCVLCFYCSLGLQIFGG---------------MVNAGNPNLD------ 652
           ++P L   L  IF V+  Y  +GL++F G               M +   P  D      
Sbjct: 315 MVPLLHIALLVIF-VIIIYAVVGLELFKGKLHKTCYHNEVAVLIMEDEAKPCADSDSWGR 373

Query: 651 ---GTDLSDNDYL-----LFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVY 496
              G  + ++D+      + NF+ +   ++T+F  + M  W   +    +  G  W ++Y
Sbjct: 374 HCSGGMICESDWAGPSKGIINFDTFYFAVITVFQCITMEGWTDVLYYMNDAVGNLWPWIY 433

Query: 495 FISFYVITVLWLLNLIVAFVLEAFQTEMD 409
           F+S  +I   +++NLI+  +   F  E +
Sbjct: 434 FVSLIIIGSFFVMNLILGVLSGEFSKERE 462



 Score = 41.6 bits (96), Expect = 0.018
 Identities = 29/120 (24%), Positives = 56/120 (46%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            L  I S+   L  +F  +  +  LG+Q+FGG  +         ++   D +  NF+ +  
Sbjct: 687  LNSIRSIASLLVLLFLFIIIFALLGMQMFGGRFS---------EIEQEDKIRSNFDTFLQ 737

Query: 594  GMVTLFNLLVMGNWQLWMQSYKELTGTS-----WSYVYFISFYVITVLWLLNLIVAFVLE 430
             ++T+F +L   +W + M +  E  G +      + VYFI  ++     LLN+ +A  ++
Sbjct: 738  ALLTVFQILTGEDWNVVMYNGIEAYGGASTIGLLTSVYFIVLFIGGNYILLNVFLAIAVD 797



 Score = 35.4 bits (80), Expect = 1.3
 Identities = 21/85 (24%), Positives = 40/85 (47%), Gaps = 13/85 (15%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWS-------------YVYFISFYV 478
            FN+++  N M+TLF +     W   +  YK +   SWS              +++  F +
Sbjct: 1138 FNYDNVMNAMLTLFVVATFEGWPGLL--YKSI--DSWSENHGPRYDARQAVALFYFVFII 1193

Query: 477  ITVLWLLNLIVAFVLEAFQTEMDME 403
            +   +++N+ V FV+  FQ + + E
Sbjct: 1194 VIAFFMMNIFVGFVIVTFQEQGEQE 1218



>gb:AX880433_1478276 Sequence 15338 from Patent EP1074617.
          Length = 333

 Score = 49.7 bits (117), Expect = 7e-05
 Identities = 20/58 (34%), Positives = 41/58 (70%)
 Frame = -2

Query: 582 LFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQTEMD 409
           L+NL+V+ NWQ+++ +Y+  +G  WS +YF+ +++++ +  +NL +A +LE F  + D
Sbjct: 227 LWNLMVVNNWQVFLDAYRRYSG-PWSKIYFVLWWLVSSVIWVNLFLALILENFLHKWD 283



>gb:DROCA1_1381791 Drosophila melanogaster calcium channel alpha-1
            subunit mRNA, complete cds.
          Length = 2516

 Score = 49.7 bits (117), Expect = 7e-05
 Identities = 36/126 (28%), Positives = 58/126 (46%), Gaps = 16/126 (12%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +   G     G  ++ N+    NF  +   ++ LF
Sbjct: 1813 LPYVALLIVLLFFIYAVVGMQVFGKIALDG-----GNAITANN----NFQTFQQAVLVLF 1863

Query: 576  NLLVMGNWQLWMQSYK---------------ELTGTSWSYVYFISFYVITVLWLLNLIVA 442
                   WQ  M S                 E  G+S +Y YFISFYV+    ++NL VA
Sbjct: 1864 RSATGEAWQEIMMSCSAQPDVKCDMNSDTPGEPCGSSIAYPYFISFYVLCSFLIINLFVA 1923

Query: 441  FVLEAF 424
             +++ F
Sbjct: 1924 VIMDNF 1929



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 27/105 (25%), Positives = 52/105 (49%)
 Frame = -2

Query: 729  CVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLLVMGNWQ 550
            C + + C  G + +GG      PN DG         + NF+++   M+T+F  + +  W 
Sbjct: 793  CGVGYQCPPGYKCYGGW---DGPN-DG---------ITNFDNFGLAMLTVFQCVTLEGWT 839

Query: 549  LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQTE 415
              + S ++  G+ W ++YFIS  ++   +++NLI+  +   F  E
Sbjct: 840  DVLYSIQDAMGSDWQWMYFISMVILGAFFVMNLILGVLSGEFSKE 884



 Score = 42.7 bits (99), Expect = 0.008
 Identities = 28/96 (29%), Positives = 47/96 (48%), Gaps = 9/96 (9%)
 Frame = -2

Query: 663  PNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLLVMGNWQ----LWMQSYKELTGTSWSY-- 502
            P L   + S+N    F+F+D   GM+TLF +     W     + + S KE  G   ++  
Sbjct: 1528 PRLREREWSNNR---FHFDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKENGGPIHNFRP 1584

Query: 501  ---VYFISFYVITVLWLLNLIVAFVLEAFQTEMDME 403
                Y+I + +I   +++N+ V FV+  FQ E + E
Sbjct: 1585 IVAAYYIIYIIIIAFFMVNIFVGFVIVTFQNEGEQE 1620



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 30/120 (25%), Positives = 53/120 (44%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            L  I S+   L  +F  +  +  LG+Q+FGG  N      DG +    +    NF+ +  
Sbjct: 1106 LNSIQSIASLLLLLFLFIVIFALLGMQVFGGKFN-----FDGKE----EKYRMNFDCFWQ 1156

Query: 594  GMVTLFNLLVMGNWQLWMQSYKELTGTSWSY-----VYFISFYVITVLWLLNLIVAFVLE 430
             ++T+F ++   +W   M       G   SY     +YFI  ++     LLN+ +A  ++
Sbjct: 1157 ALLTVFQIMTGEDWNAVMYVGINAYGGVSSYGALACIYFIILFICGNYILLNVFLAIAVD 1216



>gb:AE014134_1129355 Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE003650_1219462 Drosophila melanogaster
            chromosome 2L, section 59 of 83 of the complete sequence.
          Length = 2300

 Score = 49.7 bits (117), Expect = 7e-05
 Identities = 36/126 (28%), Positives = 58/126 (46%), Gaps = 16/126 (12%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +   G     G  ++ N+    NF  +   ++ LF
Sbjct: 1813 LPYVALLIVLLFFIYAVVGMQVFGKIALDG-----GNAITANN----NFQTFQQAVLVLF 1863

Query: 576  NLLVMGNWQLWMQSYK---------------ELTGTSWSYVYFISFYVITVLWLLNLIVA 442
                   WQ  M S                 E  G+S +Y YFISFYV+    ++NL VA
Sbjct: 1864 RSATGEAWQEIMMSCSAQPDVKCDMNSDTPGEPCGSSIAYPYFISFYVLCSFLIINLFVA 1923

Query: 441  FVLEAF 424
             +++ F
Sbjct: 1924 VIMDNF 1929



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 27/105 (25%), Positives = 52/105 (49%)
 Frame = -2

Query: 729  CVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLLVMGNWQ 550
            C + + C  G + +GG      PN DG         + NF+++   M+T+F  + +  W 
Sbjct: 793  CGVGYQCPPGYKCYGGW---DGPN-DG---------ITNFDNFGLAMLTVFQCVTLEGWT 839

Query: 549  LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQTE 415
              + S ++  G+ W ++YFIS  ++   +++NLI+  +   F  E
Sbjct: 840  DVLYSIQDAMGSDWQWMYFISMVILGAFFVMNLILGVLSGEFSKE 884



 Score = 42.7 bits (99), Expect = 0.008
 Identities = 28/96 (29%), Positives = 47/96 (48%), Gaps = 9/96 (9%)
 Frame = -2

Query: 663  PNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLLVMGNWQ----LWMQSYKELTGTSWSY-- 502
            P L   + S+N    F+F+D   GM+TLF +     W     + + S KE  G   ++  
Sbjct: 1528 PRLREREWSNNR---FHFDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKENGGPIHNFRP 1584

Query: 501  ---VYFISFYVITVLWLLNLIVAFVLEAFQTEMDME 403
                Y+I + +I   +++N+ V FV+  FQ E + E
Sbjct: 1585 IVAAYYIIYIIIIAFFMVNIFVGFVIVTFQNEGEQE 1620



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 30/120 (25%), Positives = 53/120 (44%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            L  I S+   L  +F  +  +  LG+Q+FGG  N      DG +    +    NF+ +  
Sbjct: 1106 LNSIQSIASLLLLLFLFIVIFALLGMQVFGGKFN-----FDGKE----EKYRMNFDCFWQ 1156

Query: 594  GMVTLFNLLVMGNWQLWMQSYKELTGTSWSY-----VYFISFYVITVLWLLNLIVAFVLE 430
             ++T+F ++   +W   M       G   SY     +YFI  ++     LLN+ +A  ++
Sbjct: 1157 ALLTVFQIMTGEDWNAVMYVGINAYGGVSSYGALACIYFIILFICGNYILLNVFLAIAVD 1216



>gb:AE014134_1129353 Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE003650_1219460 Drosophila melanogaster
            chromosome 2L, section 59 of 83 of the complete sequence.
          Length = 2552

 Score = 49.7 bits (117), Expect = 7e-05
 Identities = 36/126 (28%), Positives = 58/126 (46%), Gaps = 16/126 (12%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +   G     G  ++ N+    NF  +   ++ LF
Sbjct: 1849 LPYVALLIVLLFFIYAVVGMQVFGKIALDG-----GNAITANN----NFQTFQQAVLVLF 1899

Query: 576  NLLVMGNWQLWMQSYK---------------ELTGTSWSYVYFISFYVITVLWLLNLIVA 442
                   WQ  M S                 E  G+S +Y YFISFYV+    ++NL VA
Sbjct: 1900 RSATGEAWQEIMMSCSAQPDVKCDMNSDTPGEPCGSSIAYPYFISFYVLCSFLIINLFVA 1959

Query: 441  FVLEAF 424
             +++ F
Sbjct: 1960 VIMDNF 1965



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 27/105 (25%), Positives = 52/105 (49%)
 Frame = -2

Query: 729  CVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLLVMGNWQ 550
            C + + C  G + +GG      PN DG         + NF+++   M+T+F  + +  W 
Sbjct: 793  CGVGYQCPPGYKCYGGW---DGPN-DG---------ITNFDNFGLAMLTVFQCVTLEGWT 839

Query: 549  LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQTE 415
              + S ++  G+ W ++YFIS  ++   +++NLI+  +   F  E
Sbjct: 840  DVLYSIQDAMGSDWQWMYFISMVILGAFFVMNLILGVLSGEFSKE 884



 Score = 42.7 bits (99), Expect = 0.008
 Identities = 28/96 (29%), Positives = 47/96 (48%), Gaps = 9/96 (9%)
 Frame = -2

Query: 663  PNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLLVMGNWQ----LWMQSYKELTGTSWSY-- 502
            P L   + S+N    F+F+D   GM+TLF +     W     + + S KE  G   ++  
Sbjct: 1564 PRLREREWSNNR---FHFDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKENGGPIHNFRP 1620

Query: 501  ---VYFISFYVITVLWLLNLIVAFVLEAFQTEMDME 403
                Y+I + +I   +++N+ V FV+  FQ E + E
Sbjct: 1621 IVAAYYIIYIIIIAFFMVNIFVGFVIVTFQNEGEQE 1656



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 30/120 (25%), Positives = 53/120 (44%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            L  I S+   L  +F  +  +  LG+Q+FGG  N      DG +    +    NF+ +  
Sbjct: 1106 LNSIQSIASLLLLLFLFIVIFALLGMQVFGGKFN-----FDGKE----EKYRMNFDCFWQ 1156

Query: 594  GMVTLFNLLVMGNWQLWMQSYKELTGTSWSY-----VYFISFYVITVLWLLNLIVAFVLE 430
             ++T+F ++   +W   M       G   SY     +YFI  ++     LLN+ +A  ++
Sbjct: 1157 ALLTVFQIMTGEDWNAVMYVGINAYGGVSSYGALACIYFIILFICGNYILLNVFLAIAVD 1216



>gb:AE014134_1129352 Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE003650_1219459 Drosophila melanogaster
            chromosome 2L, section 59 of 83 of the complete sequence.
          Length = 2519

 Score = 49.7 bits (117), Expect = 7e-05
 Identities = 36/126 (28%), Positives = 58/126 (46%), Gaps = 16/126 (12%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +   G     G  ++ N+    NF  +   ++ LF
Sbjct: 1816 LPYVALLIVLLFFIYAVVGMQVFGKIALDG-----GNAITANN----NFQTFQQAVLVLF 1866

Query: 576  NLLVMGNWQLWMQSYK---------------ELTGTSWSYVYFISFYVITVLWLLNLIVA 442
                   WQ  M S                 E  G+S +Y YFISFYV+    ++NL VA
Sbjct: 1867 RSATGEAWQEIMMSCSAQPDVKCDMNSDTPGEPCGSSIAYPYFISFYVLCSFLIINLFVA 1926

Query: 441  FVLEAF 424
             +++ F
Sbjct: 1927 VIMDNF 1932



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 27/105 (25%), Positives = 52/105 (49%)
 Frame = -2

Query: 729  CVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLLVMGNWQ 550
            C + + C  G + +GG      PN DG         + NF+++   M+T+F  + +  W 
Sbjct: 793  CGVGYQCPPGYKCYGGW---DGPN-DG---------ITNFDNFGLAMLTVFQCVTLEGWT 839

Query: 549  LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQTE 415
              + S ++  G+ W ++YFIS  ++   +++NLI+  +   F  E
Sbjct: 840  DVLYSIQDAMGSDWQWMYFISMVILGAFFVMNLILGVLSGEFSKE 884



 Score = 42.7 bits (99), Expect = 0.008
 Identities = 28/96 (29%), Positives = 47/96 (48%), Gaps = 9/96 (9%)
 Frame = -2

Query: 663  PNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLLVMGNWQ----LWMQSYKELTGTSWSY-- 502
            P L   + S+N    F+F+D   GM+TLF +     W     + + S KE  G   ++  
Sbjct: 1531 PRLREREWSNNR---FHFDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKENGGPIHNFRP 1587

Query: 501  ---VYFISFYVITVLWLLNLIVAFVLEAFQTEMDME 403
                Y+I + +I   +++N+ V FV+  FQ E + E
Sbjct: 1588 IVAAYYIIYIIIIAFFMVNIFVGFVIVTFQNEGEQE 1623



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 30/120 (25%), Positives = 53/120 (44%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            L  I S+   L  +F  +  +  LG+Q+FGG  N      DG +    +    NF+ +  
Sbjct: 1106 LNSIQSIASLLLLLFLFIVIFALLGMQVFGGKFN-----FDGKE----EKYRMNFDCFWQ 1156

Query: 594  GMVTLFNLLVMGNWQLWMQSYKELTGTSWSY-----VYFISFYVITVLWLLNLIVAFVLE 430
             ++T+F ++   +W   M       G   SY     +YFI  ++     LLN+ +A  ++
Sbjct: 1157 ALLTVFQIMTGEDWNAVMYVGINAYGGVSSYGALACIYFIILFICGNYILLNVFLAIAVD 1216



>sp|P22316|CCAS_CYPCA Dihydropyridine-sensitive L-type, skeletal
            muscle calcium channel alpha-1 subunit.>pir|A37860|A37860
            calcium channel protein alpha-1 chain, skeletal muscle -
            common carp>gb:CYICCA1_2570475 Carp skeletal muscle
            calcium channel alpha-1 subunit mRNA, complete cds.
          Length = 1852

 Score = 49.7 bits (117), Expect = 7e-05
 Identities = 32/125 (25%), Positives = 62/125 (49%), Gaps = 17/125 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +P++G +  +L F Y  +G+Q+FG +       +DGT+++ N+    NF  +P  ++ LF
Sbjct: 1288 LPHVGLLIVMLFFIYAVIGMQMFGKVAL-----VDGTEINRNN----NFQTFPQAVLLLF 1338

Query: 576  NLLVMGNWQ--LWMQSYKELT--------------GTSWSYVYFISFYVITVLWLLNLIV 445
             +     W   +    Y +L               G+S +  YF+SFY++    ++NL V
Sbjct: 1339 RVATGEQWPKVILASMYGKLCDAKSDYGPGEEYTCGSSIAVFYFLSFYILCAFLIINLFV 1398

Query: 444  AFVLE 430
            A +++
Sbjct: 1399 AIIMD 1403



 Score = 42.0 bits (97), Expect = 0.014
 Identities = 30/120 (25%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            D      NF+++P 
Sbjct: 568 LNSVKSIASLLLLLFLFIVIFALLGMQVFGGKFN----------FPDRVIQRSNFDNFPQ 617

Query: 594 GMVTLFNLLVMGNWQLWMQSYKELTGTSWS-----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++++F +L    W   M +     G   S      +YFI  YV     LLN+ +A  ++
Sbjct: 618 ALISVFQVLTGEEWDSIMYNGIMAHGGPQSPGILVSIYFIILYVCGNFVLLNVFLAIAVD 677



 Score = 38.9 bits (89), Expect = 0.12
 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 12/84 (14%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWMQS------------YKELTGTSWSYVYFISFYVI 475
            FNF++  NGM+ LF +     W   +              Y    G S   ++FI + +I
Sbjct: 1011 FNFDNVLNGMLALFTISTFEGWPEILYKAIDSNAVDTGPLYNNRVGIS---IFFIIYIII 1067

Query: 474  TVLWLLNLIVAFVLEAFQTEMDME 403
               +++N+ V FV+  FQ + + E
Sbjct: 1068 IAFFMMNIFVGFVIVTFQKQGEQE 1091



 Score = 35.4 bits (80), Expect = 1.3
 Identities = 15/73 (20%), Positives = 36/73 (49%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           +F++    M+T+F  +   +W   +    +  G  W ++YF++  ++   ++LNL++  +
Sbjct: 291 HFDNSCFAMLTVFQCITTESWTDVLYWINDAMGNDWPWIYFLTLILVGSFFILNLVLGAL 350

Query: 435 LEAFQTEMDMETS 397
              F  E +   S
Sbjct: 351 SGEFTKEREESRS 363



>sp|Q24270|CCAD_DROME Voltage-dependent calcium channel type D alpha-1
            subunit (DmCA1D).>gb:AE014134_1129354 Drosophila
            melanogaster chromosome 2L, complete
            sequence.>gb:AE003650_1219461 Drosophila melanogaster
            chromosome 2L, section 59 of 83 of the complete
            sequence.>gb:DROSADH09_1382866 Drosophila melanogaster,
            chromosome 2L, region 34C4-36A7 (Adh region), section 9
            of 10 of the complete sequence.
          Length = 2516

 Score = 49.7 bits (117), Expect = 7e-05
 Identities = 36/126 (28%), Positives = 58/126 (46%), Gaps = 16/126 (12%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +   G     G  ++ N+    NF  +   ++ LF
Sbjct: 1813 LPYVALLIVLLFFIYAVVGMQVFGKIALDG-----GNAITANN----NFQTFQQAVLVLF 1863

Query: 576  NLLVMGNWQLWMQSYK---------------ELTGTSWSYVYFISFYVITVLWLLNLIVA 442
                   WQ  M S                 E  G+S +Y YFISFYV+    ++NL VA
Sbjct: 1864 RSATGEAWQEIMMSCSAQPDVKCDMNSDTPGEPCGSSIAYPYFISFYVLCSFLIINLFVA 1923

Query: 441  FVLEAF 424
             +++ F
Sbjct: 1924 VIMDNF 1929



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 27/105 (25%), Positives = 52/105 (49%)
 Frame = -2

Query: 729  CVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLLVMGNWQ 550
            C + + C  G + +GG      PN DG         + NF+++   M+T+F  + +  W 
Sbjct: 793  CGVGYQCPPGYKCYGGW---DGPN-DG---------ITNFDNFGLAMLTVFQCVTLEGWT 839

Query: 549  LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQTE 415
              + S ++  G+ W ++YFIS  ++   +++NLI+  +   F  E
Sbjct: 840  DVLYSIQDAMGSDWQWMYFISMVILGAFFVMNLILGVLSGEFSKE 884



 Score = 42.7 bits (99), Expect = 0.008
 Identities = 28/96 (29%), Positives = 47/96 (48%), Gaps = 9/96 (9%)
 Frame = -2

Query: 663  PNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLLVMGNWQ----LWMQSYKELTGTSWSY-- 502
            P L   + S+N    F+F+D   GM+TLF +     W     + + S KE  G   ++  
Sbjct: 1528 PRLREREWSNNR---FHFDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKENGGPIHNFRP 1584

Query: 501  ---VYFISFYVITVLWLLNLIVAFVLEAFQTEMDME 403
                Y+I + +I   +++N+ V FV+  FQ E + E
Sbjct: 1585 IVAAYYIIYIIIIAFFMVNIFVGFVIVTFQNEGEQE 1620



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 30/120 (25%), Positives = 53/120 (44%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            L  I S+   L  +F  +  +  LG+Q+FGG  N      DG +    +    NF+ +  
Sbjct: 1106 LNSIQSIASLLLLLFLFIVIFALLGMQVFGGKFN-----FDGKE----EKYRMNFDCFWQ 1156

Query: 594  GMVTLFNLLVMGNWQLWMQSYKELTGTSWSY-----VYFISFYVITVLWLLNLIVAFVLE 430
             ++T+F ++   +W   M       G   SY     +YFI  ++     LLN+ +A  ++
Sbjct: 1157 ALLTVFQIMTGEDWNAVMYVGINAYGGVSSYGALACIYFIILFICGNYILLNVFLAIAVD 1216



>sp|O73700|CCAD_CHICK Voltage-dependent L-type calcium channel
            alpha-1D subunit (Voltage- gated calcium channel alpha
            subunit Cav1.3) (CHCACHA1D).>gb:AF027602_2469254 Gallus
            gallus L-type voltage-gated calcium channel alpha1D
            subunit ChCaChA1D mRNA, complete cds.
          Length = 2190

 Score = 49.3 bits (116), Expect = 9e-05
 Identities = 32/127 (25%), Positives = 60/127 (47%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +    N  ++  +         NF  +P  ++ LF
Sbjct: 1379 LPYVALLIAMLFFIYAVIGMQVFGKVAMRDNNQINRNN---------NFQTFPQAVLLLF 1429

Query: 576  NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  M +                +E T G++++ +YFISFY++    ++NL V
Sbjct: 1430 RCATGEAWQEIMLACLPGKRCDPESDYNPGEEYTCGSNFAIIYFISFYMLCAFLIINLFV 1489

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1490 AVIMDNF 1496



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W ++YF+S  ++   ++LNL++  +
Sbjct: 341 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGCEWPWIYFVSLIILGSFFVLNLVLGVL 400

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 401 SGEFSKERE 409



 Score = 38.5 bits (88), Expect = 0.15
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            FNF++  + M+ LF +     W   +     S  E  G  ++Y     ++FI + +I   
Sbjct: 1103 FNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENVGPVYNYRVEISIFFIIYIIIIAF 1162

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1163 FMMNIFVGFVIVTFQEQGEQE 1183



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 31/131 (23%), Positives = 56/131 (42%), Gaps = 5/131 (3%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            L  + S+   L  +F  +  +  LG+Q+FGG       N D T    +      F+++P 
Sbjct: 665  LNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKF-----NFDETQTKRS-----TFDNFPQ 714

Query: 594  GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
             ++T+F +L   +W   M        G S S     +YFI  ++     LLN+ +A  ++
Sbjct: 715  ALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVD 774

Query: 429  AFQTEMDMETS 397
                   + T+
Sbjct: 775  NLADAESLNTA 785



>gb:RATRCACN4B_2133682 Rat rCACN4B mRNA for L-type voltage-dependent
            calcium channel alpha 1 subunit, complete cds.
          Length = 1668

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 33/127 (25%), Positives = 60/127 (47%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +    N  ++  +         NF  +P  ++ LF
Sbjct: 1394 LPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNN---------NFQTFPQAVLLLF 1444

Query: 576  NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  M +                +E T G++++ VYFISFY++    ++NL V
Sbjct: 1445 RCATGEAWQEIMLACLPGKLCDPDSDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFV 1504

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1505 AVIMDNF 1511



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 18/69 (26%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W +VYF+S  ++   ++LNL++  +
Sbjct: 346 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGWEWPWVYFVSLIILGSFFVLNLVLGVL 405

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 406 SGEFSKERE 414



 Score = 38.5 bits (88), Expect = 0.15
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            FNF++  + M+ LF +     W   +     S  E  G  ++Y     ++FI + +I   
Sbjct: 1141 FNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENVGPVYNYRVEISIFFIIYIIIVAF 1200

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1201 FMMNIFVGFVIVTFQEQGEKE 1221



 Score = 37.0 bits (84), Expect = 0.45
 Identities = 31/131 (23%), Positives = 55/131 (41%), Gaps = 5/131 (3%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            L  + S+   L  +F  +  +  LG+Q+FGG       N D T    +      F+++P 
Sbjct: 703  LNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKF-----NFDETQTKRS-----TFDNFPQ 752

Query: 594  GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
             ++T+F +L   +W   M        G S S     +YFI  ++     LL L +A  ++
Sbjct: 753  ALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLKLFLAIAVD 812

Query: 429  AFQTEMDMETS 397
                   + T+
Sbjct: 813  NLADAESLNTA 823



>gb:MMU437292_2121468 Mus musculus mRNA for L-type voltage-gated
            calcium channel Cav1.3(1b) subunit (cacna1d gene).
          Length = 2166

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 33/127 (25%), Positives = 60/127 (47%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +    N  ++  +         NF  +P  ++ LF
Sbjct: 1357 LPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNN---------NFQTFPQAVLLLF 1407

Query: 576  NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  M +                +E T G++++ VYFISFY++    ++NL V
Sbjct: 1408 RCATGEAWQEIMLACLPGKLCDPDSDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFV 1467

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1468 AVIMDNF 1474



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 18/69 (26%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W +VYF+S  ++   ++LNL++  +
Sbjct: 368 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGWEWPWVYFVSLIILGSFFVLNLVLGVL 427

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 428 SGEFSKERE 436



 Score = 38.5 bits (88), Expect = 0.15
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            FNF++  + M+ LF +     W   +     S  E  G  ++Y     ++FI + +I   
Sbjct: 1104 FNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENVGPVYNYRVEISIFFIIYIIIVAF 1163

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1164 FMMNIFVGFVIVTFQEQGEKE 1184



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 31/131 (23%), Positives = 56/131 (42%), Gaps = 5/131 (3%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            L  + S+   L  +F  +  +  LG+Q+FGG       N D T    +      F+++P 
Sbjct: 666  LNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKF-----NFDETQTKRS-----TFDNFPQ 715

Query: 594  GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
             ++T+F +L   +W   M        G S S     +YFI  ++     LLN+ +A  ++
Sbjct: 716  ALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVD 775

Query: 429  AFQTEMDMETS 397
                   + T+
Sbjct: 776  NLADAESLNTA 786



>gb:MMU437291_2121467 Mus musculus mRNA for L-type voltage-gated
            calcium channel Cav1.3(1a) subunit (cacna1d gene).
          Length = 2144

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 33/127 (25%), Positives = 60/127 (47%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +    N  ++  +         NF  +P  ++ LF
Sbjct: 1335 LPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNN---------NFQTFPQAVLLLF 1385

Query: 576  NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  M +                +E T G++++ VYFISFY++    ++NL V
Sbjct: 1386 RCATGEAWQEIMLACLPGKLCDPDSDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFV 1445

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1446 AVIMDNF 1452



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 18/69 (26%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W +VYF+S  ++   ++LNL++  +
Sbjct: 346 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGWEWPWVYFVSLIILGSFFVLNLVLGVL 405

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 406 SGEFSKERE 414



 Score = 38.5 bits (88), Expect = 0.15
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            FNF++  + M+ LF +     W   +     S  E  G  ++Y     ++FI + +I   
Sbjct: 1082 FNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENVGPVYNYRVEISIFFIIYIIIVAF 1141

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1142 FMMNIFVGFVIVTFQEQGEKE 1162



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 31/131 (23%), Positives = 56/131 (42%), Gaps = 5/131 (3%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            L  + S+   L  +F  +  +  LG+Q+FGG       N D T    +      F+++P 
Sbjct: 644  LNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKF-----NFDETQTKRS-----TFDNFPQ 693

Query: 594  GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
             ++T+F +L   +W   M        G S S     +YFI  ++     LLN+ +A  ++
Sbjct: 694  ALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVD 753

Query: 429  AFQTEMDMETS 397
                   + T+
Sbjct: 754  NLADAESLNTA 764



>gb:MAU311617_2113373 Mesocricetus auratus mRNA for neuroendocrine
            voltage-gated calcium channel alpha1 subunit (caV1.3
            (alpha1D) gene).
          Length = 1602

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 33/127 (25%), Positives = 60/127 (47%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +    N  ++  +         NF  +P  ++ LF
Sbjct: 1340 LPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNN---------NFQTFPQAVLLLF 1390

Query: 576  NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  M +                +E T G++++ VYFISFY++    ++NL V
Sbjct: 1391 RCATGEAWQEIMLACLPGKLCDPDSDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFV 1450

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1451 AVIMDNF 1457



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 31/131 (23%), Positives = 56/131 (42%), Gaps = 5/131 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG       N D T    +      F+++P 
Sbjct: 635 LNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKF-----NFDETQTKRS-----TFDNFPQ 684

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S S     +YFI  ++     LLN+ +A  ++
Sbjct: 685 ALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVD 744

Query: 429 AFQTEMDMETS 397
                  + T+
Sbjct: 745 NLADAESLNTA 755



 Score = 37.7 bits (86), Expect = 0.26
 Identities = 17/69 (24%), Positives = 34/69 (49%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G    +VYF+S  +    ++LNL++  +
Sbjct: 337 NFDNFAFAMLTVFQCITMEGWTDVLYWMNDAMGFELPWVYFVSLVIFGSFFVLNLVLGVL 396

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 397 SGEFSKERE 405



 Score = 36.6 bits (83), Expect = 0.59
 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVY---------FISFYVITVL 466
            FNF++  + M+ LF +     W   +    +  G +   VY         FI + +I   
Sbjct: 1072 FNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENAGPVYNHRVEISIFFIIYIIIVAF 1131

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1132 FMMNIFVGFVIVTFQEQGEKE 1152



>gb:BC058783_2103488 Mus musculus cDNA clone MGC:65542
           IMAGE:6310199, complete cds.
          Length = 859

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 33/127 (25%), Positives = 60/127 (47%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753 MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
           +PY+  +  +L F Y  +G+Q+FG +    N  ++  +         NF  +P  ++ LF
Sbjct: 50  LPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNN---------NFQTFPQAVLLLF 100

Query: 576 NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                  WQ  M +                +E T G++++ VYFISFY++    ++NL V
Sbjct: 101 RCATGEAWQEIMLACLPGKLCDPDSDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFV 160

Query: 444 AFVLEAF 424
           A +++ F
Sbjct: 161 AVIMDNF 167



>gb:AF370009_2064309 Rattus norvegicus voltage-gated calcium channel
            pore forming subunit CaV1.3alpha1 mRNA, complete cds,
            alternatively spliced.
          Length = 1643

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 33/127 (25%), Positives = 60/127 (47%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +    N  ++  +         NF  +P  ++ LF
Sbjct: 1346 LPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNN---------NFQTFPQAVLLLF 1396

Query: 576  NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  M +                +E T G++++ VYFISFY++    ++NL V
Sbjct: 1397 RCATGEAWQEIMLACLPGKLCDPDSDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFV 1456

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1457 AVIMDNF 1463



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 18/69 (26%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W +VYF+S  ++   ++LNL++  +
Sbjct: 337 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGWEWPWVYFVSLIILGSFFVLNLVLGVL 396

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 397 SGEFSKERE 405



 Score = 38.5 bits (88), Expect = 0.15
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            FNF++  + M+ LF +     W   +     S  E  G  ++Y     ++FI + +I   
Sbjct: 1093 FNFDNVLSAMMVLFTVSTFEGWPALLYKAIDSNGENVGPVYNYRVEISIFFIIYIIIVAF 1152

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1153 FMMNIFVGFVIVTFQEQGEKE 1173



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 31/131 (23%), Positives = 56/131 (42%), Gaps = 5/131 (3%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            L  + S+   L  +F  +  +  LG+Q+FGG       N D T    +      F+++P 
Sbjct: 655  LNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKF-----NFDETQTKRS-----TFDNFPQ 704

Query: 594  GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
             ++T+F +L   +W   M        G S S     +YFI  ++     LLN+ +A  ++
Sbjct: 705  ALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVD 764

Query: 429  AFQTEMDMETS 397
                   + T+
Sbjct: 765  NLADAESLNTA 775



>gb:AB086123_2047791 Mus musculus mRNA for calcium channel alpha 1D
            subunit, complete cds.
          Length = 2179

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 33/127 (25%), Positives = 60/127 (47%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +    N  ++  +         NF  +P  ++ LF
Sbjct: 1370 LPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNN---------NFQTFPQAVLLLF 1420

Query: 576  NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  M +                +E T G++++ VYFISFY++    ++NL V
Sbjct: 1421 RCATGEAWQEIMLACLPGKLCDPDSDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFV 1480

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1481 AVIMDNF 1487



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 18/69 (26%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W +VYF+S  ++   ++LNL++  +
Sbjct: 346 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGWEWPWVYFVSLIILGSFFVLNLVLGVL 405

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 406 SGEFSKERE 414



 Score = 38.5 bits (88), Expect = 0.15
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            FNF++  + M+ LF +     W   +     S  E  G  ++Y     ++FI + +I   
Sbjct: 1102 FNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENVGPVYNYRVEISIFFIIYIIIVAF 1161

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1162 FMMNIFVGFVIVTFQEQGEKE 1182



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 31/131 (23%), Positives = 56/131 (42%), Gaps = 5/131 (3%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            L  + S+   L  +F  +  +  LG+Q+FGG       N D T    +      F+++P 
Sbjct: 664  LNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKF-----NFDETQTKRS-----TFDNFPQ 713

Query: 594  GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
             ++T+F +L   +W   M        G S S     +YFI  ++     LLN+ +A  ++
Sbjct: 714  ALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVD 773

Query: 429  AFQTEMDMETS 397
                   + T+
Sbjct: 774  NLADAESLNTA 784



>gb:D43705S43_1994657 Homo sapiens CACN4 gene for voltage-dependent
            calcium channel alpha 1 subunit, exon 49 and complete
            cds.
          Length = 2170

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 33/127 (25%), Positives = 60/127 (47%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +    N  ++  +         NF  +P  ++ LF
Sbjct: 1359 LPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNN---------NFQTFPQAVLLLF 1409

Query: 576  NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  M +                +E T G++++ VYFISFY++    ++NL V
Sbjct: 1410 RCATGEAWQEIMLACLPGKLCDPESDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFV 1469

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1470 AVIMDNF 1476



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 18/69 (26%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W +VYF+S  ++   ++LNL++  +
Sbjct: 337 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGWEWPWVYFVSLIILGSFFVLNLVLGVL 396

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 397 SGEFSKERE 405



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 31/131 (23%), Positives = 56/131 (42%), Gaps = 5/131 (3%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            L  + S+   L  +F  +  +  LG+Q+FGG       N D T    +      F+++P 
Sbjct: 655  LNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKF-----NFDETQTKRS-----TFDNFPQ 704

Query: 594  GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
             ++T+F +L   +W   M        G S S     +YFI  ++     LLN+ +A  ++
Sbjct: 705  ALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVD 764

Query: 429  AFQTEMDMETS 397
                   + T+
Sbjct: 765  NLADAESLNTA 775



 Score = 36.2 bits (82), Expect = 0.77
 Identities = 19/81 (23%), Positives = 37/81 (45%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVY---------FISFYVITVL 466
            FNF++  + M+ LF +     W   +    +  G +   +Y         FI + +I   
Sbjct: 1093 FNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENIGPIYNHRVEISIFFIIYIIIVAF 1152

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1153 FMMNIFVGFVIVTFQEQGEKE 1173



>gb:AX546814_1470187 Sequence 15 from Patent WO02063000.
          Length = 1772

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 33/127 (25%), Positives = 60/127 (47%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +    N  ++  +         NF  +P  ++ LF
Sbjct: 961  LPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNN---------NFQTFPQAVLLLF 1011

Query: 576  NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  M +                +E T G++++ VYFISFY++    ++NL V
Sbjct: 1012 RCATGEAWQEIMLACLPGKLCDPESDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFV 1071

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1072 AVIMDNF 1078



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 31/131 (23%), Positives = 56/131 (42%), Gaps = 5/131 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG       N D T    +      F+++P 
Sbjct: 199 LNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKF-----NFDETQTKRS-----TFDNFPQ 248

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S S     +YFI  ++     LLN+ +A  ++
Sbjct: 249 ALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVD 308

Query: 429 AFQTEMDMETS 397
                  + T+
Sbjct: 309 NLADAESLNTA 319



 Score = 36.2 bits (82), Expect = 0.77
 Identities = 19/81 (23%), Positives = 37/81 (45%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618 FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVY---------FISFYVITVL 466
           FNF++  + M+ LF +     W   +    +  G +   +Y         FI + +I   
Sbjct: 693 FNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENIGPIYNHRVEISIFFIIYIIIVAF 752

Query: 465 WLLNLIVAFVLEAFQTEMDME 403
           +++N+ V FV+  FQ + + E
Sbjct: 753 FMMNIFVGFVIVTFQEQGEKE 773



>gb:AX546802_1470180 Sequence 3 from Patent WO02063000.
          Length = 2166

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 33/127 (25%), Positives = 60/127 (47%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +    N  ++  +         NF  +P  ++ LF
Sbjct: 1355 LPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNN---------NFQTFPQAVLLLF 1405

Query: 576  NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  M +                +E T G++++ VYFISFY++    ++NL V
Sbjct: 1406 RCATGEAWQEIMLACLPGKLCDPESDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFV 1465

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1466 AVIMDNF 1472



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 18/69 (26%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W +VYF+S  ++   ++LNL++  +
Sbjct: 346 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGWEWPWVYFVSLIILGSFFVLNLVLGVL 405

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 406 SGEFSKERE 414



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 31/131 (23%), Positives = 56/131 (42%), Gaps = 5/131 (3%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            L  + S+   L  +F  +  +  LG+Q+FGG       N D T    +      F+++P 
Sbjct: 664  LNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKF-----NFDETQTKRS-----TFDNFPQ 713

Query: 594  GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
             ++T+F +L   +W   M        G S S     +YFI  ++     LLN+ +A  ++
Sbjct: 714  ALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVD 773

Query: 429  AFQTEMDMETS 397
                   + T+
Sbjct: 774  NLADAESLNTA 784



 Score = 36.2 bits (82), Expect = 0.77
 Identities = 19/81 (23%), Positives = 37/81 (45%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVY---------FISFYVITVL 466
            FNF++  + M+ LF +     W   +    +  G +   +Y         FI + +I   
Sbjct: 1102 FNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENIGPIYNHRVEISIFFIIYIIIVAF 1161

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1162 FMMNIFVGFVIVTFQEQGEKE 1182



>gb:D31718_1376121 Blattella germanica mRNA for voltage-dependent
            calcium channel alpha-1 subunit, partial cds.
          Length = 871

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 36/128 (28%), Positives = 60/128 (46%), Gaps = 18/128 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLD-GTDLSDNDYLLFNFNDYPNGMVTL 580
            +PY+  +  +L F Y  +G+Q+FG +       LD GT +  N+    NF  +P  ++ L
Sbjct: 683  LPYVALLIVMLFFIYAVIGMQMFGKIA------LDSGTAIHRNN----NFQTFPQAVLLL 732

Query: 579  FNLLVMGNWQLWM----------------QSYKELTGTSWSYVYFISFYVITVLWLLNLI 448
            F       WQ  M                +  K + G+  ++ YFISFYV+    ++NL 
Sbjct: 733  FRSATGEAWQDIMLDGSARDGVRCDSESDEKDKPICGSDMAFPYFISFYVLCSFLIINLF 792

Query: 447  VAFVLEAF 424
            VA +++ F
Sbjct: 793  VAVIMDNF 800



 Score = 40.0 bits (92), Expect = 0.053
 Identities = 22/81 (27%), Positives = 41/81 (50%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618 FNFNDYPNGMVTLFNLLVMGNWQ----LWMQSYKELTGTSWSY-----VYFISFYVITVL 466
           F+F+D    M+TLF +     W     + + S+ E  G   ++     ++FI + +I   
Sbjct: 426 FHFDDVAKAMLTLFTVSTFEGWPGLLYVSIDSHDEDEGPIHNFRPIVAIFFIVYIIIIAF 485

Query: 465 WLLNLIVAFVLEAFQTEMDME 403
           +++N+ V FV+  FQ E + E
Sbjct: 486 FMVNIFVGFVIVTFQNEGEQE 506



>pir|JH0422|JH0422 voltage-dependent calcium channel complex alpha-1
            chain - rat>gb:RATRBC_2133665 Rat brain calcium channel
            alpha-1 subunit mRNA, complete cds.
          Length = 1646

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 33/127 (25%), Positives = 60/127 (47%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +    N  ++  +         NF  +P  ++ LF
Sbjct: 1349 LPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNN---------NFQTFPQAVLLLF 1399

Query: 576  NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  M +                +E T G++++ VYFISFY++    ++NL V
Sbjct: 1400 RCATGEAWQEIMLACLPGKLCDPDSDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFV 1459

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1460 AVIMDNF 1466



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 18/69 (26%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W +VYF+S  ++   ++LNL++  +
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGWEWPWVYFVSLIILGSFFVLNLVLGVL 404

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 405 SGEFSKERE 413



 Score = 38.5 bits (88), Expect = 0.15
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            FNF++  + M+ LF +     W   +     S  E  G  ++Y     ++FI + +I   
Sbjct: 1081 FNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENVGPVYNYRVEISIFFIIYIIIVAF 1140

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1141 FMMNIFVGFVIVTFQEQGEKE 1161



 Score = 37.0 bits (84), Expect = 0.45
 Identities = 31/131 (23%), Positives = 55/131 (41%), Gaps = 5/131 (3%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            L  + S+   L  +F  +  +  LG+Q+FGG       N D T    +      F+++P 
Sbjct: 643  LNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKF-----NFDETQTKRS-----TFDNFPQ 692

Query: 594  GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
             ++T+F +L   +W   M        G S S     +YFI  ++     LL L +A  ++
Sbjct: 693  ALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLKLFLAIAVD 752

Query: 429  AFQTEMDMETS 397
                   + T+
Sbjct: 753  NLADAESLNTA 763



>pir|A38198|A38198 calcium channel alpha-1 chain, pancreatic -
            human>gb:AX546816_1470188 Sequence 17 from Patent
            WO02063000.>gb:AX546818_1470189 Sequence 19 from Patent
            WO02063000.>gb:HUMCACH1A_2029772 Human
            neuroendocrine/beta-cell-type calcium channel alpha-1
            subunit mRNA, complete cds.
          Length = 2181

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 33/127 (25%), Positives = 60/127 (47%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +    N  ++  +         NF  +P  ++ LF
Sbjct: 1370 LPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNN---------NFQTFPQAVLLLF 1420

Query: 576  NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  M +                +E T G++++ VYFISFY++    ++NL V
Sbjct: 1421 RCATGEAWQEIMLACLPGKLCDPESDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFV 1480

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1481 AVIMDNF 1487



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 18/69 (26%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W +VYF+S  ++   ++LNL++  +
Sbjct: 346 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGWEWPWVYFVSLIILGSFFVLNLVLGVL 405

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 406 SGEFSKERE 414



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 31/131 (23%), Positives = 56/131 (42%), Gaps = 5/131 (3%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            L  + S+   L  +F  +  +  LG+Q+FGG       N D T    +      F+++P 
Sbjct: 664  LNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKF-----NFDETQTKRS-----TFDNFPQ 713

Query: 594  GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
             ++T+F +L   +W   M        G S S     +YFI  ++     LLN+ +A  ++
Sbjct: 714  ALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVD 773

Query: 429  AFQTEMDMETS 397
                   + T+
Sbjct: 774  NLADAESLNTA 784



 Score = 36.2 bits (82), Expect = 0.77
 Identities = 19/81 (23%), Positives = 37/81 (45%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVY---------FISFYVITVL 466
            FNF++  + M+ LF +     W   +    +  G +   +Y         FI + +I   
Sbjct: 1102 FNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENIGPIYNHRVEISIFFIIYIIIVAF 1161

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1162 FMMNIFVGFVIVTFQEQGEKE 1182



>pir|JH0564|JH0564 calcium channel alpha-1D chain - human
          Length = 2161

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 31/127 (24%), Positives = 58/127 (45%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +    N  ++  +         NF  +P  ++ LF
Sbjct: 1350 LPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNN---------NFQTFPQAVLLLF 1400

Query: 576  NLLVMGNWQLWMQSY----------------KELTGTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  M +                 +   G++++ VYFISFY++    ++NL V
Sbjct: 1401 RCATGEAWQEIMLACLPGKLCDPESDYNPGEEHTCGSNFAIVYFISFYMLCAFLIINLFV 1460

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1461 AVIMDNF 1467



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 31/131 (23%), Positives = 56/131 (42%), Gaps = 5/131 (3%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            L  + S+   L  +F  +  +  LG+Q+FGG       N D T    +      F+++P 
Sbjct: 644  LNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKF-----NFDETQTKRS-----TFDNFPQ 693

Query: 594  GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
             ++T+F +L   +W   M        G S S     +YFI  ++     LLN+ +A  ++
Sbjct: 694  ALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVD 753

Query: 429  AFQTEMDMETS 397
                   + T+
Sbjct: 754  NLADAESLNTA 764



 Score = 37.7 bits (86), Expect = 0.26
 Identities = 17/69 (24%), Positives = 34/69 (49%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G    +VYF+S  +    ++LNL++  +
Sbjct: 346 NFDNFAFAMLTVFQCITMEGWTDVLYWMNDAMGFELPWVYFVSLVIFGSFFVLNLVLGVL 405

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 406 SGEFSKERE 414



 Score = 36.2 bits (82), Expect = 0.77
 Identities = 19/81 (23%), Positives = 37/81 (45%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVY---------FISFYVITVL 466
            FNF++  + M+ LF +     W   +    +  G +   +Y         FI + +I   
Sbjct: 1082 FNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENIGPIYNHRVEISIFFIIYIIIVAF 1141

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1142 FMMNIFVGFVIVTFQEQGEKE 1162



>sp|P27732|CCAD_RAT Voltage-dependent L-type calcium channel alpha-1D
            subunit (Voltage- gated calcium channel alpha subunit
            Cav1.3) (Calcium channel, L type, alpha-1 polypeptide,
            isoform 2) (RAT brain class D) (RBD).>pir|T42742|T42742
            voltage-dependent calcium channel alpha 1 chain, isoform
            CACN4A - rat>gb:RATRCACN4A_2133681 Rat rCACN4A mRNA for
            L-type voltage-dependent calcium channel alpha 1 subunit,
            complete cds.
          Length = 2203

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 33/127 (25%), Positives = 60/127 (47%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +    N  ++  +         NF  +P  ++ LF
Sbjct: 1394 LPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNN---------NFQTFPQAVLLLF 1444

Query: 576  NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  M +                +E T G++++ VYFISFY++    ++NL V
Sbjct: 1445 RCATGEAWQEIMLACLPGKLCDPDSDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFV 1504

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1505 AVIMDNF 1511



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 18/69 (26%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W +VYF+S  ++   ++LNL++  +
Sbjct: 346 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGWEWPWVYFVSLIILGSFFVLNLVLGVL 405

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 406 SGEFSKERE 414



 Score = 38.5 bits (88), Expect = 0.15
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            FNF++  + M+ LF +     W   +     S  E  G  ++Y     ++FI + +I   
Sbjct: 1141 FNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENVGPVYNYRVEISIFFIIYIIIVAF 1200

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1201 FMMNIFVGFVIVTFQEQGEKE 1221



 Score = 37.0 bits (84), Expect = 0.45
 Identities = 31/131 (23%), Positives = 55/131 (41%), Gaps = 5/131 (3%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            L  + S+   L  +F  +  +  LG+Q+FGG       N D T    +      F+++P 
Sbjct: 703  LNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKF-----NFDETQTKRS-----TFDNFPQ 752

Query: 594  GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
             ++T+F +L   +W   M        G S S     +YFI  ++     LL L +A  ++
Sbjct: 753  ALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLKLFLAIAVD 812

Query: 429  AFQTEMDMETS 397
                   + T+
Sbjct: 813  NLADAESLNTA 823



>sp|Q99244|CCAD_MESAU Voltage-dependent L-type calcium channel
            alpha-1D subunit (Voltage- gated calcium channel alpha
            subunit Cav1.3) (Calcium channel, L type, alpha-1
            polypeptide isoform 2).>pir|A46227|A46227
            voltage-dependent Ca2+ channel alpha 1-subunit - golden
            hamster
          Length = 1610

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 33/127 (25%), Positives = 60/127 (47%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +    N  ++  +         NF  +P  ++ LF
Sbjct: 1348 LPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNN---------NFQTFPQAVLLLF 1398

Query: 576  NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  M +                +E T G++++ VYFISFY++    ++NL V
Sbjct: 1399 RCATGEAWQEIMLACLPGKLCDPDSDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFV 1458

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1459 AVIMDNF 1465



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 31/131 (23%), Positives = 56/131 (42%), Gaps = 5/131 (3%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            L  + S+   L  +F  +  +  LG+Q+FGG       N D T    +      F+++P 
Sbjct: 643  LNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKF-----NFDETQTKRS-----TFDNFPQ 692

Query: 594  GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
             ++T+F +L   +W   M        G S S     +YFI  ++     LLN+ +A  ++
Sbjct: 693  ALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVD 752

Query: 429  AFQTEMDMETS 397
                   + T+
Sbjct: 753  NLADAESLNTA 763



 Score = 37.7 bits (86), Expect = 0.26
 Identities = 17/69 (24%), Positives = 34/69 (49%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G    +VYF+S  +    ++LNL++  +
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWMNDAMGFELPWVYFVSLVIFGSFFVLNLVLGVL 404

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 405 SGEFSKERE 413



 Score = 36.6 bits (83), Expect = 0.59
 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVY---------FISFYVITVL 466
            FNF++  + M+ LF +     W   +    +  G +   VY         FI + +I   
Sbjct: 1080 FNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENAGPVYNHRVEISIFFIIYIIIVAF 1139

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1140 FMMNIFVGFVIVTFQEQGEKE 1160



>sp|Q01668|CCAD_HUMAN Voltage-dependent L-type calcium channel
            alpha-1D subunit (Voltage- gated calcium channel alpha
            subunit Cav1.3) (Calcium channel, L type, alpha-1
            polypeptide, isoform 2).>gb:HUMCACNLS_2029783 Human
            neuronal DHP-sensitive, voltage-dependent, calcium
            channel alpha-1D subunit mRNA, complete cds.
          Length = 2161

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 31/127 (24%), Positives = 58/127 (45%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +    N  ++  +         NF  +P  ++ LF
Sbjct: 1350 LPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNN---------NFQTFPQAVLLLF 1400

Query: 576  NLLVMGNWQLWMQSY----------------KELTGTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  M +                 +   G++++ VYFISFY++    ++NL V
Sbjct: 1401 RCATGEAWQEIMLACLPGKLCDPESDYNPGEEHTCGSNFAIVYFISFYMLCAFLIINLFV 1460

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1461 AVIMDNF 1467



 Score = 37.7 bits (86), Expect = 0.26
 Identities = 17/69 (24%), Positives = 34/69 (49%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G    +VYF+S  +    ++LNL++  +
Sbjct: 346 NFDNFAFAMLTVFQCITMEGWTDVLYWMNDAMGFELPWVYFVSLVIFGSFFVLNLVLGVL 405

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 406 SGEFSKERE 414



 Score = 36.6 bits (83), Expect = 0.59
 Identities = 28/118 (23%), Positives = 51/118 (43%), Gaps = 5/118 (4%)
 Frame = -2

Query: 735 IFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLLVMGN 556
           +F  +  +  LG+Q+FGG  N      D T    +      F+++P  ++T+F +L   +
Sbjct: 657 LFLFIIIFSLLGMQLFGGKFN-----FDETQTKRS-----TFDNFPQALLTVFQILTGED 706

Query: 555 WQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLEAFQTEMDMETS 397
           W   M        G S S     +YFI  ++     LLN+ +A  ++       + T+
Sbjct: 707 WNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADAESLNTA 764



 Score = 36.2 bits (82), Expect = 0.77
 Identities = 19/81 (23%), Positives = 37/81 (45%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVY---------FISFYVITVL 466
            FNF++  + M+ LF +     W   +    +  G +   +Y         FI + +I   
Sbjct: 1082 FNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENIGPIYNHRVEISIFFIIYIIIVAF 1141

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1142 FMMNIFVGFVIVTFQEQGEKE 1162



>gb:HSU93305_2027608 Homo sapiens A4 differentiation-dependent
           protein (A4), triple LIM domain protein (LMO6), and
           synaptophysin (SYP) genes, complete cds; and calcium
           channel alpha-1 subunit (CACNA1F) gene, partial cds.
          Length = 644

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 33/127 (25%), Positives = 62/127 (48%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753 MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
           +PY+  +  ++ F Y  +G+Q+FG +        DGT ++ N+    NF  +P  ++ LF
Sbjct: 110 LPYVALLIAMIFFIYAVIGMQMFGKVALQ-----DGTQINRNN----NFQTFPQAVLLLF 160

Query: 576 NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                  WQ  M +                +E T G++++  YFISF+++    ++NL V
Sbjct: 161 RCATGEAWQEIMLASLPGNRCDPESDFGPGEEFTCGSNFAIAYFISFFMLCAFLIINLFV 220

Query: 444 AFVLEAF 424
           A +++ F
Sbjct: 221 AVIMDNF 227



>gb:AF201304_1889785 Homo sapiens voltage-gated L-type calcium channel
            alpha-1 subunit mRNA, complete cds.
          Length = 1977

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 33/127 (25%), Positives = 62/127 (48%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  ++ F Y  +G+Q+FG +        DGT ++ N+    NF  +P  ++ LF
Sbjct: 1327 LPYVALLIAMIFFIYAVIGMQMFGKVALQ-----DGTQINRNN----NFQTFPQAVLLLF 1377

Query: 576  NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  M +                +E T G++++  YFISF+++    ++NL V
Sbjct: 1378 RCATGEAWQEIMLASLPGNRCDPESDFGPGEEFTCGSNFAIAYFISFFMLCAFLIINLFV 1437

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1438 AVIMDNF 1444



 Score = 38.9 bits (89), Expect = 0.12
 Identities = 21/81 (25%), Positives = 41/81 (50%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            FNF++  + M+ LF +     W   +     +Y E  G  ++Y     V+FI + +I   
Sbjct: 1067 FNFDNVLSAMMALFTVSTFEGWPALLYKAIDAYAEDHGPIYNYRVEISVFFIVYIIIIAF 1126

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  F+ + + E
Sbjct: 1127 FMMNIFVGFVIITFRAQGEQE 1147



 Score = 37.0 bits (84), Expect = 0.45
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQ---LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIV 445
           NF+++   M+T+F  + M  W     WMQ   +  G    +VYF+S  +    ++LNL++
Sbjct: 312 NFDNFFFAMLTVFQCVTMEGWTDVLYWMQ---DAMGYELPWVYFVSLVIFGSFFVLNLVL 368

Query: 444 AFVLEAFQTEMD 409
             +   F  E +
Sbjct: 369 GVLSGEFSKERE 380



 Score = 36.2 bits (82), Expect = 0.77
 Identities = 28/120 (23%), Positives = 52/120 (43%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG       N D T    +      F+ +P 
Sbjct: 650 LNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKF-----NFDQTHTKRS-----TFDTFPQ 699

Query: 594 GMVTLFNLLVMGNWQLWMQSYKELTGTSW-----SYVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W + M       G  +       +YFI  ++     LLN+ +A  ++
Sbjct: 700 ALLTVFQILTGEDWNVVMYDGIMAYGGPFFPGMLVCIYFIILFICGNYILLNVFLAIAVD 759



>gb:AF067227_1880527 Homo sapiens voltage-gated L-type calcium channel
            alpha-1 subunit (CACNA1F) mRNA, complete cds.
          Length = 1912

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 33/127 (25%), Positives = 62/127 (48%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  ++ F Y  +G+Q+FG +        DGT ++ N+    NF  +P  ++ LF
Sbjct: 1262 LPYVALLIAMIFFIYAVIGMQMFGKVALQ-----DGTQINRNN----NFQTFPQAVLLLF 1312

Query: 576  NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  M +                +E T G++++  YFISF+++    ++NL V
Sbjct: 1313 RCATGEAWQEIMLASLPGNRCDPESDFGPGEEFTCGSNFAIAYFISFFMLCAFLIINLFV 1372

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1373 AVIMDNF 1379



 Score = 38.9 bits (89), Expect = 0.12
 Identities = 21/81 (25%), Positives = 41/81 (50%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            FNF++  + M+ LF +     W   +     +Y E  G  ++Y     V+FI + +I   
Sbjct: 1002 FNFDNVLSAMMALFTVSTFEGWPALLYKAIDAYAEDHGPIYNYRVEISVFFIVYIIIIAF 1061

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  F+ + + E
Sbjct: 1062 FMMNIFVGFVIITFRAQGEQE 1082



 Score = 37.0 bits (84), Expect = 0.45
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQ---LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIV 445
           NF+++   M+T+F  + M  W     WMQ   +  G    +VYF+S  +    ++LNL++
Sbjct: 247 NFDNFFFAMLTVFQCVTMEGWTDVLYWMQ---DAMGYELPWVYFVSLVIFGSFFVLNLVL 303

Query: 444 AFVLEAFQTEMD 409
             +   F  E +
Sbjct: 304 GVLSGEFSKERE 315



 Score = 36.2 bits (82), Expect = 0.77
 Identities = 28/120 (23%), Positives = 52/120 (43%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG       N D T    +      F+ +P 
Sbjct: 585 LNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKF-----NFDQTHTKRS-----TFDTFPQ 634

Query: 594 GMVTLFNLLVMGNWQLWMQSYKELTGTSW-----SYVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W + M       G  +       +YFI  ++     LLN+ +A  ++
Sbjct: 635 ALLTVFQILTGEDWNVVMYDGIMAYGGPFFPGMLVCIYFIILFICGNYILLNVFLAIAVD 694



>sp|O60840|CCAF_HUMAN Voltage-dependent L-type calcium channel
            alpha-1F subunit (Voltage- gated calcium channel alpha
            subunit Cav1.4).>gb:HSA6216_2009820 Homo sapiens CACNA1F
            gene, exons 1 to 48.>gb:HSAJ4874_2010376 Homo sapiens
            mRNA for L-type calcium channel alpha-1 subunit, complete
            CDS.
          Length = 1966

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 33/127 (25%), Positives = 62/127 (48%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  ++ F Y  +G+Q+FG +        DGT ++ N+    NF  +P  ++ LF
Sbjct: 1316 LPYVALLIAMIFFIYAVIGMQMFGKVALQ-----DGTQINRNN----NFQTFPQAVLLLF 1366

Query: 576  NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  M +                +E T G++++  YFISF+++    ++NL V
Sbjct: 1367 RCATGEAWQEIMLASLPGNRCDPESDFGPGEEFTCGSNFAIAYFISFFMLCAFLIINLFV 1426

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1427 AVIMDNF 1433



 Score = 38.9 bits (89), Expect = 0.12
 Identities = 21/81 (25%), Positives = 41/81 (50%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            FNF++  + M+ LF +     W   +     +Y E  G  ++Y     V+FI + +I   
Sbjct: 1056 FNFDNVLSAMMALFTVSTFEGWPALLYKAIDAYAEDHGPIYNYRVEISVFFIVYIIIIAF 1115

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  F+ + + E
Sbjct: 1116 FMMNIFVGFVIITFRAQGEQE 1136



 Score = 37.0 bits (84), Expect = 0.45
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQ---LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIV 445
           NF+++   M+T+F  + M  W     WMQ   +  G    +VYF+S  +    ++LNL++
Sbjct: 312 NFDNFFFAMLTVFQCVTMEGWTDVLYWMQ---DAMGYELPWVYFVSLVIFGSFFVLNLVL 368

Query: 444 AFVLEAFQTEMD 409
             +   F  E +
Sbjct: 369 GVLSGEFSKERE 380



 Score = 36.2 bits (82), Expect = 0.77
 Identities = 28/120 (23%), Positives = 52/120 (43%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG       N D T    +      F+ +P 
Sbjct: 639 LNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKF-----NFDQTHTKRS-----TFDTFPQ 688

Query: 594 GMVTLFNLLVMGNWQLWMQSYKELTGTSW-----SYVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W + M       G  +       +YFI  ++     LLN+ +A  ++
Sbjct: 689 ALLTVFQILTGEDWNVVMYDGIMAYGGPFFPGMLVCIYFIILFICGNYILLNVFLAIAVD 748



>gb:AF365975_2064220 Rattus norvegicus alpha 1F calcium channel
            subunit mRNA, complete cds.
          Length = 1981

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 33/127 (25%), Positives = 63/127 (49%), Gaps = 17/127 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +P++  +  ++ F Y  +G+Q+FG +        DGT ++ N+    NF  +P  ++ LF
Sbjct: 1326 LPHVALLIAMIFFIYAVIGMQMFGKVALQ-----DGTQINRNN----NFQTFPQAVLLLF 1376

Query: 576  NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                   WQ  M +                +E T G++++ VYFISF+++    ++NL V
Sbjct: 1377 RCATGEAWQEIMLASLPGNRCDPESDFGPGEEFTCGSNFAIVYFISFFMLCAFLIINLFV 1436

Query: 444  AFVLEAF 424
            A +++ F
Sbjct: 1437 AVIMDNF 1443



 Score = 37.4 bits (85), Expect = 0.34
 Identities = 20/81 (24%), Positives = 41/81 (50%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            FNF++  + M+ LF +     W   +     ++ E  G  ++Y     V+FI + +I   
Sbjct: 1066 FNFDNVLSAMMALFTVSTFEGWPALLYKAIDAHAEDEGPIYNYHVEISVFFIVYIIIIAF 1125

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  F+ + + E
Sbjct: 1126 FMMNIFVGFVIITFRAQGEQE 1146



 Score = 37.4 bits (85), Expect = 0.34
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQ---LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIV 445
           NF+++   M+T+F  + M  W     WMQ   +  G    +VYF+S  +    ++LNL++
Sbjct: 312 NFDNFFFAMLTVFQCITMEGWTDVLYWMQ---DAMGYELPWVYFVSLVIFGSFFVLNLVL 368

Query: 444 AFVLEAFQTEMD 409
             +   F  E +
Sbjct: 369 GVLSGEFSKERE 380



 Score = 36.6 bits (83), Expect = 0.59
 Identities = 29/120 (24%), Positives = 52/120 (43%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG       N D T    +      F+ +P 
Sbjct: 650 LNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKF-----NFDQTHTKRS-----TFDTFPQ 699

Query: 594 GMVTLFNLLVMGNWQLWMQSYKELTGTSW-----SYVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W + M       G  +       VYFI  ++     LLN+ +A  ++
Sbjct: 700 ALLTVFQILTGEDWNVVMYDGIMAYGGPFFPGMLVCVYFIILFICGNYILLNVFLAIAVD 759



>gb:RATRBCII_2133667 Rat brain calcium channel alpha-1 subunit
            (rbC-II) mRNA, complete cds.
          Length = 2143

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 36/129 (27%), Positives = 61/129 (47%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1363 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1413

Query: 576  NLLVMGNWQLWM----------------QSYKELT--GTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M                 S K  T  G+S++  YFISFY++    ++NL
Sbjct: 1414 RCATGEAWQDIMLACMPGKKCAPESEPSNSTKGETPCGSSFAVFYFISFYMLCAFLIINL 1473

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1474 FVAVIMDNF 1482



 Score = 38.5 bits (88), Expect = 0.15
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQ---LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIV 445
           NF+++   M+T+F  + M  W     WMQ   +  G    +VYF+S  +    ++LNL++
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWMQ---DAMGYELPWVYFVSLVIFGSFFVLNLVL 401

Query: 444 AFVLEAFQTEMD 409
             +   F  E +
Sbjct: 402 GVLSGEFSKERE 413



 Score = 36.6 bits (83), Expect = 0.59
 Identities = 34/160 (21%), Positives = 64/160 (40%), Gaps = 5/160 (3%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 645  LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 694

Query: 594  GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
             ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 695  SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754

Query: 429  AFQTEMDMETSAICVDGENKXXXXXXXXRKYGTKTRSQRV 310
                + +  TSA   + E K         +  +  + Q V
Sbjct: 755  NL-ADAESLTSAQKEEEEEKERKKLARPARTASPEKKQEV 793



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1099 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1158

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1159 FMMNIFVGFVIVTFQEQGEQE 1179



>gb:AF227748_1891556 Homo sapiens voltage-dependent calcium channel
            alpha 1G subunit isoform bcd (CACNA1G) mRNA, complete
            cds.
          Length = 2306

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 40/138 (28%), Positives = 63/138 (45%), Gaps = 5/138 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 848  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 903

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 904  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 958

Query: 450  IVAFVLEAFQTEMDMETS 397
            +VA ++E FQ E D   S
Sbjct: 959  LVAILVEGFQAEGDANKS 976



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
            TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 1381 TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 1439

Query: 615  -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                 NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 1440 VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 1499

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1500 IVAFFVLNMFVGVVVENF 1517



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 1723 LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 1776

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 1777 TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 1829



>gb:AF227747_1891555 Homo sapiens voltage-dependent calcium channel
            alpha 1G subunit isoform bc (CACNA1G) mRNA, complete cds.
          Length = 2261

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 40/138 (28%), Positives = 63/138 (45%), Gaps = 5/138 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 848  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 903

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 904  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 958

Query: 450  IVAFVLEAFQTEMDMETS 397
            +VA ++E FQ E D   S
Sbjct: 959  LVAILVEGFQAEGDANKS 976



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
            TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 1381 TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 1439

Query: 615  -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                 NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 1440 VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 1499

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1500 IVAFFVLNMFVGVVVENF 1517



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 1723 LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 1776

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 1777 TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 1829



>gb:AF227746_1891554 Homo sapiens voltage-dependent calcium channel
            alpha 1G subunit isoform af (CACNA1G) mRNA, complete cds.
          Length = 2298

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 40/138 (28%), Positives = 63/138 (45%), Gaps = 5/138 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 848  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 903

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 904  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 958

Query: 450  IVAFVLEAFQTEMDMETS 397
            +VA ++E FQ E D   S
Sbjct: 959  LVAILVEGFQAEGDANKS 976



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
            TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 1381 TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 1439

Query: 615  -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                 NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 1440 VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 1499

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1500 IVAFFVLNMFVGVVVENF 1517



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 1712 LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 1765

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 1766 TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 1818



>gb:AF134985_1885667 Homo sapiens T calcium channel alpha1G subunit
            (CACNA1G) mRNA, complete cds.
          Length = 2171

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 40/138 (28%), Positives = 63/138 (45%), Gaps = 5/138 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 848  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 903

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 904  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 958

Query: 450  IVAFVLEAFQTEMDMETS 397
            +VA ++E FQ E D   S
Sbjct: 959  LVAILVEGFQAEGDANKS 976



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
            TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 1381 TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 1439

Query: 615  -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                 NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 1440 VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 1499

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1500 IVAFFVLNMFVGVVVENF 1517



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 1712 LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 1765

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 1766 TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 1818



>gb:AF126966_1885183 Homo sapiens voltage-dependent calcium channel
            alpha 1G subunit a isoform (CACNA1G) mRNA, complete
            cds.>gb:AF190860_1889020 Homo sapiens low
            voltage-activated T-type calcium channel alpha 1G splice
            variant CavT.1a (CACNA1G) mRNA, complete cds.
          Length = 2250

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 40/138 (28%), Positives = 63/138 (45%), Gaps = 5/138 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 848  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 903

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 904  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 958

Query: 450  IVAFVLEAFQTEMDMETS 397
            +VA ++E FQ E D   S
Sbjct: 959  LVAILVEGFQAEGDANKS 976



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
            TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 1381 TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 1439

Query: 615  -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                 NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 1440 VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 1499

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1500 IVAFFVLNMFVGVVVENF 1517



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 1712 LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 1765

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 1766 TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 1818



>gb:AF126965_1885182 Homo sapiens voltage-dependent calcium channel
            alpha 1G subunit b isoform (CACNA1G) mRNA, complete cds.
          Length = 2243

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 40/138 (28%), Positives = 63/138 (45%), Gaps = 5/138 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 848  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 903

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 904  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 958

Query: 450  IVAFVLEAFQTEMDMETS 397
            +VA ++E FQ E D   S
Sbjct: 959  LVAILVEGFQAEGDANKS 976



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
            TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 1381 TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 1439

Query: 615  -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                 NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 1440 VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 1499

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1500 IVAFFVLNMFVGVVVENF 1517



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 1705 LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 1758

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 1759 TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 1811



>gb:AF124351_1885006 Homo sapiens T-type calcium channel alpha 1G
            (CACNA1G) mRNA, partial cds.
          Length = 1207

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 40/138 (28%), Positives = 63/138 (45%), Gaps = 5/138 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 848  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 903

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 904  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 958

Query: 450  IVAFVLEAFQTEMDMETS 397
            +VA ++E FQ E D   S
Sbjct: 959  LVAILVEGFQAEGDANKS 976



>gb:BC057399_2102751 Mus musculus calcium channel, voltage-dependent,
            T type, alpha 1G subunit, mRNA (cDNA clone MGC:62312
            IMAGE:6410519), complete cds.
          Length = 2248

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 40/138 (28%), Positives = 63/138 (45%), Gaps = 5/138 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 831  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 886

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 887  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 941

Query: 450  IVAFVLEAFQTEMDMETS 397
            +VA ++E FQ E D   S
Sbjct: 942  LVAILVEGFQAEGDATKS 959



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
            TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 1365 TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 1423

Query: 615  -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                 NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 1424 VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 1483

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1484 IVAFFVLNMFVGVVVENF 1501



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 1707 LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 1760

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 1761 TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 1813



>gb:AL645965_2072054 Mouse DNA sequence from clone RP23-65I14 on
            chromosome 11 Contains the 5' end of the gene for a novel
            protein (330000P08Rik) (Luc7a), the gene for a novel
            protein (5530600A18Rik), the Abcc3 gene for ATP-binding
            cassette sub-family C (CFTR/MRP) member 3, the Cacna1g
            gene for calcium channel voltage-dependent T type alpha
            1G subunit, the 3' end of the Tisp78 gene for transcript
            increased in spermiogenesis 78 and one CpG island,
            complete sequence.
          Length = 2254

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 40/138 (28%), Positives = 63/138 (45%), Gaps = 5/138 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 848  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 903

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 904  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 958

Query: 450  IVAFVLEAFQTEMDMETS 397
            +VA ++E FQ E D   S
Sbjct: 959  LVAILVEGFQAEGDATKS 976



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
            TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 1382 TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 1440

Query: 615  -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                 NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 1441 VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 1500

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1501 IVAFFVLNMFVGVVVENF 1518



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 1713 LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 1766

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 1767 TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 1819



>gb:AL645965_2072053 Mouse DNA sequence from clone RP23-65I14 on
            chromosome 11 Contains the 5' end of the gene for a novel
            protein (330000P08Rik) (Luc7a), the gene for a novel
            protein (5530600A18Rik), the Abcc3 gene for ATP-binding
            cassette sub-family C (CFTR/MRP) member 3, the Cacna1g
            gene for calcium channel voltage-dependent T type alpha
            1G subunit, the 3' end of the Tisp78 gene for transcript
            increased in spermiogenesis 78 and one CpG island,
            complete sequence.
          Length = 2176

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 40/138 (28%), Positives = 63/138 (45%), Gaps = 5/138 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 848  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 903

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 904  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 958

Query: 450  IVAFVLEAFQTEMDMETS 397
            +VA ++E FQ E D   S
Sbjct: 959  LVAILVEGFQAEGDATKS 976



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
            TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 1382 TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 1440

Query: 615  -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                 NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 1441 VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 1500

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1501 IVAFFVLNMFVGVVVENF 1518



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 1713 LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 1766

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 1767 TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 1819



>gb:AL645965_2072052 Mouse DNA sequence from clone RP23-65I14 on
            chromosome 11 Contains the 5' end of the gene for a novel
            protein (330000P08Rik) (Luc7a), the gene for a novel
            protein (5530600A18Rik), the Abcc3 gene for ATP-binding
            cassette sub-family C (CFTR/MRP) member 3, the Cacna1g
            gene for calcium channel voltage-dependent T type alpha
            1G subunit, the 3' end of the Tisp78 gene for transcript
            increased in spermiogenesis 78 and one CpG island,
            complete sequence.
          Length = 2265

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 40/138 (28%), Positives = 63/138 (45%), Gaps = 5/138 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 848  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 903

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 904  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 958

Query: 450  IVAFVLEAFQTEMDMETS 397
            +VA ++E FQ E D   S
Sbjct: 959  LVAILVEGFQAEGDATKS 976



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
            TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 1382 TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 1440

Query: 615  -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                 NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 1441 VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 1500

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1501 IVAFFVLNMFVGVVVENF 1518



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 1724 LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 1777

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 1778 TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 1830



>gb:AL645965_2072051 Mouse DNA sequence from clone RP23-65I14 on
            chromosome 11 Contains the 5' end of the gene for a novel
            protein (330000P08Rik) (Luc7a), the gene for a novel
            protein (5530600A18Rik), the Abcc3 gene for ATP-binding
            cassette sub-family C (CFTR/MRP) member 3, the Cacna1g
            gene for calcium channel voltage-dependent T type alpha
            1G subunit, the 3' end of the Tisp78 gene for transcript
            increased in spermiogenesis 78 and one CpG island,
            complete sequence.
          Length = 2247

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 40/138 (28%), Positives = 63/138 (45%), Gaps = 5/138 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 848  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 903

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 904  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 958

Query: 450  IVAFVLEAFQTEMDMETS 397
            +VA ++E FQ E D   S
Sbjct: 959  LVAILVEGFQAEGDATKS 976



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
            TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 1382 TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 1440

Query: 615  -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                 NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 1441 VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 1500

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1501 IVAFFVLNMFVGVVVENF 1518



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 1706 LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 1759

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 1760 TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 1812



>gb:AL645965_2072050 Mouse DNA sequence from clone RP23-65I14 on
            chromosome 11 Contains the 5' end of the gene for a novel
            protein (330000P08Rik) (Luc7a), the gene for a novel
            protein (5530600A18Rik), the Abcc3 gene for ATP-binding
            cassette sub-family C (CFTR/MRP) member 3, the Cacna1g
            gene for calcium channel voltage-dependent T type alpha
            1G subunit, the 3' end of the Tisp78 gene for transcript
            increased in spermiogenesis 78 and one CpG island,
            complete sequence.
          Length = 2248

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 40/138 (28%), Positives = 63/138 (45%), Gaps = 5/138 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 831  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 886

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 887  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 941

Query: 450  IVAFVLEAFQTEMDMETS 397
            +VA ++E FQ E D   S
Sbjct: 942  LVAILVEGFQAEGDATKS 959



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
            TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 1365 TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 1423

Query: 615  -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                 NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 1424 VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 1483

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1484 IVAFFVLNMFVGVVVENF 1501



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 1707 LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 1760

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 1761 TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 1813



>sp|O54898|CCAG_RAT Voltage-dependent T-type calcium channel alpha-1G
            subunit (Voltage- gated calcium channel alpha subunit
            Cav3.1).>pir|T09053|T09053 low voltage-activated, T-type
            calcium channel alpha chain - rat>gb:AF290212_2061700
            Rattus norvegicus calcium channel alpha-1-G subunit mRNA,
            complete cds.>gb:RNCAA1G_2134547 Rattus norvegicus low
            voltage-activated, T-type calcium channel alpha subunit
            (CACNA1G) mRNA, complete cds.
          Length = 2254

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 40/138 (28%), Positives = 63/138 (45%), Gaps = 5/138 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 849  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 904

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 905  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 959

Query: 450  IVAFVLEAFQTEMDMETS 397
            +VA ++E FQ E D   S
Sbjct: 960  LVAILVEGFQAEGDATKS 977



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
            TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 1383 TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 1441

Query: 615  -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                 NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 1442 VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 1501

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1502 IVAFFVLNMFVGVVVENF 1519



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 1714 LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 1767

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 1768 TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 1820



>sp|Q15878|CCAE_HUMAN Voltage-dependent R-type calcium channel
           alpha-1E subunit (Voltage- gated calcium channel alpha
           subunit Cav2.3) (Calcium channel, L type, alpha-1
           polypeptide, isoform 6) (Brain calcium channel II)
           (BII).>gb:HUMVOCC_2038146 Homo sapiens voltage-operated
           calcium channel, alpha-1 subunit mRNA, complete cds.
          Length = 2312

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 31/119 (26%), Positives = 58/119 (48%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           ++ + S++  L  +F  +  +  LG+Q+FGG  N      DGT  +       NF+ +P 
Sbjct: 597 MSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFN----DGTPSA-------NFDTFPA 645

Query: 594 GMVTLFNLLVMGNWQLWM----QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M    +S   ++   WS +YFI   +     LLN+ +A  ++
Sbjct: 646 AIITVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVD 704



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 32/130 (24%), Positives = 55/130 (42%), Gaps = 19/130 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +      +++  +         NF  +   ++ LF
Sbjct: 1606 LPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHN---------NFRSFFGSLMLLF 1656

Query: 576  NLLVMGNWQLWM------------------QSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M                  Q+  E  GT  +YVYF+SF       +LNL
Sbjct: 1657 RSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLNL 1716

Query: 450  IVAFVLEAFQ 421
             VA +++ F+
Sbjct: 1717 FVAVIMDNFE 1726



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 16/68 (23%), Positives = 36/68 (52%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  +  G +W+++YFI   +I   ++LNL++  + 
Sbjct: 292 FDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLS 351

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 352 GEFAKERE 359



>gb:AB016287_2043895 Cavia porcellus mRNA for L-type calcium channel
            alpha 1 subunit, complete cds.
          Length = 2169

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 34/129 (26%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1389 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1439

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1440 RCATGEAWQDIMLACMPGKKCAPESDPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1499

Query: 450  IVAFVLEAF 424
             VA V++ F
Sbjct: 1500 FVAVVMDNF 1508



 Score = 40.8 bits (94), Expect = 0.031
 Identities = 34/157 (21%), Positives = 67/157 (42%), Gaps = 36/157 (22%)
 Frame = -2

Query: 771 TLIPSLMPYLGT---IFCVLCFYCSLGLQIFGGMVNAGNPNLDG-TDLSDND-------- 628
           ++I +++P L T   +  V+  Y  +GL++F G ++    N +G TD+   +        
Sbjct: 289 SIIKAMVPLLHTALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGITDVPAEEDPSPCALE 348

Query: 627 ---------------------YLLFNFNDYPNGMVTLFNLLVMGNWQ---LWMQSYKELT 520
                                + + NF+++   M+T+F  + M  W     WMQ   +  
Sbjct: 349 SGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQ---DAM 405

Query: 519 GTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQTEMD 409
           G    +VYF+S  +    ++LNL++  +   F  E +
Sbjct: 406 GYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKERE 442



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1125 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1184

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1185 FMMNIFVGFVIVTFQEQGEQE 1205



 Score = 35.4 bits (80), Expect = 1.3
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            L  + S+   L  +F  +  +  LG+Q+FGG  N        +           F+++P 
Sbjct: 674  LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMRTRRS----------TFDNFPQ 723

Query: 594  GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
             ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 724  SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 783



>gb:AL160059_1921716 Human DNA sequence from clone RP11-94G15 on
            chromosome 1 Contains the 5' end of the CACNA1E gene for
            calcium channel voltage-dependent alpha 1E subunit,
            complete sequence.>gb:AL161734_1922157 Human DNA sequence
            from clone RP11-33M22 on chromosome 1q25.2-31.2 Contains
            the 3' end of the CACNA1E gene for calcium channel
            voltage-dependent alpha 1E subunit, complete
            sequence.>gb:AL359270_1925451 Human DNA sequence from
            clone RP11-494J9 on chromosome 1 Contains parrt of the
            CACNA1E gene for calcium channel voltage-dependent alpha
            1E subunit, complete sequence.>gb:AL590998_1929946 Human
            DNA sequence from clone RP4-677A15 on chromosome 1
            Contains parrt of the CACNA1E gene for calcium channel
            voltage-dependent alpha 1E subunit, complete sequence.
          Length = 2251

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 48/209 (22%), Positives = 85/209 (40%), Gaps = 26/209 (12%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            ++ + S++  L  +F  +  +  LG+Q+FGG  N      DGT  +       NF+ +P 
Sbjct: 597  MSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFN----DGTPSA-------NFDTFPA 645

Query: 594  GMVTLFNLLVMGNWQLWM----QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL-- 433
             ++T+F +L   +W   M    +S   ++   WS +YFI   +     LLN+ +A  +  
Sbjct: 646  AIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDN 705

Query: 432  ---------------EAFQTEMDMETS--AICVDGENKXXXXXXXXRKYGTKTRSQRVDA 304
                           EAF  +  ++ +     +   N         R++      QR   
Sbjct: 706  LANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERERRRRHHMSVWEQRTSQ 765

Query: 303  LLHHMLSSE---LTQCSSP*FSPLQVMNP 226
            L  HM  S    L +  +P  +PL  +NP
Sbjct: 766  LRKHMQMSSQEALNREEAPTMNPLNPLNP 794



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 32/130 (24%), Positives = 55/130 (42%), Gaps = 19/130 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +      +++  +         NF  +   ++ LF
Sbjct: 1588 LPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHN---------NFRSFFGSLMLLF 1638

Query: 576  NLLVMGNWQLWM------------------QSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M                  Q+  E  GT  +YVYF+SF       +LNL
Sbjct: 1639 RSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLNL 1698

Query: 450  IVAFVLEAFQ 421
             VA +++ F+
Sbjct: 1699 FVAVIMDNFE 1708



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 16/68 (23%), Positives = 36/68 (52%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  +  G +W+++YFI   +I   ++LNL++  + 
Sbjct: 292 FDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLS 351

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 352 GEFAKERE 359



>gb:AF239258S3_1892431 Homo sapiens calcium channel alpha1E subunit
            (CACNA1E) gene, exons 7-49, and partial cds,
            alternatively spliced.
          Length = 2162

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 48/209 (22%), Positives = 85/209 (40%), Gaps = 26/209 (12%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            ++ + S++  L  +F  +  +  LG+Q+FGG  N      DGT  +       NF+ +P 
Sbjct: 508  MSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFN----DGTPSA-------NFDTFPA 556

Query: 594  GMVTLFNLLVMGNWQLWM----QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL-- 433
             ++T+F +L   +W   M    +S   ++   WS +YFI   +     LLN+ +A  +  
Sbjct: 557  AIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDN 616

Query: 432  ---------------EAFQTEMDMETS--AICVDGENKXXXXXXXXRKYGTKTRSQRVDA 304
                           EAF  +  ++ +     +   N         R++      QR   
Sbjct: 617  LANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERERRRRHHMSVWEQRTSQ 676

Query: 303  LLHHMLSSE---LTQCSSP*FSPLQVMNP 226
            L  HM  S    L +  +P  +PL  +NP
Sbjct: 677  LRKHMQMSSQEALNREEAPTMNPLNPLNP 705



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 32/130 (24%), Positives = 55/130 (42%), Gaps = 19/130 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +      +++  +         NF  +   ++ LF
Sbjct: 1499 LPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHN---------NFRSFFGSLMLLF 1549

Query: 576  NLLVMGNWQLWM------------------QSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M                  Q+  E  GT  +YVYF+SF       +LNL
Sbjct: 1550 RSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLNL 1609

Query: 450  IVAFVLEAFQ 421
             VA +++ F+
Sbjct: 1610 FVAVIMDNFE 1619



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 16/68 (23%), Positives = 36/68 (52%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  +  G +W+++YFI   +I   ++LNL++  + 
Sbjct: 203 FDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLS 262

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 263 GEFAKERE 270



>gb:AF199511_1415930 Oryctolagus cuniculus calcium channel mRNA,
           partial cds.
          Length = 909

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753 MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
           +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 588 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 638

Query: 576 NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                  WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 639 RCATGEAWQDIMLACMPGKKCAPESEPHNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 698

Query: 450 IVAFVLEAF 424
            VA +++ F
Sbjct: 699 FVAIIMDNF 707



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618 FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
           F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 335 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 394

Query: 465 WLLNLIVAFVLEAFQTEMDME 403
           +++N+ V FV+  FQ + + E
Sbjct: 395 FMMNIFVGFVIVTFQEQGEQE 415



>gb:U37548_1402917 Caenorhabditis elegans cosmid C54D2, complete
            sequence.
          Length = 1418

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 39/140 (27%), Positives = 63/140 (45%), Gaps = 23/140 (16%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLC----FYCSLGLQIFGGMV------NAGNPNLDGTDLSD--N 631
            +TLI SL P +G I  + C     +  LG+Q+F GM+        GN       + D  N
Sbjct: 1239 MTLISSLKP-IGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGNVTTKADCIEDYRN 1297

Query: 630  DYL--LFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISF 484
             ++   +NF++    +++LF L     W   M    +  G           W  +YFISF
Sbjct: 1298 KWVNHRYNFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISF 1357

Query: 483  YVITVLWLLNLIVAFVLEAF 424
             ++   ++LN+ V  V+E F
Sbjct: 1358 LLLVGFFVLNMFVGVVVENF 1377



 Score = 37.0 bits (84), Expect = 0.45
 Identities = 19/71 (26%), Positives = 36/71 (50%)
 Frame = -2

Query: 615  NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
            NF+     ++T+F +L   +W + + +    T   W+ +YF++        L NL+VA +
Sbjct: 820  NFDTLLWALITVFQILTQEDWNMVLFNGMAQTNP-WAALYFVALMTFGNYVLFNLLVAIL 878

Query: 435  LEAFQTEMDME 403
            +E FQ   + E
Sbjct: 879  VEGFQESKEEE 889



>gb:AY322480_1319475 Caenorhabditis elegans T-type voltage sensitive
            calcium channel alpha1 subunit isoform D (cca-1) mRNA,
            complete cds.>gb:U37548_1402913 Caenorhabditis elegans
            cosmid C54D2, complete sequence.
          Length = 1844

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 39/140 (27%), Positives = 63/140 (45%), Gaps = 23/140 (16%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLC----FYCSLGLQIFGGMV------NAGNPNLDGTDLSD--N 631
            +TLI SL P +G I  + C     +  LG+Q+F GM+        GN       + D  N
Sbjct: 1246 MTLISSLKP-IGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGNVTTKADCIEDYRN 1304

Query: 630  DYL--LFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISF 484
             ++   +NF++    +++LF L     W   M    +  G           W  +YFISF
Sbjct: 1305 KWVNHRYNFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISF 1364

Query: 483  YVITVLWLLNLIVAFVLEAF 424
             ++   ++LN+ V  V+E F
Sbjct: 1365 LLLVGFFVLNMFVGVVVENF 1384



 Score = 41.2 bits (95), Expect = 0.024
 Identities = 31/140 (22%), Positives = 63/140 (45%), Gaps = 5/140 (3%)
 Frame = -2

Query: 807  YEVIVPL*QHFLTLIPSLMPYLGTIFCVLCFYCSLGLQIFG-GMVNAGNPNLDGTDLSDN 631
            Y+++V      L  + ++  + G +   +  + +LG+ +FG    N  +  L  T     
Sbjct: 763  YQLVV-----MLRTMDNVTVFFGLLVLFIFIFSTLGMVLFGCKFCNHPDTGLQCTSAQVI 817

Query: 630  DYLL----FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLW 463
              +      NF+++    VT+F +L   +W + + +    T   W+ +YF++        
Sbjct: 818  SSICECDRMNFDNFLFATVTVFQILTQEDWNMVLFNGMAQTNP-WAALYFVALMTFGNYV 876

Query: 462  LLNLIVAFVLEAFQTEMDME 403
            L NL+VA ++E FQ   + E
Sbjct: 877  LFNLLVAILVEGFQESKEEE 896



>gb:AY313900_1318671 Caenorhabditis elegans T-type calcium channel
            alpha1 subunit isoform C (cca-1) mRNA, complete cds;
            alternatively spliced.>gb:U37548_1402916 Caenorhabditis
            elegans cosmid C54D2, complete sequence.
          Length = 1852

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 39/140 (27%), Positives = 63/140 (45%), Gaps = 23/140 (16%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLC----FYCSLGLQIFGGMV------NAGNPNLDGTDLSD--N 631
            +TLI SL P +G I  + C     +  LG+Q+F GM+        GN       + D  N
Sbjct: 1239 MTLISSLKP-IGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGNVTTKADCIEDYRN 1297

Query: 630  DYL--LFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISF 484
             ++   +NF++    +++LF L     W   M    +  G           W  +YFISF
Sbjct: 1298 KWVNHRYNFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISF 1357

Query: 483  YVITVLWLLNLIVAFVLEAF 424
             ++   ++LN+ V  V+E F
Sbjct: 1358 LLLVGFFVLNMFVGVVVENF 1377



 Score = 37.0 bits (84), Expect = 0.45
 Identities = 19/71 (26%), Positives = 36/71 (50%)
 Frame = -2

Query: 615  NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
            NF+     ++T+F +L   +W + + +    T   W+ +YF++        L NL+VA +
Sbjct: 820  NFDTLLWALITVFQILTQEDWNMVLFNGMAQTNP-WAALYFVALMTFGNYVLFNLLVAIL 878

Query: 435  LEAFQTEMDME 403
            +E FQ   + E
Sbjct: 879  VEGFQESKEEE 889



>gb:AY313899_1318670 Caenorhabditis elegans T-type calcium channel
            alpha1 subunit isoform B (cca-1) mRNA, complete cds;
            alternatively spliced.>gb:U37548_1402914 Caenorhabditis
            elegans cosmid C54D2, complete sequence.
          Length = 1885

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 39/140 (27%), Positives = 63/140 (45%), Gaps = 23/140 (16%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLC----FYCSLGLQIFGGMV------NAGNPNLDGTDLSD--N 631
            +TLI SL P +G I  + C     +  LG+Q+F GM+        GN       + D  N
Sbjct: 1287 MTLISSLKP-IGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGNVTTKADCIEDYRN 1345

Query: 630  DYL--LFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISF 484
             ++   +NF++    +++LF L     W   M    +  G           W  +YFISF
Sbjct: 1346 KWVNHRYNFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISF 1405

Query: 483  YVITVLWLLNLIVAFVLEAF 424
             ++   ++LN+ V  V+E F
Sbjct: 1406 LLLVGFFVLNMFVGVVVENF 1425



 Score = 40.0 bits (92), Expect = 0.053
 Identities = 33/130 (25%), Positives = 58/130 (44%), Gaps = 3/130 (2%)
 Frame = -2

Query: 783  QHFLTLIPSLMPY-LGTIF--CVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFN 613
            ++F TL+ +L+   LG +   C  C +   GLQ     V +     D            N
Sbjct: 819  KNFDTLLWALITVTLGMVLFGCKFCNHPDTGLQCTSAQVISSICECDR----------MN 868

Query: 612  FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
            F+++    VT+F +L   +W + + +    T   W+ +YF++        L NL+VA ++
Sbjct: 869  FDNFLFATVTVFQILTQEDWNMVLFNGMAQTNP-WAALYFVALMTFGNYVLFNLLVAILV 927

Query: 432  EAFQTEMDME 403
            E FQ   + E
Sbjct: 928  EGFQESKEEE 937



>gb:AF368920_1266270 Caenorhabditis elegans voltage-dependent calcium
            channel alpha13 subunit (cca-1) mRNA, complete
            cds.>gb:AY313898_1318669 Caenorhabditis elegans T-type
            calcium channel alpha1 subunit isoform A (cca-1) mRNA,
            complete cds; alternatively spliced.>gb:U37548_1402915
            Caenorhabditis elegans cosmid C54D2, complete sequence.
          Length = 1837

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 39/140 (27%), Positives = 63/140 (45%), Gaps = 23/140 (16%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLC----FYCSLGLQIFGGMV------NAGNPNLDGTDLSD--N 631
            +TLI SL P +G I  + C     +  LG+Q+F GM+        GN       + D  N
Sbjct: 1239 MTLISSLKP-IGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGNVTTKADCIEDYRN 1297

Query: 630  DYL--LFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISF 484
             ++   +NF++    +++LF L     W   M    +  G           W  +YFISF
Sbjct: 1298 KWVNHRYNFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISF 1357

Query: 483  YVITVLWLLNLIVAFVLEAF 424
             ++   ++LN+ V  V+E F
Sbjct: 1358 LLLVGFFVLNMFVGVVVENF 1377



 Score = 37.0 bits (84), Expect = 0.45
 Identities = 19/71 (26%), Positives = 36/71 (50%)
 Frame = -2

Query: 615  NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
            NF+     ++T+F +L   +W + + +    T   W+ +YF++        L NL+VA +
Sbjct: 820  NFDTLLWALITVFQILTQEDWNMVLFNGMAQTNP-WAALYFVALMTFGNYVLFNLLVAIL 878

Query: 435  LEAFQTEMDME 403
            +E FQ   + E
Sbjct: 879  VEGFQESKEEE 889



>gb:AF361884_1265570 Schistosoma mansoni high voltage-activated
            calcium channel Cav1 mRNA, complete cds.
          Length = 1776

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 36/135 (26%), Positives = 64/135 (47%), Gaps = 19/135 (14%)
 Frame = -2

Query: 771  TLIPSL--MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNP--NLDGTDLSDNDYLLFNFN 607
            T I S+  +PY+  +  ++ F Y  +G+Q+FG +    NP    +   L  N+    NF 
Sbjct: 1253 TFIKSIQALPYVALLIAMIFFIYAVIGMQLFGQISIEENPLEEEEWPTLHRNN----NFQ 1308

Query: 606  DYPNGMVTLFNLLVMGNWQLWMQSYKE--------------LTGTSWSYVYFISFYVITV 469
            ++   ++ LF      +WQ  M + +E                G+  +Y YFISF+ I+ 
Sbjct: 1309 NFFYALLVLFRCATGESWQDIMMACREGQKCSKDSGETEVNGCGSKLAYAYFISFHAISA 1368

Query: 468  LWLLNLIVAFVLEAF 424
              ++NL VA +++ F
Sbjct: 1369 FLVINLFVAVIMDNF 1383



 Score = 40.4 bits (93), Expect = 0.041
 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            FNF++ PN ++TLF +     W   +     S  E  G   +Y      ++I+F ++   
Sbjct: 1010 FNFDNVPNALLTLFAVSTFEGWPSLLYRSIDSNAEDHGPITNYRPVVAFFYITFIILIPF 1069

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ E + E
Sbjct: 1070 FMINIFVGFVIVTFQKEGEAE 1090



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 15/71 (21%), Positives = 37/71 (52%)
 Frame = -2

Query: 621 LFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVA 442
           + +F+++   M+T+F  + M  W        +  G+ W ++YF++  V+   +++NL++ 
Sbjct: 293 IVSFDNFLYSMLTVFVCITMEGWTSTGYYVSDAIGSWWPWIYFVTLMVLGSFFVMNLVLG 352

Query: 441 FVLEAFQTEMD 409
            +   F  E +
Sbjct: 353 VLSGEFSKEKE 363



 Score = 36.6 bits (83), Expect = 0.59
 Identities = 29/119 (24%), Positives = 52/119 (43%), Gaps = 4/119 (3%)
 Frame = -2

Query: 738 TIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLLVMG 559
           +IF ++C    LG+Q+FGG  N             ++    NF+     M+T+F +L   
Sbjct: 596 SIFILICSL--LGMQLFGGRFN----------FIAHEKPRANFDGILQAMLTVFQILTGE 643

Query: 558 NWQL----WMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQTEMDMETSA 394
           +W       M++Y+         +YFI  ++     LLN+ +A  ++    + D E  A
Sbjct: 644 DWNEVMYHGMRAYENSPWYGVVVIYFIFLFICGNYILLNVFLAIAVDNLNEDEDEEDEA 702



>gb:AB042806_1195638 Halocynthia roretzi mRNA for sodium channel,
            complete cds.
          Length = 2221

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 34/138 (24%), Positives = 60/138 (43%), Gaps = 27/138 (19%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF----YCSLGLQIFGGM----VNAGNPNLDGTDLSDNDYLL------- 619
            +P +G + CV       +  +G+Q++ G     V++     + T + +    L       
Sbjct: 1304 IPSIGNVLCVCLLIWLVFRIMGVQLYKGQFYRCVDSSGTAYNATFVPNRTICLQNNFTWT 1363

Query: 618  ---FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGT---------SWSYVYFISFYVI 475
                NF++  NGM+ LF +     W   M    +  G           +SYV+F  F +I
Sbjct: 1364 TPPINFDNVVNGMIALFQVATFEGWIEVMSDASDTDGVYNQPTRGANPYSYVFFFIFVLI 1423

Query: 474  TVLWLLNLIVAFVLEAFQ 421
               ++LNLIV  ++E+FQ
Sbjct: 1424 GSFFILNLIVGVIIESFQ 1441



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 35/142 (24%), Positives = 57/142 (40%), Gaps = 11/142 (7%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCF---YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFND 604
            LTL+ SL P       +  F   +  LG+  F       N  L G  L+D    + NF  
Sbjct: 1617 LTLMISLPPLFNIAVILGVFMVIFAILGMSFFM------NVKLRGA-LND----IVNFRT 1665

Query: 603  YPNGMVTLFNLLVMGNWQLWMQSY--------KELTGTSWSYVYFISFYVITVLWLLNLI 448
            + N M+ LF L+    W   ++          KE      + +YF+ +     L ++N+ 
Sbjct: 1666 FGNSMMLLFRLMTSAGWNDVLEPLMNEEDCEPKECGNRIIAVIYFVLYIFFVFLVIVNMY 1725

Query: 447  VAFVLEAFQTEMDMETSAICVD 382
            +A +LE F      E + +  D
Sbjct: 1726 IAIILENFDEIFQQEETGVSQD 1747



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 22/82 (26%), Positives = 40/82 (48%), Gaps = 1/82 (1%)
 Frame = -2

Query: 645 DLSDNDYLLF-NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITV 469
           D+ +N    F NF+     ++T F LL +  W+          G +W+ ++F    V+  
Sbjct: 368 DIGENPNFGFTNFDHMGWALLTCFQLLTLDYWENVYNMIIRAEG-AWNVLFFFMSVVLGP 426

Query: 468 LWLLNLIVAFVLEAFQTEMDME 403
            +LLNL++A V  A+  E + +
Sbjct: 427 FYLLNLLLAVVTLAYSKEHEKQ 448



>pir|S29237|S29237 calcium channel protein BII-2, brain -
           rabbit>gb:OCBCCBII_1442110 O.cuniculus mRNA for brain
           calcium channel BII-2.
          Length = 2178

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 32/119 (26%), Positives = 58/119 (48%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           ++ + S++  L  +F  +  +  LG+Q+FGG  N      DGT  +       NF+ +P 
Sbjct: 597 MSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFN----DGTPSA-------NFDTFPA 645

Query: 594 GMVTLFNLLVMGNWQLWM----QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M    +S   ++   WS VYFI   +     LLN+ +A  ++
Sbjct: 646 AIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAVYFIVLTLFGNYTLLNVFLAIAVD 704



 Score = 42.7 bits (99), Expect = 0.008
 Identities = 35/130 (26%), Positives = 53/130 (40%), Gaps = 19/130 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG      N  LD     +      NF  +   ++ LF
Sbjct: 1597 LPYVCLLIAMLFFIYAIIGMQVFG------NIRLDEESHINRHN---NFRSFFGSLMLLF 1647

Query: 576  NLLVMGNWQLWM------------------QSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M                  Q   E  GT  +YVYF+SF       +LNL
Sbjct: 1648 RSATGEAWQEIMLSCLGEKGCEPDTTAPSGQQESERCGTDLAYVYFVSFIFFCSFLMLNL 1707

Query: 450  IVAFVLEAFQ 421
             VA +++ F+
Sbjct: 1708 FVAVIMDNFE 1717



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 16/68 (23%), Positives = 36/68 (52%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  +  G +W+++YFI   +I   ++LNL++  + 
Sbjct: 292 FDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLS 351

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 352 GEFAKERE 359



>pir|B54972|B54972 voltage-dependent calcium channel alpha 1E-1 -
            human>gb:HUMHVDC_2032291 Homo sapiens (clone
            pcDNA-alpha1E-1) voltage-dependent calcium channel
            alpha-1E-1 subunit mRNA, complete cds.
          Length = 2251

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 48/209 (22%), Positives = 85/209 (40%), Gaps = 26/209 (12%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            ++ + S++  L  +F  +  +  LG+Q+FGG  N      DGT  +       NF+ +P 
Sbjct: 597  MSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFN----DGTPSA-------NFDTFPA 645

Query: 594  GMVTLFNLLVMGNWQLWM----QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL-- 433
             ++T+F +L   +W   M    +S   ++   WS +YFI   +     LLN+ +A  +  
Sbjct: 646  AIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDN 705

Query: 432  ---------------EAFQTEMDMETS--AICVDGENKXXXXXXXXRKYGTKTRSQRVDA 304
                           EAF  +  ++ +     +   N         R++      QR   
Sbjct: 706  LANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERERRRRHHMSVWEQRTSQ 765

Query: 303  LLHHMLSSE---LTQCSSP*FSPLQVMNP 226
            L  HM  S    L +  +P  +PL  +NP
Sbjct: 766  LRKHMQMSSQEALNREEAPTMNPLNPLNP 794



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 32/130 (24%), Positives = 55/130 (42%), Gaps = 19/130 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +      +++  +         NF  +   ++ LF
Sbjct: 1588 LPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHN---------NFRSFFGSLMLLF 1638

Query: 576  NLLVMGNWQLWM------------------QSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M                  Q+  E  GT  +YVYF+SF       +LNL
Sbjct: 1639 RSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLNL 1698

Query: 450  IVAFVLEAFQ 421
             VA +++ F+
Sbjct: 1699 FVAVIMDNFE 1708



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 16/68 (23%), Positives = 36/68 (52%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  +  G +W+++YFI   +I   ++LNL++  + 
Sbjct: 292 FDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLS 351

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 352 GEFAKERE 359



>sp|Q02343|CCAE_RABIT Voltage-dependent R-type calcium channel
           alpha-1E subunit (Voltage- gated calcium channel alpha
           subunit Cav2.3) (Calcium channel, L type, alpha-1
           polypeptide, isoform 6) (Brain calcium channel II)
           (BII).>pir|S29236|S29236 calcium channel protein BII-1,
           brain - rabbit>gb:OCBCBII1_1442109 O.cuniculus mRNA for
           brain calcium channel BII-1.
          Length = 2259

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 32/119 (26%), Positives = 58/119 (48%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           ++ + S++  L  +F  +  +  LG+Q+FGG  N      DGT  +       NF+ +P 
Sbjct: 597 MSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFN----DGTPSA-------NFDTFPA 645

Query: 594 GMVTLFNLLVMGNWQLWM----QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M    +S   ++   WS VYFI   +     LLN+ +A  ++
Sbjct: 646 AIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAVYFIVLTLFGNYTLLNVFLAIAVD 704



 Score = 42.7 bits (99), Expect = 0.008
 Identities = 35/130 (26%), Positives = 53/130 (40%), Gaps = 19/130 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG      N  LD     +      NF  +   ++ LF
Sbjct: 1597 LPYVCLLIAMLFFIYAIIGMQVFG------NIRLDEESHINRHN---NFRSFFGSLMLLF 1647

Query: 576  NLLVMGNWQLWM------------------QSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M                  Q   E  GT  +YVYF+SF       +LNL
Sbjct: 1648 RSATGEAWQEIMLSCLGEKGCEPDTTAPSGQQESERCGTDLAYVYFVSFIFFCSFLMLNL 1707

Query: 450  IVAFVLEAFQ 421
             VA +++ F+
Sbjct: 1708 FVAVIMDNFE 1717



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 16/68 (23%), Positives = 36/68 (52%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  +  G +W+++YFI   +I   ++LNL++  + 
Sbjct: 292 FDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLS 351

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 352 GEFAKERE 359



>gb:U17869_2140213 Mus musculus murine erythroleukemia cardiac calcium
            channel (MELC-CC) mRNA, complete cds.
          Length = 1869

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1090 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1140

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1141 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1200

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1201 FVAVIMDNF 1209



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W ++YF++  +I   ++LNL++  +
Sbjct: 81  NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVL 140

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 141 SGEFSKERE 149



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 837  FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 896

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 897  FMMNIFVGFVIVTFQEQGEQE 917



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 406 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 455

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 456 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 515



>gb:RATRBCI_2133666 Rat brain calcium channel alpha-1 subunit (rbC-I)
            mRNA, complete cds.
          Length = 2140

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1360 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1410

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1411 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1470

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1471 FVAVIMDNF 1479



 Score = 38.5 bits (88), Expect = 0.15
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQ---LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIV 445
           NF+++   M+T+F  + M  W     WMQ   +  G    +VYF+S  +    ++LNL++
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWMQ---DAMGYELPWVYFVSLVIFGSFFVLNLVL 401

Query: 444 AFVLEAFQTEMD 409
             +   F  E +
Sbjct: 402 GVLSGEFSKERE 413



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1096 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1155

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1156 FMMNIFVGFVIVTFQEQGEQE 1176



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 645 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 694

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 695 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754



>gb:AY728090_2088247 Mus musculus neuronal voltage-gated calcium
            channel alpha 1C subunit (Cacna1c) mRNA, complete cds.
          Length = 2139

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1360 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1410

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1411 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1470

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1471 FVAVIMDNF 1479



 Score = 38.5 bits (88), Expect = 0.15
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQ---LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIV 445
           NF+++   M+T+F  + M  W     WMQ   +  G    +VYF+S  +    ++LNL++
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWMQ---DAMGYELPWVYFVSLVIFGSFFVLNLVL 401

Query: 444 AFVLEAFQTEMD 409
             +   F  E +
Sbjct: 402 GVLSGEFSKERE 413



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1096 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1155

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1156 FMMNIFVGFVIVTFQEQGEQE 1176



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 645 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 694

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 695 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754



>gb:AY029412_2074071 Rattus norvegicus calcium channel isoform
            alpha1E7 (CaV2.3) mRNA, complete cds.
          Length = 2295

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 48/209 (22%), Positives = 85/209 (40%), Gaps = 26/209 (12%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            ++ + S++  L  +F  +  +  LG+Q+FGG  N      DGT  +       NF+ +P 
Sbjct: 597  MSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFN----DGTPSA-------NFDTFPA 645

Query: 594  GMVTLFNLLVMGNW-QLWMQSYKELTGTS---WSYVYFISFYVITVLWLLNLIVAFVL-- 433
             ++T+F +L   +W ++     +   G S   WS +YFI   +     LLN+ +A  +  
Sbjct: 646  AIMTVFQILTGEDWNEVLYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDN 705

Query: 432  ---------------EAFQTEMDMETS--AICVDGENKXXXXXXXXRKYGTKTRSQRVDA 304
                           EAF  +  ++ +     +   N         R++      QR   
Sbjct: 706  LANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERERRRRHHMSVWEQRTSQ 765

Query: 303  LLHHMLSSE---LTQCSSP*FSPLQVMNP 226
            L  HM  S    L +  +P  +PL  +NP
Sbjct: 766  LRRHMQMSSQEALNKEEAPPMNPLNPLNP 794



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 32/130 (24%), Positives = 55/130 (42%), Gaps = 19/130 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +      +++  +         NF  +   ++ LF
Sbjct: 1589 LPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHN---------NFRSFFGSLMLLF 1639

Query: 576  NLLVMGNWQLWM------------------QSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M                  Q+  E  GT  +YVYF+SF       +LNL
Sbjct: 1640 RSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNESERCGTDLAYVYFVSFIFFCSFLMLNL 1699

Query: 450  IVAFVLEAFQ 421
             VA +++ F+
Sbjct: 1700 FVAVIMDNFE 1709



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 16/68 (23%), Positives = 36/68 (52%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  +  G +W+++YFI   +I   ++LNL++  + 
Sbjct: 292 FDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLS 351

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 352 GEFAKERE 359



>gb:AF394940_2064795 Rattus norvegicus clone 12 L-type calcium channel
            alpha-1c subunit mRNA, complete cds, alternatively
            spliced.
          Length = 2170

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1390 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1440

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1441 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1500

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1501 FVAVIMDNF 1509



 Score = 38.5 bits (88), Expect = 0.15
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQ---LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIV 445
           NF+++   M+T+F  + M  W     WMQ   +  G    +VYF+S  +    ++LNL++
Sbjct: 375 NFDNFAFAMLTVFQCITMEGWTDVLYWMQ---DAMGYELPWVYFVSLVIFGSFFVLNLVL 431

Query: 444 AFVLEAFQTEMD 409
             +   F  E +
Sbjct: 432 GVLSGEFSKERE 443



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1126 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1185

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1186 FMMNIFVGFVIVTFQEQGEQE 1206



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 675  LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 724

Query: 594  GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
             ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 725  SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 784



>gb:AF394939_2064794 Rattus norvegicus clone 5 L-type calcium channel
            alpha-1c subunit mRNA, complete cds, alternatively
            spliced.
          Length = 2170

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1390 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1440

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1441 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1500

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1501 FVAVIMDNF 1509



 Score = 38.5 bits (88), Expect = 0.15
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQ---LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIV 445
           NF+++   M+T+F  + M  W     WMQ   +  G    +VYF+S  +    ++LNL++
Sbjct: 375 NFDNFAFAMLTVFQCITMEGWTDVLYWMQ---DAMGYELPWVYFVSLVIFGSFFVLNLVL 431

Query: 444 AFVLEAFQTEMD 409
             +   F  E +
Sbjct: 432 GVLSGEFSKERE 443



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1126 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1185

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1186 FMMNIFVGFVIVTFQEQGEQE 1206



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 675  LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 724

Query: 594  GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
             ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 725  SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 784



>gb:AF394938_2064793 Rattus norvegicus clone 15 L-type calcium channel
            alpha-1c subunit mRNA, complete cds, alternatively
            spliced.
          Length = 2170

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1390 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1440

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1441 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1500

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1501 FVAVIMDNF 1509



 Score = 38.5 bits (88), Expect = 0.15
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQ---LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIV 445
           NF+++   M+T+F  + M  W     WMQ   +  G    +VYF+S  +    ++LNL++
Sbjct: 375 NFDNFAFAMLTVFQCITMEGWTDVLYWMQ---DAMGYELPWVYFVSLVIFGSFFVLNLVL 431

Query: 444 AFVLEAFQTEMD 409
             +   F  E +
Sbjct: 432 GVLSGEFSKERE 443



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1126 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1185

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1186 FMMNIFVGFVIVTFQEQGEQE 1206



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 675  LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 724

Query: 594  GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
             ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 725  SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 784



>gb:HUMLVDCCB_2034119 Homo sapiens (clone hHT-1) L-type
            voltage-dependent calcium channel a1 subunit (hHT) mRNA,
            complete cds.
          Length = 2180

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1331 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1381

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1382 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1441

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1442 FVAVIMDNF 1450



 Score = 38.5 bits (88), Expect = 0.15
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQ---LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIV 445
           NF+++   M+T+F  + M  W     WMQ   +  G    +VYF+S  +    ++LNL++
Sbjct: 316 NFDNFAFAMLTVFQCITMEGWTDVLYWMQ---DAMGYELPWVYFVSLVIFGSFFVLNLVL 372

Query: 444 AFVLEAFQTEMD 409
             +   F  E +
Sbjct: 373 GVLSGEFSKERE 384



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1067 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1126

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1127 FMMNIFVGFVIVTFQEQGEQE 1147



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 616 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 665

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 666 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 725



>gb:HUMCALCHAA_2029805 Human L-type calcium channel HFCC mRNA,
            complete cds.
          Length = 2221

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1408 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1458

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1459 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1518

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1519 FVAVIMDNF 1527



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W ++YF++  +I   ++LNL++  +
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVL 404

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 405 SGEFSKERE 413



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1116 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1175

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1176 FMMNIFVGFVIVTFQEQGEQE 1196



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 645 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 694

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 695 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754



>gb:HUMCACNL1G_2029779 Homo sapiens calcium channel L-type alpha 1
            subunit (CACNL1A1) mRNA, complete cds.
          Length = 2109

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1331 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1381

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1382 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1441

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1442 FVAVIMDNF 1450



 Score = 38.5 bits (88), Expect = 0.15
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQ---LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIV 445
           NF+++   M+T+F  + M  W     WMQ   +  G    +VYF+S  +    ++LNL++
Sbjct: 316 NFDNFAFAMLTVFQCITMEGWTDVLYWMQ---DAMGYELPWVYFVSLVIFGSFFVLNLVL 372

Query: 444 AFVLEAFQTEMD 409
             +   F  E +
Sbjct: 373 GVLSGEFSKERE 384



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1067 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1126

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1127 FMMNIFVGFVIVTFQEQGEQE 1147



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 616 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 665

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 666 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 725



>gb:HUMCACNL1E_2029778 Homo sapiens cardiac L-type voltage-dependent
            calcium channel a1 subunit (CACNL1A1) mRNA, complete cds.
          Length = 2144

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1331 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1381

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1382 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1441

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1442 FVAVIMDNF 1450



 Score = 38.5 bits (88), Expect = 0.15
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQ---LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIV 445
           NF+++   M+T+F  + M  W     WMQ   +  G    +VYF+S  +    ++LNL++
Sbjct: 316 NFDNFAFAMLTVFQCITMEGWTDVLYWMQ---DAMGYELPWVYFVSLVIFGSFFVLNLVL 372

Query: 444 AFVLEAFQTEMD 409
             +   F  E +
Sbjct: 373 GVLSGEFSKERE 384



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1067 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1126

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1127 FMMNIFVGFVIVTFQEQGEQE 1147



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 616 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 665

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 666 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 725



>gb:HUMCACN_2029777 Homo sapiens (clone HHT-1 variant harboring HH-05)
            cardiac L-type voltage dependent calcium channel alpha 1
            subunit (CACNL1A1) mRNA, complete cds.
          Length = 2169

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1320 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1370

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1371 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1430

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1431 FVAVIMDNF 1439



 Score = 38.5 bits (88), Expect = 0.15
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQ---LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIV 445
           NF+++   M+T+F  + M  W     WMQ   +  G    +VYF+S  +    ++LNL++
Sbjct: 316 NFDNFAFAMLTVFQCITMEGWTDVLYWMQ---DAMGYELPWVYFVSLVIFGSFFVLNLVL 372

Query: 444 AFVLEAFQTEMD 409
             +   F  E +
Sbjct: 373 GVLSGEFSKERE 384



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1067 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1126

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1127 FMMNIFVGFVIVTFQEQGEQE 1147



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 616 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 665

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 666 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 725



>gb:HSZ74996_2028566 H.sapiens mRNA for voltage-dependent L-type
            calcium channel, alpha 1C subunit (splice variant).
          Length = 2157

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1360 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1410

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1411 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1470

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1471 FVAVIMDNF 1479



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W ++YF++  +I   ++LNL++  +
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVL 404

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 405 SGEFSKERE 413



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1096 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1155

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1156 FMMNIFVGFVIVTFQEQGEQE 1176



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 645 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 694

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 695 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754



>gb:HSLCC1NE3_2016959 H.sapiens mRNA for L-type calcium channel
           isoform 1, neuronal subform (partial).
          Length = 683

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753 MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
           +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 269 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 319

Query: 576 NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                  WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 320 KCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 379

Query: 450 IVAFVLEAF 424
            VA +++ F
Sbjct: 380 FVAVIMDNF 388



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618 FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
           F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 5   FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 64

Query: 465 WLLNLIVAFVLEAFQTEMDME 403
           +++N+ V FV+  FQ + + E
Sbjct: 65  FMMNIFVGFVIVTFQEQGEQE 85



>gb:HSLCC1NE1_2016958 H.sapiens mRNA for L-type calcium channel
           isoform 1, neuronal subform (partial).
          Length = 574

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753 MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
           +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 45  LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 95

Query: 576 NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                  WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 96  RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 155

Query: 450 IVAFVLEAF 424
            VA +++ F
Sbjct: 156 FVAVIMDNF 164



>gb:HSCACHA9_2011223 H.sapiens (HLCC85) mRNA for voltage-dependent
            L-type Ca channel alpha 1 subunit (splice variant).
          Length = 2173

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1360 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1410

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1411 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1470

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1471 FVAVIMDNF 1479



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W ++YF++  +I   ++LNL++  +
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVL 404

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 405 SGEFSKERE 413



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1096 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1155

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1156 FMMNIFVGFVIVTFQEQGEQE 1176



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 645 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 694

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 695 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754



>gb:HSCACHA8_2011222 H.sapiens (HLCC78) mRNA for voltage-dependent
            L-type Ca channel alpha 1 subunit (splice variant).
          Length = 2138

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1360 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1410

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1411 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1470

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1471 FVAVIMDNF 1479



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W ++YF++  +I   ++LNL++  +
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVL 404

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 405 SGEFSKERE 413



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1096 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1155

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1156 FMMNIFVGFVIVTFQEQGEQE 1176



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 645 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 694

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 695 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754



>gb:HSCACHA7_2011221 H.sapiens (HLCC77) mRNA for voltage-dependent
            L-type Ca channel alpha 1 subunit (splice variant).
          Length = 2138

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1360 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1410

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1411 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1470

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1471 FVAVIMDNF 1479



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W ++YF++  +I   ++LNL++  +
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVL 404

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 405 SGEFSKERE 413



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1096 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1155

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1156 FMMNIFVGFVIVTFQEQGEQE 1176



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 645 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 694

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 695 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754



>gb:HSCACHA6_2011220 H.sapiens (HLCC76) mRNA for voltage-dependent
            L-type Ca channel alpha 1 subunit (splice variant).
          Length = 2127

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1349 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1399

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1400 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1459

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1460 FVAVIMDNF 1468



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W ++YF++  +I   ++LNL++  +
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVL 404

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 405 SGEFSKERE 413



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1096 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1155

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1156 FMMNIFVGFVIVTFQEQGEQE 1176



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 645 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 694

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 695 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754



>gb:HSCACHA5_2011219 H.sapiens (HLCC74) mRNA for voltage-dependent
            L-type Ca channel alpha 1 subunit (splice variant).
          Length = 2146

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1349 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1399

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1400 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1459

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1460 FVAVIMDNF 1468



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W ++YF++  +I   ++LNL++  +
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVL 404

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 405 SGEFSKERE 413



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1096 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1155

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1156 FMMNIFVGFVIVTFQEQGEQE 1176



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 645 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 694

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 695 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754



>gb:HSCACHA4_2011218 H.sapiens (HLCC73) mRNA for voltage-dependent
            L-type Ca channel alpha 1 subunit (splice variant).
          Length = 2146

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1349 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1399

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1400 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1459

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1460 FVAVIMDNF 1468



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W ++YF++  +I   ++LNL++  +
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVL 404

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 405 SGEFSKERE 413



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1096 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1155

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1156 FMMNIFVGFVIVTFQEQGEQE 1176



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 645 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 694

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 695 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754



>gb:HSCACHA3_2011217 H.sapiens (HLCC71) mRNA for voltage-dependent
            L-type Ca channel alpha 1 subunit (splice variant).
          Length = 2157

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1360 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1410

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1411 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1470

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1471 FVAVIMDNF 1479



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W ++YF++  +I   ++LNL++  +
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVL 404

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 405 SGEFSKERE 413



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1096 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1155

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1156 FMMNIFVGFVIVTFQEQGEQE 1176



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 645 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 694

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 695 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754



>gb:HSCACHA2_2011216 H.sapiens (HLCC70) mRNA for voltage-dependent
            L-type Ca channel alpha 1 subunit (splice variant).
          Length = 2138

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1360 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1410

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1411 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1470

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1471 FVAVIMDNF 1479



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W ++YF++  +I   ++LNL++  +
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVL 404

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 405 SGEFSKERE 413



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1096 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1155

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1156 FMMNIFVGFVIVTFQEQGEQE 1176



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 645 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 694

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 695 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754



>gb:HSCACHA14_2011215 H.sapiens (HLCC90) mRNA for voltage-dependent
            L-type Ca channel alpha 1 subunit (splice variant).
          Length = 2186

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1408 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1458

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1459 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1518

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1519 FVAVIMDNF 1527



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W ++YF++  +I   ++LNL++  +
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVL 404

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 405 SGEFSKERE 413



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1116 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1175

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1176 FMMNIFVGFVIVTFQEQGEQE 1196



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 645 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 694

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 695 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754



>gb:HSCACHA13_2011214 H.sapiens (HLCC89) mRNA for voltage-dependent
            L-type Ca channel alpha 1 subunit (splice variant).
          Length = 2155

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1377 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1427

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1428 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1487

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1488 FVAVIMDNF 1496



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W ++YF++  +I   ++LNL++  +
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVL 404

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 405 SGEFSKERE 413



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1096 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1155

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1156 FMMNIFVGFVIVTFQEQGEQE 1176



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 645 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 694

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 695 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754



>gb:HSCACHA12_2011213 H.sapiens (HLCC88) mRNA for voltage-dependent
            L-type Ca channel alpha 1 subunit (splice variant).
          Length = 2166

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1388 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1438

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1439 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1498

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1499 FVAVIMDNF 1507



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W ++YF++  +I   ++LNL++  +
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVL 404

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 405 SGEFSKERE 413



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1096 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1155

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1156 FMMNIFVGFVIVTFQEQGEQE 1176



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 645 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 694

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 695 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754



>gb:HSCACHA11_2011212 H.sapiens (HLCC87) mRNA for voltage-dependent
            L-type Ca channel alpha 1 subunit (splice variant).
          Length = 2158

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1380 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1430

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1431 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1490

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1491 FVAVIMDNF 1499



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W ++YF++  +I   ++LNL++  +
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVL 404

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 405 SGEFSKERE 413



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1116 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1175

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1176 FMMNIFVGFVIVTFQEQGEQE 1196



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 645 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 694

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 695 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754



>gb:HSCACHA10_2011211 H.sapiens (HLCC86) mRNA for voltage-dependent
            L-type Ca channel alpha 1 subunit (splice variant).
          Length = 2139

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1360 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1410

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1411 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1470

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1471 FVAVIMDNF 1479



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W ++YF++  +I   ++LNL++  +
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVL 404

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 405 SGEFSKERE 413



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1096 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1155

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1156 FMMNIFVGFVIVTFQEQGEQE 1176



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 645 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 694

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 695 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754



>gb:HSCACHA1_2011210 H.sapiens (HLCC69) mRNA for voltage-dependent
            L-type Ca channel alpha 1 subunit (splice variant).
          Length = 2138

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1360 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1410

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1411 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1470

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1471 FVAVIMDNF 1479



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W ++YF++  +I   ++LNL++  +
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVL 404

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 405 SGEFSKERE 413



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1096 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1155

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1156 FMMNIFVGFVIVTFQEQGEQE 1176



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 645 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 694

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 695 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754



>gb:HSAJ4873_2010375 Homo sapiens (HLCC105) mRNA for voltage-dependent
            L-type calcium channel alpha-1C subunit (splice variant).
          Length = 2138

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1360 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1410

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1411 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1470

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1471 FVAVIMDNF 1479



 Score = 38.5 bits (88), Expect = 0.15
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQ---LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIV 445
           NF+++   M+T+F  + M  W     WMQ   +  G    +VYF+S  +    ++LNL++
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWMQ---DAMGYELPWVYFVSLVIFGSFFVLNLVL 401

Query: 444 AFVLEAFQTEMD 409
             +   F  E +
Sbjct: 402 GVLSGEFSKERE 413



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1096 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1155

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1156 FMMNIFVGFVIVTFQEQGEQE 1176



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 645 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 694

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 695 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754



>gb:AL160059_1921718 Human DNA sequence from clone RP11-94G15 on
           chromosome 1 Contains the 5' end of the CACNA1E gene for
           calcium channel voltage-dependent alpha 1E subunit,
           complete sequence.>gb:AL161734_1922158 Human DNA
           sequence from clone RP11-33M22 on chromosome 1q25.2-31.2
           Contains the 3' end of the CACNA1E gene for calcium
           channel voltage-dependent alpha 1E subunit, complete
           sequence.>gb:AL359270_1925453 Human DNA sequence from
           clone RP11-494J9 on chromosome 1 Contains parrt of the
           CACNA1E gene for calcium channel voltage-dependent alpha
           1E subunit, complete sequence.>gb:AL590998_1929945 Human
           DNA sequence from clone RP4-677A15 on chromosome 1
           Contains parrt of the CACNA1E gene for calcium channel
           voltage-dependent alpha 1E subunit, complete sequence.
          Length = 2270

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 31/119 (26%), Positives = 58/119 (48%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           ++ + S++  L  +F  +  +  LG+Q+FGG  N      DGT  +       NF+ +P 
Sbjct: 597 MSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFN----DGTPSA-------NFDTFPA 645

Query: 594 GMVTLFNLLVMGNWQLWM----QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M    +S   ++   WS +YFI   +     LLN+ +A  ++
Sbjct: 646 AIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVD 704



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 32/130 (24%), Positives = 55/130 (42%), Gaps = 19/130 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +      +++  +         NF  +   ++ LF
Sbjct: 1607 LPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHN---------NFRSFFGSLMLLF 1657

Query: 576  NLLVMGNWQLWM------------------QSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M                  Q+  E  GT  +YVYF+SF       +LNL
Sbjct: 1658 RSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLNL 1717

Query: 450  IVAFVLEAFQ 421
             VA +++ F+
Sbjct: 1718 FVAVIMDNFE 1727



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 16/68 (23%), Positives = 36/68 (52%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  +  G +W+++YFI   +I   ++LNL++  + 
Sbjct: 292 FDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLS 351

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 352 GEFAKERE 359



>gb:AL160059_1921717 Human DNA sequence from clone RP11-94G15 on
           chromosome 1 Contains the 5' end of the CACNA1E gene for
           calcium channel voltage-dependent alpha 1E subunit,
           complete sequence.>gb:AL161734_1922156 Human DNA
           sequence from clone RP11-33M22 on chromosome 1q25.2-31.2
           Contains the 3' end of the CACNA1E gene for calcium
           channel voltage-dependent alpha 1E subunit, complete
           sequence.>gb:AL359270_1925452 Human DNA sequence from
           clone RP11-494J9 on chromosome 1 Contains parrt of the
           CACNA1E gene for calcium channel voltage-dependent alpha
           1E subunit, complete sequence.>gb:AL590998_1929944 Human
           DNA sequence from clone RP4-677A15 on chromosome 1
           Contains parrt of the CACNA1E gene for calcium channel
           voltage-dependent alpha 1E subunit, complete sequence.
          Length = 2313

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 31/119 (26%), Positives = 58/119 (48%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           ++ + S++  L  +F  +  +  LG+Q+FGG  N      DGT  +       NF+ +P 
Sbjct: 597 MSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFN----DGTPSA-------NFDTFPA 645

Query: 594 GMVTLFNLLVMGNWQLWM----QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M    +S   ++   WS +YFI   +     LLN+ +A  ++
Sbjct: 646 AIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVD 704



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 32/130 (24%), Positives = 55/130 (42%), Gaps = 19/130 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +      +++  +         NF  +   ++ LF
Sbjct: 1607 LPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHN---------NFRSFFGSLMLLF 1657

Query: 576  NLLVMGNWQLWM------------------QSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M                  Q+  E  GT  +YVYF+SF       +LNL
Sbjct: 1658 RSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLNL 1717

Query: 450  IVAFVLEAFQ 421
             VA +++ F+
Sbjct: 1718 FVAVIMDNFE 1727



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 16/68 (23%), Positives = 36/68 (52%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  +  G +W+++YFI   +I   ++LNL++  + 
Sbjct: 292 FDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLS 351

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 352 GEFAKERE 359



>gb:AF465484_1903468 Homo sapiens jejunum L-type calcium channel
            alpha1C subunit mRNA, complete cds.
          Length = 2138

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1360 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1410

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1411 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1470

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1471 FVAVIMDNF 1479



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W ++YF++  +I   ++LNL++  +
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVL 404

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 405 SGEFSKERE 413



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1096 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1155

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1156 FMMNIFVGFVIVTFQEQGEQE 1176



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 645 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 694

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 695 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754



>gb:AF239258S3_1892430 Homo sapiens calcium channel alpha1E subunit
           (CACNA1E) gene, exons 7-49, and partial cds,
           alternatively spliced.
          Length = 2224

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 31/119 (26%), Positives = 58/119 (48%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           ++ + S++  L  +F  +  +  LG+Q+FGG  N      DGT  +       NF+ +P 
Sbjct: 508 MSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFN----DGTPSA-------NFDTFPA 556

Query: 594 GMVTLFNLLVMGNWQLWM----QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M    +S   ++   WS +YFI   +     LLN+ +A  ++
Sbjct: 557 AIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVD 615



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 32/130 (24%), Positives = 55/130 (42%), Gaps = 19/130 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +      +++  +         NF  +   ++ LF
Sbjct: 1518 LPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHN---------NFRSFFGSLMLLF 1568

Query: 576  NLLVMGNWQLWM------------------QSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M                  Q+  E  GT  +YVYF+SF       +LNL
Sbjct: 1569 RSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLNL 1628

Query: 450  IVAFVLEAFQ 421
             VA +++ F+
Sbjct: 1629 FVAVIMDNFE 1638



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 16/68 (23%), Positives = 36/68 (52%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  +  G +W+++YFI   +I   ++LNL++  + 
Sbjct: 203 FDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLS 262

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 263 GEFAKERE 270



>gb:AF252384_1416856 Bos taurus calcium channel subunit alpha 1D
           mRNA, partial cds.
          Length = 200

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 32/124 (25%), Positives = 58/124 (46%), Gaps = 17/124 (13%)
 Frame = -2

Query: 753 MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
           +PY+  +  +L F Y  +G+Q+FG +    N  ++  +         NF  +P  ++ LF
Sbjct: 86  LPYVALLIAMLFFIYAVIGMQMFGKVAMRDNNQINRNN---------NFQTFPQAVLLLF 136

Query: 576 NLLVMGNWQLWMQSY---------------KELT-GTSWSYVYFISFYVITVLWLLNLIV 445
                  WQ  M +                +E T G++++ VYFISFY++    ++NL V
Sbjct: 137 RCATGEAWQEIMLACLPGKQCDPDSDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFV 196

Query: 444 AFVL 433
           A ++
Sbjct: 197 AVIM 200



>pir|JH0427|JH0427 voltage-dependent calcium channel complex alpha-1
            chain rbC-II - rat
          Length = 2143

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1363 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1413

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1414 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1473

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1474 FVAVIMDNF 1482



 Score = 38.5 bits (88), Expect = 0.15
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQ---LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIV 445
           NF+++   M+T+F  + M  W     WMQ   +  G    +VYF+S  +    ++LNL++
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWMQ---DAMGYELPWVYFVSLVIFGSFFVLNLVL 401

Query: 444 AFVLEAFQTEMD 409
             +   F  E +
Sbjct: 402 GVLSGEFSKERE 413



 Score = 36.6 bits (83), Expect = 0.59
 Identities = 34/160 (21%), Positives = 64/160 (40%), Gaps = 5/160 (3%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 645  LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 694

Query: 594  GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
             ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 695  SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754

Query: 429  AFQTEMDMETSAICVDGENKXXXXXXXXRKYGTKTRSQRV 310
                + +  TSA   + E K         +  +  + Q V
Sbjct: 755  NL-ADAESLTSAQKEEEEEKERKKLARPARTASPEKKQEV 793



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1099 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1158

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1159 FMMNIFVGFVIVTFQEQGEQE 1179



>pir|S11339|S11339 calcium channel protein -
            rabbit>gb:OCCACBRE_1442125 Rabbit mRNA for smooth muscle
            calcium channel blocker (CaCB) receptor.
          Length = 2166

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1385 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1435

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1436 RCATGEAWQDIMLACMPGKKCAPESEPHNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1495

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1496 FVAVIMDNF 1504



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W ++YF++  +I   ++LNL++  +
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVL 404

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 405 SGEFSKERE 413



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1121 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1180

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1181 FMMNIFVGFVIVTFQEQGEQE 1201



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 670 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 719

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 720 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 779



>pir|A54972|A54972 voltage-dependent calcium channel alpha 1E-3 -
           human>gb:HUMHVDCA_2032292 Homo sapiens (clone
           pcDNA-alpha1E-3) voltage-dependent calcium channel
           alpha-1E-3 subunit mRNA, complete cds.
          Length = 2270

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 31/119 (26%), Positives = 58/119 (48%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           ++ + S++  L  +F  +  +  LG+Q+FGG  N      DGT  +       NF+ +P 
Sbjct: 597 MSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFN----DGTPSA-------NFDTFPA 645

Query: 594 GMVTLFNLLVMGNWQLWM----QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M    +S   ++   WS +YFI   +     LLN+ +A  ++
Sbjct: 646 AIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVD 704



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 32/130 (24%), Positives = 55/130 (42%), Gaps = 19/130 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +      +++  +         NF  +   ++ LF
Sbjct: 1607 LPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHN---------NFRSFFGSLMLLF 1657

Query: 576  NLLVMGNWQLWM------------------QSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M                  Q+  E  GT  +YVYF+SF       +LNL
Sbjct: 1658 RSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLNL 1717

Query: 450  IVAFVLEAFQ 421
             VA +++ F+
Sbjct: 1718 FVAVIMDNFE 1727



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 16/68 (23%), Positives = 36/68 (52%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  +  G +W+++YFI   +I   ++LNL++  + 
Sbjct: 292 FDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLS 351

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 352 GEFAKERE 359



>pir|A45290|A45290 calcium channel protein type L - human
          Length = 2220

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1408 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1458

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1459 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1518

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1519 FVAVIMDNF 1527



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W ++YF++  +I   ++LNL++  +
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVL 404

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 405 SGEFSKERE 413



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1116 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1175

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1176 FMMNIFVGFVIVTFQEQGEQE 1196



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 645 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 694

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 695 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754



>sp|Q07652|CCAE_RAT Voltage-dependent R-type calcium channel
           alpha-1E subunit (Voltage- gated calcium channel alpha
           subunit Cav2.3) (Calcium channel, L type, alpha-1
           polypeptide, isoform 6) (RBE-II) (RBE2) (Brain calcium
           channel II) (BII).>pir|A37490|A37490 voltage-dependent
           calcium channel alpha 1E - rat>gb:RATCALCHAN_2131677
           Rattus norvegicus voltage-activated calcium channel
           alpha-1 subunit (rbe-ii) mRNA, complete cds.
          Length = 2222

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 31/119 (26%), Positives = 58/119 (48%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           ++ + S++  L  +F  +  +  LG+Q+FGG  N      DGT  +       NF+ +P 
Sbjct: 548 MSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFN----DGTPSA-------NFDTFPA 596

Query: 594 GMVTLFNLLVMGNWQLWM----QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M    +S   ++   WS +YFI   +     LLN+ +A  ++
Sbjct: 597 AIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVD 655



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 32/130 (24%), Positives = 55/130 (42%), Gaps = 19/130 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +      +++  +         NF  +   ++ LF
Sbjct: 1559 LPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHN---------NFRSFFGSLMLLF 1609

Query: 576  NLLVMGNWQLWM------------------QSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M                  Q+  E  GT  +YVYF+SF       +LNL
Sbjct: 1610 RSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNESERCGTDLAYVYFVSFIFFCSFLMLNL 1669

Query: 450  IVAFVLEAFQ 421
             VA +++ F+
Sbjct: 1670 FVAVIMDNFE 1679



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 16/68 (23%), Positives = 36/68 (52%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  +  G +W+++YFI   +I   ++LNL++  + 
Sbjct: 243 FDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLS 302

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 303 GEFAKERE 310



>sp|Q61290|CCAE_MOUSE Voltage-dependent R-type calcium channel
           alpha-1E subunit (Voltage- gated calcium channel alpha
           subunit Cav2.3) (Calcium channel, L type, alpha-1
           polypeptide, isoform 6) (Brain calcium channel II)
           (BII).>pir|C54972|C54972 voltage-dependent calcium
           channel alpha 1E - mouse>gb:MUSALPH_2125099 Mus musculus
           (clones MG2a, S12a, VBx6a and TP7a) voltage-dependent
           alpha-1 E calcium channel mRNA, complete cds.
          Length = 2272

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 31/119 (26%), Positives = 58/119 (48%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           ++ + S++  L  +F  +  +  LG+Q+FGG  N      DGT  +       NF+ +P 
Sbjct: 598 MSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFN----DGTPSA-------NFDTFPA 646

Query: 594 GMVTLFNLLVMGNWQLWM----QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M    +S   ++   WS +YFI   +     LLN+ +A  ++
Sbjct: 647 AIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVD 705



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 32/130 (24%), Positives = 55/130 (42%), Gaps = 19/130 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +      +++  +         NF  +   ++ LF
Sbjct: 1610 LPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHN---------NFRSFFGSLMLLF 1660

Query: 576  NLLVMGNWQLWM------------------QSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M                  Q+  E  GT  +YVYF+SF       +LNL
Sbjct: 1661 RSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNESERCGTDLAYVYFVSFIFFCSFLMLNL 1720

Query: 450  IVAFVLEAFQ 421
             VA +++ F+
Sbjct: 1721 FVAVIMDNFE 1730



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 16/68 (23%), Positives = 36/68 (52%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  +  G +W+++YFI   +I   ++LNL++  + 
Sbjct: 293 FDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLS 352

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 353 GEFAKERE 360



>sp|P22002|CCAC_RAT Voltage-dependent L-type calcium channel alpha-1C
            subunit (Voltage- gated calcium channel alpha subunit
            Cav1.2) (Calcium channel, L type, alpha-1 polypeptide,
            isoform 1, cardiac muscle) (RAT brain class C)
            (RBC).>gb:RATVDCCA_2134225 Rat dihydropryridine-sensitive
            calcium channel alpha-1 subunit gene, complete cds.
          Length = 2169

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1389 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1439

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1440 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1499

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1500 FVAVIMDNF 1508



 Score = 38.5 bits (88), Expect = 0.15
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQ---LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIV 445
           NF+++   M+T+F  + M  W     WMQ   +  G    +VYF+S  +    ++LNL++
Sbjct: 375 NFDNFAFAMLTVFQCITMEGWTDVLYWMQ---DAMGYELPWVYFVSLVIFGSFFVLNLVL 431

Query: 444 AFVLEAFQTEMD 409
             +   F  E +
Sbjct: 432 GVLSGEFSKERE 443



 Score = 36.6 bits (83), Expect = 0.59
 Identities = 28/120 (23%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 675  LNSLRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 724

Query: 594  GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
             ++T+F +L   +W   M        G S+      +YFI  ++     LLNL +A  ++
Sbjct: 725  SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFISPNYILLNLFLAIAVD 784



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1125 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1184

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1185 FMMNIFVGFVIVTFQEQGEQE 1205



>sp|P15381|CCAC_RABIT Voltage-dependent L-type calcium channel
            alpha-1C subunit (Voltage- gated calcium channel alpha
            subunit Cav1.2) (Calcium channel, L type, alpha-1
            polypeptide, isoform 1, cardiac muscle) (Smooth muscle
            calcium channel blocker receptor)
            (CACB-receptor).>pir|S05054|S05054 calcium channel
            alpha-1 chain, dihydropyridine sensitive, cardiac (clone
            lambda-CCAR34) - rabbit>gb:OCCACHAN_1442126 Rabbit mRNA
            for cardiac dihydropyridine-sensitive calcium channel
            protein.
          Length = 2171

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1390 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1440

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1441 RCATGEAWQDIMLACMPGKKCAPESEPHNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1500

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1501 FVAVIMDNF 1509



 Score = 38.5 bits (88), Expect = 0.15
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQ---LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIV 445
           NF+++   M+T+F  + M  W     WMQ   +  G    +VYF+S  +    ++LNL++
Sbjct: 375 NFDNFAFAMLTVFQCITMEGWTDVLYWMQ---DAMGYELPWVYFVSLVIFGSFFVLNLVL 431

Query: 444 AFVLEAFQTEMD 409
             +   F  E +
Sbjct: 432 GVLSGEFSKERE 443



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1126 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1185

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1186 FMMNIFVGFVIVTFQEQGEQE 1206



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
            L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 675  LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 724

Query: 594  GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
             ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 725  SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 784



>sp|Q01815|CCAC_MOUSE Voltage-dependent L-type calcium channel
            alpha-1C subunit (Voltage- gated calcium channel alpha
            subunit Cav1.2) (Calcium channel, L type, alpha-1
            polypeptide, isoform 1, cardiac muscle) (Mouse brain
            class C) (MBC) (MELC-CC).>pir|A44467|A44467
            voltage-dependent calcium channel complex alpha-1 chain
            mbC - mouse>gb:MUSDHPCC_2125669 Mus musculus neuronal
            dihydropyridine-sensitive L-type calcium channel alpha-1
            subunit mRNA, complete cds.
          Length = 2139

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1360 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1410

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1411 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1470

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1471 FVAVIMDNF 1479



 Score = 38.5 bits (88), Expect = 0.15
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQ---LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIV 445
           NF+++   M+T+F  + M  W     WMQ   +  G    +VYF+S  +    ++LNL++
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWMQ---DAMGYELPWVYFVSLVIFGSFFVLNLVL 401

Query: 444 AFVLEAFQTEMD 409
             +   F  E +
Sbjct: 402 GVLSGEFSKERE 413



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1096 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1155

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1156 FMMNIFVGFVIVTFQEQGEQE 1176



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 645 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 694

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 695 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754



>sp|Q13936|CCAC_HUMAN Voltage-dependent L-type calcium channel
            alpha-1C subunit (Voltage- gated calcium channel alpha
            subunit Cav1.2) (Calcium channel, L type, alpha-1
            polypeptide, isoform 1, cardiac muscle).
          Length = 2221

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/129 (25%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 1408 LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 1458

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G+S++  YFISFY++    ++NL
Sbjct: 1459 RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL 1518

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 1519 FVAVIMDNF 1527



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W ++YF++  +I   ++LNL++  +
Sbjct: 345 NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVL 404

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 405 SGEFSKERE 413



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSWSY-----VYFISFYVITVL 466
            F+F++    M+ LF +     W   +     S+ E  G  ++Y     ++FI + +I   
Sbjct: 1116 FDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAF 1175

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  FQ + + E
Sbjct: 1176 FMMNIFVGFVIVTFQEQGEQE 1196



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG  N            +       F+++P 
Sbjct: 645 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFN----------FDEMQTRRSTFDNFPQ 694

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 695 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754



>gb:BX248410_2567111 Zebrafish DNA sequence from clone DKEY-65M5 in
            linkage group 4 Contains a gene for a novel protein
            (zgc:64017), a gene for a novel protein (zgc:55466), the
            3' end of the cacna1c gene for calcium channel
            voltage-dependent L type alpha 1C subunit, a novel gene
            and a CpG island, complete sequence.>gb:BX649380_2567757
            Zebrafish DNA sequence from clone CH211-87P6 in linkage
            group 4 Contains the gene for a novel protein similar to
            vertebrate calcium channel voltage-dependent alpha
            2/delta 3 subunit (CACNA2D3), a gene for a novel protein
            (zgc:55777), the mitc1 gene for MAD homolog 4 interacting
            transcription coactivator 1, the 5' end of the cacna1c
            gene for calcium channel voltage-dependent L type alpha
            1C subunit and two novel genes, complete sequence.
          Length = 2196

 Score = 46.2 bits (108), Expect = 7e-04
 Identities = 30/126 (23%), Positives = 56/126 (44%), Gaps = 16/126 (12%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +    N  ++  +         NF  +P  ++ LF
Sbjct: 1408 LPYVALLIVMLFFIYAVIGMQMFGKIALRDNSQINRNN---------NFQTFPQAVLLLF 1458

Query: 576  NLLVMGNWQLWMQSYK---------------ELTGTSWSYVYFISFYVITVLWLLNLIVA 442
                   WQ  M +                 E  G+ ++  YF+SFY++    ++NL VA
Sbjct: 1459 RCATGEAWQEIMLACSPNRPCEKGSEINHSSEDCGSHFAIFYFVSFYMLCAFLIINLFVA 1518

Query: 441  FVLEAF 424
             +++ F
Sbjct: 1519 VIMDNF 1524



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 27/100 (27%), Positives = 47/100 (47%), Gaps = 9/100 (9%)
 Frame = -2

Query: 675  NAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSW 508
            N G P        ++D   FNF+D   GM+ LF +     W   +     S+ E  G  +
Sbjct: 1092 NVGKPEKAQRSWENSD---FNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHAEDVGPIY 1148

Query: 507  SY-----VYFISFYVITVLWLLNLIVAFVLEAFQTEMDME 403
            +Y     ++FI + +I   +++N+ V FV+  FQ + + E
Sbjct: 1149 NYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQE 1188



 Score = 38.5 bits (88), Expect = 0.15
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQ---LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIV 445
           NF+++   M+T+F  + M  W     WMQ   +  G    +VYF+S  +    ++LNL++
Sbjct: 358 NFDNFAFAMLTVFQCITMEGWTDVLYWMQ---DAMGYELPWVYFVSLVIFGSFFVLNLVL 414

Query: 444 AFVLEAFQTEMD 409
             +   F  E +
Sbjct: 415 GVLSGEFSKERE 426



 Score = 37.4 bits (85), Expect = 0.34
 Identities = 30/120 (25%), Positives = 53/120 (44%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG       N D T  S        F+++P 
Sbjct: 658 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKF-----NFDETRRS-------TFDNFPQ 705

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 706 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 765



>gb:AF305689_2486449 Danio rerio voltage-gated L-type calcium channel
            alpha-1 subunit (isl) mRNA, complete cds.
          Length = 2168

 Score = 46.2 bits (108), Expect = 7e-04
 Identities = 30/126 (23%), Positives = 56/126 (44%), Gaps = 16/126 (12%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +    N  ++  +         NF  +P  ++ LF
Sbjct: 1380 LPYVALLIVMLFFIYAVIGMQMFGKIALRDNSQINRNN---------NFQTFPQAVLLLF 1430

Query: 576  NLLVMGNWQLWMQSYK---------------ELTGTSWSYVYFISFYVITVLWLLNLIVA 442
                   WQ  M +                 E  G+ ++  YF+SFY++    ++NL VA
Sbjct: 1431 RCATGEAWQEIMLACSPNRPCEKGSEINHSSEDCGSHFAIFYFVSFYMLCAFLIINLFVA 1490

Query: 441  FVLEAF 424
             +++ F
Sbjct: 1491 VIMDNF 1496



 Score = 43.5 bits (101), Expect = 0.005
 Identities = 27/100 (27%), Positives = 47/100 (47%), Gaps = 9/100 (9%)
 Frame = -2

Query: 675  NAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLLVMGNWQLWM----QSYKELTGTSW 508
            N G P        ++D   FNF+D   GM+ LF +     W   +     S+ E  G  +
Sbjct: 1092 NVGEPEKAQRSWENSD---FNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHAEDVGPIY 1148

Query: 507  SY-----VYFISFYVITVLWLLNLIVAFVLEAFQTEMDME 403
            +Y     ++FI + +I   +++N+ V FV+  FQ + + E
Sbjct: 1149 NYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQE 1188



 Score = 38.5 bits (88), Expect = 0.15
 Identities = 20/72 (27%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQ---LWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIV 445
           NF+++   M+T+F  + M  W     WMQ   +  G    +VYF+S  +    ++LNL++
Sbjct: 358 NFDNFAFAMLTVFQCITMEGWTDVLYWMQ---DAMGYELPWVYFVSLVIFGSFFVLNLVL 414

Query: 444 AFVLEAFQTEMD 409
             +   F  E +
Sbjct: 415 GVLSGEFSKERE 426



 Score = 37.4 bits (85), Expect = 0.34
 Identities = 30/120 (25%), Positives = 53/120 (44%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  +  +  LG+Q+FGG       N D T  S        F+++P 
Sbjct: 658 LNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKF-----NFDETRRS-------TFDNFPQ 705

Query: 594 GMVTLFNLLVMGNWQLWM-QSYKELTGTSWS----YVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M        G S+      +YFI  ++     LLN+ +A  ++
Sbjct: 706 SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 765



>gb:HS172B20_1997286 Human DNA sequence from clone RP1-172B20 on
           chromosome 22q12.3-13.1 Contains the 3' part of the
           CACNA1I gene for voltage-dependent calcium channel,
           alpha 1I subunit, ESTs, STSs, GSSs and a putative CpG
           island, complete sequence.
          Length = 2029

 Score = 46.2 bits (108), Expect = 7e-04
 Identities = 39/139 (28%), Positives = 63/139 (45%), Gaps = 6/139 (4%)
 Frame = -2

Query: 795 VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
           +P  +  L ++   M  + T FC+L       +  LG+ IFG   +        TD  D 
Sbjct: 551 MPALRRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHIFGCKFSLR------TDTGDT 603

Query: 630 DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS-WSYVYFISFYVITVLWLLN 454
                NF+     +VT+F +L   +W + +  Y  +  TS W+ +YF++        L N
Sbjct: 604 VPDRKNFDSLLWAIVTVFQILTQEDWNVVL--YNGMASTSPWASLYFVALMTFGNYVLFN 661

Query: 453 LIVAFVLEAFQTEMDMETS 397
           L+VA ++E FQ E D   S
Sbjct: 662 LLVAILVEGFQAEGDANRS 680



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 37/138 (26%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGGM----VNAGNPNLDG-TDLSDNDYLL 619
            TLI SL P +G I  + C     +  LG+Q+F G     +     N+   +D    +Y  
Sbjct: 1104 TLISSLKP-IGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCMAANYRW 1162

Query: 618  ----FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                +NF++    +++LF L     W   M +  +              W  +YFISF +
Sbjct: 1163 VHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLL 1222

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1223 IVSFFVLNMFVGVVVENF 1240



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 31/117 (26%), Positives = 56/117 (47%), Gaps = 12/117 (10%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMV-NAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNL 571
            LG +F +L F Y +LG+++FG +V N  NP  +G            F ++    +TLF +
Sbjct: 1428 LGLLFMLLFFIYAALGVELFGKLVCNDENP-CEGMSRHAT------FENFGMAFLTLFQV 1480

Query: 570  LVMGNWQ-LWMQSYKELTGTSWSYV---------YFISFYVITVLWLLNLIVAFVLE 430
                NW  +   + ++ T    S +         YF+SF +     L+N++VA +++
Sbjct: 1481 STGDNWNGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMK 1537



>gb:AF393329_1900570 Homo sapiens voltage-dependent calcium channel
            T-type alpha 1I subunit (CACNA1I) mRNA, complete cds.
          Length = 2188

 Score = 46.2 bits (108), Expect = 7e-04
 Identities = 39/139 (28%), Positives = 63/139 (45%), Gaps = 6/139 (4%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  +  L ++   M  + T FC+L       +  LG+ IFG   +        TD  D 
Sbjct: 710  MPALRRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHIFGCKFSLR------TDTGDT 762

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS-WSYVYFISFYVITVLWLLN 454
                 NF+     +VT+F +L   +W + +  Y  +  TS W+ +YF++        L N
Sbjct: 763  VPDRKNFDSLLWAIVTVFQILTQEDWNVVL--YNGMASTSPWASLYFVALMTFGNYVLFN 820

Query: 453  LIVAFVLEAFQTEMDMETS 397
            L+VA ++E FQ E D   S
Sbjct: 821  LLVAILVEGFQAEGDANRS 839



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 37/138 (26%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGGM----VNAGNPNLDG-TDLSDNDYLL 619
            TLI SL P +G I  + C     +  LG+Q+F G     +     N+   +D    +Y  
Sbjct: 1263 TLISSLKP-IGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCMAANYRW 1321

Query: 618  ----FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                +NF++    +++LF L     W   M +  +              W  +YFISF +
Sbjct: 1322 VHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLL 1381

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1382 IVSFFVLNMFVGVVVENF 1399



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 31/117 (26%), Positives = 56/117 (47%), Gaps = 12/117 (10%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMV-NAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNL 571
            LG +F +L F Y +LG+++FG +V N  NP  +G            F ++    +TLF +
Sbjct: 1587 LGLLFMLLFFIYAALGVELFGKLVCNDENP-CEGMSRHAT------FENFGMAFLTLFQV 1639

Query: 570  LVMGNWQ-LWMQSYKELTGTSWSYV---------YFISFYVITVLWLLNLIVAFVLE 430
                NW  +   + ++ T    S +         YF+SF +     L+N++VA +++
Sbjct: 1640 STGDNWNGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMK 1696



>gb:AF211189_1890180 Homo sapiens T-type calcium channel alpha1
            subunit Alpha1I-a isoform (CACNA1I) mRNA, complete cds.
          Length = 1981

 Score = 46.2 bits (108), Expect = 7e-04
 Identities = 39/139 (28%), Positives = 63/139 (45%), Gaps = 6/139 (4%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  +  L ++   M  + T FC+L       +  LG+ IFG   +        TD  D 
Sbjct: 710  MPALRRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHIFGCKFSLR------TDTGDT 762

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS-WSYVYFISFYVITVLWLLN 454
                 NF+     +VT+F +L   +W + +  Y  +  TS W+ +YF++        L N
Sbjct: 763  VPDRKNFDSLLWAIVTVFQILTQEDWNVVL--YNGMASTSPWASLYFVALMTFGNYVLFN 820

Query: 453  LIVAFVLEAFQTEMDMETS 397
            L+VA ++E FQ E D   S
Sbjct: 821  LLVAILVEGFQAEGDANRS 839



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 37/138 (26%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGGM----VNAGNPNLDG-TDLSDNDYLL 619
            TLI SL P +G I  + C     +  LG+Q+F G     +     N+   +D    +Y  
Sbjct: 1263 TLISSLKP-IGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCMAANYRW 1321

Query: 618  ----FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                +NF++    +++LF L     W   M +  +              W  +YFISF +
Sbjct: 1322 VHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLL 1381

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1382 IVSFFVLNMFVGVVVENF 1399



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 31/117 (26%), Positives = 56/117 (47%), Gaps = 12/117 (10%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMV-NAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNL 571
            LG +F +L F Y +LG+++FG +V N  NP  +G            F ++    +TLF +
Sbjct: 1587 LGLLFMLLFFIYAALGVELFGKLVCNDENP-CEGMSRHAT------FENFGMAFLTLFQV 1639

Query: 570  LVMGNWQ-LWMQSYKELTGTSWSYV---------YFISFYVITVLWLLNLIVAFVLE 430
                NW  +   + ++ T    S +         YF+SF +     L+N++VA +++
Sbjct: 1640 STGDNWNGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMK 1696



>gb:AF129133_1885313 Homo sapiens T-type calcium channel alpha1I
            subunit (CACNA1I) mRNA, complete
            cds.>gb:HS1104E15_1996779 Human DNA sequence from clone
            RP5-1104E15 on chromosome 22q12.3-13.1 Contains the MGAT3
            gene for mannosyl (beta-1,4-)-glycoprotein
            beta-1,4-N-acetylglucosaminyltransferase, the gene for a
            predicted protein, the ATF4 gene for activating
            transcription factor 4 (tax-responsive enhancer element
            B67) and the 5' end of the CACNA1I gene for
            voltage-dependent calcium channel, alpha 1I subunit.
            Contains ESTs, STSs, GSSs and five putative CpG islands,
            complete sequence.>gb:HS172B20_1997287 Human DNA sequence
            from clone RP1-172B20 on chromosome 22q12.3-13.1 Contains
            the 3' part of the CACNA1I gene for voltage-dependent
            calcium channel, alpha 1I subunit, ESTs, STSs, GSSs and a
            putative CpG island, complete
            sequence.>gb:HS206C7_1997457 Human DNA sequence from
            clone CTA-206C7 on chromosome 22q12.3-13.2, complete
            sequence.
          Length = 2016

 Score = 46.2 bits (108), Expect = 7e-04
 Identities = 39/139 (28%), Positives = 63/139 (45%), Gaps = 6/139 (4%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  +  L ++   M  + T FC+L       +  LG+ IFG   +        TD  D 
Sbjct: 745  MPALRRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHIFGCKFSLR------TDTGDT 797

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS-WSYVYFISFYVITVLWLLN 454
                 NF+     +VT+F +L   +W + +  Y  +  TS W+ +YF++        L N
Sbjct: 798  VPDRKNFDSLLWAIVTVFQILTQEDWNVVL--YNGMASTSPWASLYFVALMTFGNYVLFN 855

Query: 453  LIVAFVLEAFQTEMDMETS 397
            L+VA ++E FQ E D   S
Sbjct: 856  LLVAILVEGFQAEGDANRS 874



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 37/138 (26%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGGM----VNAGNPNLDG-TDLSDNDYLL 619
            TLI SL P +G I  + C     +  LG+Q+F G     +     N+   +D    +Y  
Sbjct: 1298 TLISSLKP-IGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCMAANYRW 1356

Query: 618  ----FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                +NF++    +++LF L     W   M +  +              W  +YFISF +
Sbjct: 1357 VHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLL 1416

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1417 IVSFFVLNMFVGVVVENF 1434



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 31/117 (26%), Positives = 56/117 (47%), Gaps = 12/117 (10%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMV-NAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNL 571
            LG +F +L F Y +LG+++FG +V N  NP  +G            F ++    +TLF +
Sbjct: 1622 LGLLFMLLFFIYAALGVELFGKLVCNDENP-CEGMSRHAT------FENFGMAFLTLFQV 1674

Query: 570  LVMGNWQ-LWMQSYKELTGTSWSYV---------YFISFYVITVLWLLNLIVAFVLE 430
                NW  +   + ++ T    S +         YF+SF +     L+N++VA +++
Sbjct: 1675 STGDNWNGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMK 1731



>sp|Q9P0X4|CCAI_HUMAN Voltage-dependent T-type calcium channel
            alpha-1I subunit (Voltage- gated calcium channel alpha
            subunit Cav3.3) (Ca(v)3.3).>gb:AF142567_1885966 Homo
            sapiens T calcium channel alpha1I subunit, delta36B
            splice variant (CACNA1I) mRNA, complete cds.
          Length = 2223

 Score = 46.2 bits (108), Expect = 7e-04
 Identities = 39/139 (28%), Positives = 63/139 (45%), Gaps = 6/139 (4%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  +  L ++   M  + T FC+L       +  LG+ IFG   +        TD  D 
Sbjct: 745  MPALRRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHIFGCKFSLR------TDTGDT 797

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS-WSYVYFISFYVITVLWLLN 454
                 NF+     +VT+F +L   +W + +  Y  +  TS W+ +YF++        L N
Sbjct: 798  VPDRKNFDSLLWAIVTVFQILTQEDWNVVL--YNGMASTSPWASLYFVALMTFGNYVLFN 855

Query: 453  LIVAFVLEAFQTEMDMETS 397
            L+VA ++E FQ E D   S
Sbjct: 856  LLVAILVEGFQAEGDANRS 874



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 37/138 (26%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGGM----VNAGNPNLDG-TDLSDNDYLL 619
            TLI SL P +G I  + C     +  LG+Q+F G     +     N+   +D    +Y  
Sbjct: 1298 TLISSLKP-IGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCMAANYRW 1356

Query: 618  ----FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                +NF++    +++LF L     W   M +  +              W  +YFISF +
Sbjct: 1357 VHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLL 1416

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1417 IVSFFVLNMFVGVVVENF 1434



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 31/117 (26%), Positives = 56/117 (47%), Gaps = 12/117 (10%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMV-NAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNL 571
            LG +F +L F Y +LG+++FG +V N  NP  +G            F ++    +TLF +
Sbjct: 1622 LGLLFMLLFFIYAALGVELFGKLVCNDENP-CEGMSRHAT------FENFGMAFLTLFQV 1674

Query: 570  LVMGNWQ-LWMQSYKELTGTSWSYV---------YFISFYVITVLWLLNLIVAFVLE 430
                NW  +   + ++ T    S +         YF+SF +     L+N++VA +++
Sbjct: 1675 STGDNWNGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMK 1731



>gb:MMU012569_2117922 Mus musculus mRNA for voltage-gated calcium
            channel, alpha-1-G subunit.
          Length = 2295

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 38/132 (28%), Positives = 61/132 (46%), Gaps = 5/132 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 848  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 903

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 904  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 958

Query: 450  IVAFVLEAFQTE 415
            +VA ++E FQ E
Sbjct: 959  LVAILVEGFQAE 970



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
            TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 1405 TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 1463

Query: 615  -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                 NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 1464 VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 1523

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1524 IVAFFVLNMFVGVVVENF 1541



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 1754 LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 1807

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 1808 TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 1860



>gb:AL645965_2072059 Mouse DNA sequence from clone RP23-65I14 on
            chromosome 11 Contains the 5' end of the gene for a novel
            protein (330000P08Rik) (Luc7a), the gene for a novel
            protein (5530600A18Rik), the Abcc3 gene for ATP-binding
            cassette sub-family C (CFTR/MRP) member 3, the Cacna1g
            gene for calcium channel voltage-dependent T type alpha
            1G subunit, the 3' end of the Tisp78 gene for transcript
            increased in spermiogenesis 78 and one CpG island,
            complete sequence.
          Length = 2295

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 38/132 (28%), Positives = 61/132 (46%), Gaps = 5/132 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 848  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 903

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 904  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 958

Query: 450  IVAFVLEAFQTE 415
            +VA ++E FQ E
Sbjct: 959  LVAILVEGFQAE 970



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
            TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 1405 TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 1463

Query: 615  -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                 NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 1464 VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 1523

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1524 IVAFFVLNMFVGVVVENF 1541



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 1754 LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 1807

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 1808 TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 1860



>gb:AL645965_2072058 Mouse DNA sequence from clone RP23-65I14 on
            chromosome 11 Contains the 5' end of the gene for a novel
            protein (330000P08Rik) (Luc7a), the gene for a novel
            protein (5530600A18Rik), the Abcc3 gene for ATP-binding
            cassette sub-family C (CFTR/MRP) member 3, the Cacna1g
            gene for calcium channel voltage-dependent T type alpha
            1G subunit, the 3' end of the Tisp78 gene for transcript
            increased in spermiogenesis 78 and one CpG island,
            complete sequence.
          Length = 2277

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 38/132 (28%), Positives = 61/132 (46%), Gaps = 5/132 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 848  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 903

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 904  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 958

Query: 450  IVAFVLEAFQTE 415
            +VA ++E FQ E
Sbjct: 959  LVAILVEGFQAE 970



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
            TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 1405 TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 1463

Query: 615  -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                 NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 1464 VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 1523

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1524 IVAFFVLNMFVGVVVENF 1541



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 1736 LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 1789

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 1790 TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 1842



>gb:AL645965_2072057 Mouse DNA sequence from clone RP23-65I14 on
            chromosome 11 Contains the 5' end of the gene for a novel
            protein (330000P08Rik) (Luc7a), the gene for a novel
            protein (5530600A18Rik), the Abcc3 gene for ATP-binding
            cassette sub-family C (CFTR/MRP) member 3, the Cacna1g
            gene for calcium channel voltage-dependent T type alpha
            1G subunit, the 3' end of the Tisp78 gene for transcript
            increased in spermiogenesis 78 and one CpG island,
            complete sequence.
          Length = 2381

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 38/132 (28%), Positives = 61/132 (46%), Gaps = 5/132 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 848  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 903

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 904  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 958

Query: 450  IVAFVLEAFQTE 415
            +VA ++E FQ E
Sbjct: 959  LVAILVEGFQAE 970



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
            TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 1405 TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 1463

Query: 615  -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                 NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 1464 VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 1523

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1524 IVAFFVLNMFVGVVVENF 1541



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 1747 LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 1800

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 1801 TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 1853



>gb:AL645965_2072056 Mouse DNA sequence from clone RP23-65I14 on
            chromosome 11 Contains the 5' end of the gene for a novel
            protein (330000P08Rik) (Luc7a), the gene for a novel
            protein (5530600A18Rik), the Abcc3 gene for ATP-binding
            cassette sub-family C (CFTR/MRP) member 3, the Cacna1g
            gene for calcium channel voltage-dependent T type alpha
            1G subunit, the 3' end of the Tisp78 gene for transcript
            increased in spermiogenesis 78 and one CpG island,
            complete sequence.
          Length = 2288

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 38/132 (28%), Positives = 61/132 (46%), Gaps = 5/132 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 848  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 903

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 904  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 958

Query: 450  IVAFVLEAFQTE 415
            +VA ++E FQ E
Sbjct: 959  LVAILVEGFQAE 970



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
            TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 1405 TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 1463

Query: 615  -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                 NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 1464 VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 1523

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1524 IVAFFVLNMFVGVVVENF 1541



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 1747 LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 1800

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 1801 TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 1853



>gb:AL645965_2072055 Mouse DNA sequence from clone RP23-65I14 on
            chromosome 11 Contains the 5' end of the gene for a novel
            protein (330000P08Rik) (Luc7a), the gene for a novel
            protein (5530600A18Rik), the Abcc3 gene for ATP-binding
            cassette sub-family C (CFTR/MRP) member 3, the Cacna1g
            gene for calcium channel voltage-dependent T type alpha
            1G subunit, the 3' end of the Tisp78 gene for transcript
            increased in spermiogenesis 78 and one CpG island,
            complete sequence.
          Length = 2270

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 38/132 (28%), Positives = 61/132 (46%), Gaps = 5/132 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 848  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 903

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 904  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 958

Query: 450  IVAFVLEAFQTE 415
            +VA ++E FQ E
Sbjct: 959  LVAILVEGFQAE 970



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
            TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 1405 TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 1463

Query: 615  -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                 NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 1464 VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 1523

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1524 IVAFFVLNMFVGVVVENF 1541



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 1729 LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 1782

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 1783 TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 1835



>gb:AF290214_2061702 Rattus norvegicus calcium channel alpha-1-I
            subunit mRNA, complete cds.
          Length = 1834

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 38/138 (27%), Positives = 62/138 (44%), Gaps = 5/138 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  +  L ++   M  + T FC+L       +  LG+ IFG   +        TD  D 
Sbjct: 703  MPALRRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGIDIFGCKFSLR------TDTGDT 755

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W + + +    T T W+ +YF++        L NL
Sbjct: 756  VPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMAST-TPWASLYFVALMTFGNYVLFNL 814

Query: 450  IVAFVLEAFQTEMDMETS 397
            +VA ++E FQ E D   S
Sbjct: 815  LVAILVEGFQAEGDANRS 832



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 38/138 (27%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGGMVN--AGNPNLDGTDLSDND------ 628
            TLI SL P +G I  + C     +  LG+Q+F G      G    + T+ SD        
Sbjct: 1256 TLISSLKP-IGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCVAANYRW 1314

Query: 627  -YLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
             +  +NF++    +++LF L     W   M +  +              W  +YFISF +
Sbjct: 1315 VHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLL 1374

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1375 IVSFFVLNMFVGVVVENF 1392



 Score = 36.2 bits (82), Expect = 0.77
 Identities = 34/117 (29%), Positives = 57/117 (48%), Gaps = 12/117 (10%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMV-NAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNL 571
            LG +F +L F Y +LG+++FG +V N  NP  +G            F +     +TLF +
Sbjct: 1580 LGLLFMLLFFIYAALGVELFGKLVCNDENP-CEGMSRHAT------FENSARAFLTLFQV 1632

Query: 570  LVMGNWQLWMQ------SYKELTGTSW----SYVYFISFYVITVLWLLNLIVAFVLE 430
                NW   M+      ++ E T  S     S +YF+SF +     L+N++VA +++
Sbjct: 1633 STGDNWNGIMKDTLRDCTHDERTCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMK 1689



>gb:AF125161_2055455 Rattus norvegicus T-type calcium channel isoform
            mRNA, complete cds.
          Length = 2288

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 38/132 (28%), Positives = 61/132 (46%), Gaps = 5/132 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 849  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 904

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 905  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 959

Query: 450  IVAFVLEAFQTE 415
            +VA ++E FQ E
Sbjct: 960  LVAILVEGFQAE 971



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
            TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 1406 TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 1464

Query: 615  -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                 NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 1465 VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 1524

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1525 IVAFFVLNMFVGVVVENF 1542



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 1748 LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 1801

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 1802 TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 1854



>gb:AF227751_1891559 Homo sapiens voltage-dependent calcium channel
            alpha 1G subunit isoform be (CACNA1G) mRNA, complete cds.
          Length = 2266

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 38/132 (28%), Positives = 61/132 (46%), Gaps = 5/132 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 848  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 903

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 904  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 958

Query: 450  IVAFVLEAFQTE 415
            +VA ++E FQ E
Sbjct: 959  LVAILVEGFQAE 970



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
            TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 1404 TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 1462

Query: 615  -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                 NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 1463 VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 1522

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1523 IVAFFVLNMFVGVVVENF 1540



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 1728 LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 1781

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 1782 TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 1834



>gb:AF227750_1891558 Homo sapiens voltage-dependent calcium channel
            alpha 1G subunit isoform bcef (CACNA1G) mRNA, complete
            cds.
          Length = 2332

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 38/132 (28%), Positives = 61/132 (46%), Gaps = 5/132 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 848  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 903

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 904  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 958

Query: 450  IVAFVLEAFQTE 415
            +VA ++E FQ E
Sbjct: 959  LVAILVEGFQAE 970



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
            TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 1404 TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 1462

Query: 615  -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                 NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 1463 VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 1522

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1523 IVAFFVLNMFVGVVVENF 1540



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 1746 LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 1799

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 1800 TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 1852



>gb:AF227749_1891557 Homo sapiens voltage-dependent calcium channel
            alpha 1G subunit isoform bce (CACNA1G) mRNA, complete
            cds.
          Length = 2284

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 38/132 (28%), Positives = 61/132 (46%), Gaps = 5/132 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 848  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 903

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 904  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 958

Query: 450  IVAFVLEAFQTE 415
            +VA ++E FQ E
Sbjct: 959  LVAILVEGFQAE 970



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
            TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 1404 TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 1462

Query: 615  -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                 NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 1463 VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 1522

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1523 IVAFFVLNMFVGVVVENF 1540



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 1746 LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 1799

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 1800 TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 1852



>gb:AF227745_1891553 Homo sapiens voltage-dependent calcium channel
            alpha 1G subunit isoform aef (CACNA1G) mRNA, complete
            cds.
          Length = 2321

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 38/132 (28%), Positives = 61/132 (46%), Gaps = 5/132 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 848  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 903

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 904  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 958

Query: 450  IVAFVLEAFQTE 415
            +VA ++E FQ E
Sbjct: 959  LVAILVEGFQAE 970



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
            TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 1404 TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 1462

Query: 615  -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                 NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 1463 VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 1522

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1523 IVAFFVLNMFVGVVVENF 1540



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 1735 LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 1788

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 1789 TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 1841



>gb:AF227744_1891552 Homo sapiens voltage-dependent calcium channel
            alpha 1G subunit isoform ae (CACNA1G) mRNA, complete cds.
          Length = 2273

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 38/132 (28%), Positives = 61/132 (46%), Gaps = 5/132 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 848  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 903

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 904  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 958

Query: 450  IVAFVLEAFQTE 415
            +VA ++E FQ E
Sbjct: 959  LVAILVEGFQAE 970



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
            TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 1404 TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 1462

Query: 615  -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                 NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 1463 VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 1522

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1523 IVAFFVLNMFVGVVVENF 1540



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 1735 LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 1788

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 1789 TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 1841



>gb:AB032949_1866130 Homo sapiens mRNA for KIAA1123 protein, partial
           cds.
          Length = 1717

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 38/132 (28%), Positives = 61/132 (46%), Gaps = 5/132 (3%)
 Frame = -2

Query: 795 VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
           +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 299 LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 354

Query: 630 DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 355 K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 409

Query: 450 IVAFVLEAFQTE 415
           +VA ++E FQ E
Sbjct: 410 LVAILVEGFQAE 421



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
            TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 855  TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 913

Query: 615  -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                 NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 914  VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 973

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 974  IVAFFVLNMFVGVVVENF 991



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 1179 LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 1232

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 1233 TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 1285



>gb:AB012043_1864376 Homo sapiens mRNA for NBR13, complete cds.
          Length = 1555

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 38/132 (28%), Positives = 61/132 (46%), Gaps = 5/132 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 848  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 903

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 904  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 958

Query: 450  IVAFVLEAFQTE 415
            +VA ++E FQ E
Sbjct: 959  LVAILVEGFQAE 970



>gb:AF361885_1265571 Schistosoma mansoni high voltage-activated
            calcium channel Cav2B mRNA, partial cds.
          Length = 1518

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 34/128 (26%), Positives = 61/128 (47%), Gaps = 12/128 (9%)
 Frame = -2

Query: 771  TLIPSL--MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDY 601
            T I S+  +PY+  +  +L F YC +G ++F  +    +  L+  +         NF  +
Sbjct: 1244 TFIQSIKALPYVCLLITMLFFIYCIVGERLFKNIKTDPHSQLNNHN---------NFQTF 1294

Query: 600  PNGMVTLFNLLVMGNWQLWM---------QSYKELTGTSWSYVYFISFYVITVLWLLNLI 448
             +G++ LF      NWQ  M         +   E  G+S++Y+YF +F  +    +LNL 
Sbjct: 1295 GDGILLLFRCATGENWQEIMLDCAAGKECEGSGESCGSSYTYLYFSTFNFLCSFIMLNLF 1354

Query: 447  VAFVLEAF 424
            VA +++ F
Sbjct: 1355 VAVIMDNF 1362



 Score = 40.8 bits (94), Expect = 0.031
 Identities = 18/74 (24%), Positives = 39/74 (52%)
 Frame = -2

Query: 630 DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
           +Y + +F++    M+T+F  + M  W   M S  +  G  ++Y+YF+   ++   ++LNL
Sbjct: 199 NYGITSFDNIGYAMLTVFQCITMEGWTEIMYSTNDAFGDRFNYLYFVPLIILGSFFMLNL 258

Query: 450 IVAFVLEAFQTEMD 409
           ++  +   F  E +
Sbjct: 259 VLGVLSGEFAKERE 272



 Score = 37.7 bits (86), Expect = 0.26
 Identities = 30/122 (24%), Positives = 54/122 (44%), Gaps = 7/122 (5%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVN--AGNPNLDGTDLSDNDYLLFNFNDY 601
           L  + S++  L  +F  +  +  LG+Q+FGG  N   G P               NF+ +
Sbjct: 515 LNSMRSIISLLFLLFLFILIFALLGMQLFGGDFNFDEGRPTQ-------------NFDTF 561

Query: 600 PNGMVTLFNLLVMGNWQLWMQSYKELTG--TSWSYVYFISFYVITVL---WLLNLIVAFV 436
              ++T+F +L   +W   M +     G  TS   +Y + F ++ V     LLN+ +A  
Sbjct: 562 VKALLTVFQILTGEDWNTVMYNGIRAQGGVTSGGAIYSVYFVLVMVFGNYTLLNVFLAIA 621

Query: 435 LE 430
           ++
Sbjct: 622 VD 623



>sp|Q9Z0Y8|CCAI_RAT Voltage-dependent T-type calcium channel alpha-1I
            subunit (Voltage- gated calcium channel alpha subunit
            Cav3.3) (CaVT.3).>gb:AF086827_2053986 Rattus norvegicus
            low voltage-activated T-type calcium channel alpha-1
            subunit (CACNA1I) mRNA, complete cds.
          Length = 1835

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 38/138 (27%), Positives = 62/138 (44%), Gaps = 5/138 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  +  L ++   M  + T FC+L       +  LG+ IFG   +        TD  D 
Sbjct: 703  MPALRRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHIFGCKFSLR------TDTGDT 755

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W + + +    T T W+ +YF++        L NL
Sbjct: 756  VPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMAST-TPWASLYFVALMTFGNYVLFNL 814

Query: 450  IVAFVLEAFQTEMDMETS 397
            +VA ++E FQ E D   S
Sbjct: 815  LVAILVEGFQAEGDANRS 832



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 38/138 (27%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGGMVN--AGNPNLDGTDLSDND------ 628
            TLI SL P +G I  + C     +  LG+Q+F G      G    + T+ SD        
Sbjct: 1257 TLISSLKP-IGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCVAANYRW 1315

Query: 627  -YLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
             +  +NF++    +++LF L     W   M +  +              W  +YFISF +
Sbjct: 1316 VHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLL 1375

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1376 IVSFFVLNMFVGVVVENF 1393



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 31/117 (26%), Positives = 56/117 (47%), Gaps = 12/117 (10%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMV-NAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNL 571
            LG +F +L F Y +LG+++FG +V N  NP  +G            F ++    +TLF +
Sbjct: 1581 LGLLFMLLFFIYAALGVELFGKLVCNDENP-CEGMSRHAT------FENFGMAFLTLFQV 1633

Query: 570  LVMGNWQ-LWMQSYKELTGTSWSYV---------YFISFYVITVLWLLNLIVAFVLE 430
                NW  +   + ++ T    S +         YF+SF +     L+N++VA +++
Sbjct: 1634 STGDNWNGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSFVLTAQFVLINVVVAVLMK 1690



>sp|O43497|CCAG_HUMAN Voltage-dependent T-type calcium channel
            alpha-1G subunit (Voltage- gated calcium channel alpha
            subunit Cav3.1) (Cav3.1c) (NBR13).>gb:AF134986_1885668
            Homo sapiens T calcium channel alpha1G subunit (CACNA1G)
            mRNA, complete cds.
          Length = 2377

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 38/132 (28%), Positives = 61/132 (46%), Gaps = 5/132 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  Q  L ++   M  + T FC+L       +  LG+ +FG    +     DG  L D 
Sbjct: 848  LPALQRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFASER---DGDTLPDR 903

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL
Sbjct: 904  K----NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNL 958

Query: 450  IVAFVLEAFQTE 415
            +VA ++E FQ E
Sbjct: 959  LVAILVEGFQAE 970



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
            TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 1404 TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 1462

Query: 615  -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                 NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 1463 VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 1522

Query: 477  ITVLWLLNLIVAFVLEAF 424
            I   ++LN+ V  V+E F
Sbjct: 1523 IVAFFVLNMFVGVVVENF 1540



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 1746 LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 1799

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 1800 TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 1852



>sp|P56699|CCAE_DISOM Probable voltage-dependent R-type calcium
            channel alpha-1E subunit (Voltage-gated calcium channel
            alpha subunit Cav2.3) (DOE-1).>pir|A47447|A47447 calcium
            channel protein alpha-1 chain (variant doe-1) - electric
            ray (Discopyge ommata)
          Length = 2223

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 37/122 (30%), Positives = 61/122 (50%), Gaps = 11/122 (9%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG   N G    D T ++ ++    NF+ + N ++ LF
Sbjct: 1555 LPYVCLLIAMLFFIYAIIGMQLFG---NIGLD--DHTPINRHN----NFHTFFNALMLLF 1605

Query: 576  NLLVMGNWQ---LWMQSYKELTGT-------SWSYVYFISFYVITVLWLLNLIVAFVLEA 427
                  +WQ   L   S KE  GT         +Y YF+SF  +    +LNL VA +++ 
Sbjct: 1606 RSATGESWQEIMLACLSGKECEGTREPSCGTDVAYFYFVSFIFLCSFLMLNLFVAVIMDN 1665

Query: 426  FQ 421
            F+
Sbjct: 1666 FE 1667



 Score = 45.1 bits (105), Expect = 0.002
 Identities = 31/119 (26%), Positives = 57/119 (47%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           ++ + S++  L  +F  +  +  LG+Q+FGG  N      +GT  +       NF+ +P 
Sbjct: 611 MSSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFE----EGTPPT-------NFDTFPA 659

Query: 594 GMVTLFNLLVMGNWQLWM----QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M    +S   +    WS VYFI   +     LLN+ +A  ++
Sbjct: 660 AIITVFQILTGEDWNEVMYNGIKSQGGVNSGMWSSVYFIVLTLFGNYTLLNVFLAIAVD 718



 Score = 38.5 bits (88), Expect = 0.15
 Identities = 16/68 (23%), Positives = 35/68 (51%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  +  G  W+++YFI   +I   ++LNL++  + 
Sbjct: 304 FDNILFALLTVFQCITMEGWTTILYNTDDALGAMWNWLYFIPLIIIGSFFVLNLVLGVLS 363

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 364 GEFAKERE 371



>gb:AY172332_1426468 Canis familiaris T-type calcium channel alpha
           H1 mRNA, partial cds.
          Length = 590

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 37/138 (26%), Positives = 63/138 (45%), Gaps = 5/138 (3%)
 Frame = -2

Query: 795 VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
           +P  +  L ++   M  + T FC+L       +  LG+ +FG   +        TD  D 
Sbjct: 204 MPALRRQLVVLMKTMDNVAT-FCMLLMLFIFIFSILGMHLFGCKFSLT------TDTGDT 256

Query: 630 DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                NF+     +VT+F +L   +W + + +    T +SW+ +YF++        L NL
Sbjct: 257 VPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMAST-SSWAALYFVALMTFGNYVLFNL 315

Query: 450 IVAFVLEAFQTEMDMETS 397
           +VA ++E FQ E D   S
Sbjct: 316 LVAILVEGFQAEGDANRS 333



>pir|S05011|S05011 calcium channel alpha-1 chain, dihydropyridine
            sensitive, cardiac (clone HTDHP 2.0) - rabbit (fragment)
          Length = 1331

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 32/129 (24%), Positives = 60/129 (46%), Gaps = 19/129 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T+++ N+    NF  +P  ++ LF
Sbjct: 650  LPYVALLIVMLFFIYAVIGMQVFGKIALN-----DTTEINRNN----NFQTFPQAVLLLF 700

Query: 576  NLLVMGNWQLWMQSY------------------KELTGTSWSYVYFISFYVITVLWLLNL 451
                   WQ  M +                   +   G++++  YFISFY++    ++NL
Sbjct: 701  RCATGEAWQDIMLACMPGKKCAPESEPHNSTEGETPCGSTFAVFYFISFYMLCAFLIINL 760

Query: 450  IVAFVLEAF 424
             VA +++ F
Sbjct: 761  FVAVIMDNF 769



 Score = 36.2 bits (82), Expect = 0.77
 Identities = 19/80 (23%), Positives = 40/80 (50%), Gaps = 12/80 (15%)
 Frame = -2

Query: 606 DYPNGMVTLFNLLVMGNWQLW-------MQSYKELTGTSWSY-----VYFISFYVITVLW 463
           D+ N + T+  L  +  ++ W       + S+ E  G  ++Y     ++FI + +I   +
Sbjct: 387 DFDNVLATMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYSIIIAFF 446

Query: 462 LLNLIVAFVLEAFQTEMDME 403
           ++N+ V FV+  FQ + + E
Sbjct: 447 MMNIFVGFVIVTFQEQGEQE 466



>gb:RNU31816_2137125 Rattus norvegicus calcium channel alpha-1S
           subunit (ROB1) mRNA, partial cds.
          Length = 281

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 32/110 (29%), Positives = 53/110 (48%), Gaps = 17/110 (15%)
 Frame = -2

Query: 753 MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
           +PY+  +  +L F Y  +G+Q+FG +       +DGT ++ N+    NF  +P  ++ LF
Sbjct: 177 LPYVALLIVMLFFIYAVIGMQMFGKIAM-----VDGTQINRNN----NFQTFPQAVLLLF 227

Query: 576 NLLVMGNWQ--LWMQSYKE--------------LTGTSWSYVYFISFYVI 475
                  WQ  L   SY +                GT+++Y YFISFY++
Sbjct: 228 RCATGAAWQEILLACSYGKRCDPESDYAPGEEYACGTNFAYYYFISFYML 277



>gb:HSA420779_2006800 Homo sapiens mRNA for calcium channel,
            voltage-dependent, T type, alpha 1Hb subunit (CACNA1HB
            gene).
          Length = 2347

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 37/138 (26%), Positives = 62/138 (44%), Gaps = 5/138 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  +  L ++   M  + T FC L       +  LG+ +FG   +        TD  D 
Sbjct: 898  LPALRRQLVVLVKTMDNVAT-FCTLLMLFIFIFSILGMHLFGCKFSLK------TDTGDT 950

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W + + +    T +SW+ +YF++        L NL
Sbjct: 951  VPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMAST-SSWAALYFVALMTFGNYVLFNL 1009

Query: 450  IVAFVLEAFQTEMDMETS 397
            +VA ++E FQ E D   S
Sbjct: 1010 LVAILVEGFQAEGDANRS 1027



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 38/140 (27%), Positives = 58/140 (41%), Gaps = 24/140 (17%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG-MVNAGNPNLDGTDLSDNDYLL---- 619
            TLI SL P +G I  + C     +  LG+Q+F G       P  D  ++S          
Sbjct: 1422 TLISSLRP-IGNIVLICCAFFIIFGILGVQLFKGKFYYCEGP--DTRNISTKAQCRAAHY 1478

Query: 618  ------FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISF 484
                  +NF++    +++LF L     W   M    +  G           W  +YFISF
Sbjct: 1479 RWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGVDQQPVQNHNPWMLLYFISF 1538

Query: 483  YVITVLWLLNLIVAFVLEAF 424
             +I   ++LN+ V  V+E F
Sbjct: 1539 LLIVSFFVLNMFVGVVVENF 1558



>gb:AH009202S4_1906681 Homo sapiens low-voltage-activated calcium
           channel alpha13.2 subunit delta25B splice variant
           (CACNA1H) gene, exons 11 through 36, and partial cds;
           and tryptase gamma 1 (TPSG1) gene, exon 6 and partial
           cds.
          Length = 1536

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 37/138 (26%), Positives = 62/138 (44%), Gaps = 5/138 (3%)
 Frame = -2

Query: 795 VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
           +P  +  L ++   M  + T FC L       +  LG+ +FG   +        TD  D 
Sbjct: 81  LPALRRQLVVLVKTMDNVAT-FCTLLMLFIFIFSILGMHLFGCKFSLK------TDTGDT 133

Query: 630 DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                NF+     +VT+F +L   +W + + +    T +SW+ +YF++        L NL
Sbjct: 134 VPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMAST-SSWAALYFVALMTFGNYVLFNL 192

Query: 450 IVAFVLEAFQTEMDMETS 397
           +VA ++E FQ E D   S
Sbjct: 193 LVAILVEGFQAEGDANRS 210



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 38/140 (27%), Positives = 58/140 (41%), Gaps = 24/140 (17%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG-MVNAGNPNLDGTDLSDNDYLL---- 619
            TLI SL P +G I  + C     +  LG+Q+F G       P  D  ++S          
Sbjct: 605  TLISSLRP-IGNIVLICCAFFIIFGILGVQLFKGKFYYCEGP--DTRNISTKAQCRAAHY 661

Query: 618  ------FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISF 484
                  +NF++    +++LF L     W   M    +  G           W  +YFISF
Sbjct: 662  RWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGVDQQPVQNHNPWMLLYFISF 721

Query: 483  YVITVLWLLNLIVAFVLEAF 424
             +I   ++LN+ V  V+E F
Sbjct: 722  LLIVSFFVLNMFVGVVVENF 741



>gb:AF073931_1880955 Homo sapiens low-voltage activated calcium
            channel alpha 1H mRNA, complete cds.
          Length = 2353

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 37/138 (26%), Positives = 62/138 (44%), Gaps = 5/138 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  +  L ++   M  + T FC L       +  LG+ +FG   +        TD  D 
Sbjct: 898  LPALRRQLVVLVKTMDNVAT-FCTLLMLFIFIFSILGMHLFGCKFSLK------TDTGDT 950

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W + + +    T +SW+ +YF++        L NL
Sbjct: 951  VPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMAST-SSWAALYFVALMTFGNYVLFNL 1009

Query: 450  IVAFVLEAFQTEMDMETS 397
            +VA ++E FQ E D   S
Sbjct: 1010 LVAILVEGFQAEGDANRS 1027



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 38/140 (27%), Positives = 58/140 (41%), Gaps = 24/140 (17%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG-MVNAGNPNLDGTDLSDNDYLL---- 619
            TLI SL P +G I  + C     +  LG+Q+F G       P  D  ++S          
Sbjct: 1422 TLISSLRP-IGNIVLICCAFFIIFGILGVQLFKGKFYYCEGP--DTRNISTKAQCRAAHY 1478

Query: 618  ------FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISF 484
                  +NF++    +++LF L     W   M    +  G           W  +YFISF
Sbjct: 1479 RWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGVDQQPVQNHNPWMLLYFISF 1538

Query: 483  YVITVLWLLNLIVAFVLEAF 424
             +I   ++LN+ V  V+E F
Sbjct: 1539 LLIVSFFVLNMFVGVVVENF 1558



>gb:AF051946_1879195 Homo sapiens T-type calcium channel alpha 1H
            subunit (CACNA1H) mRNA, complete cds.
          Length = 2353

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 37/138 (26%), Positives = 62/138 (44%), Gaps = 5/138 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  +  L ++   M  + T FC L       +  LG+ +FG   +        TD  D 
Sbjct: 898  LPALRRQLVVLVKTMDNVAT-FCTLLMLFIFIFSILGMHLFGCKFSLK------TDTGDT 950

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W + + +    T +SW+ +YF++        L NL
Sbjct: 951  VPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMAST-SSWAALYFVALMTFGNYVLFNL 1009

Query: 450  IVAFVLEAFQTEMDMETS 397
            +VA ++E FQ E D   S
Sbjct: 1010 LVAILVEGFQAEGDANRS 1027



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 38/140 (27%), Positives = 58/140 (41%), Gaps = 24/140 (17%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG-MVNAGNPNLDGTDLSDNDYLL---- 619
            TLI SL P +G I  + C     +  LG+Q+F G       P  D  ++S          
Sbjct: 1422 TLISSLRP-IGNIVLICCAFFIIFGILGVQLFKGKFYYCEGP--DTRNISTKAQCRAAHY 1478

Query: 618  ------FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISF 484
                  +NF++    +++LF L     W   M    +  G           W  +YFISF
Sbjct: 1479 RWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGVDQQPVQNHNPWMLLYFISF 1538

Query: 483  YVITVLWLLNLIVAFVLEAF 424
             +I   ++LN+ V  V+E F
Sbjct: 1539 LLIVSFFVLNMFVGVVVENF 1558



>gb:AE006466_1875651 Homo sapiens 16p13.3 sequence section 5 of 8.
          Length = 2373

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 37/138 (26%), Positives = 62/138 (44%), Gaps = 5/138 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  +  L ++   M  + T FC L       +  LG+ +FG   +        TD  D 
Sbjct: 918  LPALRRQLVVLVKTMDNVAT-FCTLLMLFIFIFSILGMHLFGCKFSLK------TDTGDT 970

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W + + +    T +SW+ +YF++        L NL
Sbjct: 971  VPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMAST-SSWAALYFVALMTFGNYVLFNL 1029

Query: 450  IVAFVLEAFQTEMDMETS 397
            +VA ++E FQ E D   S
Sbjct: 1030 LVAILVEGFQAEGDANRS 1047



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 38/140 (27%), Positives = 58/140 (41%), Gaps = 24/140 (17%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG-MVNAGNPNLDGTDLSDNDYLL---- 619
            TLI SL P +G I  + C     +  LG+Q+F G       P  D  ++S          
Sbjct: 1442 TLISSLRP-IGNIVLICCAFFIIFGILGVQLFKGKFYYCEGP--DTRNISTKAQCRAAHY 1498

Query: 618  ------FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISF 484
                  +NF++    +++LF L     W   M    +  G           W  +YFISF
Sbjct: 1499 RWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGVDQQPVQNHNPWMLLYFISF 1558

Query: 483  YVITVLWLLNLIVAFVLEAF 424
             +I   ++LN+ V  V+E F
Sbjct: 1559 LLIVSFFVLNMFVGVVVENF 1578



>sp|O95180|CCAH_HUMAN Voltage-dependent T-type calcium channel
            alpha-1H subunit (Voltage- gated calcium channel alpha
            subunit Cav3.2) (Low-voltage-activated calcium channel
            alpha1 3.2 subunit).
          Length = 2353

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 37/138 (26%), Positives = 62/138 (44%), Gaps = 5/138 (3%)
 Frame = -2

Query: 795  VPL*QHFLTLIPSLMPYLGTIFCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDN 631
            +P  +  L ++   M  + T FC L       +  LG+ +FG   +        TD  D 
Sbjct: 898  LPALRRQLVVLVKTMDNVAT-FCTLLMLFIFIFSILGMHLFGCKFSLK------TDTGDT 950

Query: 630  DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                 NF+     +VT+F +L   +W + + +    T +SW+ +YF++        L NL
Sbjct: 951  VPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMAST-SSWAALYFVALMTFGNYVLFNL 1009

Query: 450  IVAFVLEAFQTEMDMETS 397
            +VA ++E FQ E D   S
Sbjct: 1010 LVAILVEGFQAEGDANRS 1027



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 38/140 (27%), Positives = 58/140 (41%), Gaps = 24/140 (17%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG-MVNAGNPNLDGTDLSDNDYLL---- 619
            TLI SL P +G I  + C     +  LG+Q+F G       P  D  ++S          
Sbjct: 1422 TLISSLRP-IGNIVLICCAFFIIFGILGVQLFKGKFYYCEGP--DTRNISTKAQCRAAHY 1478

Query: 618  ------FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISF 484
                  +NF++    +++LF L     W   M    +  G           W  +YFISF
Sbjct: 1479 RWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGVDQQPVQNHNPWMLLYFISF 1538

Query: 483  YVITVLWLLNLIVAFVLEAF 424
             +I   ++LN+ V  V+E F
Sbjct: 1539 LLIVSFFVLNMFVGVVVENF 1558



>gb:BX548009_2567645 Zebrafish DNA sequence from clone CH211-237K17
           in linkage group 3 Contains the 5' part of a novel gene
           similar to vertebrate CACNA1A (voltage-dependent calcium
           channel, P/Q type, alpha 1A subunit), complete sequence.
          Length = 1938

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 31/121 (25%), Positives = 56/121 (46%), Gaps = 6/121 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVN--AGNPNLDGTDLSDNDYLLFNFNDY 601
           L  + S++  L  +F  +  +  LG+Q+FGG  N  AG P               NF+ +
Sbjct: 592 LNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFEAGTPPT-------------NFDTF 638

Query: 600 PNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLW----LLNLIVAFVL 433
           P  ++T+F +L   +W + M    E  G     + F  F+++  L+    LLN+ +A  +
Sbjct: 639 PAAIMTVFQILTGEDWNMVMYDGIESQGGVKKGMVFSVFFIVLTLFGNYTLLNVFLAIAV 698

Query: 432 E 430
           +
Sbjct: 699 D 699



 Score = 40.8 bits (94), Expect = 0.031
 Identities = 32/125 (25%), Positives = 54/125 (43%), Gaps = 14/125 (11%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +      N D      N     NF  +   ++ LF
Sbjct: 1573 LPYVCLLIAMLFFIYAIIGMQLFGNIKI--EENSDSAITQHN-----NFRTFFQALMLLF 1625

Query: 576  NLLVMGNWQLWMQSY-------------KELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
                   W   M S              K   G+ ++Y+YF+SF  +    +LNL VA +
Sbjct: 1626 RSATGEAWHDIMLSCLGKKPCDILSDNPKPECGSEFAYLYFVSFIFLCSFLMLNLFVAVI 1685

Query: 435  LEAFQ 421
            ++ F+
Sbjct: 1686 MDNFE 1690



 Score = 40.0 bits (92), Expect = 0.053
 Identities = 17/74 (22%), Positives = 39/74 (52%)
 Frame = -2

Query: 630 DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
           +Y +  F++    ++T+F  + M  W   +    +  G++W+++YFI   +I   ++LNL
Sbjct: 286 NYGITQFDNILFAVLTVFQCITMEGWTDLLYYSNDAAGSAWNWMYFIPLIIIGSFFMLNL 345

Query: 450 IVAFVLEAFQTEMD 409
           ++  +   F  E +
Sbjct: 346 VLGVLSGEFAKERE 359



>gb:BX548009_2567644 Zebrafish DNA sequence from clone CH211-237K17
           in linkage group 3 Contains the 5' part of a novel gene
           similar to vertebrate CACNA1A (voltage-dependent calcium
           channel, P/Q type, alpha 1A subunit), complete sequence.
          Length = 1939

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 31/121 (25%), Positives = 56/121 (46%), Gaps = 6/121 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVN--AGNPNLDGTDLSDNDYLLFNFNDY 601
           L  + S++  L  +F  +  +  LG+Q+FGG  N  AG P               NF+ +
Sbjct: 592 LNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFEAGTPPT-------------NFDTF 638

Query: 600 PNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLW----LLNLIVAFVL 433
           P  ++T+F +L   +W + M    E  G     + F  F+++  L+    LLN+ +A  +
Sbjct: 639 PAAIMTVFQILTGEDWNMVMYDGIESQGGVKKGMVFSVFFIVLTLFGNYTLLNVFLAIAV 698

Query: 432 E 430
           +
Sbjct: 699 D 699



 Score = 40.8 bits (94), Expect = 0.031
 Identities = 32/125 (25%), Positives = 54/125 (43%), Gaps = 14/125 (11%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +      N D      N     NF  +   ++ LF
Sbjct: 1573 LPYVCLLIAMLFFIYAIIGMQLFGNIKI--EENSDSAITQHN-----NFRTFFQALMLLF 1625

Query: 576  NLLVMGNWQLWMQSY-------------KELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
                   W   M S              K   G+ ++Y+YF+SF  +    +LNL VA +
Sbjct: 1626 RSATGEAWHDIMLSCLGKKPCDILSDNPKPECGSEFAYLYFVSFIFLCSFLMLNLFVAVI 1685

Query: 435  LEAFQ 421
            ++ F+
Sbjct: 1686 MDNFE 1690



 Score = 40.0 bits (92), Expect = 0.053
 Identities = 17/74 (22%), Positives = 39/74 (52%)
 Frame = -2

Query: 630 DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
           +Y +  F++    ++T+F  + M  W   +    +  G++W+++YFI   +I   ++LNL
Sbjct: 286 NYGITQFDNILFAVLTVFQCITMEGWTDLLYYSNDAAGSAWNWMYFIPLIIIGSFFMLNL 345

Query: 450 IVAFVLEAFQTEMD 409
           ++  +   F  E +
Sbjct: 346 VLGVLSGEFAKERE 359



>gb:AL831748_2504562 Zebrafish DNA sequence from clone DKEY-70P6 in
            linkage group 17 Contains two novel genes, a novel gene
            similar to human and mouse URKL1 (uridine kinase-like 1),
            a novel gene similar to vertebrate SYP (synaptophysin), a
            novel gene similar to vertebrate CACNA1
            (voltage-dependent calcium channel P/Q type alpha 1
            subunit), a novel pseudogene similar to human and mouse
            EMILIN2 (elastin microfibril interfacer 2) and a CpG
            island, complete sequence.
          Length = 1798

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 35/135 (25%), Positives = 64/135 (47%), Gaps = 19/135 (14%)
 Frame = -2

Query: 771  TLIPSL--MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDY 601
            T + SL  +PY+  +  ++ F Y  +G+Q FG +        D T ++ N+    NF  +
Sbjct: 1166 TFVKSLQALPYVALLIAMIFFIYAVIGMQTFGKIAMQ-----DHTQINRNN----NFQTF 1216

Query: 600  PNGMVTLFNLLVMGNWQLWM---------------QSYKELT-GTSWSYVYFISFYVITV 469
            P  ++ LF       WQ  M               +  +E + G++ + VYFISF+++  
Sbjct: 1217 PQAVLLLFRCATGEAWQEIMLASLPGKRCDAESDFEPGEEFSCGSNIAIVYFISFFMLCA 1276

Query: 468  LWLLNLIVAFVLEAF 424
              ++NL VA +++ F
Sbjct: 1277 FLIINLFVAVIMDNF 1291



 Score = 36.6 bits (83), Expect = 0.59
 Identities = 17/69 (24%), Positives = 34/69 (49%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G    +VYF+S  +    ++LNL++  +
Sbjct: 221 NFDNFFFAMLTVFQCITMEGWTDVLYWMNDAIGFELPWVYFVSLVIFGSFFVLNLVLGVL 280

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 281 SGEFSKERE 289



 Score = 35.8 bits (81), Expect = 1.0
 Identities = 19/81 (23%), Positives = 37/81 (45%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVY---------FISFYVITVL 466
            FNF++   GM+ LF +     W   +    +  G +   +Y         FI + +I   
Sbjct: 921  FNFDNVLMGMMALFTVSTFEGWPALLYKAIDANGENHGPIYNYRVEISIFFIVYIIIIAF 980

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            +++N+ V FV+  F+ + + E
Sbjct: 981  FMMNIFVGFVIITFREQGEAE 1001



 Score = 33.9 bits (76), Expect = 3.8
 Identities = 21/78 (26%), Positives = 35/78 (44%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S+   L  +F  L  +  LG+Q+FGG       N D T    +      F+ +P 
Sbjct: 536 LNSMKSIASLLLLLFLFLIIFALLGMQLFGGKF-----NFDETQTKRS-----TFDSFPQ 585

Query: 594 GMVTLFNLLVMGNWQLWM 541
            ++T F +L   +W + M
Sbjct: 586 ALLTCFQILTGEDWNVVM 603



>gb:AF051526_2052504 Rattus norvegicus class A calcium channel
           variant riA-I (BCCA1) mRNA, partial cds.
          Length = 791

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 36/130 (27%), Positives = 56/130 (43%), Gaps = 19/130 (14%)
 Frame = -2

Query: 753 MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDL-SDNDYLLF----NFNDYPNG 592
           +PY+  +  +L F Y  +G+Q+FG      N  +DG D  SD D        NF  +   
Sbjct: 78  LPYVCLLIAMLFFIYAIIGMQVFG------NIGIDGEDEDSDEDEFQITEHNNFRTFFQA 131

Query: 591 MVTLFNLLVMGNWQLWMQS-------------YKELTGTSWSYVYFISFYVITVLWLLNL 451
           ++ LF       W   M S              K   G  ++Y YF+SF  +    +LNL
Sbjct: 132 LMLLFRSATGEAWHNIMLSCLSGKPCDKNSGIQKPECGNEFAYFYFVSFIFLCSFLMLNL 191

Query: 450 IVAFVLEAFQ 421
            VA +++ F+
Sbjct: 192 FVAVIMDNFE 201



>pir|T15838|T15838 hypothetical protein C54D2.5 - Caenorhabditis
            elegans
          Length = 1657

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 37/137 (27%), Positives = 61/137 (44%), Gaps = 23/137 (16%)
 Frame = -2

Query: 765  IPSLMPYLGTIFCVLC----FYCSLGLQIFGGMV------NAGNPNLDGTDLSD--NDYL 622
            IP+L P +G I  + C     +  LG+Q+F GM+        GN       + D  N ++
Sbjct: 1173 IPTLKP-IGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVGNVTTKADCIEDYRNKWV 1231

Query: 621  --LFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYVI 475
               +NF++    +++LF L     W   M    +  G           W  +YFISF ++
Sbjct: 1232 NHRYNFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISFLLL 1291

Query: 474  TVLWLLNLIVAFVLEAF 424
               ++LN+ V  V+E F
Sbjct: 1292 VGFFVLNMFVGVVVENF 1308



 Score = 37.0 bits (84), Expect = 0.45
 Identities = 19/71 (26%), Positives = 36/71 (50%)
 Frame = -2

Query: 615  NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
            NF+     ++T+F +L   +W + + +    T   W+ +YF++        L NL+VA +
Sbjct: 854  NFDTLLWALITVFQILTQEDWNMVLFNGMAQTNP-WAALYFVALMTFGNYVLFNLLVAIL 912

Query: 435  LEAFQTEMDME 403
            +E FQ   + E
Sbjct: 913  VEGFQESKEEE 923



>sp|P54282|CCAA_RAT Voltage-dependent P/Q-type calcium channel
            alpha-1A subunit (Voltage- gated calcium channel alpha
            subunit Cav2.1) (Calcium channel, L type, alpha-1
            polypeptide, isoform 4) (Brain calcium channel I) (BI)
            (RAT brain class A) (RBA-I).>pir|A41098|A41098 calcium
            channel protein alpha-1 chain isoform A -
            rat>gb:RATBCCA1S_2131601 Rat calcium channel alpha-1
            subunit mRNA, complete cds.
          Length = 2212

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 36/130 (27%), Positives = 56/130 (43%), Gaps = 19/130 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDL-SDNDYLLF----NFNDYPNG 592
            +PY+  +  +L F Y  +G+Q+FG      N  +DG D  SD D        NF  +   
Sbjct: 1643 LPYVCLLIAMLFFIYAIIGMQVFG------NIGIDGEDEDSDEDEFQITEHNNFRTFFQA 1696

Query: 591  MVTLFNLLVMGNWQLWMQS-------------YKELTGTSWSYVYFISFYVITVLWLLNL 451
            ++ LF       W   M S              K   G  ++Y YF+SF  +    +LNL
Sbjct: 1697 LMLLFRSATGEAWHNIMLSCLSGKPCDKNSGIQKPECGNEFAYFYFVSFIFLCSFLMLNL 1756

Query: 450  IVAFVLEAFQ 421
             VA +++ F+
Sbjct: 1757 FVAVIMDNFE 1766



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 31/119 (26%), Positives = 57/119 (47%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N      +GT  +       NF+ +P 
Sbjct: 610 LNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFD----EGTPPT-------NFDTFPA 658

Query: 594 GMVTLFNLLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVL---WLLNLIVAFVLE 430
            ++T+F +L   +W ++     K   G     V+ I F V+T+     LLN+ +A  ++
Sbjct: 659 AIMTVFQILTGEDWNEVMYDEIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVD 717



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 16/68 (23%), Positives = 37/68 (54%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  + +G +W+++YFI   +I   ++LNL++  + 
Sbjct: 303 FDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLS 362

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 363 GEFAKERE 370



>gb:AK122452_2069117 Mus musculus mRNA for mKIAA1120 protein.
          Length = 1460

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 5/117 (4%)
 Frame = -2

Query: 732 FCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
           FC+L       +  LG+ +FG   +        TD  D      NF+     +VT+F +L
Sbjct: 16  FCMLLMLFIFIFSILGMHLFGCKFSLK------TDSGDTVPDRKNFDSLLWAIVTVFQIL 69

Query: 567 VMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQTEMDMETS 397
              +W + + +    T +SW+ +YF++        L NL+VA ++E FQ E D   S
Sbjct: 70  TQEDWNVVLYNGMAST-SSWAALYFVALMTFGNYVLFNLLVAILVEGFQAEGDATRS 125



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 38/142 (26%), Positives = 58/142 (40%), Gaps = 26/142 (18%)
 Frame = -2

Query: 771 TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLL----- 619
           TLI SL P +G I  + C     +  LG+Q+F G         +GTD  +          
Sbjct: 534 TLISSLRP-IGNIVLICCAFFIIFGILGVQLFKGKFYY----CEGTDTRNITTKAECHAA 588

Query: 618 --------FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFI 490
                   +NF++    +++LF L     W   M    +  G           W  +YFI
Sbjct: 589 HYRWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGIDQQPVQNHNPWMLLYFI 648

Query: 489 SFYVITVLWLLNLIVAFVLEAF 424
           SF +I   ++LN+ V  V+E F
Sbjct: 649 SFLLIVSFFVLNMFVGVVVENF 670



>gb:AF055477_2052652 Rattus norvegicus pore-forming calcium channel
            alpha-1B subunit variant a mRNA, complete cds;
            alternatively spliced.
          Length = 2333

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 31/123 (25%), Positives = 58/123 (47%), Gaps = 12/123 (9%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        DGT ++ ++    NF  +   ++ LF
Sbjct: 1596 LPYVCLLIAMLFFIYAIIGMQVFGNIALD-----DGTSINRHN----NFRTFLQALMLLF 1646

Query: 576  N-----------LLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
                        L  +GN      +     G+ ++Y YF+SF  +    +LNL VA +++
Sbjct: 1647 RSATGEAWHEIMLSCLGNRACDPHANASECGSDFAYFYFVSFIFLCSFLMLNLFVAVIMD 1706

Query: 429  AFQ 421
             F+
Sbjct: 1707 NFE 1709



 Score = 41.2 bits (95), Expect = 0.024
 Identities = 17/69 (24%), Positives = 37/69 (53%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF++    ++T+F  + M  W   + +  +  G +W+++YFI   +I   ++LNL++  +
Sbjct: 296 NFDNILFAILTVFQCITMEGWTDILYNTNDAAGNTWNWLYFIPLIIIGSFFMLNLVLGVL 355

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 356 SGEFAKERE 364



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 33/138 (23%), Positives = 61/138 (44%), Gaps = 11/138 (7%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N             ++    NF+ +P 
Sbjct: 603 LNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFN-----------FQDETPTTNFDTFPA 651

Query: 594 GMVTLFNLLVMGNWQLWM----QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL-- 433
            ++T+F +L   +W   M    +S   ++   +S  YFI   +     LLN+ +A  +  
Sbjct: 652 AILTVFQILTGEDWNAVMYHGIESQGGVSKGMFSSFYFIVLTLFGNYTLLNVFLAIAVDN 711

Query: 432 -----EAFQTEMDMETSA 394
                E  + E +ME +A
Sbjct: 712 LANAQELTKDEEEMEEAA 729



>gb:AB031389_2044747 Mus musculus mRNA for voltage-gated sodium
            channel alpha subunit NaT/Scn11a, complete cds.
          Length = 1765

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 31/128 (24%), Positives = 55/128 (42%), Gaps = 12/128 (9%)
 Frame = -2

Query: 765  IPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMV 586
            +PSL      +F V+  Y   G+  F  +         G+ + D    +FNF+ +   M+
Sbjct: 1473 LPSLFNIGLLLFLVMFIYAIFGMSWFSKVKR-------GSGIDD----IFNFDTFSGSML 1521

Query: 585  TLFNLLVMGNWQLWMQSYKELTGTSWS------------YVYFISFYVITVLWLLNLIVA 442
             LF +     W   +    E   +  S             VYF+S+ +I++L ++N+ +A
Sbjct: 1522 CLFQITTSAGWDALLNPMLESKASCNSSSQESCQQPQIAIVYFVSYIIISLLIVVNMYIA 1581

Query: 441  FVLEAFQT 418
             +LE F T
Sbjct: 1582 VILENFNT 1589



 Score = 36.2 bits (82), Expect = 0.77
 Identities = 19/76 (25%), Positives = 41/76 (53%), Gaps = 4/76 (5%)
 Frame = -2

Query: 630 DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITV----LW 463
           DY   NF+ +    + +F ++   +W+   + Y+++  TS   +YF+ F+V+ +     +
Sbjct: 334 DYNYTNFDSFGWSFLAMFRVMTQDSWE---KLYRQILRTSG--IYFVFFFVVVIFLGSFY 388

Query: 462 LLNLIVAFVLEAFQTE 415
           LLNL +A V   ++ +
Sbjct: 389 LLNLTLAVVTMGYEEQ 404



 Score = 35.4 bits (80), Expect = 1.3
 Identities = 29/145 (20%), Positives = 58/145 (40%), Gaps = 25/145 (17%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMV-------------NAGN-PNLDGTDLS 637
            ++ IP+++  L         +C LG+  F G               NA N PN     +S
Sbjct: 1151 MSAIPAILNVLLVCLIFWLIFCILGVNFFSGKFGRCINGTDINKYFNASNVPNQSQCLVS 1210

Query: 636  DNDYLL--FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFI 490
            ++ + +   NF++  N  + L  +     W   M +  +  G           ++Y+YF+
Sbjct: 1211 NHTWKVPNVNFDNVGNAYLALLQVATYKGWLDIMNAAVDSRGKDEQPAFEANLYAYLYFV 1270

Query: 489  SFYVITVLWLLNLIVAFVLEAFQTE 415
             F +    + LNL +  +++ F  +
Sbjct: 1271 VFIIFGSFFTLNLFIGVIIDNFNQQ 1295



>gb:AF244126_1416673 Bos taurus calcium channel subunit alpha 1E
           mRNA, partial cds.
          Length = 168

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 33/130 (25%), Positives = 55/130 (42%), Gaps = 19/130 (14%)
 Frame = -2

Query: 753 MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
           +PY+  +  +L F Y  +G+Q+FG +      +++  +         NF  +   ++ LF
Sbjct: 12  LPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHN---------NFRSFFGSLMLLF 62

Query: 576 NLLVMGNWQLWM------------------QSYKELTGTSWSYVYFISFYVITVLWLLNL 451
                  WQ  M                  QS  E  GT  +YVYF+SF       +LNL
Sbjct: 63  RSATGEAWQEIMLSCLGEKGCEPDTTAPSGQSESERCGTDLAYVYFVSFIFFCSFLMLNL 122

Query: 450 IVAFVLEAFQ 421
            VA +++ F+
Sbjct: 123 FVAVIMDNFE 132



>gb:U61951_1405503 Caenorhabditis elegans cosmid C48A7, complete
            sequence.
          Length = 1877

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 33/132 (25%), Positives = 58/132 (43%), Gaps = 22/132 (16%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q FG +        D T +  N+    NF+ +P  ++ LF
Sbjct: 1246 LPYVALLIVLLFFIYAVIGMQFFGKVALD-----DSTSIHRNN----NFHSFPAAILVLF 1296

Query: 576  NLLVMGNWQLWMQSYKELT---------------------GTSWSYVYFISFYVITVLWL 460
                   WQ  M S  +                       G +++Y YFISF+++    +
Sbjct: 1297 RSATGEAWQDIMLSCSDREDVRCDPMSDDYHKGGLNESRCGNNFAYPYFISFFMLCSFLV 1356

Query: 459  LNLIVAFVLEAF 424
            +NL VA +++ F
Sbjct: 1357 INLFVAVIMDNF 1368



 Score = 41.2 bits (95), Expect = 0.024
 Identities = 16/69 (23%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + +  W   M    +  G  W ++YF++  ++   ++LNL++  +
Sbjct: 308 NFDNFGLAMLTVFQCVSLEGWTDVMYWVNDAVGREWPWIYFVTLVILGSFFVLNLVLGVL 367

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 368 SGEFSKERE 376



 Score = 37.7 bits (86), Expect = 0.26
 Identities = 24/88 (27%), Positives = 46/88 (52%), Gaps = 9/88 (10%)
 Frame = -2

Query: 639  SDNDYLLFNFNDYPNGMVTLFNLLVMGNWQ----LWMQSYKELTGTSWSY-----VYFIS 487
            S+ND   FNF++  + M++LF +     W     + + S +E  G   +      ++FI+
Sbjct: 990  SNND---FNFDNVGDAMISLFVVSTFEGWPQLLYVAIDSNEEDKGPIHNSRQAVALFFIA 1046

Query: 486  FYVITVLWLLNLIVAFVLEAFQTEMDME 403
            F ++   +++N+ V FV+  FQ E + E
Sbjct: 1047 FIIVIAFFMMNIFVGFVIVTFQNEGERE 1074



 Score = 35.4 bits (80), Expect = 1.3
 Identities = 28/120 (23%), Positives = 52/120 (43%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N  NP               NF+ +  
Sbjct: 594 LNSLRSIISLLLLLFLFIVIFALLGMQVFGGKFNF-NPQQPKPRA--------NFDTFVQ 644

Query: 594 GMVTLFNLLVMGNWQLWMQSYKELTGTSWSY-----VYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M    E  G   +      +Y+I  ++     LLN+ +A  ++
Sbjct: 645 ALLTVFQILTGEDWNTVMYHGIESFGGVGTLGVIVCIYYIVLFICGNYILLNVFLAIAVD 704



>gb:D86600_1376364 Loligo bleekeri mRNA for voltage-dependent
           calcium channel, complete cds.
          Length = 2196

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 31/137 (22%), Positives = 65/137 (47%), Gaps = 5/137 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L+ + S++  L  +F  +  +  LG+Q+FGGM+N       G           +F+ +P 
Sbjct: 602 LSSMRSIVSLLFLLFLFILIFALLGMQLFGGMMNFEEGRPPG-----------HFDTFPI 650

Query: 594 GMVTLFNLLVMGNWQLWMQS-YKELTGTSWSYVYFISFYVITVLW----LLNLIVAFVLE 430
            ++T+F +L   +W   M S  +   G +   + + S+++I VL+    LLN+ +A  ++
Sbjct: 651 ALLTVFQILTGEDWNEVMYSGIRARGGIAGGGMLYCSYFIILVLFGNYTLLNVFLAIAVD 710

Query: 429 AFQTEMDMETSAICVDG 379
                 ++  +    +G
Sbjct: 711 NLANAQELTAAEEIQEG 727



 Score = 40.0 bits (92), Expect = 0.053
 Identities = 32/125 (25%), Positives = 56/125 (44%), Gaps = 15/125 (12%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDG-TDLSDNDYLLFNFNDYPNGMVTL 580
            +PY+  +  +L F Y  +G+Q+FG      N  LD  T ++ ++    NF  +   ++ L
Sbjct: 1346 LPYVCLLIAMLFFIYAIIGMQVFG------NIRLDSKTSINRHN----NFRSFFYAVLLL 1395

Query: 579  FNLLVMGNWQLWMQS-------------YKELTGTSWSYVYFISFYVITVLWLLNLIVAF 439
            F      +WQ  M S                  G   +Y+YF++F  +    +LNL VA 
Sbjct: 1396 FRCATGESWQQIMLSCLSGRPCDPESKMLDNSCGLDIAYIYFVTFIFLCSFLMLNLFVAV 1455

Query: 438  VLEAF 424
            +++ F
Sbjct: 1456 IMDNF 1460



 Score = 37.7 bits (86), Expect = 0.26
 Identities = 16/74 (21%), Positives = 39/74 (52%)
 Frame = -2

Query: 630 DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
           +Y + +F++    M+T+F  + M  W   +    +  G +++++YF+   V+   ++LNL
Sbjct: 272 NYGITSFDNMGFAMLTVFQCVTMEGWTQVLYYTDDAVGDAYNWIYFVPLIVLGSFFMLNL 331

Query: 450 IVAFVLEAFQTEMD 409
           ++  +   F  E +
Sbjct: 332 VLGVLSGEFAKERE 345



 Score = 32.7 bits (73), Expect = 8.5
 Identities = 17/81 (20%), Positives = 41/81 (50%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELT----GTSWSY-----VYFISFYVITVL 466
            F++++    M+TLF +     W + +++  + T    G    Y     +Y++ F+++   
Sbjct: 1093 FHYDNVMFAMLTLFTVTTGEGWPMVLKNSMDSTSDDMGPKPGYRMEMAIYYVVFFIVFPF 1152

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            + +N+ VA ++  FQ + + E
Sbjct: 1153 FFVNIFVALIIITFQEQGENE 1173



>gb:AF484084_1275758 Lymnaea stagnalis voltage-dependent T-type
            calcium channel alpha-1 subunit mRNA, partial cds,
            alternatively spliced.
          Length = 1942

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 39/139 (28%), Positives = 63/139 (45%), Gaps = 23/139 (16%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG-MVNAGNPN-LDGTDLSD------ND 628
            TL+ SL P +G I  + C     +  LG+Q+F G   +   PN L  T+ S       N 
Sbjct: 715  TLLSSLRP-IGNIVLICCTFFIIFGILGVQLFKGTFYHCKGPNILQITNRSQCEADKKNS 773

Query: 627  YL--LFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTG---------TSWSYVYFISFY 481
            ++   +NF++    ++ LF L     W   M +  +  G           W  +YFISF 
Sbjct: 774  WINQKYNFDNLGQALMALFVLASKDGWVQIMYTGLDAVGIDQQPIENYNEWRLIYFISFL 833

Query: 480  VITVLWLLNLIVAFVLEAF 424
            ++   ++LN+ V  V+E F
Sbjct: 834  LLVAFFVLNMFVGVVVENF 852



 Score = 40.8 bits (94), Expect = 0.031
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 1/68 (1%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS-WSYVYFISFYVITVLWLLNLIVAF 439
           NF+     ++T+F +L   +W   +  Y  +T TS W+ +YF++        L NL+VA 
Sbjct: 122 NFDSLLWALITVFQVLTQEDWNTVL--YNGMTKTSNWASLYFVALMTFGNYVLFNLLVAI 179

Query: 438 VLEAFQTE 415
           ++E F TE
Sbjct: 180 LVEGFSTE 187



>pir|A45386|A45386 omega-conotoxin-sensitive calcium channel alpha-1
            subunit rbB-I - rat
          Length = 2336

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 31/123 (25%), Positives = 58/123 (47%), Gaps = 12/123 (9%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        DGT ++ ++    NF  +   ++ LF
Sbjct: 1599 LPYVCLLIAMLFFIYAIIGMQVFGNIALD-----DGTSINRHN----NFRTFLQALMLLF 1649

Query: 576  N-----------LLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
                        L  +GN      +     G+ ++Y YF+SF  +    +LNL VA +++
Sbjct: 1650 RSATGEAWHEIMLSCLGNRACDPHANASECGSDFAYFYFVSFIFLCSFLMLNLFVAVIMD 1709

Query: 429  AFQ 421
             F+
Sbjct: 1710 NFE 1712



 Score = 41.2 bits (95), Expect = 0.024
 Identities = 17/69 (24%), Positives = 37/69 (53%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF++    ++T+F  + M  W   + +  +  G +W+++YFI   +I   ++LNL++  +
Sbjct: 296 NFDNILFAILTVFQCITMEGWTDILYNTNDAAGNTWNWLYFIPLIIIGSFFMLNLVLGVL 355

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 356 SGEFAKERE 364



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 33/138 (23%), Positives = 61/138 (44%), Gaps = 11/138 (7%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N             ++    NF+ +P 
Sbjct: 604 LNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFN-----------FQDETPTTNFDTFPA 652

Query: 594 GMVTLFNLLVMGNWQLWM----QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL-- 433
            ++T+F +L   +W   M    +S   ++   +S  YFI   +     LLN+ +A  +  
Sbjct: 653 AILTVFQILTGEDWNAVMYHGIESQGGVSKGMFSSFYFIVLTLFGNYTLLNVFLAIAVDN 712

Query: 432 -----EAFQTEMDMETSA 394
                E  + E +ME +A
Sbjct: 713 LANAQELTKDEEEMEEAA 730



>pir|C88728|C88728 protein C48A7.1 [imported] - Caenorhabditis elegans
          Length = 1917

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 33/132 (25%), Positives = 58/132 (43%), Gaps = 22/132 (16%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q FG +        D T +  N+    NF+ +P  ++ LF
Sbjct: 1275 LPYVALLIVLLFFIYAVIGMQFFGKVALD-----DSTSIHRNN----NFHSFPAAILVLF 1325

Query: 576  NLLVMGNWQLWMQSYKELT---------------------GTSWSYVYFISFYVITVLWL 460
                   WQ  M S  +                       G +++Y YFISF+++    +
Sbjct: 1326 RSATGEAWQDIMLSCSDREDVRCDPMSDDYHKGGLNESRCGNNFAYPYFISFFMLCSFLV 1385

Query: 459  LNLIVAFVLEAF 424
            +NL VA +++ F
Sbjct: 1386 INLFVAVIMDNF 1397



 Score = 41.2 bits (95), Expect = 0.024
 Identities = 16/69 (23%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + +  W   M    +  G  W ++YF++  ++   ++LNL++  +
Sbjct: 337 NFDNFGLAMLTVFQCVSLEGWTDVMYWVNDAVGREWPWIYFVTLVILGSFFVLNLVLGVL 396

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 397 SGEFSKERE 405



 Score = 37.7 bits (86), Expect = 0.26
 Identities = 24/88 (27%), Positives = 46/88 (52%), Gaps = 9/88 (10%)
 Frame = -2

Query: 639  SDNDYLLFNFNDYPNGMVTLFNLLVMGNWQ----LWMQSYKELTGTSWSY-----VYFIS 487
            S+ND   FNF++  + M++LF +     W     + + S +E  G   +      ++FI+
Sbjct: 1019 SNND---FNFDNVGDAMISLFVVSTFEGWPQLLYVAIDSNEEDKGPIHNSRQAVALFFIA 1075

Query: 486  FYVITVLWLLNLIVAFVLEAFQTEMDME 403
            F ++   +++N+ V FV+  FQ E + E
Sbjct: 1076 FIIVIAFFMMNIFVGFVIVTFQNEGERE 1103



 Score = 35.4 bits (80), Expect = 1.3
 Identities = 28/120 (23%), Positives = 52/120 (43%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N  NP               NF+ +  
Sbjct: 623 LNSLRSIISLLLLLFLFIVIFALLGMQVFGGKFNF-NPQQPKPRA--------NFDTFVQ 673

Query: 594 GMVTLFNLLVMGNWQLWMQSYKELTGTSWSY-----VYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M    E  G   +      +Y+I  ++     LLN+ +A  ++
Sbjct: 674 ALLTVFQILTGEDWNTVMYHGIESFGGVGTLGVIVCIYYIVLFICGNYILLNVFLAIAVD 733



>pir|T37258|T37258 probable voltage-dependent calcium channel complex
            alpha-1 chain, L-type - Caenorhabditis
            elegans>gb:AF023602_1233760 Caenorhabditis elegans
            putative L-type calcium channel alpha 1 subunit (egl-19)
            mRNA, complete cds.>gb:U61951_1405504 Caenorhabditis
            elegans cosmid C48A7, complete sequence.
          Length = 1783

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 33/132 (25%), Positives = 58/132 (43%), Gaps = 22/132 (16%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q FG +        D T +  N+    NF+ +P  ++ LF
Sbjct: 1246 LPYVALLIVLLFFIYAVIGMQFFGKVALD-----DSTSIHRNN----NFHSFPAAILVLF 1296

Query: 576  NLLVMGNWQLWMQSYKELT---------------------GTSWSYVYFISFYVITVLWL 460
                   WQ  M S  +                       G +++Y YFISF+++    +
Sbjct: 1297 RSATGEAWQDIMLSCSDREDVRCDPMSDDYHKGGLNESRCGNNFAYPYFISFFMLCSFLV 1356

Query: 459  LNLIVAFVLEAF 424
            +NL VA +++ F
Sbjct: 1357 INLFVAVIMDNF 1368



 Score = 41.2 bits (95), Expect = 0.024
 Identities = 16/69 (23%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + +  W   M    +  G  W ++YF++  ++   ++LNL++  +
Sbjct: 308 NFDNFGLAMLTVFQCVSLEGWTDVMYWVNDAVGREWPWIYFVTLVILGSFFVLNLVLGVL 367

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 368 SGEFSKERE 376



 Score = 37.7 bits (86), Expect = 0.26
 Identities = 24/88 (27%), Positives = 46/88 (52%), Gaps = 9/88 (10%)
 Frame = -2

Query: 639  SDNDYLLFNFNDYPNGMVTLFNLLVMGNWQ----LWMQSYKELTGTSWSY-----VYFIS 487
            S+ND   FNF++  + M++LF +     W     + + S +E  G   +      ++FI+
Sbjct: 990  SNND---FNFDNVGDAMISLFVVSTFEGWPQLLYVAIDSNEEDKGPIHNSRQAVALFFIA 1046

Query: 486  FYVITVLWLLNLIVAFVLEAFQTEMDME 403
            F ++   +++N+ V FV+  FQ E + E
Sbjct: 1047 FIIVIAFFMMNIFVGFVIVTFQNEGERE 1074



 Score = 35.4 bits (80), Expect = 1.3
 Identities = 28/120 (23%), Positives = 52/120 (43%), Gaps = 5/120 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N  NP               NF+ +  
Sbjct: 594 LNSLRSIISLLLLLFLFIVIFALLGMQVFGGKFNF-NPQQPKPRA--------NFDTFVQ 644

Query: 594 GMVTLFNLLVMGNWQLWMQSYKELTGTSWSY-----VYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M    E  G   +      +Y+I  ++     LLN+ +A  ++
Sbjct: 645 ALLTVFQILTGEDWNTVMYHGIESFGGVGTLGVIVCIYYIVLFICGNYILLNVFLAIAVD 704



>sp|Q9EQ60|CCAH_RAT Voltage-dependent T-type calcium channel alpha-1H
            subunit (Voltage- gated calcium channel alpha subunit
            Cav3.2).>gb:AF290213_2061701 Rattus norvegicus calcium
            channel alpha-1-H subunit mRNA, complete cds.
          Length = 2359

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 5/117 (4%)
 Frame = -2

Query: 732  FCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            FC+L       +  LG+ +FG   +        TD  D      NF+     +VT+F +L
Sbjct: 915  FCMLLMLFIFIFSILGMHLFGCKFSLK------TDSGDTVPDRKNFDSLLWAIVTVFQIL 968

Query: 567  VMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQTEMDMETS 397
               +W + + +    T +SW+ +YF++        L NL+VA ++E FQ E D   S
Sbjct: 969  TQEDWNVVLYNGMAST-SSWAALYFVALMTFGNYVLFNLLVAILVEGFQAEGDATRS 1024



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 38/142 (26%), Positives = 58/142 (40%), Gaps = 26/142 (18%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLL----- 619
            TLI SL P +G I  + C     +  LG+Q+F G         +GTD  +          
Sbjct: 1433 TLISSLRP-IGNIVLICCAFFIIFGILGVQLFKGKFYY----CEGTDTRNITTKAECHAA 1487

Query: 618  --------FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFI 490
                    +NF++    +++LF L     W   M    +  G           W  +YFI
Sbjct: 1488 HYRWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGIDQQPVQNHNPWMLLYFI 1547

Query: 489  SFYVITVLWLLNLIVAFVLEAF 424
            SF +I   ++LN+ V  V+E F
Sbjct: 1548 SFLLIVSFFVLNMFVGVVVENF 1569



>sp|O88427|CCAH_MOUSE Voltage-dependent T-type calcium channel
            alpha-1H subunit (Voltage- gated calcium channel alpha
            subunit Cav3.2).>gb:AY026385S2_2073990 Mus musculus
            low-voltage-activated calcium channel alpha13.2 subunit
            (Cacna1h) gene, exons 3 through 36 and complete cds;
            tryptase gamma 1 (Tpsg1) gene, exon 5 and partial cds.
          Length = 2365

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 5/117 (4%)
 Frame = -2

Query: 732  FCVLCF-----YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            FC+L       +  LG+ +FG   +        TD  D      NF+     +VT+F +L
Sbjct: 915  FCMLLMLFIFIFSILGMHLFGCKFSLK------TDSGDTVPDRKNFDSLLWAIVTVFQIL 968

Query: 567  VMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEAFQTEMDMETS 397
               +W + + +    T +SW+ +YF++        L NL+VA ++E FQ E D   S
Sbjct: 969  TQEDWNVVLYNGMAST-SSWAALYFVALMTFGNYVLFNLLVAILVEGFQAEGDATRS 1024



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 38/142 (26%), Positives = 58/142 (40%), Gaps = 26/142 (18%)
 Frame = -2

Query: 771  TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLL----- 619
            TLI SL P +G I  + C     +  LG+Q+F G         +GTD  +          
Sbjct: 1433 TLISSLRP-IGNIVLICCAFFIIFGILGVQLFKGKFYY----CEGTDTRNITTKAECHAA 1487

Query: 618  --------FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFI 490
                    +NF++    +++LF L     W   M    +  G           W  +YFI
Sbjct: 1488 HYRWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGIDQQPVQNHNPWMLLYFI 1547

Query: 489  SFYVITVLWLLNLIVAFVLEAF 424
            SF +I   ++LN+ V  V+E F
Sbjct: 1548 SFLLIVSFFVLNMFVGVVVENF 1569



>sp|Q02294|CCAB_RAT Voltage-dependent N-type calcium channel alpha-1B
            subunit (Voltage- gated calcium channel alpha subunit
            Cav2.2) (Calcium channel, L type, alpha-1 polypeptide
            isoform 5) (Brain calcium channel III)
            (BIII).>gb:RATRBBI_2133664 Rat calcium channel alpha-1
            subunit (rbB-I) mRNA, complete cds.
          Length = 2336

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 31/123 (25%), Positives = 58/123 (47%), Gaps = 12/123 (9%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        DGT ++ ++    NF  +   ++ LF
Sbjct: 1599 LPYVCLLIAMLFFIYAIIGMQVFGNIALD-----DGTSINRHN----NFRTFLQALMLLF 1649

Query: 576  N-----------LLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
                        L  +GN      +     G+ ++Y YF+SF  +    +LNL VA +++
Sbjct: 1650 RSATGEAWHEIMLSCLGNRACDPHANASECGSDFAYFYFVSFIFLCSFLMLNLFVAVIMD 1709

Query: 429  AFQ 421
             F+
Sbjct: 1710 NFE 1712



 Score = 41.2 bits (95), Expect = 0.024
 Identities = 17/69 (24%), Positives = 37/69 (53%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF++    ++T+F  + M  W   + +  +  G +W+++YFI   +I   ++LNL++  +
Sbjct: 296 NFDNILFAILTVFQCITMEGWTDILYNTNDAAGNTWNWLYFIPLIIIGSFFMLNLVLGVL 355

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 356 SGEFAKERE 364



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 33/138 (23%), Positives = 61/138 (44%), Gaps = 11/138 (7%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N             ++    NF+ +P 
Sbjct: 604 LNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFN-----------FQDETPTTNFDTFPA 652

Query: 594 GMVTLFNLLVMGNWQLWM----QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL-- 433
            ++T+F +L   +W   M    +S   ++   +S  YFI   +     LLN+ +A  +  
Sbjct: 653 AILTVFQILTGEDWNAVMYHGIESQGGVSKGMFSSFYFIVLTLFGNYTLLNVFLAIAVDN 712

Query: 432 -----EAFQTEMDMETSA 394
                E  + E +ME +A
Sbjct: 713 LANAQELTKDEEEMEEAA 730



>gb:AF361883_1265569 Schistosoma mansoni high voltage-activated
            calcium channel Cav2A mRNA, complete cds.
          Length = 2203

 Score = 43.9 bits (102), Expect = 0.004
 Identities = 34/121 (28%), Positives = 55/121 (45%), Gaps = 11/121 (9%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+QIFG +        +G   S N     NF+ +P  ++ LF
Sbjct: 1319 LPYVCLLITMLFFIYAVVGMQIFGTIATN---EAEGQITSYN-----NFHSFPYAVLLLF 1370

Query: 576  NLLVMGNWQLWMQSY----------KELTGTSWSYVYFISFYVITVLWLLNLIVAFVLEA 427
                  +WQ  M +               G++ SY YF+SF       +LNL VA +++ 
Sbjct: 1371 RCATGESWQEIMLACTYGQECVNRASNNCGSNASYTYFVSFNFFCSFLMLNLFVAVIVDN 1430

Query: 426  F 424
            F
Sbjct: 1431 F 1431



 Score = 37.4 bits (85), Expect = 0.34
 Identities = 29/122 (23%), Positives = 54/122 (44%), Gaps = 7/122 (5%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVN--AGNPNLDGTDLSDNDYLLFNFNDY 601
           L  + S++  L  +F  +  +  LG+Q+FGG  N   G P               NF+ +
Sbjct: 603 LNAMRSILSLLFLLFLFMLIFALLGMQLFGGEFNFDDGKPGQ-------------NFDTF 649

Query: 600 PNGMVTLFNLLVMGNWQLWMQSYKELTG--TSWSYVYFISFYVITVL---WLLNLIVAFV 436
              ++T+F +L   +W + M       G   +  +VY I F ++ +     LLN+ +A  
Sbjct: 650 VKALLTVFQILTGEDWNMIMYDGIRSQGGVNNGGFVYCIYFVLLALFGNYTLLNVFLAIA 709

Query: 435 LE 430
           ++
Sbjct: 710 VD 711



 Score = 37.4 bits (85), Expect = 0.34
 Identities = 18/74 (24%), Positives = 37/74 (50%)
 Frame = -2

Query: 630 DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
           +Y + +F++    M+T+F  + M  W   +       G+ ++++YFI   VI    L+NL
Sbjct: 295 NYGITSFDNIGYAMLTVFQCITMEGWTDVLYMTNRTYGSRFNWIYFIPLIVIGAFLLINL 354

Query: 450 IVAFVLEAFQTEMD 409
           ++  +   F  E +
Sbjct: 355 VLGVLSGEFAKERE 368



>pir|JC5280|JC5280 voltage-dependent calcium channel alpha 1 chain -
           Bleeker's squid
          Length = 2206

 Score = 43.9 bits (102), Expect = 0.004
 Identities = 32/137 (23%), Positives = 63/137 (45%), Gaps = 5/137 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L+ + S++  L  +F  +  +  LG+Q+FGGM+N       G           +F+ +P 
Sbjct: 612 LSSMRSIVSLLFLLFLFILIFALLGMQLFGGMMNFEEGRPPG-----------HFDTFPI 660

Query: 594 GMVTLFNLLVMGNWQLWMQSYKELTGTS-WSYVYFISFYVITVLW----LLNLIVAFVLE 430
            ++T+F +L   +W   M S     G S     Y + +++I VL+    LLN+ +A  ++
Sbjct: 661 ALLTVFQILTGEDWNEVMYSGIRARGASPEEGCYTVHYFIILVLFGNYTLLNVFLAIAVD 720

Query: 429 AFQTEMDMETSAICVDG 379
                 ++  +    +G
Sbjct: 721 NLANAQELTAAEEIQEG 737



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 31/125 (24%), Positives = 55/125 (44%), Gaps = 15/125 (12%)
 Frame = -2

Query: 753  MPYLGTIFCVL-CFYCSLGLQIFGGMVNAGNPNLDG-TDLSDNDYLLFNFNDYPNGMVTL 580
            +PY+  +  +L   Y  +G+Q+FG      N  LD  T ++ ++    NF  +   ++ L
Sbjct: 1356 LPYVCLLIAMLFLIYAIIGMQVFG------NIRLDSKTSINRHN----NFRSFFYAVLLL 1405

Query: 579  FNLLVMGNWQLWMQS-------------YKELTGTSWSYVYFISFYVITVLWLLNLIVAF 439
            F      +WQ  M S                  G   +Y+YF++F  +    +LNL VA 
Sbjct: 1406 FRCATGESWQQIMLSCLSGRPCDPESKMLDNSCGLDIAYIYFVTFIFLCSFLMLNLFVAV 1465

Query: 438  VLEAF 424
            +++ F
Sbjct: 1466 IMDNF 1470



 Score = 37.7 bits (86), Expect = 0.26
 Identities = 16/74 (21%), Positives = 39/74 (52%)
 Frame = -2

Query: 630 DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
           +Y + +F++    M+T+F  + M  W   +    +  G +++++YF+   V+   ++LNL
Sbjct: 282 NYGITSFDNMGFAMLTVFQCVTMEGWTQVLYYTDDAVGDAYNWIYFVPLIVLGSFFMLNL 341

Query: 450 IVAFVLEAFQTEMD 409
           ++  +   F  E +
Sbjct: 342 VLGVLSGEFAKERE 355



 Score = 32.7 bits (73), Expect = 8.5
 Identities = 17/81 (20%), Positives = 41/81 (50%), Gaps = 9/81 (11%)
 Frame = -2

Query: 618  FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELT----GTSWSY-----VYFISFYVITVL 466
            F++++    M+TLF +     W + +++  + T    G    Y     +Y++ F+++   
Sbjct: 1103 FHYDNVMFAMLTLFTVTTGEGWPMVLKNSMDSTSDDMGPKPGYRMEMAIYYVVFFIVFPF 1162

Query: 465  WLLNLIVAFVLEAFQTEMDME 403
            + +N+ VA ++  FQ + + E
Sbjct: 1163 FFVNIFVALIIITFQEQGENE 1183



>gb:AF422930S1_2065458 Rattus norvegicus voltage-gated calcium
           channel alpha-1D subunit mRNA, I-II loop region, partial
           cds.
          Length = 263

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 18/69 (26%), Positives = 36/69 (52%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+++   M+T+F  + M  W   +    +  G  W +VYF+S  ++   ++LNL++  +
Sbjct: 31  NFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGWEWPWVYFVSLIILGSFFVLNLVLGVL 90

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 91  SGEFSKERE 99



>gb:AF118044_2055114 Mus musculus voltage-gated sodium channel NaN
            (Scn11a) mRNA, complete cds.
          Length = 1765

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 31/128 (24%), Positives = 54/128 (42%), Gaps = 12/128 (9%)
 Frame = -2

Query: 765  IPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMV 586
            +PSL      +F V+  Y   G+  F  +         G+ + D    +FNF+ +   M+
Sbjct: 1473 LPSLFNIGLLLFLVMFIYAIFGMNWFSKVKR-------GSGIDD----IFNFDTFSGSML 1521

Query: 585  TLFNLLVMGNWQLWMQSYKELTGTSWS------------YVYFISFYVITVLWLLNLIVA 442
             LF +     W   +    E   +  S             VYF+S+ +I+ L ++N+ +A
Sbjct: 1522 CLFQITTSAGWDALLNPMLESKASCNSSSQESCQQPQIAIVYFVSYIIISFLIVVNMYIA 1581

Query: 441  FVLEAFQT 418
             +LE F T
Sbjct: 1582 VILENFNT 1589



 Score = 37.7 bits (86), Expect = 0.26
 Identities = 20/76 (26%), Positives = 42/76 (55%), Gaps = 4/76 (5%)
 Frame = -2

Query: 630 DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITV----LW 463
           DY   NF+ +    + +F ++   +W+   + Y+++  TS   +YF+ F+V+ +     +
Sbjct: 334 DYNYTNFDSFGWSFLAMFRVMTQDSWE---KLYRQILRTSG--IYFVFFFVVVIFLGSFY 388

Query: 462 LLNLIVAFVLEAFQTE 415
           LLNL +A V  A++ +
Sbjct: 389 LLNLTLAVVTMAYEEQ 404



 Score = 34.3 bits (77), Expect = 2.9
 Identities = 29/145 (20%), Positives = 57/145 (39%), Gaps = 25/145 (17%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMV-------------NAGN-PNLDGTDLS 637
            ++ IP+++  L         +C LG+  F G               NA N PN     +S
Sbjct: 1151 MSAIPAILNVLLVCLIFWLIFCILGVNFFSGKFGRCINGTDINKYFNASNVPNQSQCLVS 1210

Query: 636  DNDYLL--FNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFI 490
            +  + +   NF++  N  + L  +     W   M +  +  G           ++Y+YF+
Sbjct: 1211 NYTWKVPNVNFDNVGNAYLALLQVATYKGWLDIMNAAVDSRGKDEQPAFEANLYAYLYFV 1270

Query: 489  SFYVITVLWLLNLIVAFVLEAFQTE 415
             F +    + LNL +  +++ F  +
Sbjct: 1271 VFIIFGSFFTLNLFIGVIIDNFNQQ 1295



>gb:AX546806_1470183 Sequence 7 from Patent WO02063000.
          Length = 166

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 32/109 (29%), Positives = 51/109 (46%), Gaps = 17/109 (15%)
 Frame = -2

Query: 753 MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
           +PY+  +  +L F Y  +G+Q+FG +       +DGT ++ N+    NF  +P  ++ LF
Sbjct: 67  LPYVALLIVMLFFIYAVIGMQMFGKIAM-----VDGTQINRNN----NFQTFPQAVLLLF 117

Query: 576 NLLVMGNWQ--LWMQSYKELT--------------GTSWSYVYFISFYV 478
                  WQ  L    Y +L               GT ++Y YFISFY+
Sbjct: 118 RCATGEAWQEILLACRYGQLCDPESDYLPGEEYTCGTDFAYYYFISFYM 166



>gb:AK129294_2069525 Mus musculus mRNA for mKIAA1123 protein.
          Length = 1389

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = -2

Query: 771 TLIPSLMPYLGTIFCVLC----FYCSLGLQIFGG--MVNAGNPNLDGTDLSDNDYLLF-- 616
           TL+ SL P +G I  + C     +  LG+Q+F G   V  G    + T+ SD     +  
Sbjct: 506 TLMSSLKP-IGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW 564

Query: 615 -----NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTS---------WSYVYFISFYV 478
                NF++    +++LF L     W   M    +  G           W  +YFISF +
Sbjct: 565 VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL 624

Query: 477 ITVLWLLNLIVAFVLEAF 424
           I   ++LN+ V  V+E F
Sbjct: 625 IVAFFVLNMFVGVVVENF 642



 Score = 40.0 bits (92), Expect = 0.053
 Identities = 22/67 (32%), Positives = 36/67 (53%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           NF+     +VT+F +L   +W   + +    T +SW+ +YFI+        L NL+VA +
Sbjct: 6   NFDSLLWAIVTVFQILTQEDWNKVLYNGMAST-SSWAALYFIALMTFGNYVLFNLLVAIL 64

Query: 435 LEAFQTE 415
           +E FQ E
Sbjct: 65  VEGFQAE 71



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 8/113 (7%)
 Frame = -2

Query: 744  LGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLFNLL 568
            LG +F +L F + +LG+++FG +        D T   +       F ++    +TLF + 
Sbjct: 848  LGLLFMLLFFIFAALGVELFGDL------ECDETHPCEGLGRHATFRNFGMAFLTLFRVS 901

Query: 567  VMGNWQLWMQSY-----KELT--GTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
               NW   M+       +E T   T  S +YF+SF +     L+N+++A +++
Sbjct: 902  TGDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMK 954



>gb:AB066609_2047131 Mus musculus Cacna1a mRNA for CaV2.1, complete
           cds, clone:MPII.
          Length = 2365

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 31/119 (26%), Positives = 57/119 (47%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N      +GT  +       NF+ +P 
Sbjct: 610 LNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFD----EGTPPT-------NFDTFPA 658

Query: 594 GMVTLFNLLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVL---WLLNLIVAFVLE 430
            ++T+F +L   +W ++     K   G     V+ I F V+T+     LLN+ +A  ++
Sbjct: 659 AIMTVFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVD 717



 Score = 42.7 bits (99), Expect = 0.008
 Identities = 37/130 (28%), Positives = 57/130 (43%), Gaps = 19/130 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDL-SDNDYLLF----NFNDYPNG 592
            +PY+  +  +L F Y  +G+Q+FG      N  +DG D  SD D        NF  +   
Sbjct: 1643 LPYVCLLIAMLFFIYAIIGMQVFG------NIGIDGEDEDSDEDEFQITEHNNFRTFFQA 1696

Query: 591  MVTLFNLLVMGNWQLWMQSYKE----------LT---GTSWSYVYFISFYVITVLWLLNL 451
            ++ LF       W   M S             LT   G  ++Y YF+SF  +    +LNL
Sbjct: 1697 LMLLFRSATGEAWHNIMLSCLSGKPCDKNSGILTADCGNEFAYFYFVSFIFLCSFLMLNL 1756

Query: 450  IVAFVLEAFQ 421
             VA +++ F+
Sbjct: 1757 FVAVIMDNFE 1766



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 16/68 (23%), Positives = 37/68 (54%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  + +G +W+++YFI   +I   ++LNL++  + 
Sbjct: 303 FDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLS 362

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 363 GEFAKERE 370



>gb:AB066608_2047130 Mus musculus Cacna1a mRNA for CaV2.1, complete
           cds, clone:MPI.
          Length = 2327

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 31/119 (26%), Positives = 57/119 (47%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N      +GT  +       NF+ +P 
Sbjct: 610 LNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFD----EGTPPT-------NFDTFPA 658

Query: 594 GMVTLFNLLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVL---WLLNLIVAFVLE 430
            ++T+F +L   +W ++     K   G     V+ I F V+T+     LLN+ +A  ++
Sbjct: 659 AIMTVFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVD 717



 Score = 42.7 bits (99), Expect = 0.008
 Identities = 37/130 (28%), Positives = 57/130 (43%), Gaps = 19/130 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDL-SDNDYLLF----NFNDYPNG 592
            +PY+  +  +L F Y  +G+Q+FG      N  +DG D  SD D        NF  +   
Sbjct: 1643 LPYVCLLIAMLFFIYAIIGMQVFG------NIGIDGEDEDSDEDEFQITEHNNFRTFFQA 1696

Query: 591  MVTLFNLLVMGNWQLWMQSYKE----------LT---GTSWSYVYFISFYVITVLWLLNL 451
            ++ LF       W   M S             LT   G  ++Y YF+SF  +    +LNL
Sbjct: 1697 LMLLFRSATGEAWHNIMLSCLSGKPCDKNSGILTADCGNEFAYFYFVSFIFLCSFLMLNL 1756

Query: 450  IVAFVLEAFQ 421
             VA +++ F+
Sbjct: 1757 FVAVIMDNFE 1766



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 16/68 (23%), Positives = 37/68 (54%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  + +G +W+++YFI   +I   ++LNL++  + 
Sbjct: 303 FDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLS 362

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 363 GEFAKERE 370



>gb:HSU79666_2026277 Homo sapiens alpha1A-voltage-dependent calcium
           channel mRNA, splice form BI-1-Vi-GGCAG, complete cds.
          Length = 2505

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 31/119 (26%), Positives = 57/119 (47%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N      +GT  +       NF+ +P 
Sbjct: 608 LNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFD----EGTPPT-------NFDTFPA 656

Query: 594 GMVTLFNLLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVL---WLLNLIVAFVLE 430
            ++T+F +L   +W ++     K   G     V+ I F V+T+     LLN+ +A  ++
Sbjct: 657 AIMTVFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVD 715



 Score = 40.4 bits (93), Expect = 0.041
 Identities = 31/128 (24%), Positives = 59/128 (46%), Gaps = 17/128 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLF---NFNDYPNGMV 586
            +PY+  +  +L F Y  +G+Q+FG +      +++  D  ++++ +    NF  +   ++
Sbjct: 1692 LPYVCLLIAMLFFIYAIIGMQVFGNI----GIDVEDEDSDEDEFQITEHNNFRTFFQALM 1747

Query: 585  TLFNLLVMGNWQLWMQSYKE----------LT---GTSWSYVYFISFYVITVLWLLNLIV 445
             LF       W   M S             LT   G  ++Y YF+SF  +    +LNL V
Sbjct: 1748 LLFRSATGEAWHNIMLSCLSGKPCDKNSGILTRECGNEFAYFYFVSFIFLCSFLMLNLFV 1807

Query: 444  AFVLEAFQ 421
            A +++ F+
Sbjct: 1808 AVIMDNFE 1815



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 16/68 (23%), Positives = 37/68 (54%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  + +G +W+++YFI   +I   ++LNL++  + 
Sbjct: 301 FDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLS 360

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 361 GEFAKERE 368



>gb:HSPQCCA1_2019694 H.sapiens mRNA for P/Q-type calcium channel
           alpha1 subunit.
          Length = 2262

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 31/119 (26%), Positives = 57/119 (47%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N      +GT  +       NF+ +P 
Sbjct: 608 LNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFD----EGTPPT-------NFDTFPA 656

Query: 594 GMVTLFNLLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVL---WLLNLIVAFVLE 430
            ++T+F +L   +W ++     K   G     V+ I F V+T+     LLN+ +A  ++
Sbjct: 657 AIMTVFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVD 715



 Score = 40.4 bits (93), Expect = 0.041
 Identities = 31/128 (24%), Positives = 59/128 (46%), Gaps = 17/128 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLF---NFNDYPNGMV 586
            +PY+  +  +L F Y  +G+Q+FG +      +++  D  ++++ +    NF  +   ++
Sbjct: 1693 LPYVCLLIAMLFFIYAIIGMQVFGNI----GIDVEDEDSDEDEFQITEHNNFRTFFQALM 1748

Query: 585  TLFNLLVMGNWQLWMQSYKE----------LT---GTSWSYVYFISFYVITVLWLLNLIV 445
             LF       W   M S             LT   G  ++Y YF+SF  +    +LNL V
Sbjct: 1749 LLFRSATGEAWHNIMLSCLSGKPCDKNSGILTRECGNEFAYFYFVSFIFLCSFLMLNLFV 1808

Query: 444  AFVLEAFQ 421
            A +++ F+
Sbjct: 1809 AVIMDNFE 1816



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 16/68 (23%), Positives = 37/68 (54%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  + +G +W+++YFI   +I   ++LNL++  + 
Sbjct: 301 FDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLS 360

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 361 GEFAKERE 368



>gb:AF004884_1875919 Homo sapiens neuronal calcium channel alpha 1A
           subunit isoform A-1 mRNA, complete cds.
          Length = 2510

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 31/119 (26%), Positives = 57/119 (47%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N      +GT  +       NF+ +P 
Sbjct: 608 LNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFD----EGTPPT-------NFDTFPA 656

Query: 594 GMVTLFNLLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVL---WLLNLIVAFVLE 430
            ++T+F +L   +W ++     K   G     V+ I F V+T+     LLN+ +A  ++
Sbjct: 657 AIMTVFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVD 715



 Score = 40.4 bits (93), Expect = 0.041
 Identities = 31/128 (24%), Positives = 59/128 (46%), Gaps = 17/128 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLF---NFNDYPNGMV 586
            +PY+  +  +L F Y  +G+Q+FG +      +++  D  ++++ +    NF  +   ++
Sbjct: 1697 LPYVCLLIAMLFFIYAIIGMQVFGNI----GIDVEDEDSDEDEFQITEHNNFRTFFQALM 1752

Query: 585  TLFNLLVMGNWQLWMQSYKE----------LT---GTSWSYVYFISFYVITVLWLLNLIV 445
             LF       W   M S             LT   G  ++Y YF+SF  +    +LNL V
Sbjct: 1753 LLFRSATGEAWHNIMLSCLSGKPCDKNSGILTRECGNEFAYFYFVSFIFLCSFLMLNLFV 1812

Query: 444  AFVLEAFQ 421
            A +++ F+
Sbjct: 1813 AVIMDNFE 1820



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 16/68 (23%), Positives = 37/68 (54%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  + +G +W+++YFI   +I   ++LNL++  + 
Sbjct: 301 FDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLS 360

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 361 GEFAKERE 368



>gb:AF004883_1875918 Homo sapiens neuronal calcium channel alpha 1A
           subunit isoform 1A-2 mRNA, complete cds.
          Length = 2266

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 31/119 (26%), Positives = 57/119 (47%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N      +GT  +       NF+ +P 
Sbjct: 608 LNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFD----EGTPPT-------NFDTFPA 656

Query: 594 GMVTLFNLLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVL---WLLNLIVAFVLE 430
            ++T+F +L   +W ++     K   G     V+ I F V+T+     LLN+ +A  ++
Sbjct: 657 AIMTVFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVD 715



 Score = 40.4 bits (93), Expect = 0.041
 Identities = 31/128 (24%), Positives = 59/128 (46%), Gaps = 17/128 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLF---NFNDYPNGMV 586
            +PY+  +  +L F Y  +G+Q+FG +      +++  D  ++++ +    NF  +   ++
Sbjct: 1697 LPYVCLLIAMLFFIYAIIGMQVFGNI----GIDVEDEDSDEDEFQITEHNNFRTFFQALM 1752

Query: 585  TLFNLLVMGNWQLWMQSYKE----------LT---GTSWSYVYFISFYVITVLWLLNLIV 445
             LF       W   M S             LT   G  ++Y YF+SF  +    +LNL V
Sbjct: 1753 LLFRSATGEAWHNIMLSCLSGKPCDKNSGILTRECGNEFAYFYFVSFIFLCSFLMLNLFV 1812

Query: 444  AFVLEAFQ 421
            A +++ F+
Sbjct: 1813 AVIMDNFE 1820



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 16/68 (23%), Positives = 37/68 (54%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  + +G +W+++YFI   +I   ++LNL++  + 
Sbjct: 301 FDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLS 360

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 361 GEFAKERE 368



>gb:AB035727_1866406 Homo sapiens CACNA1A mRNA for
           alpha1A-voltage-dependent calcium channel, complete cds,
           isolate:TMDN-CNT-001.
          Length = 2506

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 31/119 (26%), Positives = 57/119 (47%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N      +GT  +       NF+ +P 
Sbjct: 607 LNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFD----EGTPPT-------NFDTFPA 655

Query: 594 GMVTLFNLLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVL---WLLNLIVAFVLE 430
            ++T+F +L   +W ++     K   G     V+ I F V+T+     LLN+ +A  ++
Sbjct: 656 AIMTVFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVD 714



 Score = 40.4 bits (93), Expect = 0.041
 Identities = 31/128 (24%), Positives = 59/128 (46%), Gaps = 17/128 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLF---NFNDYPNGMV 586
            +PY+  +  +L F Y  +G+Q+FG +      +++  D  ++++ +    NF  +   ++
Sbjct: 1691 LPYVCLLIAMLFFIYAIIGMQVFGNI----GIDVEDEDSDEDEFQITEHNNFRTFFQALM 1746

Query: 585  TLFNLLVMGNWQLWMQSYKE----------LT---GTSWSYVYFISFYVITVLWLLNLIV 445
             LF       W   M S             LT   G  ++Y YF+SF  +    +LNL V
Sbjct: 1747 LLFRSATGEAWHNIMLSCLSGKPCDKNSGILTRECGNEFAYFYFVSFIFLCSFLMLNLFV 1806

Query: 444  AFVLEAFQ 421
            A +++ F+
Sbjct: 1807 AVIMDNFE 1814



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 16/68 (23%), Positives = 37/68 (54%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  + +G +W+++YFI   +I   ++LNL++  + 
Sbjct: 301 FDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLS 360

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 361 GEFAKERE 368



>gb:OCCCBI1CB_1442131 Rabbit mRNA for calcium channel BI-1 (lambda
           CBP109 and CB101).
          Length = 2273

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 31/119 (26%), Positives = 57/119 (47%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N      +GT  +       NF+ +P 
Sbjct: 608 LNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFD----EGTPPT-------NFDTFPA 656

Query: 594 GMVTLFNLLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVL---WLLNLIVAFVLE 430
            ++T+F +L   +W ++     K   G     V+ I F V+T+     LLN+ +A  ++
Sbjct: 657 AIMTVFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVD 715



 Score = 40.8 bits (94), Expect = 0.031
 Identities = 31/128 (24%), Positives = 59/128 (46%), Gaps = 17/128 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLF---NFNDYPNGMV 586
            +PY+  +  +L F Y  +G+Q+FG +      +++  D  ++++ +    NF  +   ++
Sbjct: 1701 LPYVCLLIAMLFFIYAIIGMQVFGNI----GIDMEDEDSDEDEFQITEHNNFRTFFQALM 1756

Query: 585  TLFNLLVMGNWQLWMQSYKE----------LT---GTSWSYVYFISFYVITVLWLLNLIV 445
             LF       W   M S             LT   G  ++Y YF+SF  +    +LNL V
Sbjct: 1757 LLFRSATGEAWHNIMLSCLSGKPCDKNSGILTPECGNEFAYFYFVSFIFLCSFLMLNLFV 1816

Query: 444  AFVLEAFQ 421
            A +++ F+
Sbjct: 1817 AVIMDNFE 1824



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 16/68 (23%), Positives = 37/68 (54%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  + +G +W+++YFI   +I   ++LNL++  + 
Sbjct: 301 FDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLS 360

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 361 GEFAKERE 368



>gb:AE014298_1125337 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003487_1212346 Drosophila melanogaster
           chromosome X, section 39 of 74 of the complete sequence.
          Length = 1848

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 31/121 (25%), Positives = 54/121 (44%), Gaps = 6/121 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVN--AGNPNLDGTDLSDNDYLLFNFNDY 601
           L  + S++  L  +F  +  +  LG+Q+FGG  N   G P               NFN +
Sbjct: 561 LNSMRSIISLLFLLFLFILIFALLGMQLFGGQFNLPGGTPET-------------NFNTF 607

Query: 600 PNGMVTLFNLLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVL---WLLNLIVAFVL 433
           P  ++T+F +L   +W ++  Q      G     +Y I F V+ +     LLN+ +A  +
Sbjct: 608 PIALLTVFQILTGEDWNEVMYQGIISQGGAQKGMIYSIYFIVLVLFGNYTLLNVFLAIAV 667

Query: 432 E 430
           +
Sbjct: 668 D 668



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 31/125 (24%), Positives = 54/125 (43%), Gaps = 15/125 (12%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG   N     ++ +    N     NF  +  G++ LF
Sbjct: 1221 LPYVCLLIAMLFFIYAIIGMQVFG---NIKLGTVENSITRHN-----NFQSFIQGVMLLF 1272

Query: 576  NLLVMGNWQLWM--------------QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAF 439
                   W   M              ++  E  G++ +Y YF+SF       +LNL VA 
Sbjct: 1273 RCATGEAWPNIMLACLKGKACDDDAEKAPGEYCGSTLAYAYFVSFIFFCSFLMLNLFVAV 1332

Query: 438  VLEAF 424
            +++ F
Sbjct: 1333 IMDNF 1337



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 16/67 (23%), Positives = 36/67 (53%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           +F++    M+T+F  + M  W   +    +  G++++++YF+   VI   ++LNL++  +
Sbjct: 253 SFDNIGFAMLTVFQCITMEGWTAILYWTNDALGSAFNWIYFVPLIVIGSFFMLNLVLGVL 312

Query: 435 LEAFQTE 415
              F  E
Sbjct: 313 SGEFSNE 319



>gb:AE014298_1125336 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003487_1212345 Drosophila melanogaster
           chromosome X, section 39 of 74 of the complete sequence.
          Length = 1851

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 31/121 (25%), Positives = 54/121 (44%), Gaps = 6/121 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVN--AGNPNLDGTDLSDNDYLLFNFNDY 601
           L  + S++  L  +F  +  +  LG+Q+FGG  N   G P               NFN +
Sbjct: 561 LNSMRSIISLLFLLFLFILIFALLGMQLFGGQFNLPGGTPET-------------NFNTF 607

Query: 600 PNGMVTLFNLLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVL---WLLNLIVAFVL 433
           P  ++T+F +L   +W ++  Q      G     +Y I F V+ +     LLN+ +A  +
Sbjct: 608 PIALLTVFQILTGEDWNEVMYQGIISQGGAQKGMIYSIYFIVLVLFGNYTLLNVFLAIAV 667

Query: 432 E 430
           +
Sbjct: 668 D 668



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 31/125 (24%), Positives = 54/125 (43%), Gaps = 15/125 (12%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG   N     ++ +    N     NF  +  G++ LF
Sbjct: 1224 LPYVCLLIAMLFFIYAIIGMQVFG---NIKLGTVENSITRHN-----NFQSFIQGVMLLF 1275

Query: 576  NLLVMGNWQLWM--------------QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAF 439
                   W   M              ++  E  G++ +Y YF+SF       +LNL VA 
Sbjct: 1276 RCATGEAWPNIMLACLKGKACDDDAEKAPGEYCGSTLAYAYFVSFIFFCSFLMLNLFVAV 1335

Query: 438  VLEAF 424
            +++ F
Sbjct: 1336 IMDNF 1340



 Score = 37.7 bits (86), Expect = 0.26
 Identities = 16/69 (23%), Positives = 37/69 (53%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           +F++    M+T+F  + M  W   +    +  G++++++YF+   VI   ++LNL++  +
Sbjct: 253 SFDNIGFAMLTVFQCITMEGWTAILYWTNDALGSAFNWIYFVPLIVIGSFFMLNLVLGVL 312

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 313 SGEFAKERE 321



>gb:AE014298_1125335 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003487_1212344 Drosophila melanogaster
           chromosome X, section 39 of 74 of the complete sequence.
          Length = 1848

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 31/121 (25%), Positives = 54/121 (44%), Gaps = 6/121 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVN--AGNPNLDGTDLSDNDYLLFNFNDY 601
           L  + S++  L  +F  +  +  LG+Q+FGG  N   G P               NFN +
Sbjct: 561 LNSMRSIISLLFLLFLFILIFALLGMQLFGGQFNLPGGTPET-------------NFNTF 607

Query: 600 PNGMVTLFNLLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVL---WLLNLIVAFVL 433
           P  ++T+F +L   +W ++  Q      G     +Y I F V+ +     LLN+ +A  +
Sbjct: 608 PIALLTVFQILTGEDWNEVMYQGIISQGGAQKGMIYSIYFIVLVLFGNYTLLNVFLAIAV 667

Query: 432 E 430
           +
Sbjct: 668 D 668



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 31/125 (24%), Positives = 54/125 (43%), Gaps = 15/125 (12%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG   N     ++ +    N     NF  +  G++ LF
Sbjct: 1221 LPYVCLLIAMLFFIYAIIGMQVFG---NIKLGTVENSITRHN-----NFQSFIQGVMLLF 1272

Query: 576  NLLVMGNWQLWM--------------QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAF 439
                   W   M              ++  E  G++ +Y YF+SF       +LNL VA 
Sbjct: 1273 RCATGEAWPNIMLACLKGKACDDDAEKAPGEYCGSTLAYAYFVSFIFFCSFLMLNLFVAV 1332

Query: 438  VLEAF 424
            +++ F
Sbjct: 1333 IMDNF 1337



 Score = 37.7 bits (86), Expect = 0.26
 Identities = 16/69 (23%), Positives = 37/69 (53%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           +F++    M+T+F  + M  W   +    +  G++++++YF+   VI   ++LNL++  +
Sbjct: 253 SFDNIGFAMLTVFQCITMEGWTAILYWTNDALGSAFNWIYFVPLIVIGSFFMLNLVLGVL 312

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 313 SGEFAKERE 321



>gb:AE014298_1125334 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003487_1212343 Drosophila melanogaster
           chromosome X, section 39 of 74 of the complete sequence.
          Length = 1851

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 31/121 (25%), Positives = 54/121 (44%), Gaps = 6/121 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVN--AGNPNLDGTDLSDNDYLLFNFNDY 601
           L  + S++  L  +F  +  +  LG+Q+FGG  N   G P               NFN +
Sbjct: 561 LNSMRSIISLLFLLFLFILIFALLGMQLFGGQFNLPGGTPET-------------NFNTF 607

Query: 600 PNGMVTLFNLLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVL---WLLNLIVAFVL 433
           P  ++T+F +L   +W ++  Q      G     +Y I F V+ +     LLN+ +A  +
Sbjct: 608 PIALLTVFQILTGEDWNEVMYQGIISQGGAQKGMIYSIYFIVLVLFGNYTLLNVFLAIAV 667

Query: 432 E 430
           +
Sbjct: 668 D 668



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 31/125 (24%), Positives = 54/125 (43%), Gaps = 15/125 (12%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG   N     ++ +    N     NF  +  G++ LF
Sbjct: 1224 LPYVCLLIAMLFFIYAIIGMQVFG---NIKLGTVENSITRHN-----NFQSFIQGVMLLF 1275

Query: 576  NLLVMGNWQLWM--------------QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAF 439
                   W   M              ++  E  G++ +Y YF+SF       +LNL VA 
Sbjct: 1276 RCATGEAWPNIMLACLKGKACDDDAEKAPGEYCGSTLAYAYFVSFIFFCSFLMLNLFVAV 1335

Query: 438  VLEAF 424
            +++ F
Sbjct: 1336 IMDNF 1340



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 16/67 (23%), Positives = 36/67 (53%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           +F++    M+T+F  + M  W   +    +  G++++++YF+   VI   ++LNL++  +
Sbjct: 253 SFDNIGFAMLTVFQCITMEGWTAILYWTNDALGSAFNWIYFVPLIVIGSFFMLNLVLGVL 312

Query: 435 LEAFQTE 415
              F  E
Sbjct: 313 SGEFSNE 319



>gb:AE014298_1125332 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003487_1212341 Drosophila melanogaster
           chromosome X, section 39 of 74 of the complete sequence.
          Length = 1848

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 31/121 (25%), Positives = 54/121 (44%), Gaps = 6/121 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVN--AGNPNLDGTDLSDNDYLLFNFNDY 601
           L  + S++  L  +F  +  +  LG+Q+FGG  N   G P               NFN +
Sbjct: 561 LNSMRSIISLLFLLFLFILIFALLGMQLFGGQFNLPGGTPET-------------NFNTF 607

Query: 600 PNGMVTLFNLLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVL---WLLNLIVAFVL 433
           P  ++T+F +L   +W ++  Q      G     +Y I F V+ +     LLN+ +A  +
Sbjct: 608 PIALLTVFQILTGEDWNEVMYQGIISQGGAQKGMIYSIYFIVLVLFGNYTLLNVFLAIAV 667

Query: 432 E 430
           +
Sbjct: 668 D 668



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 31/125 (24%), Positives = 54/125 (43%), Gaps = 15/125 (12%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG   N     ++ +    N     NF  +  G++ LF
Sbjct: 1221 LPYVCLLIAMLFFIYAIIGMQVFG---NIKLGTVENSITRHN-----NFQSFIQGVMLLF 1272

Query: 576  NLLVMGNWQLWM--------------QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAF 439
                   W   M              ++  E  G++ +Y YF+SF       +LNL VA 
Sbjct: 1273 RCATGEAWPNIMLACLKGKACDDDAEKAPGEYCGSTLAYAYFVSFIFFCSFLMLNLFVAV 1332

Query: 438  VLEAF 424
            +++ F
Sbjct: 1333 IMDNF 1337



 Score = 37.7 bits (86), Expect = 0.26
 Identities = 16/69 (23%), Positives = 37/69 (53%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           +F++    M+T+F  + M  W   +    +  G++++++YF+   VI   ++LNL++  +
Sbjct: 253 SFDNIGFAMLTVFQCITMEGWTAILYWTNDALGSAFNWIYFVPLIVIGSFFMLNLVLGVL 312

Query: 435 LEAFQTEMD 409
              F  E +
Sbjct: 313 SGEFAKERE 321



>pir|I46477|I46477 calcium channel BI-1 - rabbit>gb:OCCCBI1_1442130
           Rabbit mRNA for calcium channel BI-1.
          Length = 2273

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 31/119 (26%), Positives = 57/119 (47%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N      +GT  +       NF+ +P 
Sbjct: 608 LNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFD----EGTPPT-------NFDTFPA 656

Query: 594 GMVTLFNLLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVL---WLLNLIVAFVLE 430
            ++T+F +L   +W ++     K   G     V+ I F V+T+     LLN+ +A  ++
Sbjct: 657 AIMTVFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVD 715



 Score = 40.8 bits (94), Expect = 0.031
 Identities = 31/128 (24%), Positives = 59/128 (46%), Gaps = 17/128 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLF---NFNDYPNGMV 586
            +PY+  +  +L F Y  +G+Q+FG +      +++  D  ++++ +    NF  +   ++
Sbjct: 1701 LPYVCLLIAMLFFIYAIIGMQVFGNI----GIDMEDEDSDEDEFQITEHNNFRTFFQALM 1756

Query: 585  TLFNLLVMGNWQLWMQSYKE----------LT---GTSWSYVYFISFYVITVLWLLNLIV 445
             LF       W   M S             LT   G  ++Y YF+SF  +    +LNL V
Sbjct: 1757 LLFRSATGEAWHNIMLSCLSGKPCDKNSGILTPECGNEFAYFYFVSFIFLCSFLMLNLFV 1816

Query: 444  AFVLEAFQ 421
            A +++ F+
Sbjct: 1817 AVIMDNFE 1824



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 16/68 (23%), Positives = 37/68 (54%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  + +G +W+++YFI   +I   ++LNL++  + 
Sbjct: 301 FDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLS 360

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 361 GEFAKERE 368



>pir|I46480|I46480 calcium channel BI-2 -
           rabbit>gb:OCCCBI2CB_1442133 Rabbit mRNA for calcium
           channel BI-2 (lambda CBP109 and CB101).
          Length = 2424

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 31/119 (26%), Positives = 57/119 (47%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N      +GT  +       NF+ +P 
Sbjct: 608 LNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFD----EGTPPT-------NFDTFPA 656

Query: 594 GMVTLFNLLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVL---WLLNLIVAFVLE 430
            ++T+F +L   +W ++     K   G     V+ I F V+T+     LLN+ +A  ++
Sbjct: 657 AIMTVFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVD 715



 Score = 40.8 bits (94), Expect = 0.031
 Identities = 31/128 (24%), Positives = 59/128 (46%), Gaps = 17/128 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLF---NFNDYPNGMV 586
            +PY+  +  +L F Y  +G+Q+FG +      +++  D  ++++ +    NF  +   ++
Sbjct: 1701 LPYVCLLIAMLFFIYAIIGMQVFGNI----GIDMEDEDSDEDEFQITEHNNFRTFFQALM 1756

Query: 585  TLFNLLVMGNWQLWMQSYKE----------LT---GTSWSYVYFISFYVITVLWLLNLIV 445
             LF       W   M S             LT   G  ++Y YF+SF  +    +LNL V
Sbjct: 1757 LLFRSATGEAWHNIMLSCLSGKPCDKNSGILTPECGNEFAYFYFVSFIFLCSFLMLNLFV 1816

Query: 444  AFVLEAFQ 421
            A +++ F+
Sbjct: 1817 AVIMDNFE 1824



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 16/68 (23%), Positives = 37/68 (54%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  + +G +W+++YFI   +I   ++LNL++  + 
Sbjct: 301 FDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLS 360

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 361 GEFAKERE 368



>pir|T13980|T13980 calcium channel alpha-1 chain - fruit fly
           (Drosophila melanogaster)>gb:DMU55776_1380850 Drosophila
           melanogaster calcium channel alpha-1 subunit (Dmca1A)
           mRNA, complete cds.
          Length = 1851

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 31/121 (25%), Positives = 54/121 (44%), Gaps = 6/121 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVN--AGNPNLDGTDLSDNDYLLFNFNDY 601
           L  + S++  L  +F  +  +  LG+Q+FGG  N   G P               NFN +
Sbjct: 561 LNSMRSIISLLFLLFLFILIFALLGMQLFGGQFNLPGGTPET-------------NFNTF 607

Query: 600 PNGMVTLFNLLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVL---WLLNLIVAFVL 433
           P  ++T+F +L   +W ++  Q      G     +Y I F V+ +     LLN+ +A  +
Sbjct: 608 PIALLTVFQILTGEDWNEVMYQGIISQGGAQKGMIYSIYFIVLVLFGNYTLLNVFLAIAV 667

Query: 432 E 430
           +
Sbjct: 668 D 668



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 31/125 (24%), Positives = 55/125 (44%), Gaps = 15/125 (12%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG   N     ++ +    N     NF  + +G++ LF
Sbjct: 1224 LPYVCLLIAMLFFIYAIIGMQVFG---NIKLGTVENSITRHN-----NFQSFIHGVMLLF 1275

Query: 576  NLLVMGNWQLWM--------------QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAF 439
                   W   M              ++  E  G++ +Y YF+SF       +LNL VA 
Sbjct: 1276 RCATGEAWPNIMLACLKGKACDDDAEKAPGEYCGSTLAYAYFVSFIFFCSFLMLNLFVAV 1335

Query: 438  VLEAF 424
            +++ F
Sbjct: 1336 IMDNF 1340



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 16/67 (23%), Positives = 36/67 (53%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           +F++    M+T+F  + M  W   +    +  G++++++YF+   VI   ++LNL++  +
Sbjct: 253 SFDNIGFAMLTVFQCITMEGWTAILYWTNDALGSAFNWIYFVPLIVIGSFFMLNLVLGVL 312

Query: 435 LEAFQTE 415
              F  E
Sbjct: 313 SGEFSNE 319



>sp|P27884|CCAA_RABIT Voltage-dependent P/Q-type calcium channel
           alpha-1A subunit (Voltage- gated calcium channel alpha
           subunit Cav2.1) (Calcium channel, L type, alpha-1
           polypeptide isoform 4) (Brain calcium channel I)
           (BI).>gb:OCCCBI2_1442132 Rabbit mRNA for calcium channel
           BI-2.
          Length = 2424

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 31/119 (26%), Positives = 57/119 (47%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N      +GT  +       NF+ +P 
Sbjct: 608 LNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFD----EGTPPT-------NFDTFPA 656

Query: 594 GMVTLFNLLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVL---WLLNLIVAFVLE 430
            ++T+F +L   +W ++     K   G     V+ I F V+T+     LLN+ +A  ++
Sbjct: 657 AIMTVFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVD 715



 Score = 40.8 bits (94), Expect = 0.031
 Identities = 31/128 (24%), Positives = 59/128 (46%), Gaps = 17/128 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLF---NFNDYPNGMV 586
            +PY+  +  +L F Y  +G+Q+FG +      +++  D  ++++ +    NF  +   ++
Sbjct: 1701 LPYVCLLIAMLFFIYAIIGMQVFGNI----GIDMEDEDSDEDEFQITEHNNFRTFFQALM 1756

Query: 585  TLFNLLVMGNWQLWMQSYKE----------LT---GTSWSYVYFISFYVITVLWLLNLIV 445
             LF       W   M S             LT   G  ++Y YF+SF  +    +LNL V
Sbjct: 1757 LLFRSATGEAWHNIMLSCLSGKPCDKNSGILTPECGNEFAYFYFVSFIFLCSFLMLNLFV 1816

Query: 444  AFVLEAFQ 421
            A +++ F+
Sbjct: 1817 AVIMDNFE 1824



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 16/68 (23%), Positives = 37/68 (54%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  + +G +W+++YFI   +I   ++LNL++  + 
Sbjct: 301 FDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLS 360

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 361 GEFAKERE 368



>sp|P97445|CCAA_MOUSE Voltage-dependent P/Q-type calcium channel
           alpha-1A subunit (Voltage- gated calcium channel alpha
           subunit Cav2.1) (Calcium channel, L type, alpha-1
           polypeptide isoform 4) (Brain calcium channel I)
           (BI).>gb:MMU76716_2123436 Mus musculus voltage-sensitive
           calcium channel alpha 1 A (Ccha1a) mRNA, complete cds.
          Length = 2164

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 31/119 (26%), Positives = 57/119 (47%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N      +GT  +       NF+ +P 
Sbjct: 562 LNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFD----EGTPPT-------NFDTFPA 610

Query: 594 GMVTLFNLLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVL---WLLNLIVAFVLE 430
            ++T+F +L   +W ++     K   G     V+ I F V+T+     LLN+ +A  ++
Sbjct: 611 AIMTVFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVD 669



 Score = 42.7 bits (99), Expect = 0.008
 Identities = 37/130 (28%), Positives = 57/130 (43%), Gaps = 19/130 (14%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDL-SDNDYLLF----NFNDYPNG 592
            +PY+  +  +L F Y  +G+Q+FG      N  +DG D  SD D        NF  +   
Sbjct: 1595 LPYVCLLIAMLFFIYAIIGMQVFG------NIGIDGEDEDSDEDEFQITEHNNFRTFFQA 1648

Query: 591  MVTLFNLLVMGNWQLWMQSYKE----------LT---GTSWSYVYFISFYVITVLWLLNL 451
            ++ LF       W   M S             LT   G  ++Y YF+SF  +    +LNL
Sbjct: 1649 LMLLFRSATGEAWHNIMLSCLSGKPCDKNSGILTADCGNEFAYFYFVSFIFLCSFLMLNL 1708

Query: 450  IVAFVLEAFQ 421
             VA +++ F+
Sbjct: 1709 FVAVIMDNFE 1718



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 16/68 (23%), Positives = 37/68 (54%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  + +G +W+++YFI   +I   ++LNL++  + 
Sbjct: 255 FDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLS 314

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 315 GEFAKERE 322



>sp|O00555|CCAA_HUMAN Voltage-dependent P/Q-type calcium channel
           alpha-1A subunit (Voltage- gated calcium channel alpha
           subunit Cav2.1) (Calcium channel, L type, alpha-1
           polypeptide isoform 4) (Brain calcium channel I) (BI).
          Length = 2505

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 31/119 (26%), Positives = 57/119 (47%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N      +GT  +       NF+ +P 
Sbjct: 608 LNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFD----EGTPPT-------NFDTFPA 656

Query: 594 GMVTLFNLLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVL---WLLNLIVAFVLE 430
            ++T+F +L   +W ++     K   G     V+ I F V+T+     LLN+ +A  ++
Sbjct: 657 AIMTVFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVD 715



 Score = 40.4 bits (93), Expect = 0.041
 Identities = 31/128 (24%), Positives = 59/128 (46%), Gaps = 17/128 (13%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLF---NFNDYPNGMV 586
            +PY+  +  +L F Y  +G+Q+FG +      +++  D  ++++ +    NF  +   ++
Sbjct: 1692 LPYVCLLIAMLFFIYAIIGMQVFGNI----GIDVEDEDSDEDEFQITEHNNFRTFFQALM 1747

Query: 585  TLFNLLVMGNWQLWMQSYKE----------LT---GTSWSYVYFISFYVITVLWLLNLIV 445
             LF       W   M S             LT   G  ++Y YF+SF  +    +LNL V
Sbjct: 1748 LLFRSATGEAWHNIMLSCLSGKPCDKNSGILTRECGNEFAYFYFVSFIFLCSFLMLNLFV 1807

Query: 444  AFVLEAFQ 421
            A +++ F+
Sbjct: 1808 AVIMDNFE 1815



 Score = 39.7 bits (91), Expect = 0.069
 Identities = 16/68 (23%), Positives = 37/68 (54%)
 Frame = -2

Query: 612 FNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVL 433
           F++    ++T+F  + M  W   + +  + +G +W+++YFI   +I   ++LNL++  + 
Sbjct: 301 FDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLS 360

Query: 432 EAFQTEMD 409
             F  E +
Sbjct: 361 GEFAKERE 368



>sp|P91645|CCAA_DROME Voltage-dependent calcium channel type A
           alpha-1 subunit (Cacophony protein) (Nightblind A
           protein) (No-on-transient B protein)
           (DmCA1A).>gb:AE014298_1125333 Drosophila melanogaster
           chromosome X, complete sequence.>gb:AE003487_1212342
           Drosophila melanogaster chromosome X, section 39 of 74
           of the complete sequence.
          Length = 1848

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 31/121 (25%), Positives = 54/121 (44%), Gaps = 6/121 (4%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVN--AGNPNLDGTDLSDNDYLLFNFNDY 601
           L  + S++  L  +F  +  +  LG+Q+FGG  N   G P               NFN +
Sbjct: 561 LNSMRSIISLLFLLFLFILIFALLGMQLFGGQFNLPGGTPET-------------NFNTF 607

Query: 600 PNGMVTLFNLLVMGNW-QLWMQSYKELTGTSWSYVYFISFYVITVL---WLLNLIVAFVL 433
           P  ++T+F +L   +W ++  Q      G     +Y I F V+ +     LLN+ +A  +
Sbjct: 608 PIALLTVFQILTGEDWNEVMYQGIISQGGAQKGMIYSIYFIVLVLFGNYTLLNVFLAIAV 667

Query: 432 E 430
           +
Sbjct: 668 D 668



 Score = 39.3 bits (90), Expect = 0.091
 Identities = 31/125 (24%), Positives = 54/125 (43%), Gaps = 15/125 (12%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG   N     ++ +    N     NF  +  G++ LF
Sbjct: 1221 LPYVCLLIAMLFFIYAIIGMQVFG---NIKLGTVENSITRHN-----NFQSFIQGVMLLF 1272

Query: 576  NLLVMGNWQLWM--------------QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAF 439
                   W   M              ++  E  G++ +Y YF+SF       +LNL VA 
Sbjct: 1273 RCATGEAWPNIMLACLKGKACDDDAEKAPGEYCGSTLAYAYFVSFIFFCSFLMLNLFVAV 1332

Query: 438  VLEAF 424
            +++ F
Sbjct: 1333 IMDNF 1337



 Score = 38.1 bits (87), Expect = 0.20
 Identities = 16/67 (23%), Positives = 36/67 (53%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
           +F++    M+T+F  + M  W   +    +  G++++++YF+   VI   ++LNL++  +
Sbjct: 253 SFDNIGFAMLTVFQCITMEGWTAILYWTNDALGSAFNWIYFVPLIVIGSFFMLNLVLGVL 312

Query: 435 LEAFQTE 415
              F  E
Sbjct: 313 SGEFSNE 319



>gb:AF173019_2478479 Gallus gallus N-type calcium channel alpha-1B
           cdB8 variant (CACHA1B) mRNA, complete cds.
          Length = 2157

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 18/74 (24%), Positives = 40/74 (54%)
 Frame = -2

Query: 630 DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
           +Y + NF++    ++T+F  + M  W   + +  +  G +W+++YFI   +I   ++LNL
Sbjct: 282 NYGITNFDNILFAVLTVFQCITMEGWTDILYNTNDAAGNTWNWLYFIPLIIIGSFFMLNL 341

Query: 450 IVAFVLEAFQTEMD 409
           ++  +   F  E +
Sbjct: 342 VLGVLSGEFAKERE 355



 Score = 41.6 bits (96), Expect = 0.018
 Identities = 31/125 (24%), Positives = 56/125 (44%), Gaps = 14/125 (11%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T ++ ++    NF  +   ++ LF
Sbjct: 1594 LPYVCLLIAMLFFIYAIIGMQVFGNIALN-----DETSINRHN----NFRTFLQALMLLF 1644

Query: 576  NLLVMGNWQLWMQSY-------------KELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
                   W   M S              K   G+ ++Y YF+SF  +    +LNL VA +
Sbjct: 1645 RSATGEAWHEIMLSCLSNRACDPLSGLTKNECGSDFAYFYFVSFIFLCSFLMLNLFVAVI 1704

Query: 435  LEAFQ 421
            ++ F+
Sbjct: 1705 MDNFE 1709



 Score = 40.0 bits (92), Expect = 0.053
 Identities = 30/119 (25%), Positives = 55/119 (46%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N      D T  +       NF+ +P 
Sbjct: 594 LNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFR----DETPTT-------NFDTFPA 642

Query: 594 GMVTLFNLLVMGNWQLWM----QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M    +S   +    +S +YFI   +     LLN+ +A  ++
Sbjct: 643 AILTVFQILTGEDWNAVMYHGIESQGGVHSGMFSSIYFIVLTLFGNYTLLNVFLAIAVD 701



>gb:AF173018_2478478 Gallus gallus N-type calcium channel alpha-1B
           cdB7 variant (CACHA1B) mRNA, complete cds.
          Length = 2332

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 18/74 (24%), Positives = 40/74 (54%)
 Frame = -2

Query: 630 DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
           +Y + NF++    ++T+F  + M  W   + +  +  G +W+++YFI   +I   ++LNL
Sbjct: 282 NYGITNFDNILFAVLTVFQCITMEGWTDILYNTNDAAGNTWNWLYFIPLIIIGSFFMLNL 341

Query: 450 IVAFVLEAFQTEMD 409
           ++  +   F  E +
Sbjct: 342 VLGVLSGEFAKERE 355



 Score = 41.6 bits (96), Expect = 0.018
 Identities = 31/125 (24%), Positives = 56/125 (44%), Gaps = 14/125 (11%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T ++ ++    NF  +   ++ LF
Sbjct: 1594 LPYVCLLIAMLFFIYAIIGMQVFGNIALN-----DETSINRHN----NFRTFLQALMLLF 1644

Query: 576  NLLVMGNWQLWMQSY-------------KELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
                   W   M S              K   G+ ++Y YF+SF  +    +LNL VA +
Sbjct: 1645 RSATGEAWHEIMLSCLSNRACDPLSGLTKNECGSDFAYFYFVSFIFLCSFLMLNLFVAVI 1704

Query: 435  LEAFQ 421
            ++ F+
Sbjct: 1705 MDNFE 1709



 Score = 40.0 bits (92), Expect = 0.053
 Identities = 30/119 (25%), Positives = 55/119 (46%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N      D T  +       NF+ +P 
Sbjct: 594 LNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFR----DETPTT-------NFDTFPA 642

Query: 594 GMVTLFNLLVMGNWQLWM----QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M    +S   +    +S +YFI   +     LLN+ +A  ++
Sbjct: 643 AILTVFQILTGEDWNAVMYHGIESQGGVHSGMFSSIYFIVLTLFGNYTLLNVFLAIAVD 701



>gb:AF173017_2478477 Gallus gallus N-type calcium channel alpha-1B
           cdB6 variant (CACHA1B) mRNA, complete cds.
          Length = 2171

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 18/74 (24%), Positives = 40/74 (54%)
 Frame = -2

Query: 630 DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
           +Y + NF++    ++T+F  + M  W   + +  +  G +W+++YFI   +I   ++LNL
Sbjct: 282 NYGITNFDNILFAVLTVFQCITMEGWTDILYNTNDAAGNTWNWLYFIPLIIIGSFFMLNL 341

Query: 450 IVAFVLEAFQTEMD 409
           ++  +   F  E +
Sbjct: 342 VLGVLSGEFAKERE 355



 Score = 41.6 bits (96), Expect = 0.018
 Identities = 31/125 (24%), Positives = 56/125 (44%), Gaps = 14/125 (11%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T ++ ++    NF  +   ++ LF
Sbjct: 1608 LPYVCLLIAMLFFIYAIIGMQVFGNIALN-----DETSINRHN----NFRTFLQALMLLF 1658

Query: 576  NLLVMGNWQLWMQSY-------------KELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
                   W   M S              K   G+ ++Y YF+SF  +    +LNL VA +
Sbjct: 1659 RSATGEAWHEIMLSCLSNRACDPLSGLTKNECGSDFAYFYFVSFIFLCSFLMLNLFVAVI 1718

Query: 435  LEAFQ 421
            ++ F+
Sbjct: 1719 MDNFE 1723



 Score = 40.0 bits (92), Expect = 0.053
 Identities = 30/119 (25%), Positives = 55/119 (46%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N      D T  +       NF+ +P 
Sbjct: 608 LNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFR----DETPTT-------NFDTFPA 656

Query: 594 GMVTLFNLLVMGNWQLWM----QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M    +S   +    +S +YFI   +     LLN+ +A  ++
Sbjct: 657 AILTVFQILTGEDWNAVMYHGIESQGGVHSGMFSSIYFIVLTLFGNYTLLNVFLAIAVD 715



>gb:AF173016_2478476 Gallus gallus N-type calcium channel alpha-1B
           cdB5 variant (CACHA1B) mRNA, complete cds.
          Length = 2346

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 18/74 (24%), Positives = 40/74 (54%)
 Frame = -2

Query: 630 DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
           +Y + NF++    ++T+F  + M  W   + +  +  G +W+++YFI   +I   ++LNL
Sbjct: 282 NYGITNFDNILFAVLTVFQCITMEGWTDILYNTNDAAGNTWNWLYFIPLIIIGSFFMLNL 341

Query: 450 IVAFVLEAFQTEMD 409
           ++  +   F  E +
Sbjct: 342 VLGVLSGEFAKERE 355



 Score = 41.6 bits (96), Expect = 0.018
 Identities = 31/125 (24%), Positives = 56/125 (44%), Gaps = 14/125 (11%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T ++ ++    NF  +   ++ LF
Sbjct: 1608 LPYVCLLIAMLFFIYAIIGMQVFGNIALN-----DETSINRHN----NFRTFLQALMLLF 1658

Query: 576  NLLVMGNWQLWMQSY-------------KELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
                   W   M S              K   G+ ++Y YF+SF  +    +LNL VA +
Sbjct: 1659 RSATGEAWHEIMLSCLSNRACDPLSGLTKNECGSDFAYFYFVSFIFLCSFLMLNLFVAVI 1718

Query: 435  LEAFQ 421
            ++ F+
Sbjct: 1719 MDNFE 1723



 Score = 40.0 bits (92), Expect = 0.053
 Identities = 30/119 (25%), Positives = 55/119 (46%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N      D T  +       NF+ +P 
Sbjct: 608 LNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFR----DETPTT-------NFDTFPA 656

Query: 594 GMVTLFNLLVMGNWQLWM----QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M    +S   +    +S +YFI   +     LLN+ +A  ++
Sbjct: 657 AILTVFQILTGEDWNAVMYHGIESQGGVHSGMFSSIYFIVLTLFGNYTLLNVFLAIAVD 715



>gb:AF173015_2478475 Gallus gallus N-type calcium channel alpha-1B
           cdB4 variant (CACHA1B) mRNA, complete cds.
          Length = 2146

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 18/74 (24%), Positives = 40/74 (54%)
 Frame = -2

Query: 630 DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
           +Y + NF++    ++T+F  + M  W   + +  +  G +W+++YFI   +I   ++LNL
Sbjct: 282 NYGITNFDNILFAVLTVFQCITMEGWTDILYNTNDAAGNTWNWLYFIPLIIIGSFFMLNL 341

Query: 450 IVAFVLEAFQTEMD 409
           ++  +   F  E +
Sbjct: 342 VLGVLSGEFAKERE 355



 Score = 41.6 bits (96), Expect = 0.018
 Identities = 31/125 (24%), Positives = 56/125 (44%), Gaps = 14/125 (11%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T ++ ++    NF  +   ++ LF
Sbjct: 1583 LPYVCLLIAMLFFIYAIIGMQVFGNIALN-----DETSINRHN----NFRTFLQALMLLF 1633

Query: 576  NLLVMGNWQLWMQSY-------------KELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
                   W   M S              K   G+ ++Y YF+SF  +    +LNL VA +
Sbjct: 1634 RSATGEAWHEIMLSCLSNRACDPLSGLTKNECGSDFAYFYFVSFIFLCSFLMLNLFVAVI 1693

Query: 435  LEAFQ 421
            ++ F+
Sbjct: 1694 MDNFE 1698



 Score = 40.0 bits (92), Expect = 0.053
 Identities = 30/119 (25%), Positives = 55/119 (46%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N      D T  +       NF+ +P 
Sbjct: 583 LNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFR----DETPTT-------NFDTFPA 631

Query: 594 GMVTLFNLLVMGNWQLWM----QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M    +S   +    +S +YFI   +     LLN+ +A  ++
Sbjct: 632 AILTVFQILTGEDWNAVMYHGIESQGGVHSGMFSSIYFIVLTLFGNYTLLNVFLAIAVD 690



>gb:AF173014_2478474 Gallus gallus N-type calcium channel alpha-1B
           cdB3 variant (CACHA1B) mRNA, complete cds.
          Length = 2321

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 18/74 (24%), Positives = 40/74 (54%)
 Frame = -2

Query: 630 DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
           +Y + NF++    ++T+F  + M  W   + +  +  G +W+++YFI   +I   ++LNL
Sbjct: 282 NYGITNFDNILFAVLTVFQCITMEGWTDILYNTNDAAGNTWNWLYFIPLIIIGSFFMLNL 341

Query: 450 IVAFVLEAFQTEMD 409
           ++  +   F  E +
Sbjct: 342 VLGVLSGEFAKERE 355



 Score = 41.6 bits (96), Expect = 0.018
 Identities = 31/125 (24%), Positives = 56/125 (44%), Gaps = 14/125 (11%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T ++ ++    NF  +   ++ LF
Sbjct: 1583 LPYVCLLIAMLFFIYAIIGMQVFGNIALN-----DETSINRHN----NFRTFLQALMLLF 1633

Query: 576  NLLVMGNWQLWMQSY-------------KELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
                   W   M S              K   G+ ++Y YF+SF  +    +LNL VA +
Sbjct: 1634 RSATGEAWHEIMLSCLSNRACDPLSGLTKNECGSDFAYFYFVSFIFLCSFLMLNLFVAVI 1693

Query: 435  LEAFQ 421
            ++ F+
Sbjct: 1694 MDNFE 1698



 Score = 40.0 bits (92), Expect = 0.053
 Identities = 30/119 (25%), Positives = 55/119 (46%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N      D T  +       NF+ +P 
Sbjct: 583 LNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFR----DETPTT-------NFDTFPA 631

Query: 594 GMVTLFNLLVMGNWQLWM----QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M    +S   +    +S +YFI   +     LLN+ +A  ++
Sbjct: 632 AILTVFQILTGEDWNAVMYHGIESQGGVHSGMFSSIYFIVLTLFGNYTLLNVFLAIAVD 690



>gb:AF173013_2478473 Gallus gallus N-type calcium channel alpha-1B
           cdB2 variant (CACHA1B) mRNA, complete cds.
          Length = 2182

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 18/74 (24%), Positives = 40/74 (54%)
 Frame = -2

Query: 630 DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
           +Y + NF++    ++T+F  + M  W   + +  +  G +W+++YFI   +I   ++LNL
Sbjct: 282 NYGITNFDNILFAVLTVFQCITMEGWTDILYNTNDAAGNTWNWLYFIPLIIIGSFFMLNL 341

Query: 450 IVAFVLEAFQTEMD 409
           ++  +   F  E +
Sbjct: 342 VLGVLSGEFAKERE 355



 Score = 41.6 bits (96), Expect = 0.018
 Identities = 31/125 (24%), Positives = 56/125 (44%), Gaps = 14/125 (11%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T ++ ++    NF  +   ++ LF
Sbjct: 1619 LPYVCLLIAMLFFIYAIIGMQVFGNIALN-----DETSINRHN----NFRTFLQALMLLF 1669

Query: 576  NLLVMGNWQLWMQSY-------------KELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
                   W   M S              K   G+ ++Y YF+SF  +    +LNL VA +
Sbjct: 1670 RSATGEAWHEIMLSCLSNRACDPLSGLTKNECGSDFAYFYFVSFIFLCSFLMLNLFVAVI 1729

Query: 435  LEAFQ 421
            ++ F+
Sbjct: 1730 MDNFE 1734



 Score = 40.0 bits (92), Expect = 0.053
 Identities = 30/119 (25%), Positives = 55/119 (46%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N      D T  +       NF+ +P 
Sbjct: 619 LNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFR----DETPTT-------NFDTFPA 667

Query: 594 GMVTLFNLLVMGNWQLWM----QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M    +S   +    +S +YFI   +     LLN+ +A  ++
Sbjct: 668 AILTVFQILTGEDWNAVMYHGIESQGGVHSGMFSSIYFIVLTLFGNYTLLNVFLAIAVD 726



>gb:AF173012_2478472 Gallus gallus N-type calcium channel alpha-1B
           cdB1 variant (CACHA1B) mRNA, complete cds.
          Length = 2357

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 18/74 (24%), Positives = 40/74 (54%)
 Frame = -2

Query: 630 DYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKELTGTSWSYVYFISFYVITVLWLLNL 451
           +Y + NF++    ++T+F  + M  W   + +  +  G +W+++YFI   +I   ++LNL
Sbjct: 282 NYGITNFDNILFAVLTVFQCITMEGWTDILYNTNDAAGNTWNWLYFIPLIIIGSFFMLNL 341

Query: 450 IVAFVLEAFQTEMD 409
           ++  +   F  E +
Sbjct: 342 VLGVLSGEFAKERE 355



 Score = 41.6 bits (96), Expect = 0.018
 Identities = 31/125 (24%), Positives = 56/125 (44%), Gaps = 14/125 (11%)
 Frame = -2

Query: 753  MPYLGTIFCVLCF-YCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMVTLF 577
            +PY+  +  +L F Y  +G+Q+FG +        D T ++ ++    NF  +   ++ LF
Sbjct: 1619 LPYVCLLIAMLFFIYAIIGMQVFGNIALN-----DETSINRHN----NFRTFLQALMLLF 1669

Query: 576  NLLVMGNWQLWMQSY-------------KELTGTSWSYVYFISFYVITVLWLLNLIVAFV 436
                   W   M S              K   G+ ++Y YF+SF  +    +LNL VA +
Sbjct: 1670 RSATGEAWHEIMLSCLSNRACDPLSGLTKNECGSDFAYFYFVSFIFLCSFLMLNLFVAVI 1729

Query: 435  LEAFQ 421
            ++ F+
Sbjct: 1730 MDNFE 1734



 Score = 40.0 bits (92), Expect = 0.053
 Identities = 30/119 (25%), Positives = 55/119 (46%), Gaps = 4/119 (3%)
 Frame = -2

Query: 774 LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPN 595
           L  + S++  L  +F  +  +  LG+Q+FGG  N      D T  +       NF+ +P 
Sbjct: 619 LNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFR----DETPTT-------NFDTFPA 667

Query: 594 GMVTLFNLLVMGNWQLWM----QSYKELTGTSWSYVYFISFYVITVLWLLNLIVAFVLE 430
            ++T+F +L   +W   M    +S   +    +S +YFI   +     LLN+ +A  ++
Sbjct: 668 AILTVFQILTGEDWNAVMYHGIESQGGVHSGMFSSIYFIVLTLFGNYTLLNVFLAIAVD 726



>gb:AX017217_1456549 Sequence 1 from Patent WO9947670.
          Length = 1765

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 33/128 (25%), Positives = 55/128 (42%), Gaps = 12/128 (9%)
 Frame = -2

Query: 765  IPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLFNFNDYPNGMV 586
            +PSL      +F V+  Y   G+  F  +         G+ + D    +FNF  +   M+
Sbjct: 1473 LPSLFNIGLLLFLVMFIYAIFGMSWFSKVKK-------GSGIDD----IFNFETFTGSML 1521

Query: 585  TLFNLLVMGNWQLW---MQSYKELTGTSW---------SYVYFISFYVITVLWLLNLIVA 442
             LF +     W      M   KE   +S          + VYF+S+ +I+ L ++N+ +A
Sbjct: 1522 CLFQITTSAGWDTLLNPMLEAKEHCNSSSQDSCQQPQIAVVYFVSYIIISFLIVVNMYIA 1581

Query: 441  FVLEAFQT 418
             +LE F T
Sbjct: 1582 VILENFNT 1589



 Score = 34.3 bits (77), Expect = 2.9
 Identities = 29/150 (19%), Positives = 57/150 (38%), Gaps = 30/150 (20%)
 Frame = -2

Query: 774  LTLIPSLMPYLGTIFCVLCFYCSLGLQIFGGMVNAGNPNLDGTDLSDNDYLLF------- 616
            ++ IP+++  L         +C LG+ +F G        ++GTD+  N YL F       
Sbjct: 1150 ISAIPAILNVLLVCLIFWLVFCILGVNLFSGKFGRC---INGTDI--NMYLDFTEVPNRS 1204

Query: 615  --------------NFNDYPNGMVTLFNLLVMGNWQLWMQS---------YKELTGTSWS 505
                          NF++  N  + L  +     W   M +           +     ++
Sbjct: 1205 QCNISNYSWKVPQVNFDNVGNAYLALLQVATYKGWLEIMNAAVDSREKDEQPDFEANLYA 1264

Query: 504  YVYFISFYVITVLWLLNLIVAFVLEAFQTE 415
            Y+YF+ F +    + LNL +  +++ F  +
Sbjct: 1265 YLYFVVFIIFGSFFTLNLFIGVIIDNFNQQ 1294



>gb:AF098944_1240865 Stylophora pistillata P-type calcium channel
           alpha 1 subunit (CACHP) mRNA, partial cds.
          Length = 100

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 9/73 (12%)
 Frame = -2

Query: 615 NFNDYPNGMVTLFNLLVMGNWQLWMQSYK-----ELT----GTSWSYVYFISFYVITVLW 463
           NF  +P  +  LF      NW L M++       +LT    G++++Y+YFISF       
Sbjct: 28  NFQSFPEAIQVLFRSATGENWHLIMKACASDADCQLTDKKCGSTFAYLYFISFIFFCSFL 87

Query: 462 LLNLIVAFVLEAF 424
           LLNL VA +++ F
Sbjct: 88  LLNLFVAVIMDNF 100


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 929,593,298
Number of Sequences: 1806583
Number of extensions: 20961644
Number of successful extensions: 57496
Number of sequences better than 10.0: 442
Number of HSP's better than 10.0 without gapping: 54129
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 57219
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 54315948166
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)