BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10081
         (682 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T09796|T09796 drought-induced major intrinsic protein PIPc -...   243   2e-63   Craterostigma plantagineum
pir|T12557|T12557 mipE protein - common ice plant>gb:MCU73467_16...   242   4e-63   Mesembryanthemum crystallinum
gb:AF314656_1785355 Brassica oleracea aquaporin (PIP3) mRNA, com...   241   9e-63   
gb:MCU26538_1685857 Mesembryanthemum crystallinum major intrinsi...   241   9e-63   
gb:AF141900_1771604 Vitis berlandieri x Vitis rupestris putative...   239   3e-62   
gb:AJ849325_1814743 Populus tremula x Populus tremuloides mRNA f...   238   6e-62   
gb:AF452012_1800840 Petunia x hybrida aquaporin-like protein (PI...   238   7e-62   
gb:AF290201_1783587 Solanum chacoense plasma membrane intrinsic ...   237   1e-61   
gb:AF051202_1764195 Picea mariana probable aquaporin (Sb01) mRNA...   237   1e-61   
sp|P93004|PI27_ARATH|PI27_ARATH Aquaporin PIP2.7 (Plasma membrane intrinsic...   237   1e-61   Arabidopsis thaliana [mouse-ear cress]
gb:AJ849328_1814746 Populus tremula x Populus tremuloides mRNA f...   236   2e-61   
gb:AJ605575_1811922 Ricinus communis mRNA for aquaporin (Pip2-1 ...   236   2e-61   
gb:AF440272_1800059 Nicotiana tabacum aquaporin (NtPIP2;1) mRNA,...   236   3e-61   
gb:D85193_1674880 Arabidopsis thaliana mRNA, partial cds.             236   3e-61   
gb:AF141642_1771587 Vitis berlandieri x Vitis rupestris putative...   236   4e-61   
pir|T14600|T14600 plasma membrane major intrinsic protein 2 - be...   236   4e-61   Beta vulgaris subsp. vulgaris [field beet]
gb:ATU78297_1557276 Arabidopsis thaliana plasma membrane intrins...   234   8e-61   
gb:AB058680_1521731 Pyrus communis Py-PIP2-2 mRNA for plasma mem...   234   8e-61   
gb:AY823263_1628894 Vitis vinifera aquaporin (PIP2-1) mRNA, comp...   233   2e-60   
pir|T14889|T14889 membrane intrinsic protein Mip-2 - Norway spru...   233   3e-60   Picea abies
gb:AJ849324_1814742 Populus tremula x Populus tremuloides mRNA f...   232   4e-60   
gb:AF003728_1760663 Arabidopsis thaliana plasma membrane intrins...   232   4e-60   
sp|Q9ZVX8|PI28_ARATH|PI28_ARATH Probable aquaporin PIP2.8 (Plasma membrane ...   232   4e-60   Arabidopsis thaliana [mouse-ear cress]
gb:AF067185_1765599 Samanea saman aquaporin 2 (Aqp2) mRNA, compl...   232   5e-60   
sp|Q9FF53|PI24_ARATH|PI24_ARATH Probable aquaporin PIP2.4 (Plasma membrane ...   232   5e-60   Arabidopsis thaliana [mouse-ear cress]
gb:AY086460_1571508 Arabidopsis thaliana clone 25220 mRNA, compl...   231   7e-60   
sp|P43287|PI22_ARATH|PI22_ARATH Aquaporin PIP2.2 (Plasma membrane intrinsic...   231   7e-60   Arabidopsis thaliana [mouse-ear cress]
sp|P42767|PIP1_ATRCA|PIP1_ATRCA Aquaporin PIP-type.>gb:ACU18403_1745438 Atr...   231   9e-60   Atriplex canescens [shadscale]
gb:AF452013_1800841 Petunia x hybrida aquaporin-like protein (PI...   230   2e-59   
pir|S44085|S44085 plasma membrane intrinsic protein 2b - Arabido...   230   2e-59   Arabidopsis thaliana [mouse-ear cress]
pir|T12440|T12440 mipC protein - common ice plant>gb:MCU73466_16...   230   2e-59   Mesembryanthemum crystallinum
gb:AF133530_1770934 Mesembryanthemum crystallinum water channel ...   230   2e-59   
gb:PTR299449_1702717 Populus tremula x Populus tremuloides mRNA ...   230   2e-59   
gb:STU18312_1722971 Solanum tuberosum mRNA for major intrinsic p...   229   3e-59   
gb:AF326492_1786638 Zea mays plasma membrane integral protein Zm...   229   3e-59   
gb:AP003802_1833567 Oryza sativa (japonica cultivar-group) genom...   229   4e-59   
pir|T02879|T02879 probable plasma membrane intrinsic protein - r...   229   4e-59   Oryza sativa Japonica Group [Japonica rice]
gb:AY903443_1632103 Astragalus membranaceus clone AM79 putative ...   228   6e-59   
gb:AY189974_1588463 Juglans regia plasma intrinsic protein 2,2 m...   228   6e-59   
gb:AF255795_1781214 Allium cepa aquaporin 1 (Aqp1) mRNA, complet...   228   8e-59   
gb:OSJN00281_1697897 Oryza sativa genomic DNA, chromosome 4, BAC...   228   8e-59   
gb:AF326496_1786642 Zea mays plasma membrane integral protein Zm...   228   1e-58   
gb:CAR275315_1645200 Cicer arietinum partial mRNA for putative w...   228   1e-58   
gb:AF326491_1786637 Zea mays plasma membrane integral protein Zm...   227   1e-58   
gb:AJ849327_1814745 Populus tremula x Populus tremuloides mRNA f...   226   2e-58   
gb:AY189973_1588462 Juglans regia plasma intrinsic protein 2,1 m...   226   2e-58   
gb:PSA243307_1701923 Pisum sativum mRNA for putative plasma memb...   226   3e-58   
gb:AY243801_1592434 Zea mays aquaporin (PIP2-1) mRNA, complete cds.   226   4e-58   
gb:AB030697_1518528 Raphanus sativus PAQ2b mRNA for Plasma membr...   225   5e-58   
gb:AB058678_1521729 Pyrus communis Py-PIP2-1 mRNA for plasma mem...   225   6e-58   
pir|T14599|T14599 plasma membrane major intrinsic protein 1 - be...   225   6e-58   Beta vulgaris subsp. vulgaris [field beet]
gb:AF118383_1769623 Brassica napus plasma membrane intrinsic pro...   224   8e-58   
gb:SPIAQUA_1721837 Spinacia oleracea aquaporin mRNA, complete cds.    224   8e-58   
gb:AY084875_1569957 Arabidopsis thaliana clone 11998 mRNA, compl...   224   8e-58   
gb:AB030698_1518529 Raphanus sativus PAQ2c mRNA for Plasma membr...   224   8e-58   
sp|P30302|PI23_ARATH|PI23_ARATH Aquaporin PIP2.3 (Plasma membrane intrinsic...   224   8e-58   Arabidopsis thaliana [mouse-ear cress]
gb:AY243802_1592435 Zea mays aquaporin (PIP2-5) mRNA, complete c...   224   1e-57   
pir|T06434|T06434 plasma membrane intrinsic protein 1 - soybean>...   224   1e-57   Glycine max [soybeans]
gb:OSJN00087_1694650 Oryza sativa genomic DNA, chromosome 4, BAC...   223   2e-57   
gb:AP003802_1833561 Oryza sativa (japonica cultivar-group) genom...   223   2e-57   
gb:AY489268_1608615 Physcomitrella patens aquaporin PIP 2 mRNA, ...   223   2e-57   
gb:AF118382_1769622 Brassica napus plasma membrane intrinsic pro...   223   3e-57   
pir|T09124|T09124 probable aquaporin - spinach                        223   3e-57   Spinacia oleracea
sp|Q9SV31|PI25_ARATH|PI25_ARATH Probable aquaporin PIP2.5 (Plasma membrane ...   223   3e-57   Arabidopsis thaliana [mouse-ear cress]
sp|P43286|PI21_ARATH|PI21_ARATH Aquaporin PIP2.1 (Plasma membrane intrinsic...   223   3e-57   Arabidopsis thaliana [mouse-ear cress]
gb:AY494191_1608855 Physcomitrella patens plasma membrane aquapo...   222   4e-57   
gb:AB012045_1511625 Raphanus sativus mRNA for Plasma membrane aq...   222   4e-57   
gb:OSJN00156_1695831 Oryza sativa genomic DNA, chromosome 4, BAC...   222   5e-57   
gb:AY494192_1608856 Physcomitrella patens plasma membrane aquapo...   222   5e-57   
sp|Q9ZV07|PI26_ARATH|PI26_ARATH Probable aquaporin PIP2.6 (Plasma membrane ...   222   5e-57   Arabidopsis thaliana [mouse-ear cress]
gb:AF452014_1800842 Petunia x hybrida aquaporin-like protein (PI...   221   7e-57   
gb:AF326495_1786641 Zea mays plasma membrane integral protein Zm...   221   9e-57   
gb:AF290620_1783621 Nicotiana glauca putative PIP2 (MIP4) mRNA, ...   221   1e-56   
gb:AY547266_1612976 Ipomoea nil aquaporin-like protein mRNA, par...   220   2e-56   
pir|T04367|T04367 plasma membrane intrinsic protein BPW1 - barle...   220   2e-56   Hordeum vulgare [barley]
gb:AF255796_1781215 Allium cepa aquaporin 2 (Aqp2) mRNA, complet...   219   3e-56   
gb:AP006168_1861230 Oryza sativa (japonica cultivar-group) genom...   219   5e-56   
gb:AF440271_1800058 Nicotiana tabacum aquaporin (NtPIP1;1) mRNA,...   219   5e-56   
gb:AP003802_1833559 Oryza sativa (japonica cultivar-group) genom...   218   6e-56   
gb:AF141643_1771588 Vitis berlandieri x Vitis rupestris putative...   218   6e-56   
gb:LETRAMP1_1684679 L.esculentum mRNA for tomato ripening membra...   218   6e-56   
gb:AB002148_1508696 Nicotiana excelsior mRNA for water channel p...   218   6e-56   
sp|Q08451|PIP1_LYCES|PIP1_LYCES Probable aquaporin PIP-type pTOM75 (Ripenin...   218   6e-56   Solanum lycopersicum
gb:AY059380_1564533 Medicago truncatula aquaporin (PIP2-1) mRNA,...   218   8e-56   
gb:AF326494_1786640 Zea mays plasma membrane integral protein Zm...   217   1e-55   
gb:AF326493_1786639 Zea mays plasma membrane integral protein Zm...   217   1e-55   
gb:AF452011_1800839 Petunia x hybrida aquaporin-like protein (PI...   217   2e-55   
gb:AY725511_1624505 Lycopersicon esculentum putative aquaporin P...   217   2e-55   
gb:AF218774_1778204 Lycopersicon esculentum putative water chann...   216   2e-55   
gb:AY663794_1620591 Fraxinus excelsior plasma membrane intrinsic...   215   5e-55   
sp|Q39196|PI14_ARATH|PI14_ARATH Probable aquaporin PIP1.4 (Plasma membrane ...   215   5e-55   Arabidopsis thaliana [mouse-ear cress]
pir|T09794|T09794 major intrinsic protein PIPb - Craterostigma p...   215   7e-55   Craterostigma plantagineum
sp|Q08733|PI13_ARATH|PI13_ARATH Aquaporin PIP1.3 (Plasma membrane intrinsic...   215   7e-55   Arabidopsis thaliana [mouse-ear cress]
gb:AB091106_1525007 Lilium longiflorum PIP1 mRNA for plasma memb...   214   9e-55   
gb:AB002149_1508697 Nicotiana excelsior mRNA for water channel p...   214   9e-55   
gb:AB029446_1518187 Oryza sativa rwc-2 mRNA for water channel pr...   214   1e-54   
gb:AB002147_1508695 Nicotiana excelsior mRNA for water channel p...   214   1e-54   
gb:AY062610_1565266 Arabidopsis thaliana plasma membrane intrins...   213   2e-54   
gb:AB100869_1526268 Malus x domestica MdPIP1a mRNA for plasma me...   213   2e-54   
pir|T03794|T03794 aquaporin NT2 - common tobacco>gb:NTU62280_169...   213   2e-54   Nicotiana tabacum [American tobacco]
gb:AP004026_1836554 Oryza sativa (japonica cultivar-group) genom...   213   2e-54   
gb:AF326487_1786633 Zea mays plasma membrane integral protein Zm...   213   2e-54   
gb:AY243800_1592433 Zea mays plasma membrane intrinsic protein (...   213   2e-54   
gb:ATPIP1C_1553861 A.thaliana mRNA for plasma membrane intrinsic...   213   2e-54   
gb:AB058679_1521730 Pyrus communis Py-PIP1-1 mRNA for plasma mem...   213   2e-54   
gb:AF131201_1770834 Zea mays plasma membrane MIP protein (pip1-2...   213   3e-54   
gb:AF004293_1760683 Brassica rapa aquaporin (MOD) mRNA, complete...   212   6e-54   
gb:AB030696_1518527 Raphanus sativus PAQ1c mRNA for plasma membr...   212   6e-54   
gb:AB030695_1518526 Raphanus sativus PAQ1b mRNA for plasma membr...   212   6e-54   
gb:HVEMIP_1682347 H.vulgare mRNA for transmembrane protein.           211   7e-54   
sp|Q8LAA6|PI15_ARATH|PI15_ARATH Probable aquaporin PIP1.5 (Plasma membrane ...   211   7e-54   Arabidopsis thaliana [mouse-ear cress]
gb:AJ843992_1814684 Plantago major partial mRNA for aquaporin 2 ...   211   9e-54   
gb:AF366564_1791667 Triticum aestivum aquaporin PIP1 (Pip1) mRNA...   211   9e-54   
gb:ZMA271796_1731485 Zea mays mRNA for plasma membrane intrinsic...   211   9e-54   
gb:D85192_1674879 Arabidopsis thaliana mRNA for transmembrane pr...   211   9e-54   
gb:AB100870_1526269 Malus x domestica MdPIP1b mRNA for plasma me...   211   9e-54   
gb:AF188843_1775242 Vitis vinifera cultivar Pinot Noir plasma me...   211   1e-53   
gb:AB012044_1511624 Raphanus sativus mRNA for plasma membrane aq...   211   1e-53   
pir|T12434|T12434 probable plasma membrane intrinsic protein A -...   211   1e-53   Mesembryanthemum crystallinum
pir|T12342|T12342 major intrinsic protein homolog - common ice p...   210   2e-53   Mesembryanthemum crystallinum
sp|P61837|PI11_ARATH|PI11_ARATH Aquaporin PIP1.1 (Plasma membrane intrinsic...   210   2e-53   Arabidopsis thaliana [mouse-ear cress]
gb:OSAJ4327_1692771 Oryza sativa mRNA for aquaporin, complete CD...   210   2e-53   
gb:AB009665_1510797 Oryza sativa (japonica cultivar-group) mRNA ...   210   2e-53   
gb:AB009309_1510771 Hordeum vulgare HvPIP1;5 mRNA, complete cds.      210   2e-53   
gb:AJ849322_1814740 Populus tremula x Populus tremuloides mRNA f...   209   3e-53   
gb:AB109206_1526807 Oryza sativa (japonica cultivar-group) genom...   209   3e-53   
gb:AB009308_1510770 Hordeum vulgare HvPIP1;3 mRNA, complete cds.      209   3e-53   
pir|T04368|T04368 plasma membrane intrinsic protein BPW2 - barley     209   3e-53   Hordeum vulgare [barley]
gb:AF141898_1771602 Vitis berlandieri x Vitis rupestris putative...   209   4e-53   
gb:AY087945_1572970 Arabidopsis thaliana clone 3982 mRNA, comple...   209   5e-53   
pir|S41194|S41194 transmembrane protein - barley                      209   5e-53   Hordeum vulgare [barley]
gb:AF299051_1784200 Brassica oleracea aquaporin PIP1b2 mRNA, com...   208   6e-53   
gb:AF299050_1784199 Brassica oleracea aquaporin PIP1b1 mRNA, com...   208   6e-53   
gb:POC314584_1700958 Posidonia oceanica mRNA for putative plasma...   208   6e-53   
pir|T14863|T14863 porin Mip1 - Norway spruce>gb:PAMIP1_1698758 P...   208   6e-53   Picea abies
pir|T02095|T02095 transmembrane protein - rice>gb:AF022737_17620...   208   6e-53   Oryza sativa [red rice]
pir|T01528|T01528 probable plasma membrane intrinsic protein 1c ...   208   6e-53   Arabidopsis thaliana [mouse-ear cress]
gb:AF499725_1806148 Thellungiella halophila plasma membrane intr...   208   8e-53   
gb:ATPIP1A_1553860 A.thaliana mRNA for plasma membrane intrinsic...   208   8e-53   
gb:ATORFA_1553802 Arabidopsis thaliana mRNA for PIP1b protein.        208   8e-53   
sp|Q06611|PI12_ARATH|PI12_ARATH Aquaporin PIP1.2 (Plasma membrane intrinsic...   208   8e-53   Arabidopsis thaliana [mouse-ear cress]
gb:AF452010_1800838 Petunia x hybrida channel-like protein (PIP1...   207   1e-52   
gb:AY088439_1573458 Arabidopsis thaliana clone 6690 mRNA, comple...   207   1e-52   
gb:AJ699398_1813477 Chenopodium rubrum partial mRNA for putative...   207   1e-52   
pir|T12435|T12435 probable plasma membrane intrinsic protein B -...   207   1e-52   Mesembryanthemum crystallinum
gb:AF326490_1786636 Zea mays plasma membrane integral protein Zm...   207   2e-52   
gb:NTAQUAPOR_1691468 Nicotiana tabacum mRNA for aquaporin 1.>gb:...   207   2e-52   
gb:BOMIPATCP_1633861 B.oleracea mRNA for transmembrane channel p...   207   2e-52   
gb:AY084470_1569559 Arabidopsis thaliana clone 108944 mRNA, comp...   206   2e-52   
pir|T09791|T09791 drought-induced major intrinsic protein PIPa2 ...   206   2e-52   Craterostigma plantagineum
gb:AB029325_1518168 Oryza sativa gene for water channel protein ...   206   3e-52   
gb:AJ605574_1811921 Ricinus communis mRNA for aquaporin (Pip1-1 ...   205   7e-52   
gb:AB016623_1512848 Oryza sativa gene for RWC-3, complete cds.        205   7e-52   
sp|P25794|PIP2_PEA|PIP2_PEA Probable aquaporin PIP-type 7a (Turgor-respon...   205   7e-52   Pisum sativum [garden pea]
gb:SOL249384_1715697 Spinacia oleracea mRNA for PM28B protein (p...   204   9e-52   
gb:PSCC7A_1702076 P.sativum mRNA of cDNA clone 7a.                    204   1e-51   
gb:HVU310639_1682666 Hordeum vulgare partial pip1 gene for putat...   204   1e-51   
gb:AF141899_1771603 Vitis berlandieri x Vitis rupestris putative...   204   2e-51   
gb:AE016959_1023118 Oryza sativa (japonica cultivar-group) chrom...   204   2e-51   
gb:AJ605569_1811916 Ricinus communis partial mRNA for putative a...   201   8e-51   
gb:AY667436_1620711 Vicia faba aquaporin mRNA, complete cds.          201   8e-51   
pir|T09260|T09260 aquaporin-like transmembrane channel protein -...   201   1e-50   Medicago sativa [alfalfa]
gb:AF188844_1775243 Vitis vinifera cultivar Pinot Noir plasma me...   201   1e-50   
pir|S60455|S60455 transmembrane protein, glucose starvation-indu...   201   1e-50   Zea mays [maize]
gb:AF386739_1794724 Medicago truncatula aquaporin protein PIP1;1...   200   2e-50   
gb:LAAJ2973_1683875 Lupinus albus mRNA for aquaporin, partial.        199   3e-50   
pir|T12037|T12037 probable aquaporin-1, drought-induced - kidney...   199   3e-50   Phaseolus vulgaris [French bean]
pir|T14601|T14601 plasma membrane major intrinsic protein 3 - be...   199   5e-50   Beta vulgaris subsp. vulgaris [field beet]
gb:AY170841_1586693 Axonopus compressus plasma membrane MIP prot...   197   2e-49   
gb:CPPMIP1_1648684 Carica papaya mRNA for membrane channel prote...   196   3e-49   
gb:AY372191_1603225 Spinacia oleracea PIP1;2 (Pip1;2) mRNA, comp...   196   3e-49   
pir|T09817|T09817 probable water channel protein MIP1 - papaya (...   196   3e-49   Carica papaya [mamon]
gb:STU18311_1722970 Solanum tuberosum mRNA for major intrinsic p...   194   1e-48   
gb:AJ605565_1811912 Ricinus communis partial mRNA for putative a...   194   2e-48   
gb:AF366565_1791668 Triticum aestivum aquaporin PIP2 (Pip2) mRNA...   194   2e-48   
gb:AJ849323_1814741 Populus tremula x Populus tremuloides mRNA f...   193   2e-48   
gb:AY781788_1628320 Glycyrrhiza uralensis plasma membrane intrin...   193   3e-48   
gb:AJ605567_1811914 Ricinus communis partial mRNA for putative a...   191   1e-47   
gb:AF139814_1771447 Triticum aestivum plasma membrane intrinsic ...   190   2e-47   
gb:AJ605568_1811915 Ricinus communis partial mRNA for putative a...   190   2e-47   
gb:AF067184_1765598 Samanea saman aquaporin 1 (Aqp1) mRNA, compl...   189   5e-47   
pir|T04139|T04139 transmembrane protein - rice>gb:OSTRAMBPR_1698...   189   5e-47   Oryza sativa [red rice]
gb:AF367457_1791840 Prunus persica clone Mip1 membrane intrinsic...   188   7e-47   
gb:AF367460_1791843 Prunus persica clone Mip3 membrane intrinsic...   187   1e-46   
gb:SBU87981_1704944 Sorghum bicolor membrane intrinsic protein (...   187   2e-46   
gb:AF367458_1791841 Prunus persica clone Mip2 membrane intrinsic...   184   1e-45   
gb:AF290621_1783622 Nicotiana glauca putative PIP (MIP5) mRNA, p...   182   6e-45   
gb:AJ605566_1811913 Ricinus communis partial mRNA for putative a...   181   8e-45   
gb:CAR515031_1645357 Cicer arietinum partial mRNA for aquoporin-...   178   9e-44   
gb:CAR005869_1645115 Cicer arietinum mRNA for putative transmemb...   177   2e-43   
gb:AC092263_1735278 Oryza sativa chromosome 3 BAC OSJNBa0033P04 ...   174   1e-42   
gb:AP006149_1860964 Oryza sativa (japonica cultivar-group) genom...   173   3e-42   
gb:AF388171_1794930 Triticum boeoticum plasma membrane intrinsic...   172   4e-42   
gb:AY333929_1600132 Pringlea antiscorbutica putative transmembra...   162   7e-39   
gb:PSA548795_1702009 Pisum sativum partial mRNA for putative pla...   145   6e-34   
gb:AY874544_1631617 Pinus taeda isolate FBRC1 aquaporin (aqua-MI...   119   5e-26   
gb:AF145708_1772031 Lotus japonicus clone LJ-AQP2 plasma membran...   115   7e-25   
gb:AF139815_1771448 Triticum aestivum plasma membrane intrinsic ...   108   1e-24   
gb:AY856056_2088678 Notomys alexis aquaporin 4 mRNA, complete cds.    103   2e-21   
sp|P47863|AQP4_RAT|AQP4_RAT Aquaporin 4 (WCH4) (Mercurial-insensitive wat...   103   2e-21   Rattus norvegicus [brown rat]
gb:AY817455_2546461 Passer domesticus aquaporin-1 (AQP1) mRNA, c...   103   3e-21   
gb:AF009037_1411380 Ovis aries aquaporin 1 (aqp1) mRNA, complete...   103   3e-21   
sp|P56401|AQP1_SHEEP|AQP1_SHEEP Aquaporin-CHIP (Water channel protein for r...   103   3e-21   Ovis aries [domestic sheep]
pir|JC2348|JC2348 water channel protein CHIP29 - bovine>gb:AF028...   102   5e-21   Bos taurus [bovine]
sp|P47865|AQP1_BOVIN|AQP1_BOVIN Aquaporin-CHIP (Water channel protein for r...   102   5e-21   Bos taurus [bovine]
gb:MMU48399_2121622 Mus musculus mercurial-insensitive water cha...   102   8e-21   
gb:MMU48398_2121621 Mus musculus mercurial-insensitive water cha...   102   8e-21   
gb:MMU33012_2120866 Mus musculus mercurial-insensitive water cha...   102   8e-21   
gb:AY032857_2074124 Dipodomys merriami aquaporin 4 isoform 1 mRN...   102   8e-21   
sp|Q923J4|AQP4_DIPME|AQP4_DIPME Aquaporin 4.>gb:AY032858_2074125 Dipodomys ...   102   8e-21   Dipodomys merriami
gb:AF469169_2066675 Mus musculus aquaporin-4 M23X isoform (Aqp4)...   101   1e-20   
gb:AF469168_2066674 Mus musculus aquaporin-4 M1 isoform (Aqp4) m...   101   1e-20   
gb:AK045357_1167371 Mus musculus adult male corpora quadrigemina...   101   1e-20   
sp|P50501|AQPA_RANES|AQPA_RANES Aquaporin FA-CHIP.>pir|I51164|I51164 chip a...   101   1e-20   Pelophylax esculentus
sp|P55088|AQP4_MOUSE|AQP4_MOUSE Aquaporin 4 (WCH4) (Mercurial-insensitive w...   101   1e-20   Mus musculus [mouse]
gb:BC072092_2556355 Xenopus laevis MGC79006 protein, mRNA (cDNA ...   101   1e-20   
gb:AY692368_2544357 Coturnix coturnix aquaporin-1 mRNA, complete...   101   1e-20   
gb:HSU34845_2023718 Human mercurial-insensitive water channel mR...   101   1e-20   
gb:AY585335_1431673 Sus scrofa aquaporin-1 (AQP1) mRNA, complete...   101   1e-20   
pir|I39178|I39178 aquaporin 4, long splice form - human>gb:HSU34...   101   1e-20   Homo sapiens [man]
gb:AY206465_1427131 Ovis aries aquaporin 4 M23 isoform mRNA, com...   100   2e-20   
gb:AY177612_1426788 Ovis aries aquaporin 4A (AQP4A) mRNA, comple...   100   2e-20   
gb:AP003802_1833562 Oryza sativa (japonica cultivar-group) genom...   100   2e-20   
gb:BC084131_2563536 Xenopus laevis hypothetical LOC495037, mRNA ...   100   3e-20   
gb:RATORFA_2133241 Rattus norvegicus mercurial-insensitive water...   100   3e-20   
gb:HSU63623_2025382 Human aquaporin 4 (AQP4) mRNA, complete cds.      100   4e-20   
gb:AB015947_1407836 Bos taurus AQP-4 mRNA for aquaporin-4-A, com...   100   4e-20   
gb:AB012950_1407793 Bos taurus AQP-4 mRNA for aquaporin-4, compl...   100   4e-20   
sp|P55087|AQP4_HUMAN|AQP4_HUMAN Aquaporin 4 (WCH4) (Mercurial-insensitive w...   100   4e-20   Homo sapiens [man]
sp|O77750|AQP4_BOVIN|AQP4_BOVIN Aquaporin 4 (WCH4) (Mercurial-insensitive w...   100   4e-20   Bos taurus [bovine]
gb:AB011373_1407753 Canis familiaris aquaporin1 mRNA for AQP-CHI...    99   7e-20   
gb:BC078213_2560799 Danio rerio si:ch211-192k9.1, mRNA (cDNA clo...    99   9e-20   
gb:BC075384_2558487 Xenopus tropicalis aquaporin 1 (channel-form...    99   9e-20   
gb:AL954739_2504941 Zebrafish DNA sequence from clone CH211-192K...    99   9e-20   
gb:AF465730_2496338 Coturnix coturnix aquaporin-4 (AQP4) mRNA, c...    99   9e-20   
gb:AB190358_2467200 Gallus gallus AQP4 mRNA for aquaporin 4, com...    99   9e-20   
gb:BC077129_2559847 Danio rerio zgc:100858, mRNA (cDNA clone MGC...    98   1e-19   
gb:AF124746_1770290 Pinus banksiana putative aquaporin (Sb01) ge...    98   2e-19   
sp|Q9NHW7|AQP_AEDAE|AQP_AEDAE Aquaporin AQPAe.a.>gb:AF218314_1252088 Aedes...    98   2e-19   Aedes aegypti
gb:AF000312_1411173 Oryctolagus cuniculus aquaporin 4 mRNA, part...    97   2e-19   
gb:AB128929_1874055 Homo sapiens AQP4 mRNA for aquaporin type4 t...    97   3e-19   
gb:AB073315_2463182 Hyla japonica mRNA for water channel protein...    97   3e-19   
pir|B44499|B44499 major intrinsic protein homolog DER2 - mouse>g...    97   3e-19   Mus musculus [mouse]
sp|Q02013|AQP1_MOUSE|AQP1_MOUSE Aquaporin-CHIP (Water channel protein for r...    97   3e-19   Mus musculus [mouse]
gb:BC066289_2554256 Danio rerio zgc:85890, mRNA (cDNA clone MGC:...    96   4e-19   
gb:RNCHIPA_2134638 R.norvegicus CHIP 28 mRNA.                          96   4e-19   
gb:AB178640_1202291 Bombyx mori aqp mRNA for aquaporin, complete...    96   4e-19   
gb:RNCHIP28K_2134637 R.norvegicus mRNA for channel integral prot...    96   6e-19   
gb:RATCHIP28A_2131798 Rattus norvegicus water channel (CHIP28) m...    96   6e-19   
pir|JC1320|JC1320 water channel protein CHIP28 - rat>gb:BC090068...    96   6e-19   Rattus norvegicus [brown rat]
sp|P29975|AQP1_RAT|AQP1_RAT Aquaporin-CHIP (Water channel protein for red...    96   6e-19   Rattus norvegicus [brown rat]
gb:AF020620_2469036 Bufo marinus aquaporin-1 homolog (AQP-t1) mR...    96   8e-19   
gb:BC007125_2090526 Mus musculus aquaporin 1, mRNA (cDNA clone M...    94   2e-18   
gb:AF420308_1269498 Pyrocoelia rufa aquaporin mRNA, complete cds.      94   2e-18   
gb:AY856055_2088677 Notomys alexis aquaporin 1 mRNA, partial cds.      94   3e-18   
sp|Q25074|AQP_HAEIE|AQP_HAEIE Aquaporin (Water channel 1) (BfWC1).>gb:HIU5...    94   3e-18   Haematobia irritans exigua
gb:AF191906_2479257 Fundulus heteroclitus lens major intrinsic p...    93   4e-18   
gb:BC022486_1977901 Homo sapiens aquaporin 1 (channel-forming in...    93   4e-18   
gb:AF480415_1904637 Homo sapiens aquaporin 1 (AQP1) gene, partia...    93   4e-18   
pir|I52366|I52366 uterine water channel - human>gb:S73482_204132...    93   4e-18   Homo sapiens [man]
pir|A41616|A41616 erythrocyte integral membrane protein 28K - hu...    93   4e-18   Homo sapiens [man]
sp|P29972|AQP1_HUMAN|AQP1_HUMAN Aquaporin-CHIP (Water channel protein for r...    93   4e-18   Homo sapiens [man]
gb:CR859936_1184036 Pongo pygmaeus mRNA; cDNA DKFZp469G0320 (fro...    92   6e-18   
gb:AY078179_2510864 Gallus gallus lens major intrinsic protein (...    92   8e-18   
gb:AB094501_2464579 Anguilla japonica AQP-1L mRNA for aquaporin ...    92   8e-18   
gb:AB094502_2464580 Anguilla japonica AQP-1S mRNA for aquaporin ...    92   1e-17   
gb:AY611006_1617768 Xerophyta humilis isolate HC398 PIP1 aquapor...    91   2e-17   
gb:AF180528_1415601 Canis familiaris water channel aquaporin-1 m...    90   3e-17   
gb:AE013599_1131285 Drosophila melanogaster chromosome 2R, compl...    90   4e-17   
gb:AE013599_1131284 Drosophila melanogaster chromosome 2R, compl...    90   4e-17   
gb:BMU22658_2566702 Bufo marinus urinary bladder aquaporin mRNA,...    89   9e-17   
gb:HSU41518_2024172 Human channel-like integral membrane protein...    88   1e-16   
sp|O82316|TI41_ARATH|TI41_ARATH Probable aquaporin TIP4.1 (Tonoplast intrin...    88   2e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AY034596_1934731 Macaca radiata aquaporin 1 mRNA, partial cds.      87   2e-16   
gb:POC289695_1700943 Posidonia oceanica partial aq2 gene for put...    87   3e-16   
pir|T48885|T48885 water channel protein MipK [imported] - common...    87   3e-16   Mesembryanthemum crystallinum
sp|Q9FY14|TIP1_MEDTR|TIP1_MEDTR Probable aquaporin TIP-type (MtAQP1).>gb:MT...    87   3e-16   Medicago truncatula
gb:AJ630659_1812772 Cicer arietinum partial mRNA for tonoplast i...    87   4e-16   
gb:AF145706_1772029 Zea mays plasma membrane intrinsic protein h...    87   4e-16   
gb:AB114829_1527474 Oryza sativa (japonica cultivar-group) OsTIP...    87   4e-16   
sp|P42067|TIP1_MEDSA|TIP1_MEDSA Probable aquaporin TIP-type (Membrane chann...    86   5e-16   
gb:AF275315_1782516 Lotus japonicus water-selective transport in...    86   6e-16   
sp|P06624|MIP_BOVIN|MIP_BOVIN Lens fiber major intrinsic protein (MIP26) (...    86   8e-16   
sp|Q23808|AQP_CICVR|AQP_CICVR Aquaporin AQPcic.>gb:CVAQUAPOR_1375982 C.vir...    86   8e-16   
gb:AC005155_1874848 Homo sapiens PAC clone RP5-877J2 from 7p14-p...    85   1e-15   
gb:AF254799_1781152 Hordeum vulgare tonoplast intrinsic protein ...    85   1e-15   
sp|Q9V5Z7|AQP_DROME|AQP_DROME Aquaporin.>gb:AE013599_1131281 Drosophila me...    84   2e-15   
gb:PSA243309_1701925 Pisum sativum mRNA for putative tonoplast i...    84   2e-15   
gb:AY573927_1431522 Ovis aries lens-specific aquaporin-0 gene, c...    84   2e-15   
pir|JQ2288|JQ2288 SPCP2 protein - soybean>gb:SOYNODB_1716068 Gly...    84   2e-15   
gb:AF326500_1786646 Zea mays tonoplast membrane integral protein...    84   3e-15   
gb:TRGTIPLP_1725816 T.repens (Huia) mRNA for gamma-Tip-like prot...    84   3e-15   
gb:SOL245953_1715696 Spinacia oleracea mRNA for delta tonoplast ...    84   3e-15   
pir|T10524|T10524 tonoplast intrinsic protein gamma homolog - wh...    84   3e-15   
gb:AF133531_1770935 Mesembryanthemum crystallinum water channel ...    83   4e-15   
pir|T14843|T14843 aquaporin-like protein - Norway spruce>gb:PAAJ...    83   4e-15   
sp|P33560|TIP_ANTMA|TIP_ANTMA Probable aquaporin TIP-type (Tonoplast intri...    83   4e-15   
gb:OSJN00201_1696623 Oryza sativa genomic DNA, chromosome 4, BAC...    83   5e-15   
gb:CAR489613_1645348 Cicer arietinum partial mRNA for tonoplast ...    83   5e-15   
gb:AB048248_1520694 Pyrus communis Py-gTIP mRNA for gamma tonopl...    83   5e-15   
gb:AF326504_1786650 Zea mays tonoplast membrane integral protein...    82   7e-15   
gb:LEU95008_1684798 Lycopersicon esculentum Rb7 (RB7) gene, part...    82   7e-15   
gb:AY731066_1625467 Lycopersicon esculentum putative aquaporin T...    82   7e-15   
pir|T14002|T14002 aquaporin TIP7 - common sunflower>gb:HAST7_168...    82   7e-15   
pir|T14314|T14314 probable membrane protein - carrot>gb:AB000506...    82   7e-15   
sp|O22588|TI32_ARATH|TI32_ARATH Probable aquaporin TIP3.2 (Tonoplast intrin...    82   7e-15   
gb:AF020621_2469037 Bufo marinus vasopressin regulated water cha...    82   9e-15   
gb:BC078904_2107056 Rattus norvegicus aquaporin 5, mRNA (cDNA cl...    82   9e-15   
gb:AF342809_1789552 Zea mays tonoplast membrane integral protein...    82   9e-15   
gb:AF271660_1782160 Vitis berlandieri x Vitis rupestris putative...    82   9e-15   
gb:AF133533_1770937 Mesembryanthemum crystallinum water channel ...    82   9e-15   
sp|P47864|AQP5_RAT|AQP5_RAT Aquaporin 5.>pir|A55630|A55630 aquaporin-5, s...    82   9e-15   
gb:AF271661_1782161 Vitis berlandieri x Vitis rupestris putative...    82   1e-14   
gb:ACU58207_1745464 Allium cepa aquaporin homologue mRNA, partia...    82   1e-14   
gb:VVI289866_1727517 Vitis vinifera mRNA for putative aquaporin ...    82   1e-14   
gb:AY177613_1426789 Ovis aries aquaporin 5 (AQP5) mRNA, complete...    82   1e-14   
pir|T12439|T12439 tonoplast intrinsic protein - common ice plant...    82   1e-14   
sp|P26587|TI31_ARATH|TI31_ARATH Aquaporin TIP3.1 (Tonoplast intrinsic prote...    82   1e-14   
sp|Q9WTY4|AQP5_MOUSE|AQP5_MOUSE Aquaporin 5.>gb:AK009302_1155058 Mus muscul...    82   1e-14   
gb:STU65700_1723146 Solanum tuberosum putative membrane channel ...    81   1e-14   
gb:AY839872_1630502 Vitis vinifera aquaporin (TIP1;1) mRNA, comp...    81   1e-14   
gb:AE016959_1023221 Oryza sativa (japonica cultivar-group) chrom...    81   1e-14   
pir|T48884|T48884 membrane channel protein [imported] - potato (...    81   1e-14   
sp|P23958|TIPA_PHAVU|TIPA_PHAVU Probable aquaporin TIP-type alpha (Tonoplas...    81   1e-14   
sp|Q41975|TI22_ARATH|TI22_ARATH Probable aquaporin TIP2.2 (Tonoplast intrin...    81   1e-14   
gb:BC084336_2563720 Xenopus laevis hypothetical LOC495140, mRNA ...    81   2e-14   
gb:AJ605573_1811920 Ricinus communis mRNA for aquaporin (Tip1-1 ...    81   2e-14   
gb:AB114830_1527475 Oryza sativa (japonica cultivar-group) OsTIP...    81   2e-14   
gb:AX597681_1471340 Sequence 1 from Patent WO02090557.>gb:AF0539...    81   2e-14   
pir|T14000|T14000 aquaporin TIP7 - common sunflower>gb:HASRB7_16...    81   2e-14   
pir|T10253|T10253 membrane protein MP28 - cucurbit>gb:CUCMP28B_1...    81   2e-14   
gb:AF004393_1760689 Arabidopsis thaliana salt-stress induced ton...    80   3e-14   
gb:CR380950_1649657 Candida glabrata strain CBS138 chromosome D ...    80   3e-14   
gb:BOU92652_1633929 Brassica oleracea var. botrytis tonoplast in...    80   3e-14   
gb:AY243804_1592437 Zea mays tonoplast water channel mRNA, compl...    80   3e-14   
gb:AY130971_1581208 Brassica oleracea var. botrytis tonoplast in...    80   3e-14   
gb:AY065181_1566335 Arabidopsis thaliana delta tonoplast intrins...    80   3e-14   
pir|T07819|T07819 probable water channel protein delta-VM23 - ra...    80   3e-14   
pir|T01648|T01648 probable tonoplast aquaporin - maize>gb:AF0571...    80   3e-14   
pir|JQ1106|JQ1106 tonoplast intrinsic protein alpha - kidney bean      80   3e-14   
sp|Q41951|TI21_ARATH|TI21_ARATH Aquaporin TIP2.1 (Tonoplast intrinsic prote...    80   3e-14   
sp|Q41963|TI12_ARATH|TI12_ARATH Aquaporin TIP1.2 (Tonoplast intrinsic prote...    80   3e-14   
gb:AB107014_2465227 Hyla japonica mRNA for water channel protein...    80   3e-14   
gb:BT019863_2151574 Synthetic construct Homo sapiens aquaporin 5...    80   3e-14   
gb:CR542024_1994250 Homo sapiens full open reading frame cDNA cl...    80   3e-14   
gb:AJ843991_1814683 Plantago major partial mRNA for aquaporin 1 ...    80   3e-14   
pir|T48886|T48886 aquaporin [imported] - Vernicia fordii>gb:AF04...    80   3e-14   
pir|T14001|T14001 aquaporin TIP18 - common sunflower>gb:HAST18_1...    80   3e-14   
pir|JN0557|JN0557 lens fiber membrane major intrinsic protein - ...    80   3e-14   
pir|I64818|I64818 water-channel aquaporin 2 - human>gb:S73197_20...    80   3e-14   
sp|Q9FGL2|TI23_ARATH|TI23_ARATH Probable aquaporin TIP2.3 (Tonoplast intrin...    80   3e-14   
sp|Q06019|MIP_RANPI|MIP_RANPI Lens fiber major intrinsic protein (MIP26) (...    80   3e-14   
sp|P55064|AQP5_HUMAN|AQP5_HUMAN Aquaporin 5.>gb:AX405909_1467837 Sequence 3...    80   3e-14   
sp|P41181|AQP2_HUMAN|AQP2_HUMAN Aquaporin-CD (AQP-CD) (Water channel protei...    80   3e-14   
gb:AF326501_1786647 Zea mays tonoplast membrane integral protein...    80   4e-14   
gb:BOU92651_1633928 Brassica oleracea var. botrytis tonoplast in...    80   4e-14   
pir|T10251|T10251 membrane protein MP23 precursor - cucurbit>gb:...    80   4e-14   
sp|O82598|TI13_ARATH|TI13_ARATH Putative aquaporin TIP1.3 (Tonoplast intrin...    80   4e-14   
pir|JQ2287|JQ2287 SPCP1 protein - soybean>gb:SOYNODA_1716066 Gly...    79   6e-14   
pir|S48116|S48116 integral membrane protein - garden snapdragon        79   6e-14   
gb:AF290619_1783620 Nicotiana glauca putative gamma TIP (MIP3) m...    79   7e-14   
gb:AF118381_1769621 Brassica napus tonoplast intrinsic protein (...    79   7e-14   
gb:AE017343_1755484 Cryptococcus neoformans var. neoformans JEC2...    79   7e-14   
gb:AB126924_1528275 Prunus persica Pr-gTIP1 mRNA for tonoplast i...    79   7e-14   
pir|T10804|T10804 tonoplast intrinsic protein, delta type - upla...    79   7e-14   
pir|T12632|T12632 water channel protein - common sunflower>gb:HA...    79   7e-14   
sp|P24422|TIP2_TOBAC|TIP2_TOBAC Probable aquaporin TIP-type RB7-18C (Tonopl...    79   7e-14   
gb:AF326502_1786648 Zea mays tonoplast membrane integral protein...    79   1e-13   
gb:POC314583_1700957 Posidonia oceanica mRNA for putative tonopl...    79   1e-13   
gb:NTAQP1_1691467 N.tabacum mRNA for aquaporin 1.                      79   1e-13   
gb:NTA237751_1691269 Nicotiana tabacum mRNA for tonoplast intrin...    79   1e-13   
gb:D84669_1674869 Raphanus sativus mRNA for VM23, complete seque...    79   1e-13   
gb:AY087558_1572588 Arabidopsis thaliana clone 36633 mRNA, compl...    79   1e-13   
gb:ATGTIPMR_1551884 A.thaliana mRNA for tonoplast intrinsic prot...    79   1e-13   
pir|S13718|S13718 probable membrane channel protein RB7 - Arabid...    79   1e-13   
sp|P21653|TIP1_TOBAC|TIP1_TOBAC Probable aquaporin TIP-type RB7-5A (Tonopla...    79   1e-13   
sp|P25818|TI11_ARATH|TI11_ARATH Aquaporin TIP1.1 (Tonoplast intrinsic prote...    79   1e-13   
pir|T51819|T51819 gamma tonoplast intrinsic protein 2 [imported]...    78   1e-13   
sp|O62735|AQP2_SHEEP|AQP2_SHEEP Aquaporin-CD (AQP-CD) (Water channel protei...    78   1e-13   
gb:AY430098_2532362 Coturnix coturnix aquaporin-2 mRNA, complete...    78   2e-13   
gb:MMU27502_2120041 Mus musculus lens major intrinsic protein (M...    78   2e-13   
gb:BC082567_2108408 Mus musculus major intrinsic protein of eye ...    78   2e-13   
gb:HSAF000143_2010054 Human putative alternative lens membrane i...    78   2e-13   
gb:TGTIP1GEN_1725038 T.gesneriana mRNA for tonoplast intrinsic p...    78   2e-13   
gb:CEF40F9_1363739 Caenorhabditis elegans cosmid F40F9, complete...    78   2e-13   
pir|T22051|T22051 hypothetical protein F40F9.9 - Caenorhabditis ...    78   2e-13   
sp|P09011|MIP_RAT|MIP_RAT Lens fiber major intrinsic protein (MIP26) (MP...    78   2e-13   
sp|P51180|MIP_MOUSE|MIP_MOUSE Lens fiber major intrinsic protein (MIP26) (...    78   2e-13   
sp|P30301|MIP_HUMAN|MIP_HUMAN Lens fiber major intrinsic protein (MIP26) (...    78   2e-13   
sp|P53386|AQY1_YEAST|AQY1_YEAST Aquaporin-like protein AQY1.>pir|S58822|S58...    78   2e-13   
gb:CR380947_1649041 Candida glabrata strain CBS138 chromosome A ...    77   2e-13   
gb:AB011374_1407754 Canis familiaris aquaporin1 mRNA for AQP-CHI...    77   2e-13   
pir|T19636|T19636 hypothetical protein C32C4.2 - Caenorhabditis ...    77   2e-13   
gb:S73196_2041310 AQP2=water-channel aquaporin 2 [human, autosom...    77   3e-13   
gb:AF290618_1783619 Nicotiana glauca putative delta TIP (MIP2) m...    77   3e-13   
gb:AF495880_1421409 Oryctolagus cuniculus aquaporin 1 mRNA, part...    77   3e-13   
gb:AP004784_1845024 Oryza sativa (japonica cultivar-group) genom...    77   4e-13   
gb:AF321111_1785922 Saccharomyces chevalieri aquaporin 2 gene, c...    77   4e-13   
gb:AX597683_1471341 Sequence 3 from Patent WO02090557.>gb:AF0561...    77   4e-13   
gb:AE016827_343594 Mannheimia succiniciproducens MBEL55E, comple...    77   4e-13   
gb:AY151156_2515306 Xenopus laevis aquaporin mRNA, complete cds.       76   5e-13   
gb:AF452015_1800843 Petunia x hybrida aquaporin-like protein (TI...    76   5e-13   
gb:BC019966_2093171 Mus musculus aquaporin 2, mRNA (cDNA clone M...    76   6e-13   
gb:AY485151_2085545 Cavia porcellus aquaporin 0 (AQP0) mRNA, par...    76   6e-13   
gb:AF020519_2051065 Mus musculus aquaporin (mAQP2) mRNA, complet...    76   6e-13   
gb:SST242805_1722600 Sporobolus stapfianus mRNA for putative gam...    76   6e-13   
gb:PAB133748_1698621 Picea abies mRNA for major intrinsic protein.     76   6e-13   
gb:RATKIDDWCA_2132749 Rattus norvegicus mRNA, complete cds.            75   8e-13   
gb:AF145707_1772030 Lotus japonicus clone LJ-AQP1 plasma membran...    75   8e-13   
gb:AY525640_1611626 Triticum aestivum delta tonoplast intrinsic ...    75   8e-13   
sp|P34080|AQP2_RAT|AQP2_RAT Aquaporin-CD (AQP-CD) (Water channel protein ...    75   8e-13   
sp|P56402|AQP2_MOUSE|AQP2_MOUSE Aquaporin-CD (AQP-CD) (Water channel protei...    75   8e-13   
gb:AF020622_2469038 Bufo marinus water channel homolog (AQP-t3) ...    75   1e-12   
gb:AB073316_2463183 Hyla japonica mRNA for water channel protein...    75   1e-12   
gb:AJ605571_1811918 Ricinus communis partial mRNA for putative a...    75   1e-12   
sp|Q9LA79|AQPZ_BRUAB|AQPZ_BRUAB Aquaporin Z (Aquaporin X).>gb:AF148066_4833...    75   1e-12   
gb:BC089685_2566233 Xenopus tropicalis cDNA clone MGC:107936 IMA...    75   1e-12   
gb:AJ829443_2503438 Gallus gallus partial aquaporin 5 homologue ...    75   1e-12   
sp|Q8FY85|AQPZ_BRUSU|AQPZ_BRUSU Aquaporin Z.>gb:AE014291_309405 Brucella su...    75   1e-12   
gb:AY525641_1611627 Triticum aestivum delta tonoplast intrinsic ...    74   2e-12   
pir|S50967|S50967 probable membrane protein YLL053c - yeast (Sac...    74   2e-12   
sp|Q7NU39|AQPZ_CHRVO|AQPZ_CHRVO Aquaporin Z.>gb:AE016920_357825 Chromobacte...    74   2e-12   
sp|Q13520|AQP6_HUMAN|AQP6_HUMAN Aquaporin 6 (Aquaporin-2 like) (hKID).>gb:H...    74   2e-12   
gb:TAU86763_1724789 Triticum aestivum delta-type tonoplast intri...    74   2e-12   
gb:AY525639_1611625 Triticum aestivum delta tonoplast intrinsic ...    74   2e-12   
pir|A37203|A37203 lens fiber membrane major intrinsic protein - ...    74   2e-12   
sp|P28238|MIP_CHICK|MIP_CHICK Lens fiber major intrinsic protein (MIP26) (...    74   2e-12   
sp|Q88F17|AQPZ_PSEPK|AQPZ_PSEPK Aquaporin Z.>gb:AE016790_333676 Pseudomonas...    74   2e-12   
sp|Q9L772|AQPZ_BRUME|AQPZ_BRUME Aquaporin Z.>pir|AI3260|AI3260 aquaporin [i...    74   2e-12   
sp|Q7WKG2|AQPZ_BORBR|AQPZ_BORBR Aquaporin Z.>sp|Q7W917|AQPZ_BORPA Aquaporin...    74   3e-12   
gb:AF124747_1770291 Pinus strobus putative aquaporin (Sb01) gene...    73   4e-12   
gb:AY231868_1177161 Drosophila yakuba clone yak-em_CG7777 mRNA s...    73   4e-12   
gb:BX571965_793115 Burkholderia pseudomallei strain K96243, chro...    73   4e-12   
gb:AF020623_2469039 Bufo marinus water channel homolog (AQP-t4) ...    73   5e-12   
gb:OSJN00221_1696972 Oryza sativa genomic DNA, chromosome 4, BAC...    73   5e-12   
gb:CR382132_1664980 Yarrowia lipolytica chromosome F of strain C...    73   5e-12   
gb:CP000010_866992 Burkholderia mallei ATCC 23344 chromosome 1, ...    73   5e-12   
sp|P50156|TIP1_ORYSA|TIP1_ORYSA Probable aquaporin TIP-type 1 (Tonoplast in...    73   5e-12   
gb:AJ605570_1811917 Ricinus communis partial mRNA for putative a...    72   7e-12   
gb:AE016820_1749689 Ashbya gossypii (= Eremothecium gossypii) AT...    72   7e-12   
gb:CP000020_871655 Vibrio fischeri ES114 chromosome I, complete ...    72   7e-12   
gb:AP001550_1821306 Oryza sativa (japonica cultivar-group) genom...    72   9e-12   
gb:AF326505_1786651 Zea mays tonoplast membrane integral protein...    72   9e-12   
gb:AE016946_364084 Bacteroides thetaiotaomicron VPI-5482, sectio...    72   9e-12   
gb:AC145396_1744460 Oryza sativa (japonica cultivar-group) chrom...    72   1e-11   
gb:CR382138_1671935 Debaryomyces hansenii chromosome F of strain...    72   1e-11   
gb:BX908798_830352 Parachlamydia-related symbiont UWE25, complet...    72   1e-11   
sp|Q8DB17|AQPZ_VIBVU|AQPZ_VIBVU Aquaporin Z.>gb:AE016803_336660 Vibrio vuln...    72   1e-11   
sp|P73809|AQPZ_SYNY3|AQPZ_SYNY3 Aquaporin Z.>pir|S74902|S74902 aquaporin Z ...    72   1e-11   
gb:CP000031_85020 Silicibacter pomeroyi DSS-3, complete genome.        71   2e-11   
gb:TAU86762_1724788 Triticum aestivum gamma-type tonoplast intri...    71   2e-11   
sp|Q7N5C1|AQPZ_PHOLL|AQPZ_PHOLL Aquaporin Z.>gb:BX571865_786890 Photorhabdu...    71   2e-11   
sp|Q9WTY0|AQP6_RAT|AQP6_RAT Aquaporin 6.>gb:AF083879_2053908 Rattus norve...    71   2e-11   
gb:AF326508_1786654 Zea mays tonoplast membrane integral protein...    70   3e-11   
gb:CR378667_94683 Photobacterium profundum SS9; segment 5/12.          70   3e-11   
gb:CR382122_1655236 Kluyveromyces lactis strain NRRL Y-1140 chro...    70   3e-11   
gb:AY243803_1592436 Zea mays tonoplast water channel (TIP1-1) mR...    70   3e-11   
sp|Q92ZW9|AQZ2_RHIME|AQZ2_RHIME Aquaporin Z 2.>pir|A95303|A95303 probable A...    70   3e-11   
sp|Q7MIV9|AQPZ_VIBVY|AQPZ_VIBVY Aquaporin Z.>gb:BA000037_723230 Vibrio vuln...    70   3e-11   
sp|Q8C4A0|AQP6_MOUSE|AQP6_MOUSE Aquaporin 6.>gb:AK082699_1173627 Mus muscul...    70   3e-11   
gb:AY138458_2076724 Notomys alexis aquaporin 2 mRNA, partial cds.      70   4e-11   
gb:BC040630_1982872 Homo sapiens aquaporin 8, mRNA (cDNA clone M...    70   4e-11   
gb:AX642337_1471474 Sequence 1 from Patent WO02093176.>gb:AB0134...    70   4e-11   
pir|S47037|S47037 tonoplast intrinsic protein gamma - barley>gb:...    70   4e-11   
sp|Q92NM3|AQZ1_RHIME|AQZ1_RHIME Aquaporin Z 1.>gb:SME591789_186190 Sinorhiz...    70   4e-11   
sp|O94778|AQP8_HUMAN|AQP8_HUMAN Aquaporin 8.>gb:AF067797_1880564 Homo sapie...    70   4e-11   
gb:AF326506_1786652 Zea mays tonoplast membrane integral protein...    69   6e-11   
sp|Q87MQ5|AQPZ_VIBPA|AQPZ_VIBPA Aquaporin Z.>gb:BA000031_707636 Vibrio para...    69   6e-11   
gb:AF521135_1807873 Kandelia candel tonoplast intrinsic protein ...    69   1e-10   
sp|P60925|AQPZ_RHOPA|AQPZ_RHOPA Aquaporin Z.>gb:BX572601_802098 Rhodopseudo...    68   1e-10   
gb:AP001550_1821307 Oryza sativa (japonica cultivar-group) genom...    67   3e-10   
gb:AF326507_1786653 Zea mays tonoplast membrane integral protein...    67   3e-10   
gb:DDU68246_1377403 Dictyostelium discoideum WacA (wacA) gene, c...    67   4e-10   
pir|T44518|T44518 aquaporin homolog [imported] - Plesiomonas shi...    67   4e-10   
sp|Q9HWZ3|AQPZ_PSEAE|AQPZ_PSEAE Aquaporin Z.>pir|F83141|F83141 aquaporin Z ...    67   4e-10   
gb:BC081511_2562342 Danio rerio zgc:103682, mRNA (cDNA clone MGC...    66   5e-10   
gb:RNMIP26R_2135249 Rat mRNA fragment for main intrinsic protein...    66   5e-10   
pir|S01439|S01439 lens fiber membrane major intrinsic protein - ...    66   5e-10   
gb:AF467246_1802415 Blumeria graminis f. sp. hordei aquaporin mR...    66   6e-10   
gb:BGR544064_1632961 Blumeria graminis aqu1 gene for aquaporin, ...    66   6e-10   
gb:AY389618_1178249 Hyacinthus orientalis mitochondrial tonoplas...    66   6e-10   
sp|Q8UI24|AQZ1_AGRT5|AQZ1_AGRT5 Aquaporin Z 1.>pir|G97416|G97416 aquaporin ...    66   6e-10   
gb:AF548383_1422419 Ovis aries aquaporin 8 mRNA, partial cds.          65   8e-10   
sp|Q8UJW4|AQZ2_AGRT5|AQZ2_AGRT5 Aquaporin Z 2.>pir|AC3204|AC3204 aquaporin ...    65   8e-10   
gb:AY069151_1293881 Drosophila melanogaster GH16993 full insert ...    65   1e-09   
gb:AE013599_1133551 Drosophila melanogaster chromosome 2R, compl...    65   1e-09   
sp|Q7NNP3|AQPZ_GLOVI|AQPZ_GLOVI Aquaporin Z.>gb:BA000045_740442 Gloeobacter...    65   1e-09   
sp|Q9STX9|TI51_ARATH|TI51_ARATH Putative aquaporin TIP5.1 (Tonoplast intrin...    65   1e-09   
gb:AF254799_1781153 Hordeum vulgare tonoplast intrinsic protein ...    64   2e-09   
gb:AB032841_1195038 Dictyostelium discoideum gene for AqpA, comp...    64   2e-09   
sp|Q89EG9|AQPZ_BRAJA|AQPZ_BRAJA Aquaporin Z.>gb:BA000040_735376 Bradyrhizob...    64   2e-09   
gb:AE013599_1133553 Drosophila melanogaster chromosome 2R, compl...    64   3e-09   
gb:AP006618_557791 Nocardia farcinica IFM 10152 DNA, complete ge...    64   3e-09   
sp|Q8EHC1|AQPZ_SHEON|AQPZ_SHEON Aquaporin Z.>gb:AE015574_315711 Shewanella ...    64   3e-09   
gb:AF275316_1782517 Lotus japonicus multifunctional transport in...    63   4e-09   
gb:AE016758_325051 Escherichia coli CFT073 section 4 of 18 of th...    63   4e-09   
gb:ECU38664_134086 Escherichia coli aquaporin Z (AqpZ) gene, com...    63   4e-09   
gb:ECOMIPRP_129451 Escherichia coli gene for MIP related protein...    63   4e-09   
sp|P60845|AQPZ_ECOL6|AQPZ_ECOL6 Aquaporin Z.>sp|P60844|AQPZ_ECOLI Aquaporin...    63   4e-09   
sp|Q8X6K6|AQPZ_ECO57|AQPZ_ECO57 Aquaporin Z.>pir|A99749|A99749 transmembran...    63   4e-09   


>pir|T09796|T09796 drought-induced major intrinsic protein PIPc -
           Craterostigma plantagineum>gb:CPPIPC_1648682
           Craterostigma plantagineum mRNA for major intrinsic
           protein PIPc.
          Length = 198

 Score =  243 bits (620), Expect = 2e-63
 Identities = 122/174 (70%), Positives = 137/174 (78%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRAV+YM                   + ++ +GGGANTV PG++KG  L 
Sbjct: 24  GLFLARKVSLIRAVSYMIAQCLGAICGVGLVKAFMHNPYNRLGGGANTVAPGYNKGTALG 83

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 84  AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 143

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTP 161
           FGAAVI NN  AWDDHWIFWVGP LGA+A A+YHQ +LRAQA KAL GSF+S P
Sbjct: 144 FGAAVIFNNGKAWDDHWIFWVGPFLGALAAAIYHQYILRAQAAKAL-GSFRSNP 196



>pir|T12557|T12557 mipE protein - common ice
           plant>gb:MCU73467_1685872 Mesembryanthemum crystallinum
           water channel protein MipE mRNA, complete cds.
          Length = 284

 Score =  242 bits (618), Expect = 4e-63
 Identities = 121/174 (69%), Positives = 138/174 (79%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRAV+YM                  K ++++VGGGAN+V  G+SKG  L 
Sbjct: 110 GLFLARKVSLIRAVSYMIAQCLGAICGVGLVKAFMKGYYNSVGGGANSVAHGYSKGTALG 169

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 170 AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 229

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTP 161
           FGAAVI N+K  WDDHWIFWVGPM+GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct: 230 FGAAVIFNSKKNWDDHWIFWVGPMVGALAAAAYHQYILRAAAIKAL-GSFRSNP 282



>gb:AF314656_1785355 Brassica oleracea aquaporin (PIP3) mRNA,
           complete cds.
          Length = 281

 Score =  241 bits (615), Expect = 9e-63
 Identities = 120/172 (69%), Positives = 136/172 (79%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RAV YM                  K  ++T+GGGANTV PG+SKG  L 
Sbjct: 107 GLFLARKVSLVRAVGYMIAQCLGAICGVGFVKAFMKTPYNTLGGGANTVAPGYSKGTALG 166

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 167 AEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARS 226

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
           FGAAVI+NN+ AWDDHWIFWVGP +GA+A A YHQ +LRA AVKAL  SF+S
Sbjct: 227 FGAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAVKAL-ASFRS 277



>gb:MCU26538_1685857 Mesembryanthemum crystallinum major intrinsic
           protein homolog (mipE) mRNA, partial cds.
          Length = 252

 Score =  241 bits (615), Expect = 9e-63
 Identities = 120/174 (68%), Positives = 138/174 (79%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRAV+YM                  K ++++VGGGAN+V  G+SKG  L 
Sbjct: 78  GLFLARKVSLIRAVSYMIAQCLGAICGVGLVKAFMKGYYNSVGGGANSVAHGYSKGTALG 137

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF +VYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 138 AEIIGTFVVVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 197

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTP 161
           FGAAVI N+K  WDDHWIFWVGPM+GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct: 198 FGAAVIFNSKKNWDDHWIFWVGPMVGALAAAAYHQYILRAAAIKAL-GSFRSNP 250



>gb:AF141900_1771604 Vitis berlandieri x Vitis rupestris putative
           aquaporin PIP2-2 (PIP2-2) mRNA, complete cds.
          Length = 279

 Score =  239 bits (610), Expect = 3e-62
 Identities = 118/174 (67%), Positives = 137/174 (78%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRA+AYM                  K F++++GGGAN+V  G++KG  L 
Sbjct: 105 GLFLARKVSLIRALAYMVAQCLGAICGVGLVKAFMKSFYNSLGGGANSVAAGYNKGTALG 164

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 165 AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 224

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTP 161
           FGAAVI+NN+  WDD WIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct: 225 FGAAVIYNNEKVWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNP 277



>gb:AJ849325_1814743 Populus tremula x Populus tremuloides mRNA for
           putative plasma membrane intrinsic protein (pip2.2
           gene).
          Length = 279

 Score =  238 bits (608), Expect = 6e-62
 Identities = 119/174 (68%), Positives = 136/174 (78%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRAVAYM                  K  ++++GGGANTV  G++ G  L 
Sbjct: 105 GLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKKKYNSLGGGANTVAMGYNTGTALG 164

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 165 AEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARS 224

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTP 161
           FGAAVI NN+ AWDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct: 225 FGAAVIFNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNP 277



>gb:AF452012_1800840 Petunia x hybrida aquaporin-like protein
           (PIP2;1) mRNA, complete cds.
          Length = 283

 Score =  238 bits (607), Expect = 7e-62
 Identities = 116/174 (66%), Positives = 135/174 (77%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL RA+AY+                  K +++++GGGAN+V  G+S G  L 
Sbjct: 109 GLFLARKVSLTRAIAYIISQSLGAICGVGLVKAFMKSYYNSLGGGANSVNSGYSNGTALG 168

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 169 AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 228

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTP 161
           FGAAVI+NN   WDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct: 229 FGAAVIYNNDKVWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNP 281



>gb:AF290201_1783587 Solanum chacoense plasma membrane intrinsic
           protein PIP2 mRNA, complete cds.
          Length = 283

 Score =  237 bits (605), Expect = 1e-61
 Identities = 120/172 (69%), Positives = 136/172 (79%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRAVAY+                  K +++  GGGAN VQPG+SKG  L 
Sbjct: 109 GLFLARKVSLIRAVAYIIAQSLGAICGVGFVKLFMKHYYNAEGGGANFVQPGYSKGTALG 168

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 169 AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 228

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
           FGAAVI+ ++  WDD WIFWVGPM+GA+A A+YHQ VLRA AVKAL GSF+S
Sbjct: 229 FGAAVIYGHEKIWDDQWIFWVGPMVGAMAAAIYHQFVLRAGAVKAL-GSFRS 279



>gb:AF051202_1764195 Picea mariana probable aquaporin (Sb01) mRNA,
           complete cds.
          Length = 282

 Score =  237 bits (605), Expect = 1e-61
 Identities = 119/176 (67%), Positives = 135/176 (76%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL RAV YM                  K ++D  GGGAN+V  G++KGVGL 
Sbjct: 108 GLFLARKVSLPRAVLYMVAQCLGAICGCGLVKAFQKSYYDQYGGGANSVAHGYTKGVGLS 167

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 168 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 227

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTPNV 155
           FGAAVI+ ++  WD+HWIFWVGP LGA   A YHQ +LRA A+KAL GSF+S P+V
Sbjct: 228 FGAAVIYGHQKIWDEHWIFWVGPFLGAAGAAAYHQYILRAGAIKAL-GSFRSNPHV 282



 Score = 33.9 bits (76), Expect = 2.7
 Identities = 32/95 (33%), Positives = 45/95 (47%), Gaps = 3/95 (3%)
 Frame = -1

Query: 508 LVAEILATFFLVY-TVFSATDPKRN-ARDSHVPVLA-PLPIGFAVFVAHVATIPITGTGI 338
           ++AE +AT   +Y TV +    KRN A    V +L      G  +FV    T  I+G  I
Sbjct: 42  IIAEFIATLLFLYITVATVIGHKRNQAACGSVGLLGIAWAFGGMIFVLVYCTAGISGGHI 101

Query: 337 NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAG 233
           NPA +FG  +    K +     ++ V   LGAI G
Sbjct: 102 NPAVTFGLFLA--RKVSLPRAVLYMVAQCLGAICG 134



>sp|P93004|PI27_ARATH Aquaporin PIP2.7 (Plasma membrane intrinsic
           protein 3) (Salt-stress induced major intrinsis
           protein).>pir|T05780|T05780 plasma membrane intrinsic
           protein M4E13.150 - Arabidopsis
           thaliana>gb:ATCHRIV82_1547471 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 82.>gb:ATM4E13_1553650
           Arabidopsis thaliana DNA chromosome 4, BAC clone M4E13
           (ESSAII project).>gb:AY062803_1565459 Arabidopsis
           thaliana plasma membrane intrinsic protein (SIMIP)
           (At4g35100; M4E13.150) mRNA, complete
           cds.>gb:AY081580_1568840 Arabidopsis thaliana plasma
           membrane intrinsic protein (SIMIP) (At4g35100) mRNA,
           complete cds.>gb:AY088485_1573504 Arabidopsis thaliana
           clone 7108 mRNA, complete sequence.>gb:AF412110_1797363
           Arabidopsis thaliana AT4g35100/M4E13_150 mRNA, complete
           cds.
          Length = 280

 Score =  237 bits (605), Expect = 1e-61
 Identities = 118/172 (68%), Positives = 135/172 (78%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RA+ YM                  K  ++T+GGGANTV  G+SKG  L 
Sbjct: 106 GLFLARKVSLVRALGYMIAQCLGAICGVGFVKAFMKTPYNTLGGGANTVADGYSKGTALG 165

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 166 AEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARS 225

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
           FGAAVI+NN+ AWDD WIFWVGP LGA+A A YHQ +LRA A+KAL GSF+S
Sbjct: 226 FGAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRASAIKAL-GSFRS 276



>gb:AJ849328_1814746 Populus tremula x Populus tremuloides mRNA for
           putative plasma membrane intrinsic protein (pip2.5
           gene).
          Length = 285

 Score =  236 bits (603), Expect = 2e-61
 Identities = 119/176 (67%), Positives = 133/176 (75%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RA+ YM                  K ++   GGGAN +  GFSKG  L 
Sbjct: 111 GLFLARKVSLVRAILYMVAQCLGAICGCGLVKAFQKSYYTKYGGGANGLASGFSKGTALG 170

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 171 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 230

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTPNV 155
           FGAAVI+N   AWDDHWIFWVGP +GA   A+YHQ VLRA AVKAL GSF+S+ N+
Sbjct: 231 FGAAVIYNEDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKAL-GSFRSSSNI 285



>gb:AJ605575_1811922 Ricinus communis mRNA for aquaporin (Pip2-1
           gene), clone pP5L.
          Length = 280

 Score =  236 bits (603), Expect = 2e-61
 Identities = 119/174 (68%), Positives = 134/174 (77%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRAVAYM                  K+ ++ +GGGAN+V  G+S G  L 
Sbjct: 106 GLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKNPYNRLGGGANSVASGYSNGTALG 165

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 166 AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 225

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTP 161
           FGAAVI+NN   WDDHWIFWVGP +GA+A A YHQ VLRA  +KAL GSF+S P
Sbjct: 226 FGAAVIYNNDKVWDDHWIFWVGPFVGALAAAAYHQYVLRAAGIKAL-GSFRSNP 278



>gb:AF440272_1800059 Nicotiana tabacum aquaporin (NtPIP2;1) mRNA,
           complete cds.
          Length = 284

 Score =  236 bits (602), Expect = 3e-61
 Identities = 115/174 (66%), Positives = 135/174 (77%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RAV Y+                  K +++T+GGGAN VQPG++KG  L 
Sbjct: 110 GLFLARKVSLLRAVGYIIAQSLGAICGVGLVKGFMKHYYNTLGGGANFVQPGYNKGTALG 169

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR+
Sbjct: 170 AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPART 229

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTP 161
           FGAAVI+N +  WDD WIFWVGP +GA+  AVYHQ +LR  A+KAL GSF+S P
Sbjct: 230 FGAAVIYNTEKIWDDQWIFWVGPFVGALVAAVYHQYILRGSAIKAL-GSFRSNP 282



>gb:D85193_1674880 Arabidopsis thaliana mRNA, partial cds.
          Length = 193

 Score =  236 bits (602), Expect = 3e-61
 Identities = 117/172 (68%), Positives = 135/172 (78%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RA+ YM                  K  ++T+GGGANTV  G+SKG  L 
Sbjct: 19  GLFLARKVSLVRALGYMIAQCLGAICGVGFVKAFMKTPYNTLGGGANTVADGYSKGTALG 78

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSH+PV+APLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 79  AEIIGTFVLVYTVFSATDPKRSARDSHIPVVAPLPIGFAVFMVHLATIPITGTGINPARS 138

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
           FGAAVI+NN+ AWDD WIFWVGP LGA+A A YHQ +LRA A+KAL GSF+S
Sbjct: 139 FGAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRASAIKAL-GSFRS 189



>gb:AF141642_1771587 Vitis berlandieri x Vitis rupestris putative
           aquaporin PIP2-1 (PIP2-1) mRNA, complete cds.
          Length = 284

 Score =  236 bits (601), Expect = 4e-61
 Identities = 118/176 (67%), Positives = 133/176 (75%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRA+ YM                    ++D  GGGAN +  G+SKG GL 
Sbjct: 110 GLFLARKVSLIRAILYMVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLG 169

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 170 AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 229

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTPNV 155
            GAAVI+NN+ AWDD WIFWVGP +GA   A YHQ +LRA A+KAL GSF+STP V
Sbjct: 230 LGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAIKAL-GSFRSTPRV 284



>pir|T14600|T14600 plasma membrane major intrinsic protein 2 -
           beet>gb:BVU60148_1643228 Beta vulgaris plasma membrane
           major intrinsic protein 2 mRNA, complete cds.
          Length = 281

 Score =  236 bits (601), Expect = 4e-61
 Identities = 117/174 (67%), Positives = 134/174 (77%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RA  YM                     +  +GGGAN+VQPG++KG  L 
Sbjct: 107 GLFLARKVSLLRAFFYMVGQCAGAICGVGLVKAFMSGAYVRLGGGANSVQPGYNKGTALG 166

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 167 AEIIGTFVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVHLATIPITGTGINPARS 226

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTP 161
           FGAAVI N+K AWDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct: 227 FGAAVIFNDKKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-GSFRSNP 279



 Score = 33.5 bits (75), Expect = 3.5
 Identities = 31/119 (26%), Positives = 50/119 (42%), Gaps = 3/119 (2%)
 Frame = -1

Query: 508 LVAEILATFFLVYTVFSATDPKRNARDSHVPV-LAPLPIGFA--VFVAHVATIPITGTGI 338
           ++AE +AT   +Y   +     +N  D    V L  +   F   +F+    T  I+G  I
Sbjct: 41  VIAEFIATLLFLYITVATVIGYKNETDPCATVGLLGIAWSFGGMIFILVYCTAGISGGHI 100

Query: 337 NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTP 161
           NPA +FG  +    K +    + + VG   GAI G    +  +    V+  GG+    P
Sbjct: 101 NPAVTFGLFLA--RKVSLLRAFFYMVGQCAGAICGVGLVKAFMSGAYVRLGGGANSVQP 157



>gb:ATU78297_1557276 Arabidopsis thaliana plasma membrane intrinsic
           protein PIP3 mRNA, complete cds.
          Length = 280

 Score =  234 bits (598), Expect = 8e-61
 Identities = 117/172 (68%), Positives = 134/172 (77%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLA KVSL+RA+ YM                  K  ++T+GGGANTV  G+SKG  L 
Sbjct: 106 GLFLAGKVSLVRALGYMIAQCLGAICGVGFVKAFMKTPYNTLGGGANTVADGYSKGTALG 165

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 166 AEIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARS 225

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
           FGAAVI+NN+ AWDD WIFWVGP LGA+A A YHQ +LRA A+KAL GSF+S
Sbjct: 226 FGAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRASAIKAL-GSFRS 276



>gb:AB058680_1521731 Pyrus communis Py-PIP2-2 mRNA for plasma
           membrane intrinsic protein 2-2, complete cds.
          Length = 287

 Score =  234 bits (598), Expect = 8e-61
 Identities = 117/176 (66%), Positives = 132/176 (75%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RAV YM                  K ++   GGGAN++  G+S GVGL 
Sbjct: 113 GLFLARKVSLVRAVLYMVAQSLGAIAGVALVKAFQKSYYIKYGGGANSLSDGYSTGVGLA 172

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 173 AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARS 232

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTPNV 155
            GAAVI+N   AWDD WIFWVGP +GA   A YHQ +LRA AVKAL GSF+S P+V
Sbjct: 233 LGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKAL-GSFRSNPHV 287



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 37/120 (30%), Positives = 53/120 (44%), Gaps = 9/120 (7%)
 Frame = -1

Query: 508 LVAEILATFFLVYTVF-------SATDPKRNARD-SHVPVLA-PLPIGFAVFVAHVATIP 356
           L+AE +AT   +Y          S TDP  NA     V +L      G  +FV    T  
Sbjct: 41  LIAEFVATLLFLYVTVLTVIGYKSQTDPAVNADACGGVGILGIAWAFGGMIFVLVYCTAG 100

Query: 355 ITGTGINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGS 176
           I+G  INPA +FG  +    K +     ++ V   LGAIAG    +   ++  +K  GG+
Sbjct: 101 ISGGHINPAVTFGLFLA--RKVSLVRAVLYMVAQSLGAIAGVALVKAFQKSYYIKYGGGA 158



>gb:AY823263_1628894 Vitis vinifera aquaporin (PIP2-1) mRNA,
           complete cds.
          Length = 284

 Score =  233 bits (595), Expect = 2e-60
 Identities = 118/176 (67%), Positives = 133/176 (75%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRA+ YM                    ++D  GGGAN +  G+SKG GL 
Sbjct: 110 GLFLARKVSLIRAILYMVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLG 169

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 170 AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 229

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTPNV 155
            GAAVI+NN+ AWDD WIFWVGP +GA   A YHQ +LRA AVKAL GSF+ST +V
Sbjct: 230 LGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKAL-GSFRSTTHV 284



>pir|T14889|T14889 membrane intrinsic protein Mip-2 - Norway
           spruce>gb:PAZ93764_1698989 P.abies mRNA for membrane
           intrinsic protein.
          Length = 309

 Score =  233 bits (593), Expect = 3e-60
 Identities = 120/183 (65%), Positives = 134/183 (73%), Gaps = 7/183 (3%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLT-------KDFFDTVGGGANTVQPGF 524
           GLFLARKVSL RA+ YM                 T       K F+D  GGGAN V  G+
Sbjct: 108 GLFLARKVSLPRAILYMIAQCLGAICGTGLAICGTGLVKSFQKSFYDRYGGGANYVHHGY 167

Query: 523 SKGVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGT 344
           +KGVGL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGT
Sbjct: 168 TKGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGT 227

Query: 343 GINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQST 164
           GINPARSFGAAVI+ +K +WDDHWIFWVGP  GA   A YHQ +LRA A+KAL GSF+S 
Sbjct: 228 GINPARSFGAAVIYGHKQSWDDHWIFWVGPFAGAALAAAYHQYILRAAAIKAL-GSFRSN 286

Query: 163 PNV 155
            NV
Sbjct: 287 GNV 289



>gb:AJ849324_1814742 Populus tremula x Populus tremuloides mRNA for
           putative plasma membrane intrinsic protein (pip2.1
           gene).
          Length = 279

 Score =  232 bits (592), Expect = 4e-60
 Identities = 117/174 (67%), Positives = 134/174 (77%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL LARKVSLIRAV YM                  K +++++GGGANTV  G+S G  L 
Sbjct: 105 GLLLARKVSLIRAVGYMVAQCLGAVCGVGLVKAFMKPYYNSLGGGANTVAHGYSTGTALG 164

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LV TVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 165 AEIIGTFVLVNTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARS 224

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTP 161
           FGAAVI N+K AWDDHWIFWVGP +GA+A A YHQ +LRA A+KAL GSF+S P
Sbjct: 225 FGAAVIINDKKAWDDHWIFWVGPFVGALAAAAYHQYILRAGAIKAL-GSFRSHP 277



>gb:AF003728_1760663 Arabidopsis thaliana plasma membrane intrinsic
           protein (SIMIP) mRNA, complete cds.
          Length = 280

 Score =  232 bits (592), Expect = 4e-60
 Identities = 116/171 (67%), Positives = 133/171 (77%)
 Frame = -1

Query: 679 LFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLVA 500
           LFLA KVSL+RA+ YM                  K  ++T+GGGANTV  G+SKG  L A
Sbjct: 107 LFLAGKVSLVRALGYMIAQCLGAICGVGFVKAFMKTPYNTLGGGANTVADGYSKGTALGA 166

Query: 499 EILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSF 320
           EI+ TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSF
Sbjct: 167 EIIGTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSF 226

Query: 319 GAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
           GAAVI+NN+ AWDD WIFWVGP LGA+A A YHQ +LRA A+KAL GSF+S
Sbjct: 227 GAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRASAIKAL-GSFRS 276



>sp|Q9ZVX8|PI28_ARATH Probable aquaporin PIP2.8 (Plasma membrane
           intrinsic protein 3b) (PIP3b).>pir|A84545|A84545
           hypothetical protein At2g16850 [imported] - Arabidopsis
           thaliana>gb:AC005167_1532220 Arabidopsis thaliana
           chromosome 2 clone F12A24 map mi398, complete
           sequence.>gb:AC005825_1533087 Arabidopsis thaliana
           chromosome 2 clone T24I21 map mi398, complete
           sequence.>gb:BT005214_1638154 Arabidopsis thaliana
           At2g16850 mRNA, complete cds.
          Length = 278

 Score =  232 bits (592), Expect = 4e-60
 Identities = 118/174 (67%), Positives = 132/174 (75%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL RAVAYM                     +  +GGGANTV  G+S G  L 
Sbjct: 104 GLFLARKVSLPRAVAYMVAQCLGAICGVGLVKAFMMTPYKRLGGGANTVADGYSTGTALG 163

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 164 AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 223

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTP 161
           FGAAVI+NN+ AWDDHWIFWVGP +GA+A A YHQ +LRA A+KAL  SF+S P
Sbjct: 224 FGAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAL-ASFRSNP 276



>gb:AF067185_1765599 Samanea saman aquaporin 2 (Aqp2) mRNA, complete
           cds.
          Length = 287

 Score =  232 bits (591), Expect = 5e-60
 Identities = 116/176 (65%), Positives = 131/176 (74%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRA+ YM                  K ++   GGGANT+  G+S G GL 
Sbjct: 113 GLFLARKVSLIRAILYMVAQCLGAICGVGLVKAFQKAYYSRYGGGANTLSDGYSTGTGLG 172

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGINPARS
Sbjct: 173 AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS 232

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTPNV 155
            GAAVI N + AWDDHWIFWVGP +GA   A YHQ +LRA A KAL GSF+S P+V
Sbjct: 233 LGAAVIFNQQKAWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAKAL-GSFRSNPSV 287



>sp|Q9FF53|PI24_ARATH Probable aquaporin PIP2.4 (Plasma membrane
           intrinsic protein 2.4).>gb:AB005246_1509601 Arabidopsis
           thaliana genomic DNA, chromosome 5, P1
           clone:MUP24.>gb:AY087245_1572279 Arabidopsis thaliana
           clone 33231 mRNA, complete sequence.
          Length = 291

 Score =  232 bits (591), Expect = 5e-60
 Identities = 116/174 (66%), Positives = 131/174 (75%), Gaps = 2/174 (1%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+R V Y+                    ++   GGGAN +  G++KG GL 
Sbjct: 113 GLFLARKVSLVRTVLYIVAQCLGAICGCGFVKAFQSSYYTRYGGGANELADGYNKGTGLG 172

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 173 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 232

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALG--GSFQS 167
           FGAAVI+NN+ AWDD WIFWVGPM+GA A A YHQ +LRA A+KALG  GSF S
Sbjct: 233 FGAAVIYNNEKAWDDQWIFWVGPMIGAAAAAFYHQFILRAAAIKALGSFGSFGS 286



>gb:AY086460_1571508 Arabidopsis thaliana clone 25220 mRNA, complete
           sequence.
          Length = 285

 Score =  231 bits (590), Expect = 7e-60
 Identities = 116/176 (65%), Positives = 129/176 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRAV YM                    ++D  GGGAN++  G++ G GL 
Sbjct: 111 GLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSSYYDRYGGGANSLADGYNTGTGLA 170

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 171 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 230

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTPNV 155
           FGAAVI+N    WDDHWIFWVGP +GA   A YHQ VLRA   K+L GSF+S  NV
Sbjct: 231 FGAAVIYNKSKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSL-GSFRSAANV 285



>sp|P43287|PI22_ARATH Aquaporin PIP2.2 (Plasma membrane intrinsic
           protein 2b) (PIP2b) (TMP2b).>pir|D84789|D84789
           hypothetical protein At2g37170 [imported] - Arabidopsis
           thaliana>gb:AC006260_1533885 Arabidopsis thaliana
           chromosome 2 clone T2N18 map ve018, complete sequence.
          Length = 285

 Score =  231 bits (590), Expect = 7e-60
 Identities = 116/176 (65%), Positives = 129/176 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRAV YM                    ++D  GGGAN++  G++ G GL 
Sbjct: 111 GLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSSYYDRYGGGANSLADGYNTGTGLA 170

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 171 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 230

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTPNV 155
           FGAAVI+N    WDDHWIFWVGP +GA   A YHQ VLRA   K+L GSF+S  NV
Sbjct: 231 FGAAVIYNKSKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSL-GSFRSAANV 285



>sp|P42767|PIP1_ATRCA Aquaporin PIP-type.>gb:ACU18403_1745438
           Atriplex canescens aquaporin mRNA, complete cds.
          Length = 282

 Score =  231 bits (589), Expect = 9e-60
 Identities = 114/174 (65%), Positives = 132/174 (75%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RA+ YM                  K  ++  GGGAN+V  G++KG    
Sbjct: 108 GLFLARKVSLLRALVYMIAQCAGAICGVGLVKAFMKGPYNQFGGGANSVALGYNKGTAFG 167

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AE++ TF LVYTVFSATDPKR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 168 AELIGTFVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVHLATIPITGTGINPARS 227

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTP 161
           FGAAVI+N K  WDDHWIFWVGP +GA+A A YHQ VLRA A+KAL GSF+S P
Sbjct: 228 FGAAVIYNKKRVWDDHWIFWVGPFVGALAAAAYHQYVLRAAAIKAL-GSFRSNP 280



>gb:AF452013_1800841 Petunia x hybrida aquaporin-like protein
           (PIP2;2) mRNA, complete cds.
          Length = 256

 Score =  230 bits (587), Expect = 2e-59
 Identities = 118/175 (67%), Positives = 136/175 (77%), Gaps = 1/175 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXX-XXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGL 506
           GLFLARKVSLIRAVAY+                 + K +++++GGGAN V  G++KG  L
Sbjct: 81  GLFLARKVSLIRAVAYIISQCLGAICGVGLVKAFMNKHYYNSLGGGANEVASGYNKGTAL 140

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
            AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct: 141 GAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR 200

Query: 325 SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTP 161
           SFGAAVI+N   AWDD WIFWVGP +GA+  A+YHQ VLRA AVKAL GSF+S P
Sbjct: 201 SFGAAVIYNQDKAWDDQWIFWVGPFIGALIAALYHQFVLRAGAVKAL-GSFRSNP 254



>pir|S44085|S44085 plasma membrane intrinsic protein 2b -
           Arabidopsis thaliana>gb:ATPIP2B_1553863 A.thaliana mRNA
           for plasma membrane intrinsic protein 2b.
          Length = 285

 Score =  230 bits (587), Expect = 2e-59
 Identities = 115/176 (65%), Positives = 129/176 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRAV YM                    ++D  GGGAN++  G++ G GL 
Sbjct: 111 GLFLARKVSLIRAVLYMVAQCLGAICGVGFRQSFQSSYYDRYGGGANSLADGYNTGTGLA 170

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 171 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 230

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTPNV 155
           FGA+VI+N    WDDHWIFWVGP +GA   A YHQ VLRA   K+L GSF+S  NV
Sbjct: 231 FGASVIYNKSKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSL-GSFRSAANV 285



>pir|T12440|T12440 mipC protein - common ice
           plant>gb:MCU73466_1685871 Mesembryanthemum crystallinum
           water channel protein MipC mRNA, complete cds.
          Length = 287

 Score =  230 bits (587), Expect = 2e-59
 Identities = 115/173 (66%), Positives = 132/173 (76%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLI+AV YM                  K ++   GGGAN +  G++KG GL 
Sbjct: 115 GLFLARKVSLIKAVLYMVAQCLGAICGVGFVKAFQKAYYVRYGGGANEMASGYTKGTGLG 174

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 175 AEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 234

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQST 164
           FGAAVI+N + AWDDHWIFWVGP +GA   A YHQ +LRA A+KAL GSF+S+
Sbjct: 235 FGAAVIYNQQKAWDDHWIFWVGPFIGAAIAAFYHQYILRAAAIKAL-GSFRSS 286



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 35/120 (29%), Positives = 53/120 (44%), Gaps = 9/120 (7%)
 Frame = -1

Query: 508 LVAEILATFFLVYTVF-------SATDPKRNARD-SHVPVLA-PLPIGFAVFVAHVATIP 356
           ++AE +AT   +Y          S TDP  NA     V +L      G  +F+    T  
Sbjct: 43  VIAEFIATLLFLYITVLTVIGYKSQTDPNTNADQCGGVGILGIAWAFGGMIFILVYCTAG 102

Query: 355 ITGTGINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGS 176
           I+G  INPA +FG  +    K +     ++ V   LGAI G  + +   +A  V+  GG+
Sbjct: 103 ISGGHINPAVTFGLFLA--RKVSLIKAVLYMVAQCLGAICGVGFVKAFQKAYYVRYGGGA 160



>gb:AF133530_1770934 Mesembryanthemum crystallinum water channel
           protein MipH (MipH) mRNA, complete cds.
          Length = 291

 Score =  230 bits (586), Expect = 2e-59
 Identities = 113/176 (64%), Positives = 129/176 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SLIRA+ YM                    +++  GGGAN +  G+SKG GL 
Sbjct: 116 GLFLARKLSLIRAIMYMVAQCLGAICGVGFVKAFQSAYYNKYGGGANELSVGYSKGTGLA 175

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 176 AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 235

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTPNV 155
            GAAVI+NN  AWDD WIFWVGP +GA   A+YHQ +LRA  +KALG    ST NV
Sbjct: 236 LGAAVIYNNNKAWDDQWIFWVGPFIGAAIAAIYHQYILRAGFIKALGSFRSSTSNV 291



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 35/122 (28%), Positives = 55/122 (45%), Gaps = 11/122 (9%)
 Frame = -1

Query: 508 LVAEILATFFLVY-TVFSA------TDPKRNARDSHVPVLAPLPIGFA----VFVAHVAT 362
           L+AE +AT   +Y TV +       +DP  +  D+    +  L I +A    +F+    T
Sbjct: 42  LIAEFIATLLFLYITVLTVIGYKHQSDPLVSGADAGCGGVGILGIAWAFGGMIFILVYCT 101

Query: 361 IPITGTGINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALG 182
             I+G  INPA +FG  +    K +     ++ V   LGAI G  + +    A   K  G
Sbjct: 102 AGISGGHINPAVTFGLFLA--RKLSLIRAIMYMVAQCLGAICGVGFVKAFQSAYYNKYGG 159

Query: 181 GS 176
           G+
Sbjct: 160 GA 161



>gb:PTR299449_1702717 Populus tremula x Populus tremuloides mRNA for
           major intrinsic protein 1 (mip1
           gene).>gb:AJ849326_1814744 Populus tremula x Populus
           tremuloides mRNA for putative plasma membrane intrinsic
           protein (pip2.3 gene).
          Length = 285

 Score =  230 bits (586), Expect = 2e-59
 Identities = 114/176 (64%), Positives = 133/176 (75%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RA+ YM                  K ++   GGG + +   +SKG GL 
Sbjct: 111 GLFLARKVSLVRAILYMVAQCLWAICGCGLVKAFPKSYYTNHGGGTHGLAIRYSKGTGLG 170

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVF ATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 171 AEIIGTFVLVYTVFCATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 230

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTPNV 155
           FGAAVI+N + AWDDHWIFWVGP +GA   A+YHQ +LRA AVK+L GSF+S+PN+
Sbjct: 231 FGAAVIYNKEKAWDDHWIFWVGPFIGAAIAALYHQFILRAAAVKSL-GSFRSSPNI 285



>gb:STU18312_1722971 Solanum tuberosum mRNA for major intrinsic
           protein 2.
          Length = 286

 Score =  229 bits (585), Expect = 3e-59
 Identities = 115/172 (66%), Positives = 129/172 (75%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRAV YM                    +++  GGG N + PG +KGVGL 
Sbjct: 114 GLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSAYYNRYGGGVNVMAPGHTKGVGLA 173

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVY VFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 174 AEIIGTFVLVYVVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 233

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
           FGAAVI N   AWD+HWIFWVGP +GA   AVYHQ +LRA A+KAL GSF+S
Sbjct: 234 FGAAVIFNGDKAWDEHWIFWVGPFIGAFIAAVYHQYILRAGAIKAL-GSFRS 284



>gb:AF326492_1786638 Zea mays plasma membrane integral protein
           ZmPIP2-2 mRNA, complete cds.
          Length = 292

 Score =  229 bits (584), Expect = 3e-59
 Identities = 113/172 (65%), Positives = 130/172 (75%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RA+ YM                    +FD  GGGAN++  G+S+G GL 
Sbjct: 120 GLFLARKVSLVRALLYMVAQCLGAVCGVGLVKAFQSAYFDRYGGGANSLASGYSRGAGLG 179

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGINPARS
Sbjct: 180 AEIVGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS 239

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
            GAAV++N    WDDHWIFWVGP+LGA   A YHQ +LRA A+KAL GSF+S
Sbjct: 240 LGAAVVYNKDKPWDDHWIFWVGPLLGAAIAAFYHQYILRAGAIKAL-GSFRS 290



>gb:AP003802_1833567 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1047_A06.
          Length = 290

 Score =  229 bits (583), Expect = 4e-59
 Identities = 114/172 (66%), Positives = 130/172 (75%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RA+ Y+                    +F+  GGGANT+  G+SKG GL 
Sbjct: 118 GLFLARKVSLVRAILYIVAQCLGAICGVGLVKAFQSAYFNRYGGGANTLAAGYSKGTGLA 177

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 178 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 237

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
            GAAVI NN+ AW +HWIFWVGP +GA   A YHQ +LRA A+KAL GSF+S
Sbjct: 238 IGAAVIFNNEKAWHNHWIFWVGPFVGAAIAAFYHQYILRAGAIKAL-GSFRS 288



>pir|T02879|T02879 probable plasma membrane intrinsic protein -
           rice>gb:AF062393_1765289 Oryza sativa aquaporin (PIP2a)
           mRNA, complete cds.
          Length = 290

 Score =  229 bits (583), Expect = 4e-59
 Identities = 114/172 (66%), Positives = 130/172 (75%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RA+ Y+                    +F+  GGGANT+  G+SKG GL 
Sbjct: 118 GLFLARKVSLVRAILYIVAQCLGAICGVGLVNAFPNAYFNRYGGGANTLAAGYSKGTGLA 177

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 178 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 237

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
            GAAVI NN+ AW +HWIFWVGP +GA   A YHQ +LRA A+KAL GSF+S
Sbjct: 238 IGAAVIFNNEKAWHNHWIFWVGPFVGAAIAAFYHQYILRAGAIKAL-GSFRS 288



>gb:AY903443_1632103 Astragalus membranaceus clone AM79 putative
           plasma membrane intrinsic protein mRNA, complete cds.
          Length = 283

 Score =  228 bits (582), Expect = 6e-59
 Identities = 116/172 (67%), Positives = 129/172 (75%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRAV YM                  K ++   GGGAN +  G++KG GL 
Sbjct: 109 GLFLARKVSLIRAVMYMVAQCLGAICGVGFVKAFQKSYYVKFGGGANELADGYNKGTGLA 168

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 169 AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 228

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
           FGAAVI+N   AWDD WIFWVGP +GA   A YHQ VLRA A+KAL GSF+S
Sbjct: 229 FGAAVIYNKDKAWDDQWIFWVGPFVGAAIAAFYHQFVLRAAAIKAL-GSFRS 279



 Score = 35.4 bits (80), Expect = 0.93
 Identities = 33/116 (28%), Positives = 53/116 (45%), Gaps = 5/116 (4%)
 Frame = -1

Query: 508 LVAEILATFFLVY-TVFSATDPKRNARDSHVPVLAPLPIGFA----VFVAHVATIPITGT 344
           ++AE +AT   +Y TV +    K  +       +  L I +A    +FV    T  I+G 
Sbjct: 41  IIAEFIATLLFLYITVLTVIGYKSQSATDQCGGVGILGIAWAFGGMIFVLVYCTAGISGG 100

Query: 343 GINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGS 176
            INPA +FG  +    K +     ++ V   LGAI G  + +   ++  VK  GG+
Sbjct: 101 HINPAVTFGLFLA--RKVSLIRAVMYMVAQCLGAICGVGFVKAFQKSYYVKFGGGA 154



>gb:AY189974_1588463 Juglans regia plasma intrinsic protein 2,2
           mRNA, complete cds.
          Length = 287

 Score =  228 bits (582), Expect = 6e-59
 Identities = 115/176 (65%), Positives = 130/176 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RAV YM                  K ++   GGGAN +  G+SKG GL 
Sbjct: 113 GLFLARKVSLVRAVFYMAAQCLGAVCGCGLVKAFQKAYYSKYGGGANELADGYSKGTGLA 172

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 173 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 232

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTPNV 155
           FGAAVI+    AWDD WIFWVGP +GA   A YHQ +LRA A KAL GSF+S+ ++
Sbjct: 233 FGAAVIYGKDKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAAKAL-GSFRSSSHM 287



>gb:AF255795_1781214 Allium cepa aquaporin 1 (Aqp1) mRNA, complete
           cds.
          Length = 291

 Score =  228 bits (581), Expect = 8e-59
 Identities = 113/167 (67%), Positives = 125/167 (74%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRA+ YM                    ++   GGGANT+  G+SKG GL 
Sbjct: 119 GLFLARKVSLIRALLYMIAQCLGAICGVGFVKAFQSAYYSRYGGGANTLNAGYSKGTGLA 178

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 179 AEIIGTFVLVYTVFAATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 238

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALG 182
           FGAAVI+N   AWDD WIFWVGP +GA   A YHQ VLRA AVKALG
Sbjct: 239 FGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAAYHQYVLRAGAVKALG 285



>gb:OSJN00281_1697897 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0093G06, complete sequence.
          Length = 282

 Score =  228 bits (581), Expect = 8e-59
 Identities = 115/175 (65%), Positives = 131/175 (74%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL LARKVS+IRAV Y+                + K  ++  GGGAN V  G+S G  L 
Sbjct: 108 GLLLARKVSVIRAVMYIVAQCLGGIVGVGIVKGIMKHQYNANGGGANMVASGYSTGTALG 167

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 168 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 227

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTPN 158
            GAAVI+N K AWDDHWIFW GP +GA+A A YHQ +LRA A+KAL GSF+S P+
Sbjct: 228 IGAAVIYNQKKAWDDHWIFWAGPFIGALAAAAYHQYILRAAAIKAL-GSFRSNPS 281



>gb:AF326496_1786642 Zea mays plasma membrane integral protein
           ZmPIP2-7 mRNA, complete cds.
          Length = 287

 Score =  228 bits (580), Expect = 1e-58
 Identities = 111/172 (64%), Positives = 127/172 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFL RKVSL+RA+ YM                  K F++  GGG NTV  G++KG  L 
Sbjct: 115 GLFLGRKVSLVRALLYMIAQCAGAICGAGLAKGFQKSFYNRYGGGVNTVSDGYNKGTALG 174

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGINPARS
Sbjct: 175 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS 234

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
           FG AVI NN  AWDD WI+WVGP +GA   A+YHQ +LR  A+KAL GSF+S
Sbjct: 235 FGPAVIFNNDKAWDDQWIYWVGPFVGAAVAAIYHQYILRGSAIKAL-GSFRS 285



>gb:CAR275315_1645200 Cicer arietinum partial mRNA for putative
           water channel protein.
          Length = 237

 Score =  228 bits (580), Expect = 1e-58
 Identities = 112/172 (65%), Positives = 128/172 (74%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLF+ RKVSL+RAV YM                  K +FD  GGGAN V  G++KG  L 
Sbjct: 65  GLFVGRKVSLLRAVFYMAAQCAGAISGTGLAKGFQKAYFDRYGGGANFVHDGYNKGTALG 124

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 125 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 184

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
           FG+AVI+N    WDD WIFWVGP++GA   A+YHQ +LR  A+KAL GSF+S
Sbjct: 185 FGSAVIYNEGKIWDDQWIFWVGPIIGATVAAIYHQYILRGSAIKAL-GSFRS 235



>gb:AF326491_1786637 Zea mays plasma membrane integral protein
           ZmPIP2-1 mRNA, complete cds.
          Length = 290

 Score =  227 bits (579), Expect = 1e-58
 Identities = 112/172 (65%), Positives = 130/172 (75%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RA+ Y+                    +FD  GGGAN++  G+S+G GL 
Sbjct: 118 GLFLARKVSLVRALLYIVAQCLGAICGVGLVKAFQSAYFDRYGGGANSLASGYSRGTGLG 177

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGINPARS
Sbjct: 178 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS 237

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
            GAAVI+N    WDDHWIFWVGP++GA   A YHQ +LRA A+KAL GSF+S
Sbjct: 238 LGAAVIYNKDKPWDDHWIFWVGPLVGAAIAAFYHQYILRAGAIKAL-GSFRS 288



>gb:AJ849327_1814745 Populus tremula x Populus tremuloides mRNA for
           putative plasma membrane intrinsic protein (pip2.4
           gene).
          Length = 285

 Score =  226 bits (577), Expect = 2e-58
 Identities = 117/172 (68%), Positives = 127/172 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRAV YM                  K ++   GGGANT+  GFS G GL 
Sbjct: 111 GLFLARKVSLIRAVMYMVAQCLGAICGVGLVKAFQKSYYKKYGGGANTLADGFSIGTGLG 170

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 171 AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 230

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
            GAAVI+N   AWD HWIFWVGP  GA   A YHQ +LRA AVKAL GSF+S
Sbjct: 231 LGAAVIYNQDKAWDHHWIFWVGPFAGAAIAAFYHQFILRAGAVKAL-GSFRS 281



>gb:AY189973_1588462 Juglans regia plasma intrinsic protein 2,1
           mRNA, complete cds.
          Length = 287

 Score =  226 bits (577), Expect = 2e-58
 Identities = 114/176 (64%), Positives = 129/176 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RAV YM                  K ++   GGGAN +  G+SKG GL 
Sbjct: 113 GLFLARKVSLVRAVFYMAAQCLGAVCGCGLVKAFQKAYYSKYGGGANELADGYSKGTGLA 172

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 173 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 232

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTPNV 155
           FGAAVI+    AW+D WIFWVGP +GA   A YHQ +LRA A KAL GSF+S+  +
Sbjct: 233 FGAAVIYGKDKAWNDQWIFWVGPFIGAAIAAFYHQYILRAGAAKAL-GSFRSSSTI 287



>gb:PSA243307_1701923 Pisum sativum mRNA for putative plasma
           membrane intrinsic protein (gene pip2-1).
          Length = 285

 Score =  226 bits (576), Expect = 3e-58
 Identities = 111/172 (64%), Positives = 127/172 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLF+ RKVSL+RAV YM                  K FFD  GGGAN +  G++KG  L 
Sbjct: 113 GLFVGRKVSLLRAVFYMAAQCAGAVCGTGLAKGFQKSFFDRYGGGANFIHDGYNKGTALG 172

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 173 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 232

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
           FG+AVI N    WDD W+FWVGP++GA   A+YHQ +LR  A+KAL GSF+S
Sbjct: 233 FGSAVILNQGKIWDDQWVFWVGPIIGATVAAIYHQYILRGSAIKAL-GSFRS 283



>gb:AY243801_1592434 Zea mays aquaporin (PIP2-1) mRNA, complete cds.
          Length = 290

 Score =  226 bits (575), Expect = 4e-58
 Identities = 111/172 (64%), Positives = 129/172 (75%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RA+ Y+                    +FD  GGGAN++  G+S+G G  
Sbjct: 118 GLFLARKVSLVRALLYIVAQCLGAICGVGLVKAFQSAYFDRYGGGANSLASGYSRGTGFG 177

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGINPARS
Sbjct: 178 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS 237

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
            GAAVI+N    WDDHWIFWVGP++GA   A YHQ +LRA A+KAL GSF+S
Sbjct: 238 LGAAVIYNKDKPWDDHWIFWVGPLVGAAIAAFYHQYILRAGAIKAL-GSFRS 288



>gb:AB030697_1518528 Raphanus sativus PAQ2b mRNA for Plasma membrane
           aquaporin 2b, complete cds.
          Length = 283

 Score =  225 bits (574), Expect = 5e-58
 Identities = 113/172 (65%), Positives = 126/172 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RAV YM                    ++   GGGAN++  G+S G GL 
Sbjct: 111 GLFLARKVSLVRAVLYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYSTGTGLA 170

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 171 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 230

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
           FGAAVI+N    WDDHWIFWVGP +GA   A YHQ VLRA   K+L GSF+S
Sbjct: 231 FGAAVIYNESKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSL-GSFRS 281



>gb:AB058678_1521729 Pyrus communis Py-PIP2-1 mRNA for plasma
           membrane intrinsic protein 2-1, complete cds.
          Length = 281

 Score =  225 bits (573), Expect = 6e-58
 Identities = 113/172 (65%), Positives = 128/172 (74%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRAV Y+                  K ++   GGGAN +  G++KG GL 
Sbjct: 109 GLFLARKVSLIRAVLYIIAQCLGAICGVGLVKAFQKSYYVKYGGGANELSAGYNKGTGLG 168

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 169 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARS 228

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
            GAAVI+N   AWDD WIFW+GP +GA   A YHQ +LRA A+KAL GSF+S
Sbjct: 229 LGAAVIYNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKAL-GSFRS 279



 Score = 33.9 bits (76), Expect = 2.7
 Identities = 33/116 (28%), Positives = 52/116 (44%), Gaps = 5/116 (4%)
 Frame = -1

Query: 508 LVAEILATFFLVY-TVFSATDPKRNARDSHVPVLAPLPIGFA----VFVAHVATIPITGT 344
           L+AE +AT   +Y TV +    K  +       +  L I +A    +FV    T  I+G 
Sbjct: 41  LIAEFIATLLFLYITVLTVIGYKSQSEADQCGGVGILGIAWAFGGMIFVLVYCTAGISGG 100

Query: 343 GINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGS 176
            INPA +FG  +    K +     ++ +   LGAI G    +   ++  VK  GG+
Sbjct: 101 HINPAVTFGLFLA--RKVSLIRAVLYIIAQCLGAICGVGLVKAFQKSYYVKYGGGA 154



>pir|T14599|T14599 plasma membrane major intrinsic protein 1 -
           beet>gb:BVU60147_1643227 Beta vulgaris plasma membrane
           major intrinsic protein 1 mRNA, complete cds.
          Length = 288

 Score =  225 bits (573), Expect = 6e-58
 Identities = 112/173 (64%), Positives = 132/173 (76%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRA+AYM                    ++D  GGGAN +  G++KG GL 
Sbjct: 116 GLFLARKVSLIRALAYMVAQCLGAICGVGFVKAFQSAYYDRYGGGANQMAHGYNKGTGLG 175

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 176 AEIIGTFVLVYTVFAATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 235

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQST 164
           FGAAVI N + +W++HWIFWVGP +GA   A YHQ +LRA A+KAL GSF+S+
Sbjct: 236 FGAAVIFNEEKSWNEHWIFWVGPFVGAAIAAFYHQYILRAGAIKAL-GSFRSS 287



>gb:AF118383_1769623 Brassica napus plasma membrane intrinsic
           protein 2 (PIP2) mRNA, complete cds.
          Length = 283

 Score =  224 bits (572), Expect = 8e-58
 Identities = 113/172 (65%), Positives = 126/172 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RAV YM                    ++   GGGAN++  G+S G GL 
Sbjct: 111 GLFLARKVSLVRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLA 170

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 171 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 230

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
           FGAAVI+N    WDDHWIFWVGP +GA   A YHQ VLRA   K+L GSF+S
Sbjct: 231 FGAAVIYNESKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSL-GSFRS 281



>gb:SPIAQUA_1721837 Spinacia oleracea aquaporin mRNA, complete cds.
          Length = 281

 Score =  224 bits (572), Expect = 8e-58
 Identities = 113/174 (64%), Positives = 129/174 (74%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RA+ YM                  K  ++  GGGAN+V  G++KG  L 
Sbjct: 107 GLFLARKVSLLRALVYMIAQCLGAICGVGLVKAFMKGPYNQFGGGANSVALGYNKGTALG 166

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 167 AEIIGTFVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVHLATIPITGTGINPARS 226

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTP 161
           FGAAVI N+   WDD WIFWVGP +GA   A YHQ VLRA A+KAL GSF+S P
Sbjct: 227 FGAAVIFNSNKVWDDQWIFWVGPFIGAAVAAAYHQYVLRAAAIKAL-GSFRSNP 279



>gb:AY084875_1569957 Arabidopsis thaliana clone 11998 mRNA, complete
           sequence.
          Length = 285

 Score =  224 bits (572), Expect = 8e-58
 Identities = 115/176 (65%), Positives = 125/176 (71%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRAV YM                     +   GGGAN +  G++ G GL 
Sbjct: 111 GLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSSHYVNYGGGANFLADGYNTGTGLA 170

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 171 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 230

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTPNV 155
           FGAAVI N    WDDHWIFWVGP +GA   A YHQ VLRA   K+L GSF+S  NV
Sbjct: 231 FGAAVIFNKSKPWDDHWIFWVGPFIGATIAAFYHQFVLRASGSKSL-GSFRSAANV 285



>gb:AB030698_1518529 Raphanus sativus PAQ2c mRNA for Plasma membrane
           aquaporin 2c, complete cds.
          Length = 283

 Score =  224 bits (572), Expect = 8e-58
 Identities = 113/172 (65%), Positives = 126/172 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RAV YM                    ++   GGGAN++  G+S G GL 
Sbjct: 111 GLFLARKVSLVRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLA 170

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 171 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 230

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
           FGAAVI+N    WDDHWIFWVGP +GA   A YHQ VLRA   K+L GSF+S
Sbjct: 231 FGAAVIYNESKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSL-GSFRS 281



>sp|P30302|PI23_ARATH Aquaporin PIP2.3 (Plasma membrane intrinsic
           protein 2c) (PIP2c) (TMP2C) (RD28-PIP) (Water-stress
           induced tonoplast intrinsic protein)
           (WSI-TIP).>pir|E84789|E84789 hypothetical protein
           At2g37180 [imported] - Arabidopsis
           thaliana>gb:AC006260_1533884 Arabidopsis thaliana
           chromosome 2 clone T2N18 map ve018, complete
           sequence.>gb:ATHRD28_1553344 Arabidopsis thaliana mRNA
           for putative transmenbrane channel
           protein.>gb:AY064029_1565967 Arabidopsis thaliana
           putative aquaporin, plasma membrane intrinsic protein 2C
           (At2g37180) mRNA, complete cds.>gb:AY096701_1576237
           Arabidopsis thaliana putative aquaporin protein
           (At2g37180) mRNA, complete cds.
          Length = 285

 Score =  224 bits (572), Expect = 8e-58
 Identities = 115/176 (65%), Positives = 125/176 (71%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRAV YM                     +   GGGAN +  G++ G GL 
Sbjct: 111 GLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSSHYVNYGGGANFLADGYNTGTGLA 170

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 171 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 230

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTPNV 155
           FGAAVI N    WDDHWIFWVGP +GA   A YHQ VLRA   K+L GSF+S  NV
Sbjct: 231 FGAAVIFNKSKPWDDHWIFWVGPFIGATIAAFYHQFVLRASGSKSL-GSFRSAANV 285



>gb:AY243802_1592435 Zea mays aquaporin (PIP2-5) mRNA, complete
           cds.>gb:AF130975_1770832 Zea mays plasma membrane
           intrinsic protein (pip2-5) mRNA, complete cds.
          Length = 285

 Score =  224 bits (571), Expect = 1e-57
 Identities = 113/169 (66%), Positives = 124/169 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RA+ Y+                    F+   GGGAN +  G+SKG GL 
Sbjct: 113 GLFLARKVSLVRALLYIVAQCLGAICGVGLVKGFQSAFYVRYGGGANELSAGYSKGTGLA 172

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 173 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 232

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGS 176
            GAAVI+NN  AWDDHWIFWVGP +GA   A YHQ VLRA A K LG S
Sbjct: 233 LGAAVIYNNDKAWDDHWIFWVGPFIGAAIAAAYHQYVLRASAAK-LGSS 280



>pir|T06434|T06434 plasma membrane intrinsic protein 1 -
           soybean>gb:GMU27347_1680642 Glycine max putative water
           channel protein (Pip1) mRNA, complete cds.
          Length = 285

 Score =  224 bits (570), Expect = 1e-57
 Identities = 112/176 (63%), Positives = 129/176 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRA+ YM                  K +++  GGGAN +  G+S GVGL 
Sbjct: 111 GLFLARKVSLIRAIMYMVAQCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLG 170

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ T   VYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+A IP+TGTGINPARS
Sbjct: 171 AEIIGTSGGVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLANIPVTGTGINPARS 230

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTPNV 155
            GAAV++N + AWDDHWIFWVGP +GA   A YHQ +LRA A KAL GSF+S P +
Sbjct: 231 LGAAVMYNQQKAWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAKAL-GSFRSNPTI 285



>gb:OSJN00087_1694650 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0084K11, complete sequence.
          Length = 282

 Score =  223 bits (569), Expect = 2e-57
 Identities = 108/165 (65%), Positives = 124/165 (75%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RA+ YM                  K  ++T GGGAN V PG++KG GL 
Sbjct: 116 GLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFQKGLYETTGGGANVVAPGYTKGDGLG 175

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 176 AEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 235

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I+N  HAWDDHWIFWVGP +GA   A+YHQVV+RA   K+
Sbjct: 236 LGAAIIYNRGHAWDDHWIFWVGPFIGAALAAIYHQVVIRAIPFKS 280



>gb:AP003802_1833561 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1047_A06.>gb:AP004668_1842993 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0475E07.
          Length = 283

 Score =  223 bits (568), Expect = 2e-57
 Identities = 110/172 (63%), Positives = 126/172 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RA+ Y+                    F+D  GGGAN +  G+SKG GL 
Sbjct: 112 GLFLARKVSLVRAILYIVAQCLGAVCGVALVKGFQSSFYDRYGGGANELAAGYSKGTGLA 171

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGINPARS
Sbjct: 172 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS 231

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
            GAAV++NN  AW D WIFWVGP +GA   A+YHQ+VLRA A     GSF+S
Sbjct: 232 LGAAVVYNNSKAWSDQWIFWVGPFIGAAIAALYHQIVLRASARGY--GSFRS 281



>gb:AY489268_1608615 Physcomitrella patens aquaporin PIP 2 mRNA,
           complete cds.
          Length = 279

 Score =  223 bits (568), Expect = 2e-57
 Identities = 114/175 (65%), Positives = 126/175 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL LARK+SL RA+AYM                    F+   GGGAN+V  G+S G GL 
Sbjct: 104 GLLLARKISLPRALAYMIAQCLGAICGAGLVKGFQTAFYMRYGGGANSVAAGYSIGTGLA 163

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 164 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 223

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTPN 158
           FGAAVI+N    WDDHWIFWVGP +GA   A YHQ VLRA   K L GSF+S P+
Sbjct: 224 FGAAVIYNRSKPWDDHWIFWVGPFVGAALAAAYHQYVLRAGPFKQL-GSFRSAPS 277



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 30/95 (31%), Positives = 45/95 (47%), Gaps = 2/95 (2%)
 Frame = -1

Query: 508 LVAEILATFFLVY-TVFSATDPKRNARDSHVPVLA-PLPIGFAVFVAHVATIPITGTGIN 335
           ++AE +AT   +Y T+ +     RNA    V +L      G  +FV    T  I+G  IN
Sbjct: 39  VIAEFVATLLFLYITIATVIGAVRNAGCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHIN 98

Query: 334 PARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGA 230
           PA +FG  ++   K +      + +   LGAI GA
Sbjct: 99  PAVTFG--LLLARKISLPRALAYMIAQCLGAICGA 131



>gb:AF118382_1769622 Brassica napus plasma membrane intrinsic
           protein 1 (PIP1) mRNA, complete cds.
          Length = 287

 Score =  223 bits (567), Expect = 3e-57
 Identities = 112/176 (63%), Positives = 126/176 (71%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL LARKVSL+RA+ YM                    ++   GGGAN++  G+S G GL 
Sbjct: 113 GLLLARKVSLVRAILYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYSTGTGLA 172

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 173 AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 232

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTPNV 155
           FGAAVI N    WDDHWIFWVGP +GA   A YHQ VLRA   K+L GSF+S  NV
Sbjct: 233 FGAAVIFNESKPWDDHWIFWVGPFVGAAIAAFYHQFVLRASGSKSL-GSFRSAANV 287



>pir|T09124|T09124 probable aquaporin - spinach
          Length = 281

 Score =  223 bits (567), Expect = 3e-57
 Identities = 112/174 (64%), Positives = 128/174 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RA+ YM                  K  ++  GGGAN+V  G++KG  L 
Sbjct: 107 GLFLARKVSLLRALVYMIAQCLGAICGVGLVKAFMKGPYNQFGGGANSVALGYNKGTALG 166

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 167 AEIIGTFVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVHLATIPITGTGINPARS 226

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTP 161
           FG AVI N+   WDD WIFWVGP +GA   A YHQ VLRA A+KAL GSF+S P
Sbjct: 227 FGPAVIFNSNKVWDDQWIFWVGPFIGAAVAAAYHQYVLRAAAIKAL-GSFRSNP 279



>sp|Q9SV31|PI25_ARATH Probable aquaporin PIP2.5 (Plasma membrane
           intrinsic protein 2d) (PIP2d).>pir|T06738|T06738
           probable plasma membrane intrinsic protein F28P10.200 -
           Arabidopsis thaliana>gb:ATF28P10_1550414 Arabidopsis
           thaliana DNA chromosome 3, BAC clone
           F28P10.>gb:AY062981_1565569 Arabidopsis thaliana
           putative aquaporin/MIP protein (At3g54820) mRNA,
           complete cds.>gb:AY084843_1569926 Arabidopsis thaliana
           clone 11929 mRNA, complete sequence.>gb:BT000670_1634948
           Arabidopsis thaliana clone RAFL07-09-N03 (R10758)
           putative aquaporin/plasma membrane intrinsic protein
           (At3g54820) mRNA, complete cds.>gb:AF370351_1792233
           Arabidopsis thaliana putative aquaporin/MIP protein
           (At3g54820) mRNA, complete cds.
          Length = 286

 Score =  223 bits (567), Expect = 3e-57
 Identities = 112/176 (63%), Positives = 127/176 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL LARKV+L+RAV YM                    +F   GGGAN +  G+S G G+ 
Sbjct: 112 GLLLARKVTLVRAVMYMVAQCLGAICGVALVKAFQSAYFTRYGGGANGLSDGYSIGTGVA 171

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 172 AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARS 231

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTPNV 155
            GAA+I+N   AWD HWIFWVGP  GA   A YHQ VLRA A+KAL GSF+S P+V
Sbjct: 232 LGAAIIYNKDKAWDHHWIFWVGPFAGAAIAAFYHQFVLRAGAIKAL-GSFRSQPHV 286



 Score = 33.5 bits (75), Expect = 3.5
 Identities = 35/120 (29%), Positives = 50/120 (41%), Gaps = 9/120 (7%)
 Frame = -1

Query: 508 LVAEILATFFLVYTVF-------SATDPKRNARD-SHVPVLA-PLPIGFAVFVAHVATIP 356
           L+AE +AT   +Y          S TDP  N    + V VL      G  +F+    T  
Sbjct: 40  LIAEFIATLLFLYVTIMTVIGYKSQTDPALNPDQCTGVGVLGIAWAFGGMIFILVYCTAG 99

Query: 355 ITGTGINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGS 176
           I+G  INPA +FG  ++   K       ++ V   LGAI G    +    A   +  GG+
Sbjct: 100 ISGGHINPAVTFG--LLLARKVTLVRAVMYMVAQCLGAICGVALVKAFQSAYFTRYGGGA 157



>sp|P43286|PI21_ARATH Aquaporin PIP2.1 (Plasma membrane intrinsic
           protein 2a) (PIP2a).>pir|S44084|S44084 plasma membrane
           intrinsic protein 2a - Arabidopsis
           thaliana>gb:ATF4P12_1550727 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F4P12.>gb:ATPIP2A_1553862
           A.thaliana mRNA for plasma membrane intrinsic protein
           2a.>gb:AY039579_1560292 Arabidopsis thaliana
           AT3g53420/F4P12_120 mRNA, complete
           cds.>gb:AY044327_1561042 Arabidopsis thaliana plasma
           membrane intrinsic protein 2a (F4P12.12) mRNA, complete
           cds.>gb:AY056085_1563423 Arabidopsis thaliana
           AT3g53420/F4P12_120 mRNA, complete
           cds.>gb:AY072374_1567191 Arabidopsis thaliana plasma
           membrane intrinsic protein 2a (At3g53420) mRNA, complete
           cds.>gb:AY087854_1572881 Arabidopsis thaliana clone
           38965 mRNA, complete sequence.>gb:AF428426_1799356
           Arabidopsis thaliana AT3g53420/F4P12_120 mRNA, complete
           cds.
          Length = 287

 Score =  223 bits (567), Expect = 3e-57
 Identities = 112/176 (63%), Positives = 127/176 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL RA+ Y+                    ++   GGGAN++  G+S G GL 
Sbjct: 113 GLFLARKVSLPRALLYIIAQCLGAICGVGFVKAFQSSYYTRYGGGANSLADGYSTGTGLA 172

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 173 AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 232

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTPNV 155
           FGAAVI+N    WDDHWIFWVGP +GA   A YHQ VLRA   K+L GSF+S  NV
Sbjct: 233 FGAAVIYNKSKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSL-GSFRSAANV 287



>gb:AY494191_1608855 Physcomitrella patens plasma membrane aquaporin
           (PIP2;1) gene, complete cds.
          Length = 279

 Score =  222 bits (566), Expect = 4e-57
 Identities = 112/175 (64%), Positives = 126/175 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL +ARK+SL RA+ YM                    F+   GGGAN+V  G+S G GL 
Sbjct: 104 GLLMARKISLPRALTYMIAQCLGAICGAGLAKGFQTAFYMRYGGGANSVALGYSTGTGLA 163

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 164 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 223

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTPN 158
           FGAAVI+N    WDDHWIFWVGP LGA   A YHQ +LRA   K+L GSF+S P+
Sbjct: 224 FGAAVIYNRSKPWDDHWIFWVGPFLGAALAASYHQYILRAAPFKSL-GSFRSAPS 277



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 29/95 (30%), Positives = 46/95 (48%), Gaps = 2/95 (2%)
 Frame = -1

Query: 508 LVAEILATFFLVY-TVFSATDPKRNARDSHVPVLA-PLPIGFAVFVAHVATIPITGTGIN 335
           ++AE +AT   +Y T+ +     RNA  + V +L      G  +FV    T  ++G  IN
Sbjct: 39  IIAEFVATLLFLYITISTVIGASRNAGCAGVGLLGIAWAFGGMIFVLVYCTAGVSGGHIN 98

Query: 334 PARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGA 230
           PA +FG  ++   K +      + +   LGAI GA
Sbjct: 99  PAVTFG--LLMARKISLPRALTYMIAQCLGAICGA 131



>gb:AB012045_1511625 Raphanus sativus mRNA for Plasma membrane
           aquaporin (PAQ2), complete cds.
          Length = 287

 Score =  222 bits (566), Expect = 4e-57
 Identities = 112/176 (63%), Positives = 126/176 (71%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL LARKVSL+RA+ YM                    ++   GGGAN++  G+S G GL 
Sbjct: 113 GLLLARKVSLVRAILYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLA 172

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 173 AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 232

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTPNV 155
           FGAAVI N    WDDHWIFWVGP +GA   A YHQ VLRA   K+L GSF+S  NV
Sbjct: 233 FGAAVIFNESKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSL-GSFRSAANV 287



>gb:OSJN00156_1695831 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0019D11, complete sequence.
          Length = 290

 Score =  222 bits (565), Expect = 5e-57
 Identities = 112/169 (66%), Positives = 123/169 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RAV Y+                    F+   GGGAN +  G+SKG GL 
Sbjct: 118 GLFLARKVSLVRAVLYIVAQSLGAICGVGLVKGFQSAFYVRYGGGANELSDGYSKGTGLA 177

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 178 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 237

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGS 176
            GAAVI+N   AW DHWIFWVGP++GA   A YHQ VLRA A K LG S
Sbjct: 238 LGAAVIYNQHKAWHDHWIFWVGPLIGAAIAAAYHQYVLRASAAK-LGSS 285



 Score = 33.5 bits (75), Expect = 3.5
 Identities = 29/103 (28%), Positives = 47/103 (45%), Gaps = 11/103 (10%)
 Frame = -1

Query: 508 LVAEILATFFLVYTVFSA-------TDPKRNARDSHVPVLAPLPIGFA----VFVAHVAT 362
           ++AE +AT   +Y   +        +DP  NA D+    +  L I +A    +F+    T
Sbjct: 44  VIAEFVATLLFLYITVATVIGYKHQSDPGANAADAACSGVGILGIAWAFGGMIFILVYCT 103

Query: 361 IPITGTGINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAG 233
             ++G  INPA +FG  +    K +     ++ V   LGAI G
Sbjct: 104 AGVSGGHINPAVTFGLFLA--RKVSLVRAVLYIVAQSLGAICG 144



>gb:AY494192_1608856 Physcomitrella patens plasma membrane aquaporin
           (PIP2;2) gene, complete cds.
          Length = 279

 Score =  222 bits (565), Expect = 5e-57
 Identities = 113/175 (64%), Positives = 127/175 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL LARK+SL RA+AYM                    F+   GGGAN+V  G+S G GL 
Sbjct: 104 GLLLARKISLPRALAYMIAQCLGAICGAGLVKGFQTAFYMRYGGGANSVAAGYSIGTGLA 163

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 164 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 223

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTPN 158
           FGAAVI+N    W+DHWI+WVGP LGA   A YHQ VLRA   K+L GSF+S P+
Sbjct: 224 FGAAVIYNRSKPWNDHWIYWVGPFLGAALAAAYHQYVLRAGPFKSL-GSFRSAPS 277



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 30/95 (31%), Positives = 45/95 (47%), Gaps = 2/95 (2%)
 Frame = -1

Query: 508 LVAEILATFFLVY-TVFSATDPKRNARDSHVPVLA-PLPIGFAVFVAHVATIPITGTGIN 335
           ++AE +AT   +Y T+ +     RNA    V +L      G  +FV    T  I+G  IN
Sbjct: 39  VIAEFVATLLFLYITIATVIGAVRNAGCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHIN 98

Query: 334 PARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGA 230
           PA +FG  ++   K +      + +   LGAI GA
Sbjct: 99  PAVTFG--LLLARKISLPRALAYMIAQCLGAICGA 131



>sp|Q9ZV07|PI26_ARATH Probable aquaporin PIP2.6 (Plasma membrane
           intrinsic protein 2e) (PIP2e).>pir|A84812|A84812
           probable aquaporin (water channel protein) [imported] -
           Arabidopsis thaliana>gb:AC005770_1533002 Arabidopsis
           thaliana chromosome 2 clone T7F6 map CIC10A06, complete
           sequence.>gb:AY045690_1561281 Arabidopsis thaliana
           At2g39010/T7F6.18 mRNA, complete
           cds.>gb:AY054142_1562964 Arabidopsis thaliana
           At2g39010/T7F6.18 mRNA, complete
           cds.>gb:AY057559_1563976 Arabidopsis thaliana
           At2g39010/T7F6.18 mRNA, complete cds.
          Length = 289

 Score =  222 bits (565), Expect = 5e-57
 Identities = 108/167 (64%), Positives = 126/167 (75%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLA KVSL+RAV+YM                    +++  GGGAN +  G++ GVG+ 
Sbjct: 112 GLFLASKVSLVRAVSYMVAQCLGATCGVGLVKVFQSTYYNRYGGGANMLSDGYNVGVGVG 171

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSH+PVLAPLPIGF+VF+ H+ATIPITGTGINPARS
Sbjct: 172 AEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFSVFMVHLATIPITGTGINPARS 231

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALG 182
           FGAAVI+NN+ AWDD WIFWVGP +GA   A YHQ VLRA A+KA G
Sbjct: 232 FGAAVIYNNQKAWDDQWIFWVGPFVGAAIAAFYHQFVLRAGAMKAYG 278



>gb:AF452014_1800842 Petunia x hybrida aquaporin-like protein
           (PIP2;3) mRNA, complete cds.
          Length = 286

 Score =  221 bits (564), Expect = 7e-57
 Identities = 114/173 (65%), Positives = 125/173 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRAV YM                    ++    GGAN +  G+SK VGL 
Sbjct: 111 GLFLARKVSLIRAVMYMVAQCLGAICGVGLVKAFQSAYYHRYDGGANMLSDGYSKSVGLS 170

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 171 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 230

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQST 164
            GAAVI N   AW DHWIFWVGP +GA   A YHQ +LRA A KAL GSF+S+
Sbjct: 231 LGAAVIFNQDKAWKDHWIFWVGPFIGAAIAAFYHQFILRAGAAKAL-GSFRSS 282



 Score = 33.9 bits (76), Expect = 2.7
 Identities = 32/101 (31%), Positives = 46/101 (45%), Gaps = 9/101 (8%)
 Frame = -1

Query: 508 LVAEILATFFLVYTVF-------SATDPKRNARD-SHVPVLA-PLPIGFAVFVAHVATIP 356
           L+AE +AT   +Y          S +DP +NA   S V +L      G  +F+    T  
Sbjct: 39  LIAEFIATLLFLYITVLTVIGYKSESDPAKNADPCSGVGILGIAWAFGGMIFILVYCTAG 98

Query: 355 ITGTGINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAG 233
           I+G  INPA +FG  +    K +     ++ V   LGAI G
Sbjct: 99  ISGGHINPAVTFGLFLA--RKVSLIRAVMYMVAQCLGAICG 137



>gb:AF326495_1786641 Zea mays plasma membrane integral protein
           ZmPIP2-6 mRNA, complete cds.
          Length = 288

 Score =  221 bits (563), Expect = 9e-57
 Identities = 111/172 (64%), Positives = 124/172 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RA+ YM                    F+   GGGAN V  G+S G GL 
Sbjct: 117 GLFLARKVSLVRALLYMAAQSLGAICGVALVKGFQSGFYARYGGGANEVSAGYSTGTGLA 176

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 177 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 236

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
            GAAV++NN  AW D WIFWVGP +GA   A+YHQ+VLRA A     GSF+S
Sbjct: 237 LGAAVVYNNSKAWSDQWIFWVGPFIGAAIAALYHQIVLRASARGY--GSFRS 286



>gb:AF290620_1783621 Nicotiana glauca putative PIP2 (MIP4) mRNA,
           complete cds.
          Length = 284

 Score =  221 bits (562), Expect = 1e-56
 Identities = 113/176 (64%), Positives = 123/176 (69%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRAV YM                L   ++    GG N +  G+S GVGL 
Sbjct: 109 GLFLARKVSLIRAVMYMVAQCLGAICGVGLVKALQSAYYHRYDGGVNMLSDGYSHGVGLS 168

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 169 AEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARS 228

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTPNV 155
            GAAVI N   AW DHWIFWVGP +GA   A YHQ +LRA A KALG    ST  V
Sbjct: 229 LGAAVIFNQHKAWKDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSSTSQV 284



>gb:AY547266_1612976 Ipomoea nil aquaporin-like protein mRNA,
           partial cds.
          Length = 214

 Score =  220 bits (560), Expect = 2e-56
 Identities = 108/165 (65%), Positives = 125/165 (75%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL R V Y+                  K  +++ GGGAN V PG++KG GL 
Sbjct: 49  GLFLARKVSLTRLVYYIVMQCLGAICGAGVVKGFGKTLYNSKGGGANVVNPGYTKGDGLG 108

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 109 AEIVGTFVLVYTVFSATDAKRNARDSHVPVLAPLPIGFAVFLVHLATIPITGTGINPARS 168

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I+NN+HAW+DHWIFWVGP +GA   A+YHQVV+RA   K+
Sbjct: 169 LGAAIIYNNEHAWNDHWIFWVGPFVGAALAALYHQVVIRAIPFKS 213



>pir|T04367|T04367 plasma membrane intrinsic protein BPW1 -
           barley>gb:AB009307_1510769 Hordeum vulgare HvPIP2;1
           mRNA, complete cd.
          Length = 286

 Score =  220 bits (560), Expect = 2e-56
 Identities = 110/172 (63%), Positives = 125/172 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRA+ Y+                    ++   GGGAN +  G+SKG GL 
Sbjct: 116 GLFLARKVSLIRALLYIIAQCLGAICGVGLVKGFQSSYYVRYGGGANELSAGYSKGTGLA 175

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 176 AEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARS 235

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
            GAAVI+N   AWDD WIFWVGP++GA   A YHQ VLRA A K   GS++S
Sbjct: 236 LGAAVIYNTDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASAAKL--GSYRS 285



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 28/103 (27%), Positives = 46/103 (44%), Gaps = 11/103 (10%)
 Frame = -1

Query: 508 LVAEILATFFLVYTVFSA-------TDPKRNARDSHVPVLAPLPIGFA----VFVAHVAT 362
           ++AE +AT   +Y   +        +DP  N  D+    +  L I +A    +FV    T
Sbjct: 42  VIAEFVATLLFLYITVATVIGYKHQSDPTVNTTDAACSGVGTLGIAWAFGGMIFVLVYCT 101

Query: 361 IPITGTGINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAG 233
             ++G  INPA +FG  +    K +     ++ +   LGAI G
Sbjct: 102 AGVSGGHINPAVTFGLFLA--RKVSLIRALLYIIAQCLGAICG 142



>gb:AF255796_1781215 Allium cepa aquaporin 2 (Aqp2) mRNA, complete
           cds.
          Length = 288

 Score =  219 bits (558), Expect = 3e-56
 Identities = 107/165 (64%), Positives = 123/165 (74%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV YM                  K  + T GGGAN V PG++KG GL 
Sbjct: 122 GLFLARKLSLTRAVFYMIMQCLGAICGAGVLKGYQKGLYMTQGGGANVVAPGYTKGSGLG 181

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 182 AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 241

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I+N  HAW+DHWIFWVGP +GA   A+YHQ+V+RA   K+
Sbjct: 242 LGAAIIYNKGHAWNDHWIFWVGPFIGAALAAMYHQIVIRAIPFKS 286



>gb:AP006168_1861230 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:B1469H02.
          Length = 288

 Score =  219 bits (557), Expect = 5e-56
 Identities = 110/172 (63%), Positives = 124/172 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRAV Y+                    ++   GGGAN +  G+SKG GL 
Sbjct: 117 GLFLARKVSLIRAVLYIIAQCLGAICGVGLVKGFQSSYYARYGGGANELSDGYSKGTGLG 176

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 177 AEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARS 236

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
            G AVI+N   AWDD WIFWVGP++GA   A YHQ VLRA A K   GS++S
Sbjct: 237 LGTAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASAAKL--GSYRS 286



>gb:AF440271_1800058 Nicotiana tabacum aquaporin (NtPIP1;1) mRNA,
           complete cds.
          Length = 286

 Score =  219 bits (557), Expect = 5e-56
 Identities = 107/165 (64%), Positives = 122/165 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV YM                  K  +  +GGGAN V PG++KG GL 
Sbjct: 122 GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFMKGPYQRLGGGANVVNPGYTKGDGLG 181

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 182 AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 241

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I N K AWDDHWIFWVGP +GA   AVYHQ+++RA   K+
Sbjct: 242 LGAAIIFNKKQAWDDHWIFWVGPFIGAALAAVYHQIIIRAIPFKS 286



>gb:AP003802_1833559 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1047_A06.>gb:AP004668_1842991 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0475E07.
          Length = 286

 Score =  218 bits (556), Expect = 6e-56
 Identities = 109/172 (63%), Positives = 123/172 (71%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RA+ YM                     +D  GGGAN +  G+S G GL 
Sbjct: 115 GLFLARKVSLVRALLYMAAQCLGAICGVALVKGFQSSLYDRYGGGANELAAGYSTGTGLA 174

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 175 AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 234

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
            G AV++NN  AW D WIFWVGP +GA   A+YHQV+LRA A     GSF+S
Sbjct: 235 LGVAVVYNNNKAWSDQWIFWVGPFIGAAIAALYHQVILRASARGY--GSFRS 284



>gb:AF141643_1771588 Vitis berlandieri x Vitis rupestris putative
           aquaporin PIP1-1 (PIP1-1) mRNA, complete cds.
          Length = 286

 Score =  218 bits (556), Expect = 6e-56
 Identities = 107/165 (64%), Positives = 124/165 (75%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV YM                  K  ++++GGGAN V  G++KG GL 
Sbjct: 121 GLFLARKLSLTRAVYYMVMQCLGAICGAGVVKGFEKGRYNSLGGGANVVNAGYTKGDGLG 180

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 181 AEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 240

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I+N  HAWDDHWIFWVGP +GA   A+YHQVV+RA   K+
Sbjct: 241 LGAAIIYNKDHAWDDHWIFWVGPFIGAALAALYHQVVIRAIPFKS 285



>gb:LETRAMP1_1684679 L.esculentum mRNA for tomato ripening membrane
           protein, clone pTOM75.
          Length = 214

 Score =  218 bits (556), Expect = 6e-56
 Identities = 104/160 (65%), Positives = 123/160 (76%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV YM                     +  +GGGAN V PG++KG GL 
Sbjct: 49  GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFMVGPYQRLGGGANVVNPGYTKGDGLG 108

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 109 AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 168

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRA 203
            GAA+I+N++HAW+DHWIFWVGPM+GA   A+YHQ+++RA
Sbjct: 169 LGAAIIYNDEHAWNDHWIFWVGPMIGAALAAIYHQIIIRA 208



>gb:AB002148_1508696 Nicotiana excelsior mRNA for water channel
           protein, complete cds.
          Length = 287

 Score =  218 bits (556), Expect = 6e-56
 Identities = 104/160 (65%), Positives = 122/160 (76%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RA+ YM                     +  +GGGAN V PG++KG GL 
Sbjct: 121 GLFLARKLSLTRAIFYMVMQCLGAICGAGVVKGFMVGPYQRLGGGANVVNPGYTKGDGLG 180

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 181 AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 240

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRA 203
            GAA+I+N++HAWDDHWIFWVGP +GA   AVYHQ+++RA
Sbjct: 241 LGAAIIYNDEHAWDDHWIFWVGPFIGAALAAVYHQIIIRA 280



>sp|Q08451|PIP1_LYCES Probable aquaporin PIP-type pTOM75
           (Ripening-associated membrane protein)
           (RAMP).>pir|S42542|S42542 ripening-associated membrane
           protein (clone pNY507) - tomato>gb:LETRAMP2_1684680
           L.esculentum mRNA for tomato ripening membrane protein,
           clone pNY507.
          Length = 286

 Score =  218 bits (556), Expect = 6e-56
 Identities = 104/160 (65%), Positives = 123/160 (76%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV YM                     +  +GGGAN V PG++KG GL 
Sbjct: 121 GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFMVGPYQRLGGGANVVNPGYTKGDGLG 180

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 181 AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 240

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRA 203
            GAA+I+N++HAW+DHWIFWVGPM+GA   A+YHQ+++RA
Sbjct: 241 LGAAIIYNDEHAWNDHWIFWVGPMIGAALAAIYHQIIIRA 280



>gb:AY059380_1564533 Medicago truncatula aquaporin (PIP2-1) mRNA,
           complete cds.
          Length = 287

 Score =  218 bits (555), Expect = 8e-56
 Identities = 107/172 (62%), Positives = 125/172 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLF+ RKVSLIRA  Y+                    +++   GG NTV  G+SKG  L 
Sbjct: 115 GLFVGRKVSLIRAFLYIVAQCLGAICGAGLAKGFQTSYYNRYKGGVNTVSDGYSKGTALG 174

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGINPARS
Sbjct: 175 AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS 234

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
           FG AVI NN+ AWDD WI+WVGP +GA   A+YHQ +LR  A+KAL GSF+S
Sbjct: 235 FGPAVIFNNEKAWDDQWIYWVGPFIGAAVAAIYHQYILRGSAIKAL-GSFRS 285



 Score = 33.1 bits (74), Expect = 4.6
 Identities = 32/103 (31%), Positives = 44/103 (42%), Gaps = 10/103 (9%)
 Frame = -1

Query: 508 LVAEILATFFLVYTVF---------SATDPKRNARDSHVPVLA-PLPIGFAVFVAHVATI 359
           ++AE +AT   +Y            S T  K N     V VL      G  +F+    T 
Sbjct: 42  VIAEFVATLLFLYITVLTIIGYSRQSDTTIKGNTECDGVGVLGIAWAFGGMIFILVYCTA 101

Query: 358 PITGTGINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGA 230
            I+G  INPA +FG  V    K +    +++ V   LGAI GA
Sbjct: 102 GISGGHINPAVTFGLFV--GRKVSLIRAFLYIVAQCLGAICGA 142



>gb:AF326494_1786640 Zea mays plasma membrane integral protein
           ZmPIP2-4 mRNA, complete cds.
          Length = 288

 Score =  217 bits (553), Expect = 1e-55
 Identities = 109/172 (63%), Positives = 125/172 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RA+ Y+                    ++   GGGAN +  G+SKG GL 
Sbjct: 117 GLFLARKVSLVRALLYIIAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLA 176

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 177 AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 236

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
            GAAVI+N   AWDD WIFWVGP++GA   A YHQ VLRA A K   GS++S
Sbjct: 237 LGAAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASATKL--GSYRS 286



>gb:AF326493_1786639 Zea mays plasma membrane integral protein
           ZmPIP2-3 mRNA, complete cds.
          Length = 289

 Score =  217 bits (553), Expect = 1e-55
 Identities = 109/172 (63%), Positives = 125/172 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RA+ Y+                    ++   GGGAN +  G+SKG GL 
Sbjct: 118 GLFLARKVSLVRALLYIIAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLA 177

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 178 AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 237

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
            GAAVI+N   AWDD WIFWVGP++GA   A YHQ VLRA A K   GS++S
Sbjct: 238 LGAAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASATKL--GSYRS 287



>gb:AF452011_1800839 Petunia x hybrida aquaporin-like protein
           (PIP1;2) mRNA, complete cds.
          Length = 286

 Score =  217 bits (552), Expect = 2e-55
 Identities = 106/165 (64%), Positives = 124/165 (75%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RA+ YM                  K  + T GGGAN V PG++KG GL 
Sbjct: 121 GLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFGKTLYQTKGGGANVVAPGYTKGDGLG 180

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 181 AEIVGTFVLVYTVFSATDAKRSARDSHVPLLAPLPIGFAVFLVHLATIPITGTGINPARS 240

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I+N +HAW+DHWIFWVGP +GA   A+YHQVV+RA   K+
Sbjct: 241 LGAAIIYNQEHAWNDHWIFWVGPFIGAALAALYHQVVIRAIPFKS 285



>gb:AY725511_1624505 Lycopersicon esculentum putative aquaporin
           PIP-type mRNA, partial cds.
          Length = 171

 Score =  217 bits (552), Expect = 2e-55
 Identities = 109/168 (64%), Positives = 126/168 (75%)
 Frame = -1

Query: 670 ARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLVAEIL 491
           ARKVSLIRAV YM                     ++ +GGGAN VQ G++ G  L AEI+
Sbjct: 1   ARKVSLIRAVLYMVAQCLGAICGVGFVKAFMTHPYNALGGGANFVQSGYNNGTALGAEII 60

Query: 490 ATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSFGAA 311
            TF LVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARSFGAA
Sbjct: 61  GTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAA 120

Query: 310 VIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
           VI +NK+ WDD WIFWVGP +GA+  A YHQ +LRA A+KAL GSF+S
Sbjct: 121 VIADNKNVWDDQWIFWVGPFVGALLAAAYHQYILRAAAIKAL-GSFRS 167



>gb:AF218774_1778204 Lycopersicon esculentum putative water channel
           protein (Aqp2) mRNA, complete cds.
          Length = 285

 Score =  216 bits (551), Expect = 2e-55
 Identities = 105/165 (63%), Positives = 122/165 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV Y+                     F T GGGAN V  G++KG GL 
Sbjct: 119 GLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQPSLFGTKGGGANVVAHGYTKGDGLG 178

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 179 AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 238

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+++N +HAWDDHWIFWVGP +GA   A+YHQV++RA   K+
Sbjct: 239 LGAAIVYNKEHAWDDHWIFWVGPFIGAALAALYHQVIIRAIPFKS 283



>gb:AY663794_1620591 Fraxinus excelsior plasma membrane intrinsic
           protein PIP1-1 mRNA, complete cds.
          Length = 286

 Score =  215 bits (548), Expect = 5e-55
 Identities = 105/160 (65%), Positives = 120/160 (75%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RA+ YM                  K  + T GGGAN V PG++KG GL 
Sbjct: 121 GLFLARKLSLTRAIFYMVMQCLGAICGAGVVKGFGKTLYMTKGGGANVVAPGYTKGDGLG 180

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 181 AEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 240

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRA 203
            GAA+I+N  HAWDDHWIFWVGP +GA   A+YH VV+RA
Sbjct: 241 LGAAIIYNKDHAWDDHWIFWVGPFIGAALAALYHVVVIRA 280



>sp|Q39196|PI14_ARATH Probable aquaporin PIP1.4 (Plasma membrane
           intrinsic protein 1.4) (Transmembrane protein C)
           (TMP-C).>gb:ATHTMP_1553432 Arabidopsis thaliana mRNA for
           transmembrane protein, complete cds.>gb:AY099825_1576850
           Arabidopsis thaliana probable plasma membrane intrinsic
           protein 1c (At4g00430) mRNA, complete
           cds.>gb:AY120785_1579667 Arabidopsis thaliana probable
           plasma membrane intrinsic protein 1c (At4g00430) mRNA,
           complete cds.>gb:BT000330_1634608 Arabidopsis thaliana
           probable plasma membrane intrinsic protein 1c
           (At4g00430) mRNA, complete cds.>gb:BT006313_1639205
           Arabidopsis thaliana At4g00430 mRNA, complete cds.
          Length = 287

 Score =  215 bits (548), Expect = 5e-55
 Identities = 105/165 (63%), Positives = 123/165 (74%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV YM                     + T+GGGANTV  G++KG GL 
Sbjct: 121 GLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYQTLGGGANTVAHGYTKGSGLG 180

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 181 AEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 240

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I+N  H+WDDHWIFWVGP +GA   A+YHQ+V+RA   K+
Sbjct: 241 LGAAIIYNKDHSWDDHWIFWVGPFIGAALAALYHQIVIRAIPFKS 285



>pir|T09794|T09794 major intrinsic protein PIPb - Craterostigma
           plantagineum>gb:CPPIPB_1648681 Craterostigma
           plantagineum mRNA for major intrinsic protein PIPb.
          Length = 288

 Score =  215 bits (547), Expect = 7e-55
 Identities = 104/165 (63%), Positives = 122/165 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RA+ YM                     +  +GGGANTV  G++KG GL 
Sbjct: 121 GLFLARKLSLTRAIFYMIMQCLGAICGAGVVKGFQVGPYQRLGGGANTVAHGYTKGAGLG 180

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 181 AEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 240

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I+N  HAWDDHW+FWVGP +GA   AVYHQ+V+RA   K+
Sbjct: 241 LGAAIIYNKDHAWDDHWVFWVGPFIGAALAAVYHQIVIRAIPFKS 285



>sp|Q08733|PI13_ARATH Aquaporin PIP1.3 (Plasma membrane intrinsic
           protein 1c) (PIP1c) (Transmembrane protein B)
           (TMP-B).>pir|A86147|A86147 hypothetical protein F22L4.16
           - Arabidopsis thaliana>gb:AE005172_889210 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:ATTMPB_1556677 A.thaliana mRNA for
           transmembrane protein TMP-B.>gb:F22L4_1677891 Sequence
           of BAC F22L4 from Arabidopsis thaliana chromosome 1,
           complete sequence.>gb:AF348574_1790118 Arabidopsis
           thaliana clone C00104 (e) putative plasma membrane
           intrinsic protein 1c (At1g01620) mRNA, complete cds.
          Length = 286

 Score =  215 bits (547), Expect = 7e-55
 Identities = 105/165 (63%), Positives = 124/165 (75%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV Y+                   + + T+GGGANTV  G++KG GL 
Sbjct: 120 GLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQPNPYQTLGGGANTVAHGYTKGSGLG 179

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 180 AEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 239

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I+N  HAWDDHWIFWVGP +GA   A+YHQ+V+RA   K+
Sbjct: 240 LGAAIIYNKDHAWDDHWIFWVGPFIGAALAALYHQLVIRAIPFKS 284



>gb:AB091106_1525007 Lilium longiflorum PIP1 mRNA for plasma
           membrane intrinsic protein, complete cds.
          Length = 288

 Score =  214 bits (546), Expect = 9e-55
 Identities = 103/165 (62%), Positives = 122/165 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RA+ Y+                  K  +++ GGGAN V  G++KG GL 
Sbjct: 122 GLFLARKLSLTRAIFYIIMQCLGAICGAGVVKGFQKGLYESNGGGANVVNHGYTKGDGLG 181

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 182 AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 241

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I+N  HAW DHW+FWVGP +GA   AVYHQ+V+RA   K+
Sbjct: 242 LGAAIIYNKSHAWHDHWVFWVGPFIGAALAAVYHQIVIRAIPFKS 286



>gb:AB002149_1508697 Nicotiana excelsior mRNA for water channel
           protein, complete cds.
          Length = 287

 Score =  214 bits (546), Expect = 9e-55
 Identities = 104/160 (65%), Positives = 120/160 (75%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RA+ YM                     +  +GGGAN VQPG++KG GL 
Sbjct: 121 GLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFMVGPYQRLGGGANVVQPGYTKGDGLG 180

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 181 AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 240

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRA 203
            GAA+I N+  AWDDHWIFWVGP +GA   AVYHQ+++RA
Sbjct: 241 LGAAIIFNHDQAWDDHWIFWVGPFIGAALAAVYHQIIIRA 280



>gb:AB029446_1518187 Oryza sativa rwc-2 mRNA for water channel
           protein, partial cds.
          Length = 181

 Score =  214 bits (545), Expect = 1e-54
 Identities = 108/172 (62%), Positives = 125/172 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RA+ Y+                    +F+  GGGANT+  G+SKG GL 
Sbjct: 9   GLFLARKVSLVRAILYIVAQCLGAICGVGLVKAFQSAYFNRYGGGANTLAAGYSKGTGLA 68

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFA F+  +ATIPITGTGINPAR+
Sbjct: 69  AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAWFMVQLATIPITGTGINPART 128

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
            G AVI NN+ AW + WIFWVGP +GA   A YHQ +LRA  +KAL GSF+S
Sbjct: 129 TGPAVIFNNEKAWHNQWIFWVGPFVGAAIAAFYHQYILRAGPIKAL-GSFRS 179



>gb:AB002147_1508695 Nicotiana excelsior mRNA for water channel
           protein, complete cds.
          Length = 285

 Score =  214 bits (545), Expect = 1e-54
 Identities = 106/165 (64%), Positives = 121/165 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV YM                  K  + T GGGAN V  G++KG GL 
Sbjct: 120 GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFGKTLYQTKGGGANVVNHGYTKGSGLG 179

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 180 AEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 239

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I+N  HAWDDHWIFWVGP +GA   A+Y QVV+RA   K+
Sbjct: 240 LGAAIIYNQDHAWDDHWIFWVGPFIGAALAALYQQVVIRAIPFKS 284



>gb:AY062610_1565266 Arabidopsis thaliana plasma membrane intrinsic
           protein 1C (transmembrane protein B) (F22L4.16) mRNA,
           complete cds.>gb:BT002101_1635704 Arabidopsis thaliana
           plasma membrane intrinsic protein 1C (transmembrane
           protein B) (At1g01620) mRNA, complete cds.
          Length = 286

 Score =  213 bits (543), Expect = 2e-54
 Identities = 104/165 (63%), Positives = 123/165 (74%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV Y+                   + + T+GGGANTV  G++KG GL 
Sbjct: 120 GLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQPNPYQTLGGGANTVAHGYTKGSGLG 179

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+AT PITGTGINPARS
Sbjct: 180 AEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATFPITGTGINPARS 239

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I+N  HAWDDHWIFWVGP +GA   A+YHQ+V+RA   K+
Sbjct: 240 LGAAIIYNKDHAWDDHWIFWVGPFIGAALAALYHQLVIRAIPFKS 284



>gb:AB100869_1526268 Malus x domestica MdPIP1a mRNA for plasma
           membrane intrinsic protein, complete cds.
          Length = 289

 Score =  213 bits (543), Expect = 2e-54
 Identities = 105/166 (63%), Positives = 124/166 (74%), Gaps = 1/166 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDF-FDTVGGGANTVQPGFSKGVGL 506
           GLFLARK+SL RAV Y+                  K   F+ +GGGAN+V  G++KG GL
Sbjct: 123 GLFLARKLSLTRAVFYIVMQTLGAIAGAAVVKGFEKSSTFEMLGGGANSVAHGYTKGQGL 182

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
            AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIP+TGTGINPAR
Sbjct: 183 GAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPVTGTGINPAR 242

Query: 325 SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
           S GAA+I+N KHAWDDHWIFWVGP +GA   A+YH VV+RA   K+
Sbjct: 243 SLGAAIIYNKKHAWDDHWIFWVGPFIGAALAALYHVVVIRAIPFKS 288



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 34/117 (29%), Positives = 50/117 (42%), Gaps = 4/117 (3%)
 Frame = -1

Query: 505 VAEILATFFLVY----TVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI 338
           +AE +ATF  +Y    TV      K       +  +A    G  +F    +T  I+G  I
Sbjct: 58  IAEFIATFLFLYITILTVMGVVKSKSKCTTVGIQGIA-WAFGGTIFALVYSTAGISGGHI 116

Query: 337 NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
           NPA +FG  +    K +      + V   LGAIAGA   +   ++   + LGG   S
Sbjct: 117 NPAVTFGLFLA--RKLSLTRAVFYIVMQTLGAIAGAAVVKGFEKSSTFEMLGGGANS 171



>pir|T03794|T03794 aquaporin NT2 - common
           tobacco>gb:NTU62280_1691857 Nicotiana tabacum aquaporin
           (NT2) mRNA, complete cds.
          Length = 284

 Score =  213 bits (543), Expect = 2e-54
 Identities = 105/165 (63%), Positives = 120/165 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV YM                     +  +GGGAN V PG++KG GL 
Sbjct: 120 GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFMVGPYQRLGGGANVVNPGYTKGDGLG 179

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGI PARS
Sbjct: 180 AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGITPARS 239

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I N   AWDDHWIFWVGP +GA   AVYHQ+++RA A K+
Sbjct: 240 LGAAIIFNQDRAWDDHWIFWVGPFIGAALAAVYHQIIIRAIAFKS 284



>gb:AP004026_1836554 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1136_C04.
          Length = 288

 Score =  213 bits (542), Expect = 2e-54
 Identities = 104/165 (63%), Positives = 120/165 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV YM                  +  +   GGGAN V PG++KG GL 
Sbjct: 122 GLFLARKLSLTRAVFYMAMQCLGAICGAGVVKGFQRGLYMGSGGGANAVNPGYTKGDGLG 181

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 182 AEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 241

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+++N  HAW DHWIFWVGP +GA   A+YH VV+RA   K+
Sbjct: 242 LGAAIVYNRAHAWHDHWIFWVGPFIGAALAAIYHVVVIRAIPFKS 286



>gb:AF326487_1786633 Zea mays plasma membrane integral protein
           ZmPIP1-3 mRNA, complete cds.>gb:AF326488_1786634 Zea
           mays plasma membrane integral protein ZmPIP1-4 mRNA,
           complete cds.
          Length = 292

 Score =  213 bits (542), Expect = 2e-54
 Identities = 103/165 (62%), Positives = 121/165 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RA+ Y+                  +  +   GGGAN V PG++KG GL 
Sbjct: 126 GLFLARKLSLTRAIFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANVVAPGYTKGDGLG 185

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 186 AEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 245

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I+N  HAW DHWIFWVGP +GA   A+YHQV++RA   K+
Sbjct: 246 LGAAIIYNRDHAWSDHWIFWVGPFIGAALAAIYHQVIIRAIPFKS 290



>gb:AY243800_1592433 Zea mays plasma membrane intrinsic protein
           (PIP1-1) mRNA, complete cds.
          Length = 288

 Score =  213 bits (542), Expect = 2e-54
 Identities = 105/165 (63%), Positives = 121/165 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV Y+                  +  +   GGGAN V PG++KG GL 
Sbjct: 122 GLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANVVAPGYTKGDGLG 181

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 182 AEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 241

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAAVI+N  HAW DHWIFWVGP +GA   A+YHQV++RA   K+
Sbjct: 242 LGAAVIYNQHHAWADHWIFWVGPFIGAALAAIYHQVIIRAIPFKS 286



>gb:ATPIP1C_1553861 A.thaliana mRNA for plasma membrane intrinsic
           protein 1c.
          Length = 286

 Score =  213 bits (542), Expect = 2e-54
 Identities = 103/165 (62%), Positives = 124/165 (75%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV Y+                   + + T+GGGANTV  G++KG GL 
Sbjct: 120 GLFLARKLSLTRAVFYIVMQCFGAICGAGVVKGFQPNPYQTLGGGANTVAHGYTKGSGLG 179

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF L+YTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+A+IPITGTGINPARS
Sbjct: 180 AEIIGTFVLIYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLASIPITGTGINPARS 239

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I+N  HAWDDHWIFWVGP +GA   A+YHQ+V+RA   K+
Sbjct: 240 LGAAIIYNKDHAWDDHWIFWVGPFIGAALAALYHQLVIRAIPFKS 284



>gb:AB058679_1521730 Pyrus communis Py-PIP1-1 mRNA for plasma
           membrane intrinsic protein 1-1, complete cds.
          Length = 289

 Score =  213 bits (542), Expect = 2e-54
 Identities = 104/166 (62%), Positives = 124/166 (74%), Gaps = 1/166 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDF-FDTVGGGANTVQPGFSKGVGL 506
           GLFLARK+SL RAV YM                  K   F+ +GGGAN+V  G++KG GL
Sbjct: 123 GLFLARKLSLTRAVFYMVMQTLGAIAGAAVVKGFEKSSTFEMLGGGANSVAHGYTKGQGL 182

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
            AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIP+TGTGINPAR
Sbjct: 183 GAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPVTGTGINPAR 242

Query: 325 SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
           S GAA+I+N +HAWDDHW+FWVGP +GA   A+YH VV+RA   K+
Sbjct: 243 SLGAAIIYNKQHAWDDHWVFWVGPFIGAALAALYHVVVIRAIPFKS 288



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 34/117 (29%), Positives = 50/117 (42%), Gaps = 4/117 (3%)
 Frame = -1

Query: 505 VAEILATFFLVY----TVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI 338
           +AE +ATF  +Y    TV      K       +  +A    G  +F    +T  I+G  I
Sbjct: 58  IAEFIATFLFLYITILTVMGVVKSKSKCTTVGIQGIA-WAFGGTIFALVYSTAGISGGHI 116

Query: 337 NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
           NPA +FG  +    K +      + V   LGAIAGA   +   ++   + LGG   S
Sbjct: 117 NPAVTFGLFLA--RKLSLTRAVFYMVMQTLGAIAGAAVVKGFEKSSTFEMLGGGANS 171



>gb:AF131201_1770834 Zea mays plasma membrane MIP protein (pip1-2)
           mRNA, complete cds.
          Length = 289

 Score =  213 bits (541), Expect = 3e-54
 Identities = 103/165 (62%), Positives = 122/165 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RA+ Y+                  +  +   GGGAN V PG++KG GL 
Sbjct: 123 GLFLARKLSLTRALFYIIMQCLGAVCGAGVVKGFQQGLYMGNGGGANVVAPGYTKGDGLG 182

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 183 AEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 242

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I+N  HAW+DHWIFWVGP +GA   A+YHQV++RA   K+
Sbjct: 243 LGAAIIYNRDHAWNDHWIFWVGPFIGAALAAIYHQVIIRAIPFKS 287



>gb:AF004293_1760683 Brassica rapa aquaporin (MOD) mRNA, complete
           cds.
          Length = 286

 Score =  212 bits (539), Expect = 6e-54
 Identities = 103/165 (62%), Positives = 121/165 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV Y+                     +  +GGGANTV PG++KG GL 
Sbjct: 120 GLFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTVAPGYTKGSGLG 179

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 180 AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 239

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I N  +AWDDHW+FWVGP +GA   A+YH +V+RA   K+
Sbjct: 240 LGAAIIFNKDNAWDDHWVFWVGPFIGAALAALYHVIVIRAIPFKS 284



>gb:AB030696_1518527 Raphanus sativus PAQ1c mRNA for plasma membrane
           aquaporin 1c, complete cds.>gb:BOMIPBTCP_1633862
           B.oleracea mRNA for transmembrane channel protein
           (mipB).
          Length = 286

 Score =  212 bits (539), Expect = 6e-54
 Identities = 103/165 (62%), Positives = 121/165 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV Y+                     +  +GGGANTV PG++KG GL 
Sbjct: 120 GLFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTVAPGYTKGSGLG 179

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 180 AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 239

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I N  +AWDDHW+FWVGP +GA   A+YH +V+RA   K+
Sbjct: 240 LGAAIIFNKDNAWDDHWVFWVGPFIGAALAALYHVIVIRAIPFKS 284



>gb:AB030695_1518526 Raphanus sativus PAQ1b mRNA for plasma membrane
           aquaporin 1b, complete cds.
          Length = 286

 Score =  212 bits (539), Expect = 6e-54
 Identities = 103/165 (62%), Positives = 121/165 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV Y+                     +  +GGGANTV PG++KG GL 
Sbjct: 120 GLFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTVAPGYTKGSGLG 179

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 180 AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 239

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I N  +AWDDHW+FWVGP +GA   A+YH +V+RA   K+
Sbjct: 240 LGAAIIFNKDNAWDDHWVFWVGPFIGAALAALYHVIVIRAIPFKS 284



>gb:HVEMIP_1682347 H.vulgare mRNA for transmembrane protein.
          Length = 288

 Score =  211 bits (538), Expect = 7e-54
 Identities = 103/160 (64%), Positives = 119/160 (74%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV Y+                  +  +   GGGAN V  G++KG GL 
Sbjct: 122 GLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANVVASGYTKGSGLG 181

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 182 AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 241

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRA 203
            GAA+I+N +HAW DHWIFWVGP +GA   A+YHQVV+RA
Sbjct: 242 LGAAIIYNREHAWSDHWIFWVGPFIGAALAAIYHQVVIRA 281



>sp|Q8LAA6|PI15_ARATH Probable aquaporin PIP1.5 (Plasma membrane
           intrinsic protein 1d) (PIP1d).>pir|T05378|T05378
           probable plasma membrane intrinsic protein F16G20.100 -
           Arabidopsis thaliana>gb:ATCHRIV59_1546177 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           59.>gb:ATF16G20_1548779 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F16G20 (ESSAII
           project).>gb:AY059948_1564792 Arabidopsis thaliana water
           channel - like protein (At4g23400; F16G20.100) mRNA,
           complete cds.>gb:AY081593_1568853 Arabidopsis thaliana
           water channel-like protein (At4g23400) mRNA, complete
           cds.
          Length = 287

 Score =  211 bits (538), Expect = 7e-54
 Identities = 103/165 (62%), Positives = 121/165 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RA+ Y+                     + T GGGAN V  G++KG GL 
Sbjct: 121 GLFLARKLSLTRALFYIVMQCLGAICGAGVVKGFQPGLYQTNGGGANVVAHGYTKGSGLG 180

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 181 AEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 240

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I+N  HAWDDHWIFWVGP +GA   A+YHQ+V+RA   K+
Sbjct: 241 LGAAIIYNKDHAWDDHWIFWVGPFIGAALAALYHQIVIRAIPFKS 285



>gb:AJ843992_1814684 Plantago major partial mRNA for aquaporin 2
           (aqp2 gene).
          Length = 282

 Score =  211 bits (537), Expect = 9e-54
 Identities = 104/160 (65%), Positives = 119/160 (74%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV YM                  +  + T GGGAN V  G++KG GL 
Sbjct: 117 GLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFGQTLYMTKGGGANVVAHGYTKGDGLG 176

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 177 AEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 236

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRA 203
            GAA+I+N  HAWDDHWIFWVGP +GA   A+YH VV+RA
Sbjct: 237 LGAAIIYNRDHAWDDHWIFWVGPFIGAALAALYHVVVIRA 276



>gb:AF366564_1791667 Triticum aestivum aquaporin PIP1 (Pip1) mRNA,
           complete cds.
          Length = 292

 Score =  211 bits (537), Expect = 9e-54
 Identities = 104/165 (63%), Positives = 121/165 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV Y+                     +   GGGAN+V PG++KG GL 
Sbjct: 126 GLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQTTLYQGNGGGANSVAPGYTKGDGLG 185

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 186 AEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 245

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I+N K AWDDHWIFWVGP +GA   A+YH VV+RA   K+
Sbjct: 246 LGAAIIYNKKQAWDDHWIFWVGPFIGAALAAIYHVVVIRAIPFKS 290



>gb:ZMA271796_1731485 Zea mays mRNA for plasma membrane intrinsic
           protein (pip4 gene).>gb:AF326489_1786635 Zea mays plasma
           membrane integral protein ZmPIP1-5 mRNA, complete cds.
          Length = 288

 Score =  211 bits (537), Expect = 9e-54
 Identities = 101/165 (61%), Positives = 121/165 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RA+ YM                  +  +   GGGAN V PG++KG GL 
Sbjct: 122 GLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFQEGLYMGAGGGANAVNPGYTKGDGLG 181

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 182 AEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 241

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+++N  HAW+DHWIFWVGP +GA   A+YH V++RA   K+
Sbjct: 242 LGAAIVYNRSHAWNDHWIFWVGPFIGAALAAIYHVVIIRALPFKS 286



>gb:D85192_1674879 Arabidopsis thaliana mRNA for transmembrane
           protein, complete cds.
          Length = 287

 Score =  211 bits (537), Expect = 9e-54
 Identities = 103/165 (62%), Positives = 121/165 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV YM                     + T+GGGANT   G++KG GL 
Sbjct: 121 GLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYQTLGGGANTGAHGYTKGSGLG 180

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KR+ RDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 181 AEIIGTFVLVYTVFSATDDKRSVRDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 240

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I+N  H+WDDHWIFWVGP +GA   A+YHQ+V+RA   K+
Sbjct: 241 LGAAIIYNKDHSWDDHWIFWVGPFIGAALAALYHQIVIRAIPFKS 285



>gb:AB100870_1526269 Malus x domestica MdPIP1b mRNA for plasma
           membrane intrinsic protein, complete cds.
          Length = 289

 Score =  211 bits (537), Expect = 9e-54
 Identities = 103/166 (62%), Positives = 124/166 (74%), Gaps = 1/166 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDF-FDTVGGGANTVQPGFSKGVGL 506
           GLFLARK+SL RA+ Y+                  K   F+ +GGGAN+V  G++KG GL
Sbjct: 123 GLFLARKLSLTRALFYIVMQTLGAIAGAAVVKGFEKSSTFEMLGGGANSVAHGYTKGQGL 182

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
            AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIP+TGTGINPAR
Sbjct: 183 GAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPVTGTGINPAR 242

Query: 325 SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
           S GAA+I+N +HAWDDHWIFWVGP +GA   A+YH VV+RA   K+
Sbjct: 243 SLGAAIIYNKRHAWDDHWIFWVGPFIGAALAALYHVVVIRAIPFKS 288



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 34/117 (29%), Positives = 50/117 (42%), Gaps = 4/117 (3%)
 Frame = -1

Query: 505 VAEILATFFLVY----TVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGI 338
           +AE +ATF  +Y    TV      K       +  +A    G  +F    +T  I+G  I
Sbjct: 58  IAEFIATFLFLYITILTVMGVVKSKSKCTTVGIQGIA-WAFGGTIFALVYSTAGISGGHI 116

Query: 337 NPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
           NPA +FG  +    K +      + V   LGAIAGA   +   ++   + LGG   S
Sbjct: 117 NPAVTFGLFLA--RKLSLTRALFYIVMQTLGAIAGAAVVKGFEKSSTFEMLGGGANS 171



>gb:AF188843_1775242 Vitis vinifera cultivar Pinot Noir plasma
           membrane aquaporin (PIP1a) mRNA, complete cds.
          Length = 286

 Score =  211 bits (536), Expect = 1e-53
 Identities = 103/160 (64%), Positives = 119/160 (74%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL LARK+SL RAV YM                     ++ +GGGAN V  G+SKG GL 
Sbjct: 120 GLLLARKLSLTRAVFYMIMQCLGAICGASVVKGFQGHQYEVLGGGANVVAAGYSKGDGLG 179

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 180 AEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 239

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRA 203
            GAA+I+N +HAWDD WIFWVGP +GA   A+YHQ+V+RA
Sbjct: 240 LGAAIIYNREHAWDDMWIFWVGPFIGAALAALYHQIVIRA 279



>gb:AB012044_1511624 Raphanus sativus mRNA for plasma membrane
           aquaporin (PAQ1), complete cds.
          Length = 286

 Score =  211 bits (536), Expect = 1e-53
 Identities = 101/165 (61%), Positives = 122/165 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RA+ Y+                   + +  +GGGANTV  G++KG GL 
Sbjct: 120 GLFLARKLSLTRALYYIVMQCLGAICGAGVVKGFQPNQYQALGGGANTVAHGYTKGSGLG 179

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 180 AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 239

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I+N  H+WDDHW+FWVGP +GA   A+YH +V+RA   K+
Sbjct: 240 LGAAIIYNKDHSWDDHWVFWVGPFIGAALAALYHVIVIRAIPFKS 284



>pir|T12434|T12434 probable plasma membrane intrinsic protein A -
           common ice plant>gb:CIPMIPA_1647639 Mesembryanthemum
           crystallinum mipA mRNA, complete cds.
          Length = 283

 Score =  211 bits (536), Expect = 1e-53
 Identities = 103/165 (62%), Positives = 121/165 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV YM                     +  +GGGAN+V PG++KG GL 
Sbjct: 118 GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFQPTPYQLLGGGANSVNPGYTKGSGLG 177

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIP+TGTGINPARS
Sbjct: 178 AEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPVTGTGINPARS 237

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I+N  HAW DHWIFWVGP +GA   A+YH VV+RA   K+
Sbjct: 238 LGAAIIYNRPHAWADHWIFWVGPFIGAALAALYHVVVIRAIPFKS 282



>pir|T12342|T12342 major intrinsic protein homolog - common ice
           plant>gb:MCU26537_1685856 Mesembryanthemum crystallinum
           major intrinsic protein homolog (mipD) mRNA, complete
           cds.
          Length = 285

 Score =  210 bits (535), Expect = 2e-53
 Identities = 102/160 (63%), Positives = 119/160 (74%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL LARK+SL RAV YM                     ++++GGGAN V   ++KG GL 
Sbjct: 119 GLLLARKLSLTRAVFYMIMQCLGAICGAGVVKGFESGAYESMGGGANVVASAYTKGDGLG 178

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 179 AEIIGTFVLVYTVFSATDAKRSARDSHVPLLAPLPIGFAVFLVHLATIPITGTGINPARS 238

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRA 203
            GAA+I+N  HAWDDHWIFWVGP +GA   AVYHQ+V+RA
Sbjct: 239 LGAAIIYNKAHAWDDHWIFWVGPFIGAALAAVYHQIVIRA 278



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 28/95 (29%), Positives = 43/95 (45%), Gaps = 3/95 (3%)
 Frame = -1

Query: 505 VAEILATFFLVY-TVFSATDPKRNARDSHVPVLAPLPIGFA--VFVAHVATIPITGTGIN 335
           +AE +ATFF +Y +V +     RN        +  +   F   +F     T  I+G  IN
Sbjct: 54  LAEFIATFFFLYVSVLTVMGVSRNPNKCATVGIQGIAWAFGGMIFALVYCTAGISGGHIN 113

Query: 334 PARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGA 230
           PA +FG  ++   K +      + +   LGAI GA
Sbjct: 114 PAVTFG--LLLARKLSLTRAVFYMIMQCLGAICGA 146



>sp|P61837|PI11_ARATH Aquaporin PIP1.1 (Plasma membrane intrinsic
           protein 1a) (PIP1a) (Aquaporin 1) (Plasma membrane
           aquaporin 1).>sp|P61838|PI11_VICFA Aquaporin PIP1.1
           (Plasma membrane intrinsic protein 1a) (PIP1a)
           (Aquaporin 1) (Plasma membrane aquaporin
           1).>pir|T47935|T47935 plasma membrane intrinsic protein
           1a - Arabidopsis thaliana>gb:ATF2A19_1550418 Arabidopsis
           thaliana DNA chromosome 3, BAC clone
           F2A19.>gb:AY058113_1564252 Arabidopsis thaliana
           AT3g61430/F2A19_30 mRNA, complete
           cds.>gb:AY097398_1576393 Arabidopsis thaliana
           AT3g61430/F2A19_30 mRNA, complete
           cds.>gb:VFA289701_1727100 Vicia faba mRNA for aquaporin
           (aq1 gene).>gb:AF266760_1781946 Vicia faba plasma
           membrane aquaporin mRNA, complete cds.
          Length = 286

 Score =  210 bits (535), Expect = 2e-53
 Identities = 102/165 (61%), Positives = 121/165 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RA+ Y+                     +  +GGGANTV  G++KG GL 
Sbjct: 120 GLFLARKLSLTRALYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTVAHGYTKGSGLG 179

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 180 AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 239

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I+N  H+WDDHW+FWVGP +GA   A+YH VV+RA   K+
Sbjct: 240 LGAAIIYNKDHSWDDHWVFWVGPFIGAALAALYHVVVIRAIPFKS 284



>gb:OSAJ4327_1692771 Oryza sativa mRNA for aquaporin, complete
           CDS.>gb:AP004139_1838158 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ1486_E07.>gb:AP005108_1847983 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0461B08.
          Length = 289

 Score =  210 bits (534), Expect = 2e-53
 Identities = 102/165 (61%), Positives = 121/165 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RA+ Y+                  +  +   GGGAN V  G++KG GL 
Sbjct: 123 GLFLARKLSLTRAIFYIVMQCLGAICGAGVVKGFQQGLYMGNGGGANVVASGYTKGDGLG 182

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 183 AEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 242

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I+N  HAW+DHWIFWVGP +GA   A+YHQV++RA   K+
Sbjct: 243 LGAAIIYNKDHAWNDHWIFWVGPFVGAALAAIYHQVIIRAIPFKS 287



>gb:AB009665_1510797 Oryza sativa (japonica cultivar-group) mRNA for
           water channel protein, complete cds.
          Length = 289

 Score =  210 bits (534), Expect = 2e-53
 Identities = 102/165 (61%), Positives = 121/165 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RA+ Y+                  +  +   GGGAN V  G++KG GL 
Sbjct: 123 GLFLARKLSLTRAIFYIVMQCLGAICGAGVVKGFQQGLYMGNGGGANVVASGYTKGDGLG 182

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 183 AEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 242

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I+N  HAW+DHWIFWVGP +GA   A+YHQV++RA   K+
Sbjct: 243 LGAAIIYNKDHAWNDHWIFWVGPFVGAALAAIYHQVIIRAIPFKS 287



>gb:AB009309_1510771 Hordeum vulgare HvPIP1;5 mRNA, complete cds.
          Length = 290

 Score =  210 bits (534), Expect = 2e-53
 Identities = 102/160 (63%), Positives = 119/160 (74%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RA+ Y+                  +  +   GGGAN V  G++KG GL 
Sbjct: 123 GLFLARKLSLTRAIFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANVVASGYTKGDGLG 182

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 183 AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 242

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRA 203
            GAA+I+N  HAW+DHWIFWVGP +GA   AVYHQV++RA
Sbjct: 243 LGAAIIYNRDHAWNDHWIFWVGPFVGAALAAVYHQVIIRA 282



>gb:AJ849322_1814740 Populus tremula x Populus tremuloides mRNA for
           putative plasma membrane intrinsic protein (pip1.2
           gene).
          Length = 288

 Score =  209 bits (533), Expect = 3e-53
 Identities = 106/166 (63%), Positives = 120/166 (72%), Gaps = 1/166 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDF-FDTVGGGANTVQPGFSKGVGL 506
           GLFLARK+SL RAV Y+                      F+  GGGAN V  G++KG GL
Sbjct: 121 GLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFQGSHNFELQGGGANVVNHGYTKGDGL 180

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
            AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct: 181 GAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR 240

Query: 325 SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
           S GAA+I N  HAWDDHWIFWVGP +GA   AVYHQ+V+RA   K+
Sbjct: 241 SLGAAIIFNKDHAWDDHWIFWVGPFIGAALAAVYHQIVIRAIPFKS 286



>gb:AB109206_1526807 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:
           P0478E02.>gb:AP006149_1860963 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 9, BAC
           clone:B1274F11.
          Length = 290

 Score =  209 bits (533), Expect = 3e-53
 Identities = 105/173 (60%), Positives = 123/173 (71%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLF  RK+SL+R V Y+                + K  +D +GGGANTV  G+S    L 
Sbjct: 115 GLFFGRKLSLVRTVLYVVAQCLGAIAGAGIVKGIMKRPYDALGGGANTVSDGYSAAGALG 174

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR ARDS +PVL PLPIGFAVFV H+ATIPITGTGINPARS
Sbjct: 175 AEIVGTFILVYTVFSATDPKRTARDSFIPVLVPLPIGFAVFVVHLATIPITGTGINPARS 234

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQST 164
            GAAV++N   AW DHWIFWVGP++GA   A YH++VLR +A KAL  SF+ST
Sbjct: 235 LGAAVLYNQHAAWKDHWIFWVGPVIGAFLAAAYHKLVLRGEAAKAL-SSFRST 286



>gb:AB009308_1510770 Hordeum vulgare HvPIP1;3 mRNA, complete cds.
          Length = 292

 Score =  209 bits (533), Expect = 3e-53
 Identities = 104/167 (62%), Positives = 121/167 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV Y+                     +   GGGAN+V  G++KG GL 
Sbjct: 126 GLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQTTLYQGNGGGANSVAAGYTKGDGLG 185

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 186 AEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 245

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALG 182
            GAA+I+N K AWDDHWIFWVGP +GA   A+YH VV+RA   K+ G
Sbjct: 246 LGAAIIYNKKQAWDDHWIFWVGPFIGAALAAIYHVVVIRAIPFKSRG 292



>pir|T04368|T04368 plasma membrane intrinsic protein BPW2 - barley
          Length = 216

 Score =  209 bits (533), Expect = 3e-53
 Identities = 104/167 (62%), Positives = 121/167 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV Y+                     +   GGGAN+V  G++KG GL 
Sbjct: 50  GLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQTTLYQGNGGGANSVAAGYTKGDGLG 109

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 110 AEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 169

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALG 182
            GAA+I+N K AWDDHWIFWVGP +GA   A+YH VV+RA   K+ G
Sbjct: 170 LGAAIIYNKKQAWDDHWIFWVGPFIGAALAAIYHVVVIRAIPFKSRG 216



>gb:AF141898_1771602 Vitis berlandieri x Vitis rupestris putative
           aquaporin PIP1-2 (PIP1-2) mRNA, complete cds.
          Length = 286

 Score =  209 bits (532), Expect = 4e-53
 Identities = 102/165 (61%), Positives = 121/165 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL LARK+SL RAV YM                     ++ +GGGAN V  G++KG GL 
Sbjct: 120 GLLLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQGHQYEVLGGGANVVAAGYTKGDGLG 179

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 180 AEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 239

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+++N +HAWDD WIFWVGP +GA   A+YHQ+V+RA   K+
Sbjct: 240 LGAAIVYNKEHAWDDMWIFWVGPFIGAALAALYHQIVIRAIPFKS 284



>gb:AY087945_1572970 Arabidopsis thaliana clone 3982 mRNA, complete
           sequence.
          Length = 287

 Score =  209 bits (531), Expect = 5e-53
 Identities = 102/165 (61%), Positives = 120/165 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RA+ Y+                     + T GGGAN V  G++KG GL 
Sbjct: 121 GLFLARKLSLTRALFYIVMQSLGAICGAGVVKGFQPGLYQTNGGGANVVAHGYTKGSGLG 180

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KR+ARDSHV +LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 181 AEIVGTFVLVYTVFSATDAKRSARDSHVRILAPLPIGFAVFLVHLATIPITGTGINPARS 240

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I+N  HAWDDHWIFWVGP +GA   A+YHQ+V+RA   K+
Sbjct: 241 LGAAIIYNKDHAWDDHWIFWVGPFIGAALAALYHQIVIRAIPFKS 285



>pir|S41194|S41194 transmembrane protein - barley
          Length = 288

 Score =  209 bits (531), Expect = 5e-53
 Identities = 103/160 (64%), Positives = 117/160 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLAR VSL RAV Y+                  +  +   GGGAN V  G++KG GL 
Sbjct: 122 GLFLARNVSLTRAVFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANVVASGYTKGSGLG 181

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI  TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 182 AEIHGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 241

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRA 203
            GAA+I+N +HAW DHWIFWVGP +GA   A+YHQVV+RA
Sbjct: 242 LGAAIIYNREHAWSDHWIFWVGPFIGAALAAIYHQVVIRA 281



>gb:AF299051_1784200 Brassica oleracea aquaporin PIP1b2 mRNA,
           complete cds.
          Length = 286

 Score =  208 bits (530), Expect = 6e-53
 Identities = 102/165 (61%), Positives = 120/165 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV Y+                     +  +GGGANTV  G++KG GL 
Sbjct: 120 GLFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTVAHGYTKGSGLG 179

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 180 AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 239

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I N  +AWDDHW+FWVGP +GA   A+YH +V+RA   K+
Sbjct: 240 LGAAIIFNKDNAWDDHWVFWVGPFIGAALAALYHVIVIRAIPFKS 284



>gb:AF299050_1784199 Brassica oleracea aquaporin PIP1b1 mRNA,
           complete cds.
          Length = 286

 Score =  208 bits (530), Expect = 6e-53
 Identities = 102/165 (61%), Positives = 120/165 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV Y+                     +  +GGGANTV  G++KG GL 
Sbjct: 120 GLFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTVAHGYTKGSGLG 179

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 180 AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 239

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I N  +AWDDHW+FWVGP +GA   A+YH +V+RA   K+
Sbjct: 240 LGAAIIFNKDNAWDDHWVFWVGPFIGAALAALYHVIVIRAIPFKS 284



>gb:POC314584_1700958 Posidonia oceanica mRNA for putative plasma
           membrane intrinsic protein (pip1a gene).
          Length = 290

 Score =  208 bits (530), Expect = 6e-53
 Identities = 105/162 (64%), Positives = 122/162 (75%), Gaps = 2/162 (1%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXX-XXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGL 506
           GLFLARK+S+ RA+ YM                 + KD F    GGAN V  G++KG GL
Sbjct: 122 GLFLARKLSMTRALFYMVMQCLGAICGAGVVKGFVNKDNFAMWKGGANVVSHGYTKGDGL 181

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
            AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct: 182 GAEIVGTFLLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR 241

Query: 325 SFGAAVIHNNKHAWDD-HWIFWVGPMLGAIAGAVYHQVVLRA 203
           SFGAAVI+N +HAWDD HW+FWVGP +GA   A+YHQ+V+RA
Sbjct: 242 SFGAAVIYNKQHAWDDHHWVFWVGPFIGAALAAIYHQIVIRA 283



>pir|T14863|T14863 porin Mip1 - Norway spruce>gb:PAMIP1_1698758
           P.abies mRNA for porin Mip1.
          Length = 288

 Score =  208 bits (530), Expect = 6e-53
 Identities = 103/160 (64%), Positives = 120/160 (75%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV YM                  +  ++  GGGAN+V  G++KG GL 
Sbjct: 122 GLFLARKLSLPRAVFYMICQCLGAICGAGVVKGFMESEYEMDGGGANSVAHGYTKGDGLG 181

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 182 AEIVGTFVLVYTVFSATDAKRSARDSHVPMLAPLPIGFAVFLVHLATIPITGTGINPARS 241

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRA 203
            GAA+I+N  HAWDDHWIFWVGP LGA   A YHQ+++RA
Sbjct: 242 LGAAIIYNKSHAWDDHWIFWVGPFLGAGLAAFYHQMIIRA 281



>pir|T02095|T02095 transmembrane protein - rice>gb:AF022737_1762012
           Oryza sativa transmembrane protein mRNA, complete cds.
          Length = 289

 Score =  208 bits (530), Expect = 6e-53
 Identities = 101/165 (61%), Positives = 120/165 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLA+ VSL RA+ Y+                  +  F   GGGAN +  G++KG GL 
Sbjct: 123 GLFLAKNVSLSRAIFYILMQCLGAICRTGFVKGFQQGLFMGHGGGANVIATGYTKGDGLG 182

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 183 AEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 242

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I+N  HAW+DHWIFWVGP +GA   A+YHQV++RA   K+
Sbjct: 243 LGAAIIYNKDHAWNDHWIFWVGPFVGAALAAIYHQVIIRAIPFKS 287



>pir|T01528|T01528 probable plasma membrane intrinsic protein 1c -
           Arabidopsis thaliana>gb:ATCHRIV1_1544222 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           1.>gb:F5I10_1678374 Arabidopsis thaliana BAC
           F5I10.>gb:IG005I10_1683060 Arabidopsis thaliana BAC
           IG005I10.
          Length = 295

 Score =  208 bits (530), Expect = 6e-53
 Identities = 106/173 (61%), Positives = 123/173 (71%), Gaps = 8/173 (4%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV YM                     + T+GGGANTV  G++KG GL 
Sbjct: 121 GLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYQTLGGGANTVAHGYTKGSGLG 180

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPV--------LAPLPIGFAVFVAHVATIPITG 347
           AEI+ TF LVYTVFSATD KR+ARDSHVPV        LAPLPIGFAVF+ H+ATIPITG
Sbjct: 181 AEIIGTFVLVYTVFSATDAKRSARDSHVPVWTPLLVPILAPLPIGFAVFLVHLATIPITG 240

Query: 346 TGINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
           TGINPARS GAA+I+N  H+WDDHWIFWVGP +GA   A+YHQ+V+RA   K+
Sbjct: 241 TGINPARSLGAAIIYNKDHSWDDHWIFWVGPFIGAALAALYHQIVIRAIPFKS 293



>gb:AF499725_1806148 Thellungiella halophila plasma membrane
           intrinsic protein 1B-like protein mRNA, complete cds.
          Length = 214

 Score =  208 bits (529), Expect = 8e-53
 Identities = 101/165 (61%), Positives = 120/165 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV Y+                     +  +GGGANT+  G++KG GL 
Sbjct: 48  GLFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTIAHGYTKGSGLG 107

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 108 AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 167

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I N  +AWDDHW+FWVGP +GA   A+YH +V+RA   K+
Sbjct: 168 LGAAIIFNKDNAWDDHWVFWVGPFIGAALAALYHVIVIRAIPFKS 212



>gb:ATPIP1A_1553860 A.thaliana mRNA for plasma membrane intrinsic
           protein 1a.
          Length = 286

 Score =  208 bits (529), Expect = 8e-53
 Identities = 101/165 (61%), Positives = 120/165 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RA+ Y+                     +  +GGGANTV  G++KG GL 
Sbjct: 120 GLFLARKLSLTRALYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTVAHGYTKGSGLG 179

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPIT TGINPARS
Sbjct: 180 AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITATGINPARS 239

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I+N  H+WDDHW+FWVGP +GA   A+YH VV+RA   K+
Sbjct: 240 LGAAIIYNKDHSWDDHWVFWVGPFIGAALAALYHVVVIRAIPFKS 284



>gb:ATORFA_1553802 Arabidopsis thaliana mRNA for PIP1b protein.
          Length = 286

 Score =  208 bits (529), Expect = 8e-53
 Identities = 101/165 (61%), Positives = 120/165 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV Y+                     +  +GGGANT+  G++KG GL 
Sbjct: 120 GLFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTIAHGYTKGSGLG 179

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 180 AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 239

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I N  +AWDDHW+FWVGP +GA   A+YH +V+RA   K+
Sbjct: 240 LGAAIIFNKDNAWDDHWVFWVGPFIGAALAALYHVIVIRAIPFKS 284



>sp|Q06611|PI12_ARATH Aquaporin PIP1.2 (Plasma membrane intrinsic
           protein 1b) (PIP1b) (Transmembrane protein A) (TMP-A)
           (AthH2).>pir|T02451|T02451 plasma membrane intrinsic
           protein 1b - Arabidopsis thaliana>gb:AC004665_1531921
           Arabidopsis thaliana chromosome 2 clone F4I18 map
           CIC02E07, complete sequence.>gb:ATRNATPR_1554076
           A.thaliana mRNA for transmembrane protein
           A.>gb:AY048294_1561755 Arabidopsis thaliana
           At2g45960/F4I18.6 mRNA, complete
           cds.>gb:AY063931_1565878 Arabidopsis thaliana putative
           aquaporin, plasma membrane intrinsic protein 1B
           (At2g45960) mRNA, complete cds.>gb:AY091254_1574462
           Arabidopsis thaliana putative aquaporin protein
           (At2g45960) mRNA, complete cds.
          Length = 286

 Score =  208 bits (529), Expect = 8e-53
 Identities = 101/165 (61%), Positives = 120/165 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV Y+                     +  +GGGANT+  G++KG GL 
Sbjct: 120 GLFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTIAHGYTKGSGLG 179

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 180 AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 239

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I N  +AWDDHW+FWVGP +GA   A+YH +V+RA   K+
Sbjct: 240 LGAAIIFNKDNAWDDHWVFWVGPFIGAALAALYHVIVIRAIPFKS 284



>gb:AF452010_1800838 Petunia x hybrida channel-like protein (PIP1;1)
           mRNA, complete cds.
          Length = 286

 Score =  207 bits (528), Expect = 1e-52
 Identities = 101/160 (63%), Positives = 119/160 (74%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RA+ Y+                  +  +  +GGGAN V  G++KG GL 
Sbjct: 121 GLFLARKLSLTRALFYIVMQCLGAICGAGVVKGYMQGPYQRLGGGANEVAHGYTKGDGLG 180

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 181 AEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 240

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRA 203
            GAA+I+N   AWDDHWIFWVGP +GA   AVYHQ+++RA
Sbjct: 241 LGAAIIYNTDAAWDDHWIFWVGPFIGAALAAVYHQIIIRA 280



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 29/95 (30%), Positives = 43/95 (45%), Gaps = 3/95 (3%)
 Frame = -1

Query: 505 VAEILATFFLVY-TVFSATDPKRNARDSHVPVLAPLPIGFA--VFVAHVATIPITGTGIN 335
           +AE +ATF  +Y T+ +    KR+    H   +  +   F   +F     T  I+G  IN
Sbjct: 56  IAEFMATFLFLYITILTVMGVKRSDSLCHSVGIQGIAWAFGGMIFALVYCTAGISGGHIN 115

Query: 334 PARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGA 230
           PA +FG  +    K +      + V   LGAI GA
Sbjct: 116 PAVTFGLFLA--RKLSLTRALFYIVMQCLGAICGA 148



>gb:AY088439_1573458 Arabidopsis thaliana clone 6690 mRNA, complete
           sequence.
          Length = 286

 Score =  207 bits (528), Expect = 1e-52
 Identities = 101/165 (61%), Positives = 120/165 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RA+ Y+                     +  +GGGANTV   ++KG GL 
Sbjct: 120 GLFLARKLSLTRALYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTVAXXYTKGSGLG 179

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 180 AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 239

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I+N  H+WDDHW+FWVGP +GA   A+YH VV+RA   K+
Sbjct: 240 LGAAIIYNKDHSWDDHWVFWVGPFIGAALAALYHVVVIRAIPFKS 284



>gb:AJ699398_1813477 Chenopodium rubrum partial mRNA for putative
           aquaporin (aqp gene).
          Length = 197

 Score =  207 bits (527), Expect = 1e-52
 Identities = 103/167 (61%), Positives = 121/167 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL LARK+SL RAV YM                     +D +GGGAN V  G+SKG GL 
Sbjct: 31  GLLLARKLSLTRAVFYMVMQCLGAICGAGVVKGFQPTPYDVLGGGANKVNHGYSKGDGLG 90

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPI FAVF+ H+ATIPITGTGINPARS
Sbjct: 91  AEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIEFAVFLVHLATIPITGTGINPARS 150

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALG 182
            GAA+I+N + +W+DHWIFWVGP +GA   AVYHQ+V+RA   K+ G
Sbjct: 151 LGAAIIYNKERSWNDHWIFWVGPFIGAALAAVYHQIVIRAIPFKSKG 197



>pir|T12435|T12435 probable plasma membrane intrinsic protein B -
           common ice plant>gb:CIPMIPB_1647640 Mesembryanthemum
           crystallinum aquaporin (mipB) mRNA, complete cds.
          Length = 285

 Score =  207 bits (527), Expect = 1e-52
 Identities = 102/165 (61%), Positives = 119/165 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL LARK+SL RAV YM                     ++ +GGGAN V  G++KG GL 
Sbjct: 119 GLLLARKLSLSRAVFYMIMQCLGAICGAGVVKGFQPSQYEMLGGGANVVNHGYTKGSGLG 178

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 179 AEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 238

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I N  HAWDDHWIFWVGP +GA   A+YH +V+RA   K+
Sbjct: 239 LGAAIIFNKGHAWDDHWIFWVGPFIGAALAALYHTIVIRAIPFKS 283



>gb:AF326490_1786636 Zea mays plasma membrane integral protein
           ZmPIP1-6 mRNA, complete cds.
          Length = 296

 Score =  207 bits (526), Expect = 2e-52
 Identities = 102/165 (61%), Positives = 117/165 (70%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL LARK+SL RAV Y+                     +++ GGGAN V PG++KG GL 
Sbjct: 128 GLLLARKLSLTRAVYYVVMQCLGAVCGAGVVKAFGSALYESAGGGANAVSPGYTKGDGLG 187

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AE++ TF LVYTVFSATD KR ARDSHVP LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 188 AEVVGTFVLVYTVFSATDAKRTARDSHVPALAPLPIGFAVFLVHLATIPITGTGINPARS 247

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I++N H W  HWIFWVGP  GA   AVYHQVVLRA   K+
Sbjct: 248 LGAAIIYDNPHGWHGHWIFWVGPFAGAALAAVYHQVVLRAIPFKS 292



>gb:NTAQUAPOR_1691468 Nicotiana tabacum mRNA for aquaporin
           1.>gb:AF024511_1762116 Nicotiana tabacum aquaporin 1
           mRNA, complete cds.
          Length = 287

 Score =  207 bits (526), Expect = 2e-52
 Identities = 100/160 (62%), Positives = 118/160 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RA+ Y+                     +  +GGGAN V  G++KG GL 
Sbjct: 121 GLFLARKLSLTRAIFYIVMQCLGAICGAGVVKGFMVGPYQRLGGGANVVNHGYTKGDGLG 180

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDS+VP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 181 AEIIGTFVLVYTVFSATDAKRNARDSYVPILAPLPIGFAVFLVHLATIPITGTGINPARS 240

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRA 203
            GAA+I+N   AWDDHWIFWVGP +GA   AVYHQ+++RA
Sbjct: 241 LGAAIIYNTDQAWDDHWIFWVGPFIGAALAAVYHQIIIRA 280



>gb:BOMIPATCP_1633861 B.oleracea mRNA for transmembrane channel
           protein (mipA).
          Length = 286

 Score =  207 bits (526), Expect = 2e-52
 Identities = 101/165 (61%), Positives = 120/165 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+S+ RAV Y+                     +  +GGGANTV  G++KG GL 
Sbjct: 120 GLFLARKLSMTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTVAHGYTKGSGLG 179

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 180 AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 239

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I N  +AWDDHW+FWVGP +GA   A+YH +V+RA   K+
Sbjct: 240 LGAAIILNKDNAWDDHWVFWVGPFIGAALAALYHVIVIRAIPFKS 284



>gb:AY084470_1569559 Arabidopsis thaliana clone 108944 mRNA,
           complete sequence.
          Length = 285

 Score =  206 bits (525), Expect = 2e-52
 Identities = 100/165 (60%), Positives = 119/165 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV Y+                     +  +GGGANT+  G++KG GL 
Sbjct: 119 GLFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTIAHGYTKGSGLG 178

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 179 AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 238

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I N  +AWDDHW+FWVGP +GA   A+YH +V+R    K+
Sbjct: 239 LGAAIIFNKDNAWDDHWVFWVGPFIGAALAALYHVIVIRTIPFKS 283



>pir|T09791|T09791 drought-induced major intrinsic protein PIPa2 -
           Craterostigma plantagineum>gb:CPPIPA2_1648680
           Craterostigma plantagineum mRNA for major intrinsic
           protein PIPa2.
          Length = 287

 Score =  206 bits (525), Expect = 2e-52
 Identities = 103/165 (62%), Positives = 120/165 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV YM                  K  ++  GGGAN V  G++KG GL 
Sbjct: 122 GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFYKPTYNLEGGGANVVANGYTKGDGLG 181

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEIL TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 182 AEILGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 241

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I+N+  AW DHW+FWVGP +GA   A+YH VV+RA   K+
Sbjct: 242 LGAAIIYNHDRAWHDHWVFWVGPFIGAALAALYHVVVIRAIPFKS 286



>gb:AB029325_1518168 Oryza sativa gene for water channel protein
           RWC3, promoter region and complete cds.
          Length = 287

 Score =  206 bits (524), Expect = 3e-52
 Identities = 103/165 (62%), Positives = 119/165 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV YM                  +  +   GGGAN V PG++KG GL 
Sbjct: 122 GLFLARKLSLTRAVFYMAMQCLGAICGAGVVKGFQRGLYMGSGGGANAVNPGYTKGDGLG 181

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPI FAVF+ H+ATIPITGTGINPARS
Sbjct: 182 AEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPI-FAVFLVHLATIPITGTGINPARS 240

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+++N  HAW DHWIFWVGP +GA   A+YH VV+RA   K+
Sbjct: 241 LGAAIVYNRAHAWHDHWIFWVGPFIGAALAAIYHVVVIRAIPFKS 285



>gb:AJ605574_1811921 Ricinus communis mRNA for aquaporin (Pip1-1
           gene), clone pP2L.
          Length = 288

 Score =  205 bits (521), Expect = 7e-52
 Identities = 102/161 (63%), Positives = 118/161 (73%), Gaps = 1/161 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDF-FDTVGGGANTVQPGFSKGVGL 506
           GLFLARK+SL RA+ YM                      +  +GGGAN+V PG++KG GL
Sbjct: 122 GLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFEGSHDYTRLGGGANSVNPGYTKGDGL 181

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
            AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct: 182 GAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR 241

Query: 325 SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRA 203
           S GAA+I N    WDDHWIFWVGP +GA   A+YHQVV+RA
Sbjct: 242 SLGAAIIFNKDQGWDDHWIFWVGPFIGAALAALYHQVVIRA 282



>gb:AB016623_1512848 Oryza sativa gene for RWC-3, complete cds.
          Length = 287

 Score =  205 bits (521), Expect = 7e-52
 Identities = 102/165 (61%), Positives = 119/165 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV YM                  +  +   GGGAN V PG++KG GL 
Sbjct: 122 GLFLARKLSLTRAVFYMAMQCLGAICGAGVVKGFQRGLYMGSGGGANAVNPGYTKGDGLG 181

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLP+ FAVF+ H+ATIPITGTGINPARS
Sbjct: 182 AEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPM-FAVFLVHLATIPITGTGINPARS 240

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+++N  HAW DHWIFWVGP +GA   A+YH VV+RA   K+
Sbjct: 241 LGAAIVYNRAHAWHDHWIFWVGPFIGAALAAIYHVVVIRAIPFKS 285



>sp|P25794|PIP2_PEA Probable aquaporin PIP-type 7a
           (Turgor-responsive protein 7a).>pir|S33617|S33617 trg-31
           protein - garden pea>gb:PATRG31A_1698866 Pisum sativum
           trg-31 gene.
          Length = 289

 Score =  205 bits (521), Expect = 7e-52
 Identities = 103/166 (62%), Positives = 120/166 (72%), Gaps = 1/166 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLT-KDFFDTVGGGANTVQPGFSKGVGL 506
           GLFLARK+SL RA+ YM                   K  F  + GGAN V PG++KG GL
Sbjct: 123 GLFLARKLSLTRAIFYMVMQVLGAICGAGVVKGFEGKQRFGDLNGGANFVAPGYTKGDGL 182

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
            AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct: 183 GAEIVGTFILVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR 242

Query: 325 SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
           S GAA++ N K  W+DHWIFWVGP +GA   A+YHQVV+RA   K+
Sbjct: 243 SLGAAIVFNKKIGWNDHWIFWVGPFIGAALAALYHQVVIRAIPFKS 288



>gb:SOL249384_1715697 Spinacia oleracea mRNA for PM28B protein
           (pm28b gene).
          Length = 285

 Score =  204 bits (520), Expect = 9e-52
 Identities = 100/165 (60%), Positives = 118/165 (71%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL LARK+SL RA+ YM                   + ++  GGGAN V  G+++G GL 
Sbjct: 119 GLLLARKLSLTRAMFYMIMQCLGAICGAGVVKGFQPNIYEMQGGGANVVNHGYTRGDGLG 178

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 179 AEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 238

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAA+I N  HAWD HWIFWVGP +GA   A+YHQ V+RA   K+
Sbjct: 239 LGAAIIFNKDHAWDHHWIFWVGPFIGAALAALYHQTVIRAIPFKS 283



>gb:PSCC7A_1702076 P.sativum mRNA of cDNA clone 7a.
          Length = 289

 Score =  204 bits (519), Expect = 1e-51
 Identities = 103/166 (62%), Positives = 119/166 (71%), Gaps = 1/166 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLT-KDFFDTVGGGANTVQPGFSKGVGL 506
           GLFLARK SL RA+ YM                   K  F  + GGAN V PG++KG GL
Sbjct: 123 GLFLARKXSLTRAIFYMVMQVLGAICGAGVVKGFEGKQRFGDLNGGANFVAPGYTKGDGL 182

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
            AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct: 183 GAEIVGTFILVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR 242

Query: 325 SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
           S GAA++ N K  W+DHWIFWVGP +GA   A+YHQVV+RA   K+
Sbjct: 243 SLGAAIVFNKKIGWNDHWIFWVGPFIGAALAALYHQVVIRAIPFKS 288



>gb:HVU310639_1682666 Hordeum vulgare partial pip1 gene for putative
           aquaporin.
          Length = 165

 Score =  204 bits (519), Expect = 1e-51
 Identities = 99/155 (63%), Positives = 114/155 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV Y+                  +  +   GGGAN V  G++KG GL 
Sbjct: 11  GLFLARKLSLTRAVFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANVVASGYTKGSGLG 70

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 71  AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 130

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQ 218
            GAA+I+N +HAW DHWIFWVGP +GA   A+YHQ
Sbjct: 131 LGAAIIYNREHAWSDHWIFWVGPFIGAALAAIYHQ 165



>gb:AF141899_1771603 Vitis berlandieri x Vitis rupestris putative
           aquaporin PIP1-3 (PIP1-3) mRNA, complete cds.
          Length = 287

 Score =  204 bits (518), Expect = 2e-51
 Identities = 101/166 (60%), Positives = 120/166 (72%), Gaps = 1/166 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLT-KDFFDTVGGGANTVQPGFSKGVGL 506
           GL LARK+SL RA+ Y+                      ++ +GGGAN V  G++KG GL
Sbjct: 120 GLLLARKLSLTRAIFYIIMQCLGAICGAGVVKGFEGSQSYEVLGGGANVVNSGYTKGDGL 179

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
            AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct: 180 GAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR 239

Query: 325 SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
           S GAA+I N +HAWDD WIFWVGP +GA   A+YHQ+V+RA   K+
Sbjct: 240 SLGAAIIFNREHAWDDMWIFWVGPFIGAALAAMYHQIVIRAIPFKS 285



>gb:AE016959_1023118 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC024594_1539341
           Oryza sativa chromosome 10 BAC OSJNBa0093B11 genomic
           sequence, complete sequence.>gb:AE017106_1752937 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           60 of 77 of the complete sequence.
          Length = 242

 Score =  204 bits (518), Expect = 2e-51
 Identities = 101/167 (60%), Positives = 119/167 (71%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL +ARKV+L+RA  Y+                     F   GGGAN V  G+SKG GL 
Sbjct: 73  GLLVARKVTLLRAALYVAAQCLGAGLVRALNSAH----FARHGGGANVVGDGYSKGAGLA 128

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AE+  TF LVYTVFSATD KR+ARDSH+PVLAPLPIGFAVFV H+ATIPITGTGINPARS
Sbjct: 129 AEVAGTFVLVYTVFSATDAKRSARDSHIPVLAPLPIGFAVFVVHLATIPITGTGINPARS 188

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALG 182
           FGAAV++N  +AW D WIFWVGP++G+    +YH+ VLRA  +KALG
Sbjct: 189 FGAAVVYNQPNAWHDQWIFWVGPLVGSAIATLYHEHVLRASTLKALG 235



>gb:AJ605569_1811916 Ricinus communis partial mRNA for putative
           aquaporin (Pip2-1 gene), clone pR450-8.
          Length = 151

 Score =  201 bits (512), Expect = 8e-51
 Identities = 98/143 (68%), Positives = 110/143 (76%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRAVAYM                  KD ++ +GGGAN+V  G+S G  L 
Sbjct: 9   GLFLARKVSLIRAVAYMVAQCLGAICGVGLVKAFMKDPYNRLGGGANSVASGYSNGTALG 68

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTG+NPARS
Sbjct: 69  AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGVNPARS 128

Query: 322 FGAAVIHNNKHAWDDHWIFWVGP 254
           FGAAVI+NN   WDDHWI+W GP
Sbjct: 129 FGAAVIYNNDKVWDDHWIYWAGP 151



>gb:AY667436_1620711 Vicia faba aquaporin mRNA, complete cds.
          Length = 290

 Score =  201 bits (512), Expect = 8e-51
 Identities = 103/166 (62%), Positives = 118/166 (71%), Gaps = 1/166 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLT-KDFFDTVGGGANTVQPGFSKGVGL 506
           GLFLARK+SL RAV Y+                   K FF   GGGAN V PG++KG GL
Sbjct: 123 GLFLARKLSLTRAVFYIVMQVLGAICGAGVVKGFEGKAFFGEKGGGANFVAPGYTKGDGL 182

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
            AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct: 183 GAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR 242

Query: 325 SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
           S GAA+I N    W+D WIFWVGP +GA   A+YH VV+RA   K+
Sbjct: 243 SLGAAIIFNQDRGWNDQWIFWVGPFIGAALAALYHTVVIRAIPFKS 288



>pir|T09260|T09260 aquaporin-like transmembrane channel protein -
           alfalfa>gb:AF004708_1760704 Medicago sativa
           aquaporin-like transmembrane channel protein (pAFI 8-1)
           mRNA, complete cds.
          Length = 290

 Score =  201 bits (511), Expect = 1e-50
 Identities = 102/166 (61%), Positives = 118/166 (71%), Gaps = 1/166 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLT-KDFFDTVGGGANTVQPGFSKGVGL 506
           GLFLARK+SL RA+ YM                   K F+    GGAN V PG++KG GL
Sbjct: 123 GLFLARKLSLTRALFYMVMQTLGAICGAGVVKGFEGKTFYTNKNGGANFVAPGYTKGDGL 182

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
            AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct: 183 GAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR 242

Query: 325 SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
           S GAA+I N    W+DHWIFWVGP +GA   A+YH VV+RA   K+
Sbjct: 243 SLGAAIIFNKDLGWNDHWIFWVGPFIGAALAALYHTVVIRAIPFKS 288



>gb:AF188844_1775243 Vitis vinifera cultivar Pinot Noir plasma
           membrane aquaporin (PIP1b) mRNA, complete cds.
          Length = 287

 Score =  201 bits (510), Expect = 1e-50
 Identities = 100/166 (60%), Positives = 119/166 (71%), Gaps = 1/166 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLT-KDFFDTVGGGANTVQPGFSKGVGL 506
           GL LARK+SL RA+ Y+                      ++ +GGGAN V  G++KG GL
Sbjct: 120 GLLLARKLSLTRAIFYIIMQCLGAICGAGVVKGFEGSQSYEVLGGGANVVNSGYTKGDGL 179

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
            AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct: 180 GAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR 239

Query: 325 SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
           S GAA+I N +HAWDD WIFWVGP +GA   A+Y Q+V+RA   K+
Sbjct: 240 SLGAAIIFNREHAWDDMWIFWVGPFIGAALAAMYQQIVIRAIPFKS 285



>pir|S60455|S60455 transmembrane protein, glucose starvation-induced
           - maize>gb:ZMTRAPRO_1732048 Z.mays mRNA for
           transmembrane protein.
          Length = 287

 Score =  201 bits (510), Expect = 1e-50
 Identities = 100/165 (60%), Positives = 117/165 (70%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV Y+                  +  +   GG  N V PG++KG GL 
Sbjct: 121 GLFLARKLSLTRAVFYIIMQCLGAICGRGVVKGFQQGLYMGNGGRRNVVAPGYTKGDGLG 180

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KR ARDSHVP+LAPLPIGFAVF+ H+AT+ ITGTGINPARS
Sbjct: 181 AEIVGTFILVYTVFSATDAKRRARDSHVPILAPLPIGFAVFLVHLATMGITGTGINPARS 240

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            GAAVI+N  HAW DHWIFWVGP +GA   A+YHQV++RA   K+
Sbjct: 241 LGAAVIYNQHHAWADHWIFWVGPFIGAALAAIYHQVIIRAIPFKS 285



>gb:AF386739_1794724 Medicago truncatula aquaporin protein PIP1;1
           (PIP1;1) mRNA, complete cds.
          Length = 289

 Score =  200 bits (508), Expect = 2e-50
 Identities = 103/166 (62%), Positives = 118/166 (71%), Gaps = 1/166 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLT-KDFFDTVGGGANTVQPGFSKGVGL 506
           GLFLARK+SL RA+ YM                   K  F  + GGAN V PG++KG GL
Sbjct: 123 GLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFEGKTRFGDLKGGANFVAPGYTKGDGL 182

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
            AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct: 183 GAEIVGTFILVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR 242

Query: 325 SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
           S GAA+I N    WDDHWIFWVGP +GA   A+YH VV+RA   K+
Sbjct: 243 SLGAAIIFNKDLGWDDHWIFWVGPFIGAALAALYHVVVIRAIPFKS 288



>gb:LAAJ2973_1683875 Lupinus albus mRNA for aquaporin, partial.
          Length = 287

 Score =  199 bits (507), Expect = 3e-50
 Identities = 102/166 (61%), Positives = 118/166 (71%), Gaps = 1/166 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLT-KDFFDTVGGGANTVQPGFSKGVGL 506
           GLFLARK+SL RAV Y+                   K  +    GGAN V PG++KG GL
Sbjct: 121 GLFLARKLSLTRAVFYIVMQVLGAIVGAGVVKGFEGKHRYTQYNGGANFVAPGYTKGDGL 180

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
            AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct: 181 GAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR 240

Query: 325 SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
           S GAA+I N    W+DHWIFWVGP +GA   A+YHQVV+RA   K+
Sbjct: 241 SLGAAIIFNKDLGWNDHWIFWVGPFIGAALAALYHQVVIRAIPFKS 286



>pir|T12037|T12037 probable aquaporin-1, drought-induced - kidney
           bean>gb:PVU97023_1703068 Phaseolus vulgaris putative
           aquaporin-1 (Mip-1) mRNA, complete cds.
          Length = 289

 Score =  199 bits (507), Expect = 3e-50
 Identities = 102/166 (61%), Positives = 117/166 (70%), Gaps = 1/166 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLT-KDFFDTVGGGANTVQPGFSKGVGL 506
           GLFLARK+SL RA+ Y+                   K  F  + GGAN V PG++KG GL
Sbjct: 123 GLFLARKLSLTRALFYIVMQVLGAIAGAGAVKGFEGKTRFGRLNGGANFVAPGYTKGDGL 182

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
            AEI+ TF LVYTVFSATD KR ARDSHVP+LAPLPIGFAVF+ H+ATIPITG GINPAR
Sbjct: 183 GAEIVGTFVLVYTVFSATDAKRCARDSHVPILAPLPIGFAVFLVHLATIPITGAGINPAR 242

Query: 325 SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
           S GAA+I N    WDDHWIFWVGP +GA   A+YHQVV+RA   K+
Sbjct: 243 SLGAAIIFNKDLGWDDHWIFWVGPFIGAALAALYHQVVIRAIPFKS 288



>pir|T14601|T14601 plasma membrane major intrinsic protein 3 -
           beet>gb:BVU60149_1643229 Beta vulgaris plasma membrane
           major intrinsic protein 3 mRNA, complete cds.
          Length = 286

 Score =  199 bits (505), Expect = 5e-50
 Identities = 102/166 (61%), Positives = 117/166 (70%), Gaps = 1/166 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV YM                     + T GGGAN V  G++KG GL 
Sbjct: 119 GLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYMTAGGGANYVHHGYTKGDGLG 178

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIG AVF+ H+ATIPITGTGINPARS
Sbjct: 179 AEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGLAVFLVHLATIPITGTGINPARS 238

Query: 322 FGAAVIHNNKH-AWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            G A+I N  H +W+DHWIFWVGP +GA   AVYH VV+RA   K+
Sbjct: 239 LGTAIIFNRHHNSWNDHWIFWVGPFIGAALAAVYHTVVIRAIPFKS 284



>gb:AY170841_1586693 Axonopus compressus plasma membrane MIP protein
           mRNA, partial cds.
          Length = 140

 Score =  197 bits (500), Expect = 2e-49
 Identities = 90/123 (73%), Positives = 105/123 (85%)
 Frame = -1

Query: 556 GGGANTVQPGFSKGVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFV 377
           GGGAN V  G++KG GL AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+
Sbjct: 16  GGGANVVAKGYTKGDGLGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFL 75

Query: 376 AHVATIPITGTGINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQA 197
            H+ATIPITGTGINPARS GAA+I+N +HAW+DHWIFWVGP +GA   A+YHQV++RA  
Sbjct: 76  VHLATIPITGTGINPARSLGAAIIYNREHAWNDHWIFWVGPFIGAALAAIYHQVIIRAIP 135

Query: 196 VKA 188
            K+
Sbjct: 136 FKS 138



>gb:CPPMIP1_1648684 Carica papaya mRNA for membrane channel protein,
           partial.
          Length = 187

 Score =  196 bits (498), Expect = 3e-49
 Identities = 102/166 (61%), Positives = 114/166 (68%), Gaps = 1/166 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDF-FDTVGGGANTVQPGFSKGVGL 506
           GL LARK+SL RA+ YM                      F+  GGGAN  QP   KG GL
Sbjct: 8   GLLLARKLSLTRAIFYMVMQCLGAICGAGVVKGFEGSATFELKGGGANVRQPWIHKGDGL 67

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
            AEI+ TF LVYTV SATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct: 68  GAEIVGTFVLVYTVLSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR 127

Query: 325 SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
           S GAA+I N   AWDDHWIFWVGP +GA   A+Y QVV+RA   K+
Sbjct: 128 SLGAAIIFNRDKAWDDHWIFWVGPFIGAALAALYQQVVIRAIPFKS 173



>gb:AY372191_1603225 Spinacia oleracea PIP1;2 (Pip1;2) mRNA,
           complete cds.
          Length = 285

 Score =  196 bits (498), Expect = 3e-49
 Identities = 100/166 (60%), Positives = 118/166 (71%), Gaps = 1/166 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV YM                     +   GGG+N V  G++KG GL 
Sbjct: 119 GLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPGPYQVGGGGSNYVHHGYTKGSGLG 178

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 179 AEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS 238

Query: 322 FGAAVIHNNK-HAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            G A+I+N + + W+DHWIFWVGP +GA   AVYH VV+RA   K+
Sbjct: 239 LGTAIIYNKQINNWNDHWIFWVGPFIGAALAAVYHTVVIRAIPFKS 284



>pir|T09817|T09817 probable water channel protein MIP1 - papaya
           (fragment)
          Length = 187

 Score =  196 bits (498), Expect = 3e-49
 Identities = 102/166 (61%), Positives = 114/166 (68%), Gaps = 1/166 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDF-FDTVGGGANTVQPGFSKGVGL 506
           GL LARK+SL RA+ YM                      F+  GGGAN  QP   KG GL
Sbjct: 8   GLLLARKLSLTRAIFYMVMQCLGAICGAGVVKGFEGSATFELKGGGANVRQPWIHKGDGL 67

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
            AEI+ TF LVYTV SATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct: 68  GAEIVGTFVLVYTVLSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR 127

Query: 325 SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
           S GAA+I N   AWDDHWIFWVGP +GA   A+Y QVV+RA   K+
Sbjct: 128 SLGAAIIFNRDKAWDDHWIFWVGPFIGAALAALYQQVVIRAIPFKS 173



>gb:STU18311_1722970 Solanum tuberosum mRNA for major intrinsic
           protein 1.
          Length = 288

 Score =  194 bits (493), Expect = 1e-48
 Identities = 94/162 (58%), Positives = 113/162 (69%)
 Frame = -1

Query: 673 LARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLVAEI 494
           L +K+SL RAV Y+                     ++ + GGAN V PG++KG GL AEI
Sbjct: 124 LGKKLSLTRAVFYIVMQCLGAICGAGVVKGFMVGPYERLNGGANVVNPGYTKGDGLGAEI 183

Query: 493 LATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSFGA 314
           + TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIP TGTG NPARS GA
Sbjct: 184 IGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPTTGTGTNPARSLGA 243

Query: 313 AVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
           A I+N   AWDDHWIFWVGP +G    AVYHQ+++RA   K+
Sbjct: 244 ATIYNQDQAWDDHWIFWVGPFIGQALAAVYHQIIIRAIPFKS 285



>gb:AJ605565_1811912 Ricinus communis partial mRNA for putative
           aquaporin (Pip2-2 gene), clone pR450-3.
          Length = 151

 Score =  194 bits (492), Expect = 2e-48
 Identities = 91/143 (63%), Positives = 108/143 (75%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RA+ YM                  + +++  GGGAN +  G+S G GL 
Sbjct: 9   GLFLARKVSLVRAIMYMAAQCLGAICGCGLVKAFQRAYYNRYGGGANELADGYSTGTGLG 68

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIP+TGTGINPARS
Sbjct: 69  AEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARS 128

Query: 322 FGAAVIHNNKHAWDDHWIFWVGP 254
           FGAAVI+N + AWDD W++W GP
Sbjct: 129 FGAAVIYNKEKAWDDQWVYWAGP 151



>gb:AF366565_1791668 Triticum aestivum aquaporin PIP2 (Pip2) mRNA,
           complete cds.
          Length = 277

 Score =  194 bits (492), Expect = 2e-48
 Identities = 99/164 (60%), Positives = 113/164 (68%), Gaps = 1/164 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDF-FDTVGGGANTVQPGFSKGVGL 506
           GL LARKVSL RA  YM                +     +   GGGAN + PG+S+  GL
Sbjct: 105 GLLLARKVSLPRAFLYMVAQCVGAICGAALVRAVHGGHQYVLYGGGANELAPGYSRTAGL 164

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
           +AEI  TF LVYTVFSATDPKR ARD HVPVLAPL IGFAV +AH+ATIP+TGTGINPAR
Sbjct: 165 IAEIAGTFVLVYTVFSATDPKRIARDPHVPVLAPLLIGFAVLMAHLATIPVTGTGINPAR 224

Query: 325 SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAV 194
           SFGAAV++N   AWDD WIFWVGP +GA    VYHQ +LR  A+
Sbjct: 225 SFGAAVVYNGGKAWDDQWIFWVGPFIGAAVATVYHQYILRNSAI 268



>gb:AJ849323_1814741 Populus tremula x Populus tremuloides mRNA for
           putative plasma membrane intrinsic protein (pip1.1
           gene).
          Length = 278

 Score =  193 bits (491), Expect = 2e-48
 Identities = 98/157 (62%), Positives = 113/157 (71%), Gaps = 1/157 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXX-XXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGL 506
           GLFLARK+SL RAV YM                   K  ++   GGAN V  G++KG GL
Sbjct: 122 GLFLARKLSLTRAVFYMLMQCLGAICGAGVVKGFYGKTNYELHNGGANMVAHGYTKGDGL 181

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
            AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct: 182 GAEIVGTFILVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR 241

Query: 325 SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQV 215
           S GAA+I N   AWDDHWIFWVGP +GA   A+YH++
Sbjct: 242 SLGAAIIFNKDSAWDDHWIFWVGPFIGAALAALYHRL 278



>gb:AY781788_1628320 Glycyrrhiza uralensis plasma membrane intrinsic
           protein (PIP) mRNA, complete cds.
          Length = 289

 Score =  193 bits (490), Expect = 3e-48
 Identities = 100/166 (60%), Positives = 115/166 (69%), Gaps = 1/166 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLT-KDFFDTVGGGANTVQPGFSKGVGL 506
           GLFLARK+SL RAV YM                   K  +    GGAN V  G++KG GL
Sbjct: 123 GLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFEGKTLYGKYNGGANFVNSGYTKGDGL 182

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
            AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+  +ATIPITGTGINPAR
Sbjct: 183 GAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVRLATIPITGTGINPAR 242

Query: 325 SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
           S GAA+I N    W+DHWIFWVGP +GA   A+YH VV+RA   K+
Sbjct: 243 SLGAAIIFNKDRGWNDHWIFWVGPFIGAGLAALYHVVVIRAIPFKS 288



>gb:AJ605567_1811914 Ricinus communis partial mRNA for putative
           aquaporin (Pip1-2 gene), clone pR450-14.
          Length = 152

 Score =  191 bits (485), Expect = 1e-47
 Identities = 94/144 (65%), Positives = 108/144 (75%), Gaps = 1/144 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKD-FFDTVGGGANTVQPGFSKGVGL 506
           GLFLARK+SL RA+ YM                   D  ++T+GGGAN V  G++KG GL
Sbjct: 9   GLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFEGDRTYETLGGGANVVNAGYTKGDGL 68

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
            AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct: 69  GAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR 128

Query: 325 SFGAAVIHNNKHAWDDHWIFWVGP 254
           S GAA+I N  HAWDDHW++WVGP
Sbjct: 129 SLGAAIIFNKDHAWDDHWVYWVGP 152



>gb:AF139814_1771447 Triticum aestivum plasma membrane intrinsic
           protein 1 (PIP1) mRNA, complete cds.
          Length = 290

 Score =  190 bits (483), Expect = 2e-47
 Identities = 100/172 (58%), Positives = 112/172 (65%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RA+ YM                                 P   +    +
Sbjct: 118 GLFLARKVSLVRALLYMIAQCLGAMCGVGLVKAFRAPTSSGTAAAPTRSPPATPRAPASL 177

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
                TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 178 RRSSGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 237

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQS 167
            GAAVI+N   AWDD WIFWVGPM+GA   A YHQ +LRA A+KAL GSF+S
Sbjct: 238 LGAAVIYNKDKAWDDQWIFWVGPMIGAAIAAFYHQYILRAGAIKAL-GSFRS 288



>gb:AJ605568_1811915 Ricinus communis partial mRNA for putative
           aquaporin (Pip2-3 gene), clone pR450-4.
          Length = 151

 Score =  190 bits (482), Expect = 2e-47
 Identities = 92/143 (64%), Positives = 104/143 (72%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL+RA+ YM                     +   GGGANT+   +S GVGL 
Sbjct: 9   GLFLARKVSLVRAIMYMVAQCLGAICGVGLVKAFQSSHYKRYGGGANTLDDNYSTGVGLG 68

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 69  AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 128

Query: 322 FGAAVIHNNKHAWDDHWIFWVGP 254
            GAAVI+N   AWDD W++W GP
Sbjct: 129 LGAAVIYNQDKAWDDQWVYWAGP 151



>gb:AF067184_1765598 Samanea saman aquaporin 1 (Aqp1) mRNA, complete
           cds.
          Length = 289

 Score =  189 bits (479), Expect = 5e-47
 Identities = 95/166 (57%), Positives = 113/166 (68%), Gaps = 1/166 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLT-KDFFDTVGGGANTVQPGFSKGVGL 506
           GLFL RK+SL R + Y+                   K  +   GGG N V  G++KG GL
Sbjct: 123 GLFLGRKLSLTRTIFYIVMQCLGAICGAGVVKGFEGKKLYGDNGGGVNYVHSGYTKGDGL 182

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
            AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct: 183 GAEIVGTFILVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR 242

Query: 325 SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
           S GAA+I N    W +HW+FWVGP +GA   A+YH VV+RA   K+
Sbjct: 243 SLGAAIIFNKHLGWHEHWVFWVGPFIGAALAALYHVVVIRAIPFKS 288



>pir|T04139|T04139 transmembrane protein - rice>gb:OSTRAMBPR_1698390
           O.sativa mRNA for transmembrane
           protein.>gb:OSU77297_1698515 Oryza sativa transmembrane
           protein mRNA, complete cds.
          Length = 291

 Score =  189 bits (479), Expect = 5e-47
 Identities = 96/168 (57%), Positives = 116/168 (69%), Gaps = 3/168 (1%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLAR +SL RA+ YM                  K  ++T GGGAN V PG++KG  L 
Sbjct: 122 GLFLARNLSLTRALFYMVMQCLGAICGAGVVKGFQKGLYETTGGGANVVAPGYTKGDRLG 181

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATD K+NARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINP R+
Sbjct: 182 AEIVGTFILVYTVFSATDAKKNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPRRT 241

Query: 322 FGAAVI---HNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
           +G   +   H   HA +DHWIFWVGP++G    A+YHQ V+RA   K+
Sbjct: 242 WGCHHLQQGHAWGHAGEDHWIFWVGPLMGGALVAIYHQGVIRAIPFKS 289



>gb:AF367457_1791840 Prunus persica clone Mip1 membrane intrinsic
           protein (mip1) mRNA, partial cds.
          Length = 165

 Score =  188 bits (478), Expect = 7e-47
 Identities = 93/137 (67%), Positives = 104/137 (75%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLAR+VSLIRAVAY+                  K  +++ GGGANTV PG+SKG  L 
Sbjct: 29  GLFLAREVSLIRAVAYIVAQSLGAIVGVGLVKAFQKHNYNSQGGGANTVAPGYSKGTALG 88

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYT FSATDPKR+ARDSHVPVLAPLPIGFAVF+ H+ TIPITGTGINPARS
Sbjct: 89  AEIIGTFVLVYTXFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLXTIPITGTGINPARS 148

Query: 322 FGAAVIHNNKHAWDDHW 272
           FG AVI NN+ AWDDHW
Sbjct: 149 FGPAVIFNNEKAWDDHW 165



>gb:AF367460_1791843 Prunus persica clone Mip3 membrane intrinsic
           protein (mip3) mRNA, partial cds.
          Length = 165

 Score =  187 bits (475), Expect = 1e-46
 Identities = 92/137 (67%), Positives = 101/137 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL RA+ YM                    +F   GGGAN +  G+S+G GL 
Sbjct: 29  GLFLARKVSLARAILYMVAQSLGAICGVGLVKAFQNAYFTKYGGGANGLADGYSQGTGLA 88

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 89  AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARS 148

Query: 322 FGAAVIHNNKHAWDDHW 272
            GAAVI+NN  AWDDHW
Sbjct: 149 LGAAVIYNNDKAWDDHW 165



>gb:SBU87981_1704944 Sorghum bicolor membrane intrinsic protein
           (Mip1) mRNA, partial cds.
          Length = 117

 Score =  187 bits (474), Expect = 2e-46
 Identities = 85/115 (73%), Positives = 98/115 (85%)
 Frame = -1

Query: 532 PGFSKGVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPI 353
           PG++KG GL AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+ H+ATIPI
Sbjct: 1   PGYTKGDGLGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPI 60

Query: 352 TGTGINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
           TGTGINPARS GAA+I+N  HAW DHWIFWVGP +GA   A+YHQV++RA   K+
Sbjct: 61  TGTGINPARSLGAAIIYNRDHAWSDHWIFWVGPFIGAALAAIYHQVIIRAIPFKS 115



>gb:AF367458_1791841 Prunus persica clone Mip2 membrane intrinsic
           protein (mip2) mRNA, partial cds.
          Length = 165

 Score =  184 bits (467), Expect = 1e-45
 Identities = 91/137 (66%), Positives = 102/137 (74%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSL RAV Y+                  K +++  GGGAN +  G++KG GL 
Sbjct: 29  GLFLARKVSLPRAVLYIVAQSLGAICGVGLVKAFQKTYYEEYGGGANELAAGYNKGTGLG 88

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 89  AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARS 148

Query: 322 FGAAVIHNNKHAWDDHW 272
           FGAAVI+N   AWDD W
Sbjct: 149 FGAAVIYNKDKAWDDRW 165



>gb:AF290621_1783622 Nicotiana glauca putative PIP (MIP5) mRNA,
           partial cds.
          Length = 156

 Score =  182 bits (461), Expect = 6e-45
 Identities = 92/135 (68%), Positives = 102/135 (75%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRAV YM                    ++   GGGAN + PG +KGVGL 
Sbjct: 22  GLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANVMAPGHTKGVGLA 81

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 82  AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS 141

Query: 322 FGAAVIHNNKHAWDD 278
           FGAAVI+N+  AWD+
Sbjct: 142 FGAAVIYNHDKAWDE 156



>gb:AJ605566_1811913 Ricinus communis partial mRNA for putative
           aquaporin (Pip1-1 gene), clone pR450-16.
          Length = 152

 Score =  181 bits (460), Expect = 8e-45
 Identities = 90/144 (62%), Positives = 105/144 (72%), Gaps = 1/144 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDF-FDTVGGGANTVQPGFSKGVGL 506
           GLFLARK+SL RA+ YM                      +  +GGGAN+V PG++KG GL
Sbjct: 9   GLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFEGSHDYTRLGGGANSVNPGYTKGDGL 68

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
            AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct: 69  GAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR 128

Query: 325 SFGAAVIHNNKHAWDDHWIFWVGP 254
           S GAA+I N    WD+HWI+WVGP
Sbjct: 129 SLGAAIIFNKDQGWDEHWIYWVGP 152



>gb:CAR515031_1645357 Cicer arietinum partial mRNA for
           aquoporin-like water channel protein (mip1 gene).
          Length = 118

 Score =  178 bits (451), Expect = 9e-44
 Identities = 84/117 (71%), Positives = 96/117 (82%)
 Frame = -1

Query: 538 VQPGFSKGVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATI 359
           V PG++KG GL AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATI
Sbjct: 1   VAPGYTKGDGLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATI 60

Query: 358 PITGTGINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
           PITGTGINPARS GAA+I N    WDD WIFWVGP +GA   A+YHQVV+RA   K+
Sbjct: 61  PITGTGINPARSLGAAIIFNKDLGWDDQWIFWVGPFIGAALAALYHQVVIRAIPFKS 117



>gb:CAR005869_1645115 Cicer arietinum mRNA for putative
           transmembrane channel protein, partial.
          Length = 115

 Score =  177 bits (449), Expect = 2e-43
 Identities = 83/114 (72%), Positives = 95/114 (83%)
 Frame = -1

Query: 529 GFSKGVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPIT 350
           G++KG GL AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPIT
Sbjct: 1   GYTKGDGLGAEIVGTFILVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPIT 60

Query: 349 GTGINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
           GTGINPARS GAA+I N    WDDHWIFWVGP +GA   A+YHQVV+RA   K+
Sbjct: 61  GTGINPARSLGAAIIFNKDLGWDDHWIFWVGPFIGAALAALYHQVVIRAIPFKS 114



>gb:AC092263_1735278 Oryza sativa chromosome 3 BAC OSJNBa0033P04
           genomic sequence, complete sequence.
          Length = 280

 Score =  174 bits (441), Expect = 1e-42
 Identities = 94/177 (53%), Positives = 109/177 (61%), Gaps = 3/177 (1%)
 Frame = -1

Query: 679 LFLARKVSLIRAVAY-MXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           + LAR+VSL RA  Y M                     +   GGGAN +  G+S G G+V
Sbjct: 103 MVLARRVSLPRAALYTMAQCVGAVCGAGLARAMHGGGQYARHGGGANELAAGYSAGAGVV 162

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AE++ TF LVYTVFSATDPKR ARDSHVPVLAPLPIG AV V H+ATIPITGTGINPARS
Sbjct: 163 AEMVGTFVLVYTVFSATDPKRKARDSHVPVLAPLPIGLAVLVVHLATIPITGTGINPARS 222

Query: 322 FGAAVI--HNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQSTPN 158
            G A++       AW   WIFWVGP  GA A  +YH  +LR  A KA   S   +P+
Sbjct: 223 LGPALVLGLGTTKAWSHLWIFWVGPFAGAAAAMIYHHYILRGAAAKAFASSSYRSPH 279



>gb:AP006149_1860964 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:B1274F11.
          Length = 257

 Score =  173 bits (438), Expect = 3e-42
 Identities = 94/173 (54%), Positives = 108/173 (62%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLF  RK+SL+R V Y+                                  G   G G+V
Sbjct: 115 GLFFGRKLSLVRTVLYVVAQCL-----------------------------GAIAGAGIV 145

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
                TF LVYTVFSATDPKR ARDS +PVL PLPIGFAVFV H+ATIPITGTGINPARS
Sbjct: 146 G----TFILVYTVFSATDPKRTARDSFIPVLVPLPIGFAVFVVHLATIPITGTGINPARS 201

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALGGSFQST 164
            GAAV++N   AW DHWIFWVGP++GA   A YH++VLR +A KAL  SF+ST
Sbjct: 202 LGAAVLYNQHAAWKDHWIFWVGPVIGAFLAAAYHKLVLRGEAAKAL-SSFRST 253



>gb:AF388171_1794930 Triticum boeoticum plasma membrane intrinsic
           protein 2 (PIP2) mRNA, partial cds.
          Length = 137

 Score =  172 bits (437), Expect = 4e-42
 Identities = 86/135 (63%), Positives = 99/135 (73%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRA+ Y+                    ++   GGGA+ +  G+SKG GL 
Sbjct: 2   GLFLARKVSLIRALLYIIAQCLGAICGVGLVKGFRSSYYVRYGGGADELSAGYSKGTGLA 61

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
           AEI+ TF LVYTVFSATDPKRNARDSH+PVLAPLPIGFAVF+ H+ATIPITGTGINPARS
Sbjct: 62  AEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARS 121

Query: 322 FGAAVIHNNKHAWDD 278
            GAAVI+N   AW+D
Sbjct: 122 LGAAVIYNKDRAWND 136



>gb:AY333929_1600132 Pringlea antiscorbutica putative transmembrane
           protein mRNA, partial cds.
          Length = 98

 Score =  162 bits (409), Expect = 7e-39
 Identities = 72/96 (75%), Positives = 84/96 (87%)
 Frame = -1

Query: 475 VYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSFGAAVIHNN 296
           VYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPARS GAA+I+N 
Sbjct: 1   VYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNK 60

Query: 295 KHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKA 188
            H+WDDHWIFWVGP +GA   A+YHQ+V+RA   K+
Sbjct: 61  DHSWDDHWIFWVGPFIGAALAALYHQIVIRAIPFKS 96



>gb:PSA548795_1702009 Pisum sativum partial mRNA for putative plasma
           membrane intrinsic protein (pip1-2 gene).
          Length = 127

 Score =  145 bits (366), Expect = 6e-34
 Identities = 78/121 (64%), Positives = 88/121 (72%), Gaps = 1/121 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLT-KDFFDTVGGGANTVQPGFSKGVGL 506
           GLFLARK+SL RAV Y+                   K F+  V GGAN V PG++KG GL
Sbjct: 7   GLFLARKLSLTRAVFYIVMQVLGAICGAGVVKGFEGKAFYGKVHGGANFVAPGYTKGDGL 66

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
            AEI+ TF LVYTVFSATD KR+ARDSHVP+LAPLPIGFAVF+ H+ATIPITGTGINPAR
Sbjct: 67  GAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPAR 126

Query: 325 S 323
           S
Sbjct: 127 S 127



>gb:AY874544_1631617 Pinus taeda isolate FBRC1 aquaporin (aqua-MIP)
           gene, partial cds.>gb:AY874545_1631618 Pinus taeda
           isolate FBRC2 aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874546_1631619 Pinus taeda isolate FBRC3
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874547_1631620 Pinus taeda isolate FBRC4
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874548_1631621 Pinus taeda isolate FBRC5
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874549_1631622 Pinus taeda isolate FBRC6
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874550_1631623 Pinus taeda isolate FBRC7
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874551_1631624 Pinus taeda isolate FBRC8
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874552_1631625 Pinus taeda isolate FBRC9
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874553_1631626 Pinus taeda isolate FBRC10
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874554_1631627 Pinus taeda isolate FBRC11
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874555_1631628 Pinus taeda isolate FBRC12
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874556_1631629 Pinus taeda isolate FBRC13
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874557_1631630 Pinus taeda isolate FBRC14
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874558_1631631 Pinus taeda isolate FBRC15
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874559_1631632 Pinus taeda isolate FBRC16
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874560_1631633 Pinus taeda isolate FBRC17
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874561_1631634 Pinus taeda isolate FBRC18
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874562_1631635 Pinus taeda isolate FBRC19
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874563_1631636 Pinus taeda isolate FBRC20
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874564_1631637 Pinus taeda isolate FBRC21
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874565_1631638 Pinus taeda isolate FBRC22
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874566_1631639 Pinus taeda isolate FBRC23
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874567_1631640 Pinus taeda isolate FBRC24
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874568_1631641 Pinus taeda isolate FBRC25
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874569_1631642 Pinus taeda isolate FBRC26
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874570_1631643 Pinus taeda isolate FBRC27
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874571_1631644 Pinus taeda isolate FBRC28
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874572_1631645 Pinus taeda isolate FBRC29
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874573_1631646 Pinus taeda isolate FBRC30
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874574_1631647 Pinus taeda isolate FBRC31
           aquaporin (aqua-MIP) gene, partial
           cds.>gb:AY874575_1631648 Pinus taeda isolate FBRC32
           aquaporin (aqua-MIP) gene, partial cds.
          Length = 87

 Score =  119 bits (298), Expect = 5e-26
 Identities = 56/74 (75%), Positives = 64/74 (86%)
 Frame = -1

Query: 577 KDFFDTVGGGANTVQPGFSKGVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLP 398
           K ++D  GGGAN V  G++KGVGL AEI+ TF LVYTVFSATDPKR+ARDSHVPVLAPLP
Sbjct: 14  KPYYDRYGGGANVVAHGYTKGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLP 73

Query: 397 IGFAVFVAHVATIP 356
           IGFAVF+ H+ATIP
Sbjct: 74  IGFAVFMVHLATIP 87



>gb:AF145708_1772031 Lotus japonicus clone LJ-AQP2 plasma membrane
           intrinsic protein homolog (PIP) mRNA, partial cds.
          Length = 192

 Score =  115 bits (288), Expect = 7e-25
 Identities = 60/102 (58%), Positives = 70/102 (68%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARK+SL RAV Y+                     +  +GGGANT+  G++KG GL 
Sbjct: 90  GLFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTIAHGYTKGSGLG 149

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFV 377
           AEI+ TF LVYTVFSATD KRNARDSHVP+LAPLPIGFAVF+
Sbjct: 150 AEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFL 191



>gb:AF139815_1771448 Triticum aestivum plasma membrane intrinsic
           protein 2 (PIP2) mRNA, complete cds.
          Length = 257

 Score =  108 bits (269), Expect(2) = 1e-24
 Identities = 58/109 (53%), Positives = 69/109 (63%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GLFLARKVSLIRA+ Y+                    ++   GGGAN +  G+SKG GL 
Sbjct: 116 GLFLARKVSLIRALLYIIAQCLGAICGVGLVKGFQSSYYVRYGGGANELSAGYSKGTGLA 175

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIP 356
           AEI+     +  VFSATDPKRNARDSH+PVLAPLPIGFAVF+ H+   P
Sbjct: 176 AEIIGPSCSL-PVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLPPSP 223



 Score = 27.3 bits (59), Expect(2) = 1e-24
 Identities = 14/28 (50%), Positives = 17/28 (60%)
 Frame = -2

Query: 336 TQQGVSALL*STTTNMPGMTTGFSGLGQ 253
           T++    LL STT   PGMT G SG G+
Sbjct: 230 TRREAWELLSSTTKTRPGMTNGSSGWGR 257



>gb:AY856056_2088678 Notomys alexis aquaporin 4 mRNA, complete cds.
          Length = 326

 Score =  103 bits (258), Expect = 2e-21
 Identities = 61/153 (39%), Positives = 88/153 (57%), Gaps = 2/153 (1%)
 Frame = -1

Query: 667 RKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGG-GANTVQPGFSKGVGLVAEIL 491
           RK+S+ ++V Y+                +T    + VGG G  TV    + G GL+ E++
Sbjct: 111 RKISIAKSVFYITAQCLGAIIGAGILYLVTPP--NVVGGLGVTTVHGNLTAGHGLLVELI 168

Query: 490 ATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSFGAA 311
            TF LV+T+F++ D KR    + V     L IGF+V + H+  I  TG  +NPARSFG A
Sbjct: 169 ITFQLVFTIFASCDSKR----TDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPA 224

Query: 310 VIHNNKHAWDDHWIFWVGPMLGAI-AGAVYHQV 215
           VI  N   W++HWI+WVGP++GA+ AGA+Y  V
Sbjct: 225 VIMGN---WENHWIYWVGPIIGAVLAGALYEYV 254



>sp|P47863|AQP4_RAT Aquaporin 4 (WCH4) (Mercurial-insensitive water
           channel) (MIWC).>pir|I59283|I59283 water channel
           protein, mercurial-insensitive - rat>gb:AF144082_2056282
           Rattus norvegicus aquaporin-4 water channel AQP4 (AQP4)
           mRNA, complete cds.>gb:RNU14007_2136882 Rattus
           norvegicus aquaporin-4 water channel (AQP4) mRNA,
           complete cds.
          Length = 323

 Score =  103 bits (258), Expect = 2e-21
 Identities = 61/153 (39%), Positives = 87/153 (56%), Gaps = 2/153 (1%)
 Frame = -1

Query: 667 RKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGG-GANTVQPGFSKGVGLVAEIL 491
           RK+S+ ++V Y+                +T      VGG G  TV    + G GL+ E++
Sbjct: 108 RKISIAKSVFYITAQCLGAIIGAGILYLVTPP--SVVGGLGVTTVHGNLTAGHGLLVELI 165

Query: 490 ATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSFGAA 311
            TF LV+T+F++ D KR    + V     L IGF+V + H+  I  TG  +NPARSFG A
Sbjct: 166 ITFQLVFTIFASCDSKR----TDVTGSVALAIGFSVAIGHLFAINYTGASMNPARSFGPA 221

Query: 310 VIHNNKHAWDDHWIFWVGPMLGAI-AGAVYHQV 215
           VI  N   W++HWI+WVGP++GA+ AGA+Y  V
Sbjct: 222 VIMGN---WENHWIYWVGPIIGAVLAGALYEYV 251



>gb:AY817455_2546461 Passer domesticus aquaporin-1 (AQP1) mRNA,
           complete cds.
          Length = 271

 Score =  103 bits (257), Expect = 3e-21
 Identities = 60/158 (37%), Positives = 87/158 (55%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL L+ ++S+ +A+ Y+                +T         G N +  G + G GL 
Sbjct: 84  GLLLSCQISIFKALMYILAQCLGAVVATAILSGVTSSLPGN-SLGLNALSEGINAGQGLG 142

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
            EI+ATF LV  V + TD +RN     V   APL IG +V + H+  I  TG GINPARS
Sbjct: 143 IEIIATFQLVLCVLATTDRRRN----DVSGSAPLAIGLSVALGHLLAIDYTGCGINPARS 198

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVL 209
           FG+A+I NN   +++HWIFWVGP++G  + A+ +  +L
Sbjct: 199 FGSALIANN---FENHWIFWVGPIIGGASAALIYDFIL 233



>gb:AF009037_1411380 Ovis aries aquaporin 1 (aqp1) mRNA, complete
           cds.
          Length = 272

 Score =  103 bits (257), Expect = 3e-21
 Identities = 61/158 (38%), Positives = 85/158 (53%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL L+ ++S++RA+ Y+                +T    D    G N + PG + G GL 
Sbjct: 84  GLLLSCQISILRAIMYIIAQCVGAIVATVILSGITSSLPDN-SLGLNALAPGVNSGQGLG 142

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
            EI+ T  LV  V + TD +R  RD  +    PL IGF+V + H+  I  TG GINPARS
Sbjct: 143 IEIIGTLQLVLCVLATTD-RRRRRD--LGDSGPLAIGFSVALGHLLAIDYTGCGINPARS 199

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVL 209
           FG++VI    H + DHWIFWVGP +GA    + +  +L
Sbjct: 200 FGSSVI---THNFQDHWIFWVGPFIGAALAVLIYDFIL 234



>sp|P56401|AQP1_SHEEP Aquaporin-CHIP (Water channel protein for red
           blood cells and kidney proximal tubule) (Aquaporin 1).
          Length = 271

 Score =  103 bits (257), Expect = 3e-21
 Identities = 61/158 (38%), Positives = 85/158 (53%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL L+ ++S++RA+ Y+                +T    D    G N + PG + G GL 
Sbjct: 83  GLLLSCQISILRAIMYIIAQCVGAIVATVILSGITSSLPDN-SLGLNALAPGVNSGQGLG 141

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
            EI+ T  LV  V + TD +R  RD  +    PL IGF+V + H+  I  TG GINPARS
Sbjct: 142 IEIIGTLQLVLCVLATTD-RRRRRD--LGDSGPLAIGFSVALGHLLAIDYTGCGINPARS 198

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVL 209
           FG++VI    H + DHWIFWVGP +GA    + +  +L
Sbjct: 199 FGSSVI---THNFQDHWIFWVGPFIGAALAVLIYDFIL 233



>pir|JC2348|JC2348 water channel protein CHIP29 -
           bovine>gb:AF028005_1411977 Bos taurus water channel
           protein CHIP29 mRNA, complete cds.>gb:S74759S1_1444433
           water channel protein CHIP29 [cattle, ocular ciliary
           epithelium, mRNA, 1211 nt, segment 1 of 2].
          Length = 271

 Score =  102 bits (255), Expect = 5e-21
 Identities = 59/158 (37%), Positives = 82/158 (51%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL L+ ++S++RA+ Y+                +T    D    G N + PG + G GL 
Sbjct: 84  GLLLSCQISVLRAIMYIIAQCVGAIVATAILSGITSSLPDN-SLGLNALAPGVNSGQGLG 142

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
            EI+ T  LV  V + TD +R           PL IGF+V + H+  I  TG GINPARS
Sbjct: 143 IEIIGTLQLVLCVLATTDRRRRDLGGS----GPLAIGFSVALGHLLAIDYTGCGINPARS 198

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVL 209
           FG++VI    H + DHWIFWVGP +GA    + +  +L
Sbjct: 199 FGSSVI---THNFQDHWIFWVGPFIGAALAVLIYDFIL 233



>sp|P47865|AQP1_BOVIN Aquaporin-CHIP (Water channel protein for red
           blood cells and kidney proximal tubule) (Aquaporin 1)
           (Water channel protein CHIP29).
          Length = 270

 Score =  102 bits (255), Expect = 5e-21
 Identities = 59/158 (37%), Positives = 82/158 (51%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL L+ ++S++RA+ Y+                +T    D    G N + PG + G GL 
Sbjct: 83  GLLLSCQISVLRAIMYIIAQCVGAIVATAILSGITSSLPDN-SLGLNALAPGVNSGQGLG 141

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
            EI+ T  LV  V + TD +R           PL IGF+V + H+  I  TG GINPARS
Sbjct: 142 IEIIGTLQLVLCVLATTDRRRRDLGGS----GPLAIGFSVALGHLLAIDYTGCGINPARS 197

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVL 209
           FG++VI    H + DHWIFWVGP +GA    + +  +L
Sbjct: 198 FGSSVI---THNFQDHWIFWVGPFIGAALAVLIYDFIL 232



>gb:MMU48399_2121622 Mus musculus mercurial-insensitive water
           channel 3 (mMIWC3) mRNA, complete cds.
          Length = 354

 Score =  102 bits (253), Expect = 8e-21
 Identities = 62/153 (40%), Positives = 86/153 (56%), Gaps = 2/153 (1%)
 Frame = -1

Query: 667 RKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGG-GANTVQPGFSKGVGLVAEIL 491
           RK+S+ ++V Y+                +T      VGG G  TV    + G GL+ E++
Sbjct: 139 RKISIAKSVFYIIAQCLGAIIGAGILYLVTPP--SVVGGLGVTTVHGNLTAGHGLLVELI 196

Query: 490 ATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSFGAA 311
            TF LV+TVF++ D KR    + V     L IGF+V + H+  I  TG  +NPARSFG A
Sbjct: 197 ITFQLVFTVFASCDSKR----TDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPA 252

Query: 310 VIHNNKHAWDDHWIFWVGPMLGAI-AGAVYHQV 215
           VI  N   W +HWI+WVGP++GA+ AGA+Y  V
Sbjct: 253 VIMGN---WANHWIYWVGPIMGAVLAGALYEYV 282



>gb:MMU48398_2121621 Mus musculus mercurial-insensitive water
           channel 2 (mMIWC2) mRNA, complete cds.
          Length = 322

 Score =  102 bits (253), Expect = 8e-21
 Identities = 62/153 (40%), Positives = 86/153 (56%), Gaps = 2/153 (1%)
 Frame = -1

Query: 667 RKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGG-GANTVQPGFSKGVGLVAEIL 491
           RK+S+ ++V Y+                +T      VGG G  TV    + G GL+ E++
Sbjct: 107 RKISIAKSVFYIIAQCLGAIIGAGILYLVTPP--SVVGGLGVTTVHGNLTAGHGLLVELI 164

Query: 490 ATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSFGAA 311
            TF LV+TVF++ D KR    + V     L IGF+V + H+  I  TG  +NPARSFG A
Sbjct: 165 ITFQLVFTVFASCDSKR----TDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPA 220

Query: 310 VIHNNKHAWDDHWIFWVGPMLGAI-AGAVYHQV 215
           VI  N   W +HWI+WVGP++GA+ AGA+Y  V
Sbjct: 221 VIMGN---WANHWIYWVGPIMGAVLAGALYEYV 250



>gb:MMU33012_2120866 Mus musculus mercurial-insensitive water
           channel mRNA, complete cds.>gb:MMU48397_2121620 Mus
           musculus mercurial-insensitive water channel 1 (mMIWC1)
           mRNA, complete cds.
          Length = 300

 Score =  102 bits (253), Expect = 8e-21
 Identities = 62/153 (40%), Positives = 86/153 (56%), Gaps = 2/153 (1%)
 Frame = -1

Query: 667 RKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGG-GANTVQPGFSKGVGLVAEIL 491
           RK+S+ ++V Y+                +T      VGG G  TV    + G GL+ E++
Sbjct: 85  RKISIAKSVFYIIAQCLGAIIGAGILYLVTPP--SVVGGLGVTTVHGNLTAGHGLLVELI 142

Query: 490 ATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSFGAA 311
            TF LV+TVF++ D KR    + V     L IGF+V + H+  I  TG  +NPARSFG A
Sbjct: 143 ITFQLVFTVFASCDSKR----TDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPA 198

Query: 310 VIHNNKHAWDDHWIFWVGPMLGAI-AGAVYHQV 215
           VI  N   W +HWI+WVGP++GA+ AGA+Y  V
Sbjct: 199 VIMGN---WANHWIYWVGPIMGAVLAGALYEYV 228



>gb:AY032857_2074124 Dipodomys merriami aquaporin 4 isoform 1 mRNA,
           complete cds.
          Length = 302

 Score =  102 bits (253), Expect = 8e-21
 Identities = 60/153 (39%), Positives = 86/153 (56%), Gaps = 2/153 (1%)
 Frame = -1

Query: 667 RKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGG-GANTVQPGFSKGVGLVAEIL 491
           RK+S+ ++V Y+                +T      VGG G  TV    + G GL+ E++
Sbjct: 86  RKISIAKSVFYIAAQCLGAIIGAGILYLVTPP--SVVGGLGVTTVHGNLTAGHGLLVELI 143

Query: 490 ATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSFGAA 311
            TF LV+T+F++ D KR    + V     L IGF+V + H+  I  TG  +NPARSFG A
Sbjct: 144 ITFQLVFTIFASCDSKR----TDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPA 199

Query: 310 VIHNNKHAWDDHWIFWVGPMLGAI-AGAVYHQV 215
           VI  N   W++HWI+WVGP++GA+ AG +Y  V
Sbjct: 200 VIMGN---WENHWIYWVGPIIGAVLAGGLYEYV 229



>sp|Q923J4|AQP4_DIPME Aquaporin 4.>gb:AY032858_2074125 Dipodomys
           merriami aquaporin 4 isoform 2 mRNA, complete cds.
          Length = 324

 Score =  102 bits (253), Expect = 8e-21
 Identities = 60/153 (39%), Positives = 86/153 (56%), Gaps = 2/153 (1%)
 Frame = -1

Query: 667 RKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGG-GANTVQPGFSKGVGLVAEIL 491
           RK+S+ ++V Y+                +T      VGG G  TV    + G GL+ E++
Sbjct: 108 RKISIAKSVFYIAAQCLGAIIGAGILYLVTPP--SVVGGLGVTTVHGNLTAGHGLLVELI 165

Query: 490 ATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSFGAA 311
            TF LV+T+F++ D KR    + V     L IGF+V + H+  I  TG  +NPARSFG A
Sbjct: 166 ITFQLVFTIFASCDSKR----TDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPA 221

Query: 310 VIHNNKHAWDDHWIFWVGPMLGAI-AGAVYHQV 215
           VI  N   W++HWI+WVGP++GA+ AG +Y  V
Sbjct: 222 VIMGN---WENHWIYWVGPIIGAVLAGGLYEYV 251



>gb:AF469169_2066675 Mus musculus aquaporin-4 M23X isoform (Aqp4)
           mRNA, complete cds.>gb:BC024526_2094572 Mus musculus
           aquaporin 4, mRNA (cDNA clone MGC:37514 IMAGE:4985265),
           complete cds.
          Length = 301

 Score =  101 bits (252), Expect = 1e-20
 Identities = 61/153 (39%), Positives = 86/153 (56%), Gaps = 2/153 (1%)
 Frame = -1

Query: 667 RKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGG-GANTVQPGFSKGVGLVAEIL 491
           RK+S+ ++V Y+                +T      VGG G  TV    + G GL+ E++
Sbjct: 86  RKISIAKSVFYIIAQCLGAIIGAGILYLVTPP--SVVGGLGVTTVHGNLTAGHGLLVELI 143

Query: 490 ATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSFGAA 311
            TF LV+T+F++ D KR    + V     L IGF+V + H+  I  TG  +NPARSFG A
Sbjct: 144 ITFQLVFTIFASCDSKR----TDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPA 199

Query: 310 VIHNNKHAWDDHWIFWVGPMLGAI-AGAVYHQV 215
           VI  N   W +HWI+WVGP++GA+ AGA+Y  V
Sbjct: 200 VIMGN---WANHWIYWVGPIMGAVLAGALYEYV 229



>gb:AF469168_2066674 Mus musculus aquaporin-4 M1 isoform (Aqp4)
           mRNA, complete cds.
          Length = 323

 Score =  101 bits (252), Expect = 1e-20
 Identities = 61/153 (39%), Positives = 86/153 (56%), Gaps = 2/153 (1%)
 Frame = -1

Query: 667 RKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGG-GANTVQPGFSKGVGLVAEIL 491
           RK+S+ ++V Y+                +T      VGG G  TV    + G GL+ E++
Sbjct: 108 RKISIAKSVFYIIAQCLGAIIGAGILYLVTPP--SVVGGLGVTTVHGNLTAGHGLLVELI 165

Query: 490 ATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSFGAA 311
            TF LV+T+F++ D KR    + V     L IGF+V + H+  I  TG  +NPARSFG A
Sbjct: 166 ITFQLVFTIFASCDSKR----TDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPA 221

Query: 310 VIHNNKHAWDDHWIFWVGPMLGAI-AGAVYHQV 215
           VI  N   W +HWI+WVGP++GA+ AGA+Y  V
Sbjct: 222 VIMGN---WANHWIYWVGPIMGAVLAGALYEYV 251



>gb:AK045357_1167371 Mus musculus adult male corpora quadrigemina
           cDNA, RIKEN full-length enriched library,
           clone:B230105H10 product:aquaporin 4, full insert
           sequence.
          Length = 224

 Score =  101 bits (252), Expect = 1e-20
 Identities = 61/153 (39%), Positives = 86/153 (56%), Gaps = 2/153 (1%)
 Frame = -1

Query: 667 RKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGG-GANTVQPGFSKGVGLVAEIL 491
           RK+S+ ++V Y+                +T      VGG G  TV    + G GL+ E++
Sbjct: 9   RKISIAKSVFYIIAQCLGAIIGAGILYLVTPP--SVVGGLGVTTVHGNLTAGHGLLVELI 66

Query: 490 ATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSFGAA 311
            TF LV+T+F++ D KR    + V     L IGF+V + H+  I  TG  +NPARSFG A
Sbjct: 67  ITFQLVFTIFASCDSKR----TDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPA 122

Query: 310 VIHNNKHAWDDHWIFWVGPMLGAI-AGAVYHQV 215
           VI  N   W +HWI+WVGP++GA+ AGA+Y  V
Sbjct: 123 VIMGN---WANHWIYWVGPIMGAVLAGALYEYV 152



>sp|P50501|AQPA_RANES Aquaporin FA-CHIP.>pir|I51164|I51164 chip
           aquaporin - edible frog>gb:RANCAQ_2578707 Rana esculenta
           chip aquaporin (AQPA) mRNA, complete cds.
          Length = 272

 Score =  101 bits (252), Expect = 1e-20
 Identities = 60/158 (37%), Positives = 84/158 (53%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           G  L+ ++S+++AV Y+                +T    +    G N + PG S G GL 
Sbjct: 86  GCLLSCQISILKAVMYIIAQCLGAVVATAILSGITSGL-ENNSLGLNGLSPGVSAGQGLG 144

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
            EIL TF LV  V + TD +R+     VP    L IG +V + H+  I  TG G+NPARS
Sbjct: 145 VEILVTFQLVLCVVAVTDRRRHDVSGSVP----LAIGLSVALGHLIAIDYTGCGMNPARS 200

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVL 209
           FG+AV+  N   +  HWIFWVGPM+G  A A+ +  +L
Sbjct: 201 FGSAVLTKN---FTYHWIFWVGPMIGGAAAAIIYDFIL 235



>sp|P55088|AQP4_MOUSE Aquaporin 4 (WCH4) (Mercurial-insensitive
           water channel) (MIWC).>gb:MMU88623_2123797 Mus musculus
           aquaporin-4 (Aqp4) mRNA, complete cds.
          Length = 323

 Score =  101 bits (252), Expect = 1e-20
 Identities = 61/153 (39%), Positives = 86/153 (56%), Gaps = 2/153 (1%)
 Frame = -1

Query: 667 RKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGG-GANTVQPGFSKGVGLVAEIL 491
           RK+S+ ++V Y+                +T      VGG G  TV    + G GL+ E++
Sbjct: 108 RKISIAKSVFYIIAQCLGAIIGAGILYLVTPP--SVVGGLGVTTVHGNLTAGHGLLVELI 165

Query: 490 ATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSFGAA 311
            TF LV+T+F++ D KR    + V     L IGF+V + H+  I  TG  +NPARSFG A
Sbjct: 166 ITFQLVFTIFASCDSKR----TDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPA 221

Query: 310 VIHNNKHAWDDHWIFWVGPMLGAI-AGAVYHQV 215
           VI  N   W +HWI+WVGP++GA+ AGA+Y  V
Sbjct: 222 VIMGN---WANHWIYWVGPIMGAVLAGALYEYV 251



>gb:BC072092_2556355 Xenopus laevis MGC79006 protein, mRNA (cDNA
           clone MGC:79006 IMAGE:4407114), complete cds.
          Length = 274

 Score =  101 bits (251), Expect = 1e-20
 Identities = 59/158 (37%), Positives = 85/158 (53%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           G  L+ ++S+++A+ Y+                +T         G N +  G S+G GL 
Sbjct: 89  GCLLSCQISILKALMYIIAQCLGAVVGTAILSGITTQISKN-SLGLNGLSEGISQGQGLG 147

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
            EI+ TF LV  V + TD +RN     V   APL IG +V + H+  I  TG G+NPARS
Sbjct: 148 VEIMVTFQLVLCVVAITDRRRN----DVSGSAPLAIGLSVALGHLIAIDYTGCGMNPARS 203

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVL 209
           FG+AV+ N    + +HWIFWVGPM+G  A A+ +  +L
Sbjct: 204 FGSAVVANQ---FTNHWIFWVGPMIGGAAAAIIYDFIL 238



>gb:AY692368_2544357 Coturnix coturnix aquaporin-1 mRNA, complete
           cds.
          Length = 270

 Score =  101 bits (251), Expect = 1e-20
 Identities = 59/159 (37%), Positives = 89/159 (55%), Gaps = 1/159 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDF-FDTVGGGANTVQPGFSKGVGL 506
           GL L+ ++S+ +A+ Y+                +T    ++++G   N +  G + G GL
Sbjct: 83  GLLLSCQISIFKALMYILAQCLGAVVATAILSGVTSSLPYNSLG--LNALAKGINAGQGL 140

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
             EI+AT  LV  V + TD +RN     V   APL IG +V + H+  I  TG GINPAR
Sbjct: 141 GIEIIATLQLVLCVLATTDRRRN----DVTGSAPLAIGLSVALGHLLAIDYTGCGINPAR 196

Query: 325 SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVL 209
           SFG+A+I NN   +++HWIFWVGP++G    A+ +  +L
Sbjct: 197 SFGSALIANN---FENHWIFWVGPIIGGAGAALIYDFIL 232



>gb:HSU34845_2023718 Human mercurial-insensitive water channel mRNA,
           form 1, complete cds.
          Length = 301

 Score =  101 bits (251), Expect = 1e-20
 Identities = 60/153 (39%), Positives = 86/153 (56%), Gaps = 2/153 (1%)
 Frame = -1

Query: 667 RKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGG-GANTVQPGFSKGVGLVAEIL 491
           RK+S+ ++V Y+                +T      VGG G   V    + G GL+ E++
Sbjct: 86  RKISIAKSVFYIAAQCLGAIIGAGILYLVTPP--SVVGGLGVTMVHGNLTAGHGLLVELI 143

Query: 490 ATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSFGAA 311
            TF LV+T+F++ D KR    + V     L IGF+V + H+  I  TG  +NPARSFG A
Sbjct: 144 ITFQLVFTIFASCDSKR----TDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPA 199

Query: 310 VIHNNKHAWDDHWIFWVGPMLGAI-AGAVYHQV 215
           VI  N   W++HWI+WVGP++GA+ AGA+Y  V
Sbjct: 200 VIMGN---WENHWIYWVGPIIGAVLAGALYEYV 229



>gb:AY585335_1431673 Sus scrofa aquaporin-1 (AQP1) mRNA, complete
           cds.
          Length = 271

 Score =  101 bits (251), Expect = 1e-20
 Identities = 59/158 (37%), Positives = 81/158 (51%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL L+ ++S++RAV Y+                +T         G N++ PG   G GL 
Sbjct: 84  GLLLSCQISVLRAVMYIIAQCVGAIVATAILSGITSSLPGN-SLGLNSLAPGVDSGQGLG 142

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
            EI+ T  LV  V + TD +R          APL IGF+V + H+  I  TG GINPARS
Sbjct: 143 IEIIGTLQLVLCVLATTDRRRRDLGGS----APLAIGFSVALGHLLAIDYTGCGINPARS 198

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVL 209
           FG+AVI    H + DHW+FWVGP +G     + +  +L
Sbjct: 199 FGSAVI---THNFQDHWVFWVGPFIGGALAVLIYDFIL 233



>pir|I39178|I39178 aquaporin 4, long splice form -
           human>gb:HSU34846_2023719 Human mercurial-insensitive
           water channel mRNA, form 2, complete cds.
          Length = 341

 Score =  101 bits (251), Expect = 1e-20
 Identities = 60/153 (39%), Positives = 86/153 (56%), Gaps = 2/153 (1%)
 Frame = -1

Query: 667 RKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGG-GANTVQPGFSKGVGLVAEIL 491
           RK+S+ ++V Y+                +T      VGG G   V    + G GL+ E++
Sbjct: 126 RKISIAKSVFYIAAQCLGAIIGAGILYLVTPP--SVVGGLGVTMVHGNLTAGHGLLVELI 183

Query: 490 ATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSFGAA 311
            TF LV+T+F++ D KR    + V     L IGF+V + H+  I  TG  +NPARSFG A
Sbjct: 184 ITFQLVFTIFASCDSKR----TDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPA 239

Query: 310 VIHNNKHAWDDHWIFWVGPMLGAI-AGAVYHQV 215
           VI  N   W++HWI+WVGP++GA+ AGA+Y  V
Sbjct: 240 VIMGN---WENHWIYWVGPIIGAVLAGALYEYV 269



>gb:AY206465_1427131 Ovis aries aquaporin 4 M23 isoform mRNA,
           complete cds.
          Length = 301

 Score =  100 bits (250), Expect = 2e-20
 Identities = 60/153 (39%), Positives = 85/153 (55%), Gaps = 2/153 (1%)
 Frame = -1

Query: 667 RKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGG-GANTVQPGFSKGVGLVAEIL 491
           R++S+ +AV Y+                +T      VGG G  TV    S G GL+ E++
Sbjct: 86  RRISIAKAVFYIAAQCLGAIIGAGILYLVTPP--SVVGGLGVTTVHRNLSAGHGLLVELI 143

Query: 490 ATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSFGAA 311
            TF LV+T+F++ D KR    + V     L IG +V + H+  I  TG  +NPARSFG A
Sbjct: 144 ITFQLVFTIFASCDSKR----TDVTGSIALAIGISVAIGHLFAINYTGASMNPARSFGPA 199

Query: 310 VIHNNKHAWDDHWIFWVGPMLGAI-AGAVYHQV 215
           VI  N   W++HWI+WVGP++GA+ AG +Y  V
Sbjct: 200 VIMGN---WENHWIYWVGPIIGAVLAGGLYEYV 229



>gb:AY177612_1426788 Ovis aries aquaporin 4A (AQP4A) mRNA, complete
           cds.>gb:AY304480_1428605 Ovis aries aquaporin-4 M1
           isoform (AQP4) mRNA, complete cds.
          Length = 323

 Score =  100 bits (250), Expect = 2e-20
 Identities = 60/153 (39%), Positives = 85/153 (55%), Gaps = 2/153 (1%)
 Frame = -1

Query: 667 RKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGG-GANTVQPGFSKGVGLVAEIL 491
           R++S+ +AV Y+                +T      VGG G  TV    S G GL+ E++
Sbjct: 108 RRISIAKAVFYIAAQCLGAIIGAGILYLVTPP--SVVGGLGVTTVHRNLSAGHGLLVELI 165

Query: 490 ATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSFGAA 311
            TF LV+T+F++ D KR    + V     L IG +V + H+  I  TG  +NPARSFG A
Sbjct: 166 ITFQLVFTIFASCDSKR----TDVTGSIALAIGISVAIGHLFAINYTGASMNPARSFGPA 221

Query: 310 VIHNNKHAWDDHWIFWVGPMLGAI-AGAVYHQV 215
           VI  N   W++HWI+WVGP++GA+ AG +Y  V
Sbjct: 222 VIMGN---WENHWIYWVGPIIGAVLAGGLYEYV 251



>gb:AP003802_1833562 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1047_A06.>gb:AP004668_1842994 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0475E07.
          Length = 71

 Score =  100 bits (249), Expect = 2e-20
 Identities = 46/71 (64%), Positives = 55/71 (77%)
 Frame = -1

Query: 379 VAHVATIPITGTGINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQ 200
           + H+ATIP+TGTGINPARS GAAV++NN  AW D WIFWVGP +GA   A+YHQ+VLRA 
Sbjct: 1   MVHLATIPVTGTGINPARSLGAAVVYNNSKAWSDQWIFWVGPFIGAAIAALYHQIVLRAS 60

Query: 199 AVKALGGSFQS 167
           A     GSF+S
Sbjct: 61  ARGY--GSFRS 69



>gb:BC084131_2563536 Xenopus laevis hypothetical LOC495037, mRNA
           (cDNA clone MGC:86220 IMAGE:6958087), complete cds.
          Length = 274

 Score =  100 bits (248), Expect = 3e-20
 Identities = 59/158 (37%), Positives = 84/158 (53%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           G  L+ ++S+++A+ Y+                +T         G N +  G S+G GL 
Sbjct: 89  GCLLSCQISILKALMYIIAQCVGAVVGTAILSGITTQISKN-SLGLNGLSEGISQGQGLG 147

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
            EI+ TF LV  V S TD +RN     V   APL IG +V + H+  I  TG G+NPARS
Sbjct: 148 VEIMVTFQLVLCVVSITDRRRN----DVSGSAPLAIGLSVALGHLIAIDYTGCGMNPARS 203

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVL 209
           FG+AV+      + +HWIFWVGPM+G  A A+ +  +L
Sbjct: 204 FGSAVVAKQ---FTNHWIFWVGPMIGGAAAAIIYDFIL 238



>gb:RATORFA_2133241 Rattus norvegicus mercurial-insensitive water
           channel mRNA, complete cds.
          Length = 301

 Score =  100 bits (248), Expect = 3e-20
 Identities = 60/153 (39%), Positives = 86/153 (56%), Gaps = 2/153 (1%)
 Frame = -1

Query: 667 RKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGG-GANTVQPGFSKGVGLVAEIL 491
           RK+S+ ++V Y+                +T      VGG G  TV    + G GL+ E++
Sbjct: 86  RKISIAKSVFYITAQCLGAIIGAGILYLVTPP--SVVGGLGVTTVHGNLTAGHGLLVELI 143

Query: 490 ATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSFGAA 311
            TF LV+T+F++ D KR    + V     L IGF+V +  +  I  TG  +NPARSFG A
Sbjct: 144 ITFQLVFTIFASCDSKR----TDVTGSVALAIGFSVAIGPLFAINYTGASMNPARSFGPA 199

Query: 310 VIHNNKHAWDDHWIFWVGPMLGAI-AGAVYHQV 215
           VI  N   W++HWI+WVGP++GA+ AGA+Y  V
Sbjct: 200 VIMGN---WENHWIYWVGPIIGAVLAGALYEYV 229



>gb:HSU63623_2025382 Human aquaporin 4 (AQP4) mRNA, complete cds.
          Length = 301

 Score = 99.8 bits (247), Expect = 4e-20
 Identities = 59/153 (38%), Positives = 85/153 (55%), Gaps = 2/153 (1%)
 Frame = -1

Query: 667 RKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGG-GANTVQPGFSKGVGLVAEIL 491
           RK+S+ ++V Y+                +T      VGG G   V    + G GL+ E++
Sbjct: 86  RKISIAKSVFYIAAQCLGAIIGAGILYLVTPP--SVVGGLGVTMVHGNLTAGHGLLVELI 143

Query: 490 ATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSFGAA 311
            TF LV+T+F++ D KR    + V     L IGF+V + H+  I  TG  +NPARSFG A
Sbjct: 144 ITFQLVFTIFASCDSKR----TDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPA 199

Query: 310 VIHNNKHAWDDHWIFWVGPMLGAI-AGAVYHQV 215
           VI  N   W++HWI+WVGP++GA+ AG +Y  V
Sbjct: 200 VIMGN---WENHWIYWVGPIIGAVLAGGLYEYV 229



>gb:AB015947_1407836 Bos taurus AQP-4 mRNA for aquaporin-4-A,
           complete cds.
          Length = 323

 Score = 99.8 bits (247), Expect = 4e-20
 Identities = 59/153 (38%), Positives = 85/153 (55%), Gaps = 2/153 (1%)
 Frame = -1

Query: 667 RKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGG-GANTVQPGFSKGVGLVAEIL 491
           R++S+ ++V Y+                +T      VGG G  TV    S G GL+ E++
Sbjct: 108 RRISIAKSVFYIAAQCLGAIIGAGILYLVTPP--SVVGGLGVTTVHGNLSAGHGLLVELI 165

Query: 490 ATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSFGAA 311
            TF LV+T+F++ D KR    + V     L IG +V + H+  I  TG  +NPARSFG A
Sbjct: 166 ITFQLVFTIFASCDSKR----TDVTGSIALAIGISVAIGHLFAINYTGASMNPARSFGPA 221

Query: 310 VIHNNKHAWDDHWIFWVGPMLGAI-AGAVYHQV 215
           VI  N   W++HWI+WVGP++GA+ AG +Y  V
Sbjct: 222 VIMGN---WENHWIYWVGPIIGAVLAGGLYEYV 251



>gb:AB012950_1407793 Bos taurus AQP-4 mRNA for aquaporin-4, complete
           cds.>gb:AB028642_1408153 Bos taurus mRNA for
           aquaporin-4-B, complete cds.
          Length = 301

 Score = 99.8 bits (247), Expect = 4e-20
 Identities = 59/153 (38%), Positives = 85/153 (55%), Gaps = 2/153 (1%)
 Frame = -1

Query: 667 RKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGG-GANTVQPGFSKGVGLVAEIL 491
           R++S+ ++V Y+                +T      VGG G  TV    S G GL+ E++
Sbjct: 86  RRISIAKSVFYIAAQCLGAIIGAGILYLVTPP--SVVGGLGVTTVHGNLSAGHGLLVELI 143

Query: 490 ATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSFGAA 311
            TF LV+T+F++ D KR    + V     L IG +V + H+  I  TG  +NPARSFG A
Sbjct: 144 ITFQLVFTIFASCDSKR----TDVTGSIALAIGISVAIGHLFAINYTGASMNPARSFGPA 199

Query: 310 VIHNNKHAWDDHWIFWVGPMLGAI-AGAVYHQV 215
           VI  N   W++HWI+WVGP++GA+ AG +Y  V
Sbjct: 200 VIMGN---WENHWIYWVGPIIGAVLAGGLYEYV 229



>sp|P55087|AQP4_HUMAN Aquaporin 4 (WCH4) (Mercurial-insensitive
           water channel) (MIWC).>gb:BC022286_1977763 Homo sapiens
           aquaporin 4, transcript variant a, mRNA (cDNA clone
           MGC:22454 IMAGE:4717755), complete
           cds.>gb:HSU63622_2025381 Human aquaporin 4 (AQP4) mRNA,
           complete cds.>gb:HUMWC_2038161 Homo sapiens mRNA for
           aquaporin, complete cds.
          Length = 323

 Score = 99.8 bits (247), Expect = 4e-20
 Identities = 59/153 (38%), Positives = 85/153 (55%), Gaps = 2/153 (1%)
 Frame = -1

Query: 667 RKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGG-GANTVQPGFSKGVGLVAEIL 491
           RK+S+ ++V Y+                +T      VGG G   V    + G GL+ E++
Sbjct: 108 RKISIAKSVFYIAAQCLGAIIGAGILYLVTPP--SVVGGLGVTMVHGNLTAGHGLLVELI 165

Query: 490 ATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSFGAA 311
            TF LV+T+F++ D KR    + V     L IGF+V + H+  I  TG  +NPARSFG A
Sbjct: 166 ITFQLVFTIFASCDSKR----TDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPA 221

Query: 310 VIHNNKHAWDDHWIFWVGPMLGAI-AGAVYHQV 215
           VI  N   W++HWI+WVGP++GA+ AG +Y  V
Sbjct: 222 VIMGN---WENHWIYWVGPIIGAVLAGGLYEYV 251



>sp|O77750|AQP4_BOVIN Aquaporin 4 (WCH4) (Mercurial-insensitive
           water channel) (MIWC).
          Length = 323

 Score = 99.8 bits (247), Expect = 4e-20
 Identities = 59/153 (38%), Positives = 85/153 (55%), Gaps = 2/153 (1%)
 Frame = -1

Query: 667 RKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGG-GANTVQPGFSKGVGLVAEIL 491
           R++S+ ++V Y+                +T      VGG G  TV    S G GL+ E++
Sbjct: 108 RRISIAKSVFYIAAQCLGAIIGAGILYLVTPP--SVVGGLGVTTVHGNLSAGHGLLVELI 165

Query: 490 ATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSFGAA 311
            TF LV+T+F++ D KR    + V     L IG +V + H+  I  TG  +NPARSFG A
Sbjct: 166 ITFQLVFTIFASCDSKR----TDVTGSIALAIGISVAIGHLFAINYTGASMNPARSFGPA 221

Query: 310 VIHNNKHAWDDHWIFWVGPMLGAI-AGAVYHQV 215
           VI  N   W++HWI+WVGP++GA+ AG +Y  V
Sbjct: 222 VIMGN---WENHWIYWVGPIIGAVLAGGLYEYV 251



>gb:AB011373_1407753 Canis familiaris aquaporin1 mRNA for AQP-CHIP,
           complete cds.
          Length = 271

 Score = 99.0 bits (245), Expect = 7e-20
 Identities = 58/158 (36%), Positives = 80/158 (50%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL L+ ++S++RAV Y+                +T    D    G N + PG + G GL 
Sbjct: 84  GLLLSCQISILRAVMYIIAQCVGAIVATAILSGITSSLPDN-SLGRNELAPGVNSGQGLG 142

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
            EI+ T  LV  V + TD +R           PL IG +V + H+  I  TG GINPARS
Sbjct: 143 IEIIGTLQLVLCVLATTDRRRRDLGGS----GPLAIGLSVALGHLLAIDYTGCGINPARS 198

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVL 209
           FG++VI    H + DHWIFWVGP +G     + +  +L
Sbjct: 199 FGSSVI---THNFKDHWIFWVGPFIGGALAVLIYDFIL 233



>gb:BC078213_2560799 Danio rerio si:ch211-192k9.1, mRNA (cDNA clone
           MGC:100922 IMAGE:7145374), complete cds.
          Length = 320

 Score = 98.6 bits (244), Expect = 9e-20
 Identities = 53/112 (47%), Positives = 67/112 (59%), Gaps = 1/112 (0%)
 Frame = -1

Query: 556 GGGANTVQPGFSKGVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFV 377
           G G  +V    S G  +V E++ TF LV+TVF+  DPKRN         A L IG +V +
Sbjct: 146 GMGVTSVNEEISAGHAIVIELIITFELVFTVFATCDPKRNDLKGS----AALAIGLSVCI 201

Query: 376 AHVATIPITGTGINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAI-AGAVY 224
            H+  IP TG  +NPARSFG AVI      W DHW++WVGP++G I A AVY
Sbjct: 202 GHLFAIPYTGASMNPARSFGPAVIMVK---WQDHWVYWVGPLIGGILAAAVY 250



>gb:BC075384_2558487 Xenopus tropicalis aquaporin 1 (channel-forming
           integral protein, 28kDa), mRNA (cDNA clone MGC:89110
           IMAGE:7006583), complete cds.
          Length = 274

 Score = 98.6 bits (244), Expect = 9e-20
 Identities = 58/158 (36%), Positives = 85/158 (53%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           G  L+ ++S+++A+ Y+                +T    +    G N +  G S+G GL 
Sbjct: 89  GCLLSCQISILKALMYIIAQCLGAVVGTAILSGITTQISNN-SLGLNGLSNGVSQGQGLG 147

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
            EI+ TF LV  V + TD +RN     V   APL IG +V + H+  I  TG G+NPARS
Sbjct: 148 VEIMVTFQLVLCVVAITDRRRN----DVSGSAPLAIGLSVALGHLIAIDYTGCGMNPARS 203

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVL 209
           FG+AV+      + +HWIFWVGPM+G  A A+ +  +L
Sbjct: 204 FGSAVVAKQ---FANHWIFWVGPMIGGAAAAIIYDFIL 238



>gb:AL954739_2504941 Zebrafish DNA sequence from clone CH211-192K9
           in linkage group 20 Contains the gene for novel protein
           similar to vertebrate aquaporin 4 (AQP4), the gene for a
           novel potassium channel tetramerisation domain protein
           and a CpG island, complete sequence.
          Length = 308

 Score = 98.6 bits (244), Expect = 9e-20
 Identities = 53/112 (47%), Positives = 67/112 (59%), Gaps = 1/112 (0%)
 Frame = -1

Query: 556 GGGANTVQPGFSKGVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFV 377
           G G  +V    S G  +V E++ TF LV+TVF+  DPKRN         A L IG +V +
Sbjct: 134 GMGVTSVNEEISAGHAIVIELIITFELVFTVFATCDPKRNDLKGS----AALAIGLSVCI 189

Query: 376 AHVATIPITGTGINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAI-AGAVY 224
            H+  IP TG  +NPARSFG AVI      W DHW++WVGP++G I A AVY
Sbjct: 190 GHLFAIPYTGASMNPARSFGPAVIMVK---WQDHWVYWVGPLIGGILAAAVY 238



>gb:AF465730_2496338 Coturnix coturnix aquaporin-4 (AQP4) mRNA,
           complete cds.
          Length = 335

 Score = 98.6 bits (244), Expect = 9e-20
 Identities = 60/153 (39%), Positives = 84/153 (54%), Gaps = 2/153 (1%)
 Frame = -1

Query: 667 RKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGG-GANTVQPGFSKGVGLVAEIL 491
           RK+SL ++V Y+                +T      VGG G   V    S G GL+ E++
Sbjct: 120 RKISLAKSVFYILAQCLGAIVGAGILYLITPP--SVVGGLGVTAVHGDLSAGHGLLVELI 177

Query: 490 ATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSFGAA 311
            TF LV+T+F++ D KR    S V     L IGF+V + H+  I  TG  +NPARSFG A
Sbjct: 178 ITFQLVFTIFASCDSKR----SDVTGSVALAIGFSVAIGHLFAINYTGASMNPARSFGPA 233

Query: 310 VIHNNKHAWDDHWIFWVGPMLGAI-AGAVYHQV 215
           VI      W++ W++WVGP++GA+ AGA+Y  V
Sbjct: 234 VIMGK---WENQWVYWVGPIIGAVLAGALYEYV 263



>gb:AB190358_2467200 Gallus gallus AQP4 mRNA for aquaporin 4,
           complete cds.
          Length = 335

 Score = 98.6 bits (244), Expect = 9e-20
 Identities = 60/153 (39%), Positives = 84/153 (54%), Gaps = 2/153 (1%)
 Frame = -1

Query: 667 RKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGG-GANTVQPGFSKGVGLVAEIL 491
           RK+SL ++V Y+                +T      VGG G   V    S G GL+ E++
Sbjct: 120 RKISLAKSVFYILAQCLGAIVGAGILYLITPP--SVVGGLGVTAVHGDLSAGHGLLVELI 177

Query: 490 ATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARSFGAA 311
            TF LV+T+F++ D KR    S V     L IGF+V + H+  I  TG  +NPARSFG A
Sbjct: 178 ITFQLVFTIFASCDSKR----SDVTGSVALAIGFSVAIGHLFAINYTGASMNPARSFGPA 233

Query: 310 VIHNNKHAWDDHWIFWVGPMLGAI-AGAVYHQV 215
           VI      W++ W++WVGP++GA+ AGA+Y  V
Sbjct: 234 VIMGK---WENQWVYWVGPIIGAVLAGALYEYV 263



>gb:BC077129_2559847 Danio rerio zgc:100858, mRNA (cDNA clone
           MGC:100858 IMAGE:7140330), complete cds.
          Length = 263

 Score = 98.2 bits (243), Expect = 1e-19
 Identities = 51/112 (45%), Positives = 69/112 (61%)
 Frame = -1

Query: 544 NTVQPGFSKGVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVA 365
           NT+QPG S G+    EI  T  LV  VF+ TD +RN R       A L IGF+V V H+ 
Sbjct: 119 NTLQPGISMGMATTIEIFLTLQLVVCVFAVTDERRNGRLGS----AALSIGFSVLVGHLL 174

Query: 364 TIPITGTGINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVL 209
            +  TG G+NPARSF  AV++ N   + +HW++WVGPM+GA  GA+ +  +L
Sbjct: 175 GMYYTGAGMNPARSFAPAVLYRN---FINHWVYWVGPMIGAAMGALLYDFML 223



>gb:AF124746_1770290 Pinus banksiana putative aquaporin (Sb01) gene,
           partial cds.
          Length = 57

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 45/56 (80%), Positives = 51/56 (91%)
 Frame = -1

Query: 556 GGGANTVQPGFSKGVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGF 389
           GGGAN+V  G++KGVGL AEI+ TF LVYT+FSATDPKRNARDSH+PVLAPLPIGF
Sbjct: 2   GGGANSVAHGYTKGVGLSAEIIGTFVLVYTIFSATDPKRNARDSHIPVLAPLPIGF 57



>sp|Q9NHW7|AQP_AEDAE Aquaporin AQPAe.a.>gb:AF218314_1252088 Aedes
           aegypti aquaporin mRNA, complete cds.
          Length = 249

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 55/155 (35%), Positives = 79/155 (50%), Gaps = 2/155 (1%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGG-GANTVQPGFSKGVGL 506
           GL +   +S+++   Y+                 T    D +GG G   + P  + G G+
Sbjct: 88  GLMITADISILKGAFYIVSQCVGAIAGAALIKAATPS--DVIGGLGVTGIDPRLTAGQGV 145

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
           + E L TF LV+ V    D +R    S +   APL IG ++   H++ I  TG  +NPAR
Sbjct: 146 MMEALITFILVFVVHGVCDNRR----SDIKGSAPLAIGLSITAGHLSAIKYTGASMNPAR 201

Query: 325 SFGAAVIHNNKHAWDDHWIFWVGPMLGAI-AGAVY 224
           SFG AV+  N   W D W++WVGP++G I AGAVY
Sbjct: 202 SFGPAVVMGN---WTDQWVYWVGPIVGGILAGAVY 233



 Score = 35.8 bits (81), Expect = 0.71
 Identities = 32/111 (28%), Positives = 48/111 (43%), Gaps = 2/111 (1%)
 Frame = -1

Query: 508 LVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATI--PITGTGIN 335
           LVAE L TFFLV     +T         + P +  +   F + VA +A     ++G  IN
Sbjct: 26  LVAEFLGTFFLVSIGIGST---MGWGGDYAPTMTQIAFTFGLVVATLAQAFGHVSGCHIN 82

Query: 334 PARSFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLRAQAVKALG 182
           PA + G  +  +        +I  V   +GAIAGA   +    +  +  LG
Sbjct: 83  PAVTIGLMITADISILKGAFYI--VSQCVGAIAGAALIKAATPSDVIGGLG 131



>gb:AF000312_1411173 Oryctolagus cuniculus aquaporin 4 mRNA, partial
           cds.
          Length = 178

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 54/117 (46%), Positives = 72/117 (61%), Gaps = 2/117 (1%)
 Frame = -1

Query: 559 VGG-GANTVQPGFSKGVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAV 383
           VGG G  TV    S G GL+ E++ TF LV+T+F + D KR    + V     L IG +V
Sbjct: 4   VGGLGVTTVHGNLSAGHGLLVELIITFQLVFTIFPSCDSKR----TDVTGSIALAIGISV 59

Query: 382 FVAHVATIPITGTGINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAI-AGAVYHQV 215
            + H+  I  TG  +NPARSFG AVI  N   W++HWI+WVGP++GA+ AG +Y  V
Sbjct: 60  AIGHLFAINYTGASMNPARSFGPAVIMGN---WENHWIYWVGPIIGAVLAGGLYEYV 113



>gb:AB128929_1874055 Homo sapiens AQP4 mRNA for aquaporin type4
           transcript variant c, complete cds.
          Length = 218

 Score = 97.1 bits (240), Expect = 3e-19
 Identities = 53/117 (45%), Positives = 73/117 (62%), Gaps = 2/117 (1%)
 Frame = -1

Query: 559 VGG-GANTVQPGFSKGVGLVAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAV 383
           VGG G   V    + G GL+ E++ TF LV+T+F++ D KR    + V     L IGF+V
Sbjct: 37  VGGLGVTMVHGNLTAGHGLLVELIITFQLVFTIFASCDSKR----TDVTGSIALAIGFSV 92

Query: 382 FVAHVATIPITGTGINPARSFGAAVIHNNKHAWDDHWIFWVGPMLGAI-AGAVYHQV 215
            + H+  I  TG  +NPARSFG AVI  N   W++HWI+WVGP++GA+ AG +Y  V
Sbjct: 93  AIGHLFAINYTGASMNPARSFGPAVIMGN---WENHWIYWVGPIIGAVLAGGLYEYV 146



>gb:AB073315_2463182 Hyla japonica mRNA for water channel protein
           AQP-h1, complete cds.
          Length = 271

 Score = 96.7 bits (239), Expect = 3e-19
 Identities = 57/158 (36%), Positives = 82/158 (51%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           G  L+ ++S+++AV Y+                +T +      G  N +  G + G GL 
Sbjct: 86  GCLLSCQISILKAVMYIIAQCLGAVVATAILSGITSNLAGNTLG-LNGLSNGVTAGQGLG 144

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
            EI+ TF LV  V + TD +R      VP    L IG +V + H+  I  TG G+NPARS
Sbjct: 145 VEIMVTFQLVLCVVAVTDRRRRDVSGSVP----LAIGLSVALGHLIAIDYTGCGMNPARS 200

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVL 209
           FG+AV+  N   +  HWIFWVGPM+G  A A+ +  +L
Sbjct: 201 FGSAVVAKN---FQYHWIFWVGPMIGGAAAAIIYDFIL 235



>pir|B44499|B44499 major intrinsic protein homolog DER2 -
           mouse>gb:AK081886_1173411 Mus musculus 16 days embryo
           head cDNA, RIKEN full-length enriched library,
           clone:C130084O08 product:aquaporin 1, full insert
           sequence.>gb:AK086688_1174770 Mus musculus 15 days
           embryo head cDNA, RIKEN full-length enriched library,
           clone:D930045N08 product:aquaporin 1, full insert
           sequence.>gb:MUSGROEARB_2126085 Mus musculus aquaporin-1
           (AQ1) mRNA, complete cds.
          Length = 269

 Score = 96.7 bits (239), Expect = 3e-19
 Identities = 57/158 (36%), Positives = 80/158 (50%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL L+ ++S++RAV Y+                +T    D    G N +  G + G GL 
Sbjct: 82  GLLLSCQISILRAVMYIIAQCVGAIVATAILSGITSSLVDN-SLGRNDLAHGVNSGQGLG 140

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
            EI+ T  LV  V + TD +R          APL IG +V + H+  I  TG GINPARS
Sbjct: 141 IEIIGTLQLVLCVLATTDRRRRDLGGS----APLAIGLSVALGHLLAIDYTGCGINPARS 196

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVL 209
           FG+AV+  N   + +HWIFWVGP +G     + +  +L
Sbjct: 197 FGSAVLTRN---FSNHWIFWVGPFIGGALAVLIYDFIL 231



>sp|Q02013|AQP1_MOUSE Aquaporin-CHIP (Water channel protein for red
           blood cells and kidney proximal tubule) (Aquaporin 1)
           (Early response protein DER2).
          Length = 268

 Score = 96.7 bits (239), Expect = 3e-19
 Identities = 57/158 (36%), Positives = 80/158 (50%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL L+ ++S++RAV Y+                +T    D    G N +  G + G GL 
Sbjct: 81  GLLLSCQISILRAVMYIIAQCVGAIVATAILSGITSSLVDN-SLGRNDLAHGVNSGQGLG 139

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
            EI+ T  LV  V + TD +R          APL IG +V + H+  I  TG GINPARS
Sbjct: 140 IEIIGTLQLVLCVLATTDRRRRDLGGS----APLAIGLSVALGHLLAIDYTGCGINPARS 195

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVL 209
           FG+AV+  N   + +HWIFWVGP +G     + +  +L
Sbjct: 196 FGSAVLTRN---FSNHWIFWVGPFIGGALAVLIYDFIL 230



>gb:BC066289_2554256 Danio rerio zgc:85890, mRNA (cDNA clone
           MGC:85890 IMAGE:6970049), complete cds.
          Length = 260

 Score = 96.3 bits (238), Expect = 4e-19
 Identities = 60/158 (37%), Positives = 87/158 (55%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL  + ++SL+RAV Y+                ++K   D +G   N +    S G G+ 
Sbjct: 76  GLLASCQISLLRAVMYILAQMIGATVASAIVLGVSKG--DALG--LNQIHTDISAGQGVG 131

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
            E+LATF LV  V + TD +R  RD  V   APL IG +V + H+  I  TG GINPAR+
Sbjct: 132 IELLATFQLVLCVLATTDKRR--RD--VSGSAPLAIGLSVCLGHLTAISFTGCGINPART 187

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVL 209
           FG A+I  +   + +HW++WVGPM G +A A+ +  +L
Sbjct: 188 FGPAMIRLD---FANHWVYWVGPMCGGVAAALIYDFLL 222



>gb:RNCHIPA_2134638 R.norvegicus CHIP 28 mRNA.
          Length = 269

 Score = 96.3 bits (238), Expect = 4e-19
 Identities = 56/158 (35%), Positives = 81/158 (51%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL L+ ++S++RAV Y+                +T    +    G N +  G + G GL 
Sbjct: 82  GLLLSCQISILRAVMYIIAQCVGAIVASAILSGITSSLLEN-SLGRNDLARGVNSGQGLG 140

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
            EI+ T  LV  V + TD +R          APL IG +V + H+  I  TG GINPARS
Sbjct: 141 IEIIGTLQLVLCVLATTDQRRRDLGGS----APLAIGLSVALGHLLAIDYTGCGINPARS 196

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVL 209
           FG+AV+  N   + +HWIFWVGP +G+    + +  +L
Sbjct: 197 FGSAVLTRN---FSNHWIFWVGPFIGSALAVLIYDFIL 231



>gb:AB178640_1202291 Bombyx mori aqp mRNA for aquaporin, complete
           cds.
          Length = 252

 Score = 96.3 bits (238), Expect = 4e-19
 Identities = 52/160 (32%), Positives = 81/160 (50%), Gaps = 1/160 (0%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQ-PGFSKGVGL 506
           GLF A  + L++A+ Y+                      D++GG   T+  PG ++   +
Sbjct: 90  GLFAAGDIKLLKAIFYIVVQSLGAVAGAAFIRLAIPA--DSIGGFGMTLPGPGVTEAQAV 147

Query: 505 VAEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPAR 326
           + E L TF LV  V    DP+RN         APL IG ++   H A IP TG+ +NPAR
Sbjct: 148 LVEALITFVLVMVVMGVCDPQRNDLKGS----APLAIGLSITACHAAVIPFTGSSMNPAR 203

Query: 325 SFGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVLR 206
           +FG A++  N   W   W++WVGP++G++   + ++  LR
Sbjct: 204 TFGPALVIGN---WTSQWVYWVGPVVGSVVAGLLYKFALR 240



>gb:RNCHIP28K_2134637 R.norvegicus mRNA for channel integral protein
           28k (CHIP28k).
          Length = 269

 Score = 95.9 bits (237), Expect = 6e-19
 Identities = 56/158 (35%), Positives = 81/158 (51%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL L+ ++S++RAV Y+                +T    +    G N +  G + G GL 
Sbjct: 82  GLLLSCQISILRAVMYIIAQCVGAIVASAILSGITSSLLEN-SLGRNDLARGVNSGQGLG 140

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
            EI+ T  LV  V + TD +R          APL IG +V + H+  I  TG GINPARS
Sbjct: 141 IEIIGTLQLVLCVLATTDRRRRDLGGS----APLAIGLSVALGHLLAIDYTGCGINPARS 196

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVL 209
           FG+AV+  N   + +HWIFWVGP +G+    + +  +L
Sbjct: 197 FGSAVLTRN---FSNHWIFWVGPFIGSALAVLIYDFIL 231



>gb:RATCHIP28A_2131798 Rattus norvegicus water channel (CHIP28)
           mRNA, complete cds.
          Length = 269

 Score = 95.9 bits (237), Expect = 6e-19
 Identities = 56/158 (35%), Positives = 81/158 (51%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL L+ ++S++RAV Y+                +T    +    G N +  G + G GL 
Sbjct: 82  GLLLSCQISILRAVMYIIAQCVGAIVASAILSGITSSLLEN-SLGRNDLARGVNSGQGLG 140

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
            EI+ T  LV  V + TD +R          APL IG +V + H+  I  TG GINPARS
Sbjct: 141 IEIIGTLQLVLCVLATTDRRRRDLGGS----APLAIGLSVALGHLLAIDYTGCGINPARS 196

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVL 209
           FG+AV+  N   + +HWIFWVGP +G+    + +  +L
Sbjct: 197 FGSAVLTRN---FSNHWIFWVGPFIGSALAVLIYDFIL 231



>pir|JC1320|JC1320 water channel protein CHIP28 -
           rat>gb:BC090068_2111198 Rattus norvegicus aquaporin 1,
           mRNA (cDNA clone MGC:93653 IMAGE:7190406), complete
           cds.>gb:RNCHIP28_2134636 R.norvegicus mRNA for channel
           integral membrane protein 28.
          Length = 269

 Score = 95.9 bits (237), Expect = 6e-19
 Identities = 56/158 (35%), Positives = 81/158 (51%)
 Frame = -1

Query: 682 GLFLARKVSLIRAVAYMXXXXXXXXXXXXXXXXLTKDFFDTVGGGANTVQPGFSKGVGLV 503
           GL L+ ++S++RAV Y+                +T    +    G N +  G + G GL 
Sbjct: 82  GLLLSCQISILRAVMYIIAQCVGAIVASAILSGITSSLLEN-SLGRNDLARGVNSGQGLG 140

Query: 502 AEILATFFLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVAHVATIPITGTGINPARS 323
            EI+ T  LV  V + TD +R          APL IG +V + H+  I  TG GINPARS
Sbjct: 141 IEIIGTLQLVLCVLATTDRRRRDLGGS----APLAIGLSVALGHLLAIDYTGCGINPARS 196

Query: 322 FGAAVIHNNKHAWDDHWIFWVGPMLGAIAGAVYHQVVL 209
           FG+AV+  N   + +HWIFWVGP +G+    + +  +L
Sbjct: 197 FGSAVLTRN---FSNHWIFWVGPFIGSALAVLIYDFIL 231


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 696,395,636
Number of Sequences: 1806583
Number of extensions: 14213978
Number of successful extensions: 55517
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 48055
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 54449
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 38703569590
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)