BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10072
         (1103 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP003218_1825425 Oryza sativa (japonica cultivar-group) genom...   323   5e-87   
gb:AC109596_1738738 Oryza sativa (japonica cultivar-group) chrom...   320   3e-86   
pir|T13013|T13013 hypothetical protein F8L21.10 - Arabidopsis th...   312   7e-84   Arabidopsis thaliana [mouse-ear cress]
pir|T05595|T05595 hypothetical protein F9D16.100 - Arabidopsis t...   305   1e-81   Arabidopsis thaliana [mouse-ear cress]
gb:AB005233_1509315 Arabidopsis thaliana genomic DNA, chromosome...   303   5e-81   
gb:AP002900_1823718 Oryza sativa (japonica cultivar-group) genom...   301   2e-80   
pir|E84899|E84899 hypothetical protein At2g46170 [imported] - Ar...   300   3e-80   Arabidopsis thaliana [mouse-ear cress]
gb:AE005173_894068 Arabidopsis thaliana chromosome 1, bottom arm...   291   2e-77   
gb:BT014988_1641958 Arabidopsis thaliana At3g61560 gene, complet...   283   6e-75   
gb:AP003527_1830478 Oryza sativa (japonica cultivar-group) genom...   259   7e-68   
gb:AP004683_1843309 Oryza sativa (japonica cultivar-group) genom...   254   3e-66   
gb:AC084320_1733526 Oryza sativa chromosome 3 BAC OSJNBa0091J19 ...   205   1e-51   
pir|B85016|B85016 hypothetical protein AT4g01230 [imported] - Ar...   202   7e-51   Arabidopsis thaliana [mouse-ear cress]
gb:ATAC009400_1542964 Arabidopsis thaliana chromosome III BAC F1...   198   1e-49   
gb:AP004010_1836325 Oryza sativa (japonica cultivar-group) genom...   192   8e-48   
pir|T47948|T47948 hypothetical protein F2A19.160 - Arabidopsis t...   191   3e-47   Arabidopsis thaliana [mouse-ear cress]
gb:AY087239_1572273 Arabidopsis thaliana clone 33183 mRNA, compl...   171   3e-41   
gb:AP000414_1820088 Arabidopsis thaliana genomic DNA, chromosome...   169   9e-41   
gb:AP002913_1823904 Oryza sativa (japonica cultivar-group) genom...   166   1e-39   
gb:BT005108_1638054 Arabidopsis thaliana clone U50321 unknown pr...   138   2e-31   
gb:BT010716_1640662 Arabidopsis thaliana At2g15280 mRNA, complet...   137   3e-31   
gb:OSJN00032_1693603 Oryza sativa genomic DNA, chromosome 4, BAC...   130   4e-29   
pir|T47571|T47571 hypothetical protein F24B22.80 - Arabidopsis t...   130   5e-29   Arabidopsis thaliana [mouse-ear cress]
pir|A84527|A84527 hypothetical protein At2g15280 [imported] - Ar...   127   5e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AP004072_1837296 Oryza sativa (japonica cultivar-group) genom...   125   1e-27   
gb:AP003450_1829608 Oryza sativa (japonica cultivar-group) genom...   124   3e-27   
gb:AB025624_1516476 Arabidopsis thaliana genomic DNA, chromosome...   120   6e-26   
gb:AY087614_1572644 Arabidopsis thaliana clone 37065 mRNA, compl...   118   2e-25   
gb:AF004806_1760738 Glycine max 24 kDa seed maturation protein m...   113   8e-24   
gb:OSJN00230_1697086 Oryza sativa genomic DNA, chromosome 4, BAC...   100   9e-20   
pir|G96705|G96705 unknown protein, 71680-70944 [imported] - Arab...    97   8e-19   Arabidopsis thaliana [mouse-ear cress]
pir|T01153|T01153 probable seed maturation protein [imported] - ...    84   4e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AY316184_2526636 Xenopus laevis RTN4.2-C (RTN4) mRNA, complet...    79   2e-13   
gb:BX088722_2567046 Zebrafish DNA sequence from clone CH211-253P...    78   3e-13   
gb:AY316190_2526642 Xenopus laevis RTN4.2-A1 (RTN4) mRNA, comple...    78   4e-13   
gb:AY316189_2526641 Xenopus laevis RTN4.2-A2 (RTN4) mRNA, comple...    78   4e-13   
gb:AY316188_2526640 Xenopus laevis RTN4.2-A3 (RTN4) mRNA, comple...    78   4e-13   
gb:AY316187_2526639 Xenopus laevis RTN4.2-B1 (RTN4) mRNA, comple...    78   4e-13   
gb:AY316186_2526638 Xenopus laevis RTN4.2-B2 (RTN4) mRNA, comple...    78   4e-13   
gb:AY316185_2526637 Xenopus laevis RTN4.2-B3 (RTN4) mRNA, comple...    78   4e-13   
gb:AY316183_2526635 Xenopus laevis RTN4.2-N (RTN4) mRNA, complet...    78   4e-13   
gb:AY750848_1961663 Homo sapiens RTN3-A1 (RTN3) mRNA, complete cds.    77   8e-13   
gb:AY427821_1950251 Homo sapiens reticulon 3-A (RTN3) mRNA, comp...    77   8e-13   
gb:CQ754324_1451567 Sequence 62 from Patent WO2004001069.              77   8e-13   
gb:CQ754320_1451565 Sequence 58 from Patent WO2004001069.              77   8e-13   
gb:CQ754318_1451564 Sequence 56 from Patent WO2004001069.              77   8e-13   
gb:CQ754316_1451563 Sequence 54 from Patent WO2004001069.              77   8e-13   
gb:CQ754314_1451562 Sequence 52 from Patent WO2004001069.              77   8e-13   
gb:CQ754312_1451561 Sequence 50 from Patent WO2004001069.              77   8e-13   
gb:CR858619_1182786 Pongo pygmaeus mRNA; cDNA DKFZp459J0533 (fro...    77   8e-13   
sp|O95197|RTN3_HUMAN|RTN3_HUMAN Reticulon protein 3 (Neuroendocrine-specifi...    77   8e-13   Homo sapiens [man]
gb:BC059623_2552597 Danio rerio reticulon 1, mRNA (cDNA clone MG...    76   1e-12   
gb:BC030455_2096814 Mus musculus reticulon 1, mRNA (cDNA clone M...    75   3e-12   
gb:AB074899_2047567 Mus musculus Rtn-1A mRNA for reticulon 1A, c...    75   3e-12   
sp|Q64548|RTN1_RAT|RTN1_RAT Reticulon 1 (Neuroendocrine-specific protein)...    75   3e-12   Rattus norvegicus [brown rat]
gb:BC084044_2563451 Xenopus laevis hypothetical LOC494980, mRNA ...    74   4e-12   
gb:AY750849_2088396 Mus musculus RTN3-A1 (Rtn3) mRNA, complete c...    74   4e-12   
gb:AY507127_2085670 Mus musculus reticulon 3 B isoform (Rtn3) mR...    74   4e-12   
gb:AY507126_2085669 Mus musculus reticulon 3 A1 isoform (Rtn3) m...    74   4e-12   
gb:AY427822_2084868 Mus musculus RTN3-A mRNA, complete cds.            74   4e-12   
gb:AK075883_1171077 Mus musculus adult male tongue cDNA, RIKEN f...    74   4e-12   
gb:AK032109_1162752 Mus musculus adult male medulla oblongata cD...    74   4e-12   
sp|Q9ES97|RTN3_MOUSE|RTN3_MOUSE Reticulon protein 3.>gb:AK036892_1164670 Mu...    74   4e-12   Mus musculus [mouse]
gb:AY164724_2516213 Gallus gallus RTN1-A (RTN1) mRNA, complete c...    74   7e-12   
gb:RNU17603_2136948 Rattus norvegicus rS-Rex-s mRNA, complete cds.     74   7e-12   
gb:HUMNSPB_2035203 Homo sapiens neuroendocrine-specific protein ...    74   7e-12   
gb:AY665269_1958574 Pan troglodytes reticulon 1 mRNA, complete cds.    74   7e-12   
pir|A60021|A60021 tropomyosin-related protein, neuronal - rat>gb...    74   7e-12   Rattus norvegicus [brown rat]
sp|Q16799|RTN1_HUMAN|RTN1_HUMAN Reticulon 1 (Neuroendocrine-specific protei...    74   7e-12   Homo sapiens [man]
gb:AY316192_2526644 Xenopus laevis RTN4.1-C (RTN4) mRNA, complet...    72   2e-11   
gb:BC062068_2104842 Rattus norvegicus reticulon 3, transcript va...    72   2e-11   
gb:AY496443_2085620 Rattus norvegicus RTN3-A mRNA, complete cds.       72   2e-11   
gb:AF442357_2065871 Rattus norvegicus reticulon 3 protein isofor...    72   2e-11   
gb:CR457030_1993237 Homo sapiens full open reading frame cDNA cl...    72   2e-11   
pir|I60904|I60904 neuroendocrine-specific protein C - human>gb:B...    72   2e-11   Homo sapiens [man]
gb:AY316194_2526646 Xenopus laevis RTN4.1-B1 (RTN4) mRNA, comple...    72   2e-11   
gb:AL732544_2504429 Zebrafish DNA sequence from clone BUSM1-6I1 ...    72   2e-11   
gb:AY198409_2518506 Xenopus laevis Nogo-B (Nogo) mRNA, complete ...    72   3e-11   
gb:AY316197_2526649 Xenopus laevis RTN4.1-A1 (RTN4) mRNA, comple...    71   3e-11   
gb:AY316196_2526648 Xenopus laevis RTN4.1-A2 (RTN4) mRNA, comple...    71   3e-11   
gb:AY316195_2526647 Xenopus laevis RTN4.1-A3 (RTN4) mRNA, comple...    71   3e-11   
gb:AY316193_2526645 Xenopus laevis RTN4.1-B2 (RTN4) mRNA, comple...    71   3e-11   
gb:AY198408_2518505 Xenopus laevis Nogo-A (Nogo) mRNA, complete ...    71   3e-11   
gb:AY198407_2518504 Xenopus laevis Nogo-C (Nogo) mRNA, complete ...    71   3e-11   
gb:AY164723_2516212 Gallus gallus RTN1-C (RTN1) mRNA, complete c...    71   4e-11   
gb:BC080089_2561521 Xenopus laevis MGC84232 protein, mRNA (cDNA ...    70   6e-11   
gb:BC073245_2557097 Xenopus laevis MGC80590 protein, mRNA (cDNA ...    69   1e-10   
gb:AY182251_2517260 Xenopus laevis reticulon 1-C.1 mRNA, complet...    69   1e-10   
gb:AY164737_2516214 Gallus gallus RTN4-C (RTN4) mRNA, complete cds.    69   1e-10   
gb:AY114153_2076262 Mus musculus nogo-B mRNA, complete cds.            69   2e-10   
gb:AY495964_2535079 Xenopus laevis RTN3 (RTN3) mRNA, complete cds.     69   2e-10   
sp|Q99P72|RTN4_MOUSE|RTN4_MOUSE Reticulon 4 (Neurite outgrowth inhibitor) (...    69   2e-10   Mus musculus [mouse]
gb:AY114152_2076261 Mus musculus nogo-A mRNA, complete cds.            68   3e-10   
gb:AL929371_2073162 Mouse DNA sequence from clone RP23-176O5 on ...    68   3e-10   
gb:AL929371_2073161 Mouse DNA sequence from clone RP23-176O5 on ...    68   3e-10   
gb:AF051335_2052494 Rattus norvegicus GLUT4 vesicle 20kDa protei...    68   3e-10   
gb:AF077050_1149734 Homo sapiens neuroendocrine-specific protein...    68   3e-10   
gb:AY164740_2077402 Rattus norvegicus RTN4-B1 (Rtn4) mRNA, compl...    68   4e-10   
gb:AF132045_2055795 Rattus norvegicus foocen-m2 mRNA, alternate ...    68   4e-10   
gb:BC071848_1988822 Homo sapiens reticulon 4, mRNA (cDNA clone I...    68   4e-10   
gb:AY102278_1936455 Homo sapiens RTN4 isoform B2 (RTN4) mRNA, co...    68   4e-10   
gb:AB040463_1866784 Homo sapiens mRNA for RTN-xS, complete cds.>...    68   4e-10   
gb:AB015639_1864742 Homo sapiens ASY mRNA, complete cds.               68   4e-10   
gb:CQ783030_1452267 Sequence 3170 from Patent EP1396543.               68   4e-10   
gb:BC032192_2097342 Mus musculus reticulon 4, mRNA (cDNA clone M...    67   5e-10   
gb:AL929371_2073163 Mouse DNA sequence from clone RP23-176O5 on ...    67   5e-10   
gb:AL929371_2073160 Mouse DNA sequence from clone RP23-176O5 on ...    67   5e-10   
gb:AB073672_2047500 Mus musculus mRNA for Nogo-A, partial cds.         67   5e-10   
gb:CR861110_1185126 Pongo pygmaeus mRNA; cDNA DKFZp459C0314 (fro...    67   5e-10   
gb:HSA251383_2001638 Homo sapiens mRNA for Nogo-A protein (Nogo ...    67   6e-10   
gb:AY102285_1936460 Homo sapiens RTN4 (RTN4) gene, complete sequ...    67   6e-10   
gb:AF333336_1897145 Homo sapiens testis specific reticulon 5 pro...    67   6e-10   
gb:AF320999_1896622 Homo sapiens Nogo-A protein short form mRNA,...    67   6e-10   
gb:AF063601_1880224 Homo sapiens brain my043 protein mRNA, compl...    67   6e-10   
gb:AB020693_1865291 Homo sapiens mRNA for KIAA0886 protein, part...    67   6e-10   
sp|Q9JK11|RTN4_RAT|RTN4_RAT Reticulon 4 (Neurite outgrowth inhibitor) (No...    67   6e-10   Rattus norvegicus [brown rat]
sp|Q9NQC3|RTN4_HUMAN|RTN4_HUMAN Reticulon 4 (Neurite outgrowth inhibitor) (...    67   6e-10   Homo sapiens [man]
gb:AY843529_2546910 Gallus gallus NOGO isoform A2 (NOGO) mRNA, c...    67   8e-10   
gb:AY494005_2534835 Gallus gallus neurite outgrowth inhibitor NO...    67   8e-10   
gb:AY484582_2534028 Xenopus laevis reticulon 1-A (RTN1-A) mRNA, ...    67   8e-10   
gb:BC084108_2563514 Xenopus laevis cDNA clone MGC:84121 IMAGE:69...    65   2e-09   
gb:AF498369_2498171 Xenopus laevis reticulon 1-C.2 (Rtn1-C.2) mR...    64   5e-09   
gb:AF132046_2055796 Rattus norvegicus foocen-m1 mRNA, alternate ...    63   9e-09   
gb:BC071446_2556186 Danio rerio reticulon 1, mRNA (cDNA clone MG...    63   1e-08   
gb:AF038537_2051871 Mus musculus NSP-like 1 (Nspl1) gene, altern...    62   2e-08   
gb:BC081614_2562408 Danio rerio zgc:92163, mRNA (cDNA clone MGC:...    59   2e-07   
sp|O70622|RTN2_MOUSE|RTN2_MOUSE Reticulon protein 2 (Neuroendocrine-specifi...    59   2e-07   Mus musculus [mouse]
gb:AY279211_2081554 Rattus norvegicus reticulon 2 mRNA, complete...    58   3e-07   
pir|C84422|C84422 hypothetical protein At2g01240 [imported] - Ar...    58   3e-07   Arabidopsis thaliana [mouse-ear cress]
pir|T26213|T26213 hypothetical protein W06A7.3b - Caenorhabditis...    57   7e-07   Caenorhabditis elegans [roundworm]
gb:AB049853_1867778 Macaca fascicularis brain cDNA, clone:QnpA-1...    57   9e-07   
gb:AF125103_1150109 Homo sapiens neuroendocrine specific protein...    57   9e-07   
gb:AE014134_1127583 Drosophila melanogaster chromosome 2L, compl...    56   1e-06   
gb:AE014134_1127578 Drosophila melanogaster chromosome 2L, compl...    56   1e-06   
gb:BC073874_1989151 Homo sapiens reticulon 2, transcript variant...    55   2e-06   
gb:AF004224_1875851 Homo sapiens RTN2-C (RTN2) mRNA, complete cds.     55   2e-06   
gb:AP005735_1856857 Oryza sativa (japonica cultivar-group) genom...    55   2e-06   
gb:BT011111_1357718 Drosophila melanogaster LD43688 full insert ...    55   2e-06   
gb:AE014134_1127584 Drosophila melanogaster chromosome 2L, compl...    55   2e-06   
gb:AE014134_1127581 Drosophila melanogaster chromosome 2L, compl...    55   2e-06   
gb:AE014134_1127579 Drosophila melanogaster chromosome 2L, compl...    55   2e-06   
sp|O75298|RTN2_HUMAN|RTN2_HUMAN Reticulon protein 2 (Neuroendocrine-specifi...    55   2e-06   Homo sapiens [man]
gb:CEW06A7_1368957 Caenorhabditis elegans cosmid W06A7, complete...    55   3e-06   
gb:CEW06A7_1368955 Caenorhabditis elegans cosmid W06A7, complete...    54   4e-06   
pir|T26216|T26216 hypothetical protein W06A7.3c - Caenorhabditis...    54   4e-06   Caenorhabditis elegans [roundworm]
pir|T26215|T26215 hypothetical protein W06A7.3a - Caenorhabditis...    54   4e-06   Caenorhabditis elegans [roundworm]
gb:AY164754_2516216 Carassius auratus RTN4-M (RTN4) mRNA, comple...    54   6e-06   
gb:AK176177_1818165 Arabidopsis thaliana mRNA for 3-beta-hydroxy...    53   1e-05   
gb:AY120728_1579610 Arabidopsis thaliana 3-beta-hydroxysteroid d...    53   1e-05   
gb:AF038540_1878129 Homo sapiens brain NSP-like 1 (NSPL1) mRNA, ...    52   2e-05   
gb:AF004223_1875850 Homo sapiens RTN2-B (RTN2) mRNA, partial cds.      52   2e-05   
gb:AF123892_1242912 Leishmania infantum 22 kDa potentially aggra...    52   2e-05   
gb:AY495963_2535078 Xenopus laevis RTN2-C (RTN2-C) mRNA, complet...    50   8e-05   
gb:AY495962_2535077 Xenopus laevis RTN2-B (RTN2-B) mRNA, complet...    50   8e-05   
gb:AE016815_1746130 Ashbya gossypii (= Eremothecium gossypii) AT...    49   2e-04   
gb:AY164748_2516215 Carassius auratus RTN3w (RTN3) mRNA, partial...    46   0.001   
gb:CR380948_1649309 Candida glabrata strain CBS138 chromosome B ...    45   0.002   
gb:CR382134_1667175 Debaryomyces hansenii chromosome B of strain...    45   0.003   
gb:AC133932_1741632 Oryza sativa chromosome 3 BAC OSJNBb0074M06 ...    44   0.004   
gb:AY880373_1180415 Gekko japonicus GekBS142P mRNA, complete cds.      44   0.008   
gb:BT005457_1638397 Arabidopsis thaliana clone U51255 unknown pr...    43   0.010   
gb:AY085180_1570259 Arabidopsis thaliana clone 13607 mRNA, compl...    43   0.010   
gb:AC002335_1530408 Arabidopsis thaliana chromosome 2 clone T1O2...    43   0.010   
pir|S59439|S59439 probable membrane protein YDR233c - yeast (Sac...    35   2.1     Saccharomyces cerevisiae [brewer's yeast]
gb:AY119228_1300950 Drosophila melanogaster SD17344 full insert ...    35   2.7     
gb:AE014134_1128320 Drosophila melanogaster chromosome 2L, compl...    35   2.7     
pir|T01721|T01721 hypothetical protein A_IG002N01.8 - Arabidopsi...    35   2.7     Arabidopsis thaliana [mouse-ear cress]
pir|T28928|T28928 hypothetical protein C48B6.9 - Caenorhabditis ...    35   3.5     Caenorhabditis elegans [roundworm]
gb:AY278317_1315327 Pachypsylla venusta mitochondrion, complete ...    34   6.0     
gb:AE017154_392626 Haemophilus ducreyi strain 35000HP section 4 ...    34   6.0     


>gb:AP003218_1825425 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, BAC clone:OSJNBb0021A09.
          Length = 253

 Score =  323 bits (827), Expect = 5e-87
 Identities = 162/257 (63%), Positives = 195/257 (75%), Gaps = 4/257 (1%)
 Frame = -3

Query: 1035 MADHAGDHDSLAETVMEKISDKLQGHXXXXXXXXXX----XXDKPSADAVKAKIYRLFGR 868
            MA+H  +     ++VMEK+S+KL G                    +A A+KAKIYRLFGR
Sbjct: 1    MAEHKEE-----QSVMEKLSEKLHGDSSSSSSDSDDDKKGSSSSSAAAAMKAKIYRLFGR 55

Query: 867  ERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAI 688
            ER VH VLGGGKPAD+ LWR+KK+SG V+  AT IW+LFE+MEYHLLTLVCH LIL+LA+
Sbjct: 56   ERPVHSVLGGGKPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAV 115

Query: 687  SFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLA 508
             FLWSNASTFI+KSPP IP V +P+D  +N+A +LR EINR  A LREI  G+D+KKFL 
Sbjct: 116  LFLWSNASTFIHKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGRDLKKFLI 175

Query: 507  VIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVL 328
            VIAGLW+LSV+G+S NFLTLFY++ V L+TVP+LYEKYED+VDAF EKAE E  K YA+ 
Sbjct: 176  VIAGLWILSVLGSSCNFLTLFYIVFVALYTVPVLYEKYEDKVDAFGEKAEIEFKKYYALF 235

Query: 327  NEKYLSKIPKGPLKDKK 277
             EK LSKIPKGPLKDKK
Sbjct: 236  EEKCLSKIPKGPLKDKK 252



>gb:AC109596_1738738 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OJ1593_C11, complete sequence.
          Length = 251

 Score =  320 bits (820), Expect = 3e-86
 Identities = 159/253 (62%), Positives = 198/253 (78%)
 Frame = -3

Query: 1035 MADHAGDHDSLAETVMEKISDKLQGHXXXXXXXXXXXXDKPSADAVKAKIYRLFGRERHV 856
            MA+H  + +SL E+VM+KISDKL G             ++ +AD +KAKIYRLFGRE+ V
Sbjct: 1    MAEHK-EEESLVESVMDKISDKLHGRGGSSSSSSDSDGER-TAD-LKAKIYRLFGREKPV 57

Query: 855  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW 676
            H VLGGGKPAD+FLWR+KK+S  V+  AT IW+LFE+M+YHLLTL+CH +IL LA+ FLW
Sbjct: 58   HSVLGGGKPADLFLWRNKKISVGVLAGATAIWLLFEVMDYHLLTLLCHCIILTLAMLFLW 117

Query: 675  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            SNASTFINKSPP IP V +P+D  +NVA +LR EINR  A LREI  G D+KKFL V+ G
Sbjct: 118  SNASTFINKSPPNIPEVKIPEDLAVNVARSLRFEINRGFATLREIGQGHDLKKFLIVVVG 177

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
            LWVLSV+G+  NFLTLFY++ ++L+TVP+LYEKYEDQ+DAF EKA  E+ K YA+ +EK 
Sbjct: 178  LWVLSVLGSCCNFLTLFYIVFMVLYTVPVLYEKYEDQIDAFGEKAMIELKKYYAIFDEKC 237

Query: 315  LSKIPKGPLKDKK 277
            LSKIPKGPLK+KK
Sbjct: 238  LSKIPKGPLKNKK 250



>pir|T13013|T13013 hypothetical protein F8L21.10 - Arabidopsis
           thaliana>gb:ATCHRIV31_1544887 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 31.>gb:ATF8L21_1551233
           Arabidopsis thaliana DNA chromosome 4, BAC clone F8L21
           (ESSA project).>gb:AY034901_1559686 Arabidopsis thaliana
           unknown protein (At4g11220) mRNA, complete
           cds.>gb:AY048273_1561734 Arabidopsis thaliana
           AT4g11220/F8L21_10 mRNA, complete
           cds.>gb:AY057606_1564019 Arabidopsis thaliana
           AT4g11220/F8L21_10 mRNA, complete
           cds.>gb:AY086294_1571347 Arabidopsis thaliana clone
           23536 mRNA, complete sequence.>gb:BT002368_1635971
           Arabidopsis thaliana clone U09869 unknown protein
           (At4g11220) mRNA, complete cds.
          Length = 271

 Score =  312 bits (800), Expect = 7e-84
 Identities = 151/246 (61%), Positives = 197/246 (80%), Gaps = 5/246 (2%)
 Frame = -3

Query: 999 ETVMEKISDKL--QGHXXXXXXXXXXXXDKPSADA---VKAKIYRLFGRERHVHKVLGGG 835
           E++MEK+S+K+  +G              K S+ +   +K+K+YRLFGRER VHKVLGGG
Sbjct: 24  ESLMEKLSEKIHHKGDSSSSSSSDDENEKKSSSSSPKSLKSKVYRLFGRERPVHKVLGGG 83

Query: 834 KPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFI 655
           KPADIF+W+DKK+SG V G AT  WVLFELMEYHLLTL+CH++I+ALA+ FLWSNA+ FI
Sbjct: 84  KPADIFMWKDKKMSGGVFGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMFI 143

Query: 654 NKSPPQIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVM 475
           +KSPP+IP V +P++ +L +AS LRIEINR ++ LREIASG+D+KKFL+ IAGLWVLS++
Sbjct: 144 HKSPPKIPEVHIPEEPLLQLASGLRIEINRGISSLREIASGRDIKKFLSAIAGLWVLSIL 203

Query: 474 GNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKG 295
           G  ++FLTL Y+ +VLL TVP+ Y+KYED+VD++ EKA AE+ KQYAVL+ K  SKIP+G
Sbjct: 204 GGCYSFLTLAYIALVLLFTVPLFYDKYEDKVDSYGEKAMAELKKQYAVLDAKVFSKIPRG 263

Query: 294 PLKDKK 277
           PLKDKK
Sbjct: 264 PLKDKK 269



>pir|T05595|T05595 hypothetical protein F9D16.100 - Arabidopsis
           thaliana>gb:ATCHRIV59_1546200 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 59.>gb:ATF9D16_1551287
           Arabidopsis thaliana DNA chromosome 4, BAC clone F9D16
           (ESSAII project).>gb:AY050321_1562100 Arabidopsis
           thaliana AT4g23630/F9D16_100 mRNA, complete
           cds.>gb:AY087881_1572908 Arabidopsis thaliana clone
           39185 mRNA, complete sequence.>gb:AY133635_1581458
           Arabidopsis thaliana AT4g23630/F9D16_100 mRNA, complete
           cds.
          Length = 275

 Score =  305 bits (780), Expect = 1e-81
 Identities = 150/250 (60%), Positives = 192/250 (76%), Gaps = 9/250 (3%)
 Frame = -3

Query: 999 ETVMEKISDKLQGHXXXXXXXXXXX-------XDKPSA--DAVKAKIYRLFGRERHVHKV 847
           E++M+KIS+K+                       KPS+   ++K+K+YRLFGRE+ VHKV
Sbjct: 24  ESLMDKISEKIHHGGDSSSSSSSSDDEDEKKKTKKPSSPSSSMKSKVYRLFGREQPVHKV 83

Query: 846 LGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNA 667
           LGGGKPADIF+W++KK+SG V+G AT  WV+FELMEYHLLTL+CH++I+ LA+ FLWSNA
Sbjct: 84  LGGGKPADIFMWKNKKMSGGVLGGATAAWVVFELMEYHLLTLLCHVMIVVLAVLFLWSNA 143

Query: 666 STFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAGLWV 487
           + FINKSPP+IP V +P++ +L +AS LRIEINR  + LREIASG+D+KKFL  IAGLWV
Sbjct: 144 TMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGRDLKKFLIAIAGLWV 203

Query: 486 LSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSK 307
           LS++G  FNFLTL Y+ +VLL TVP+ Y+KYED+VD   EKA  E+ KQYAVL+EK LSK
Sbjct: 204 LSILGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAMIELKKQYAVLDEKVLSK 263

Query: 306 IPKGPLKDKK 277
           IP GPLK+KK
Sbjct: 264 IPLGPLKNKK 273



>gb:AB005233_1509315 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MBK23.>gb:AY035169_1559936 Arabidopsis thaliana
           unknown protein (At5g41600) mRNA, complete
           cds.>gb:AY057638_1564051 Arabidopsis thaliana
           AT5g41600/MBK23_13 mRNA, complete
           cds.>gb:AY150449_1585014 Arabidopsis thaliana unknown
           protein (At5g41600) mRNA, complete cds.
          Length = 257

 Score =  303 bits (775), Expect = 5e-81
 Identities = 154/248 (62%), Positives = 183/248 (73%), Gaps = 7/248 (2%)
 Frame = -3

Query: 999 ETVMEKISDKLQGHXXXXXXXXXXXXDKP---SADAVKAKIYRLFGRERHVHKVLGGGKP 829
           E+++EKI +K+ GH             K    S+ + K+KIYRLFGRE+ VHKVLGGGKP
Sbjct: 9   ESILEKIVEKIHGHGDSSSLSDSDDDKKSTSSSSSSFKSKIYRLFGREKPVHKVLGGGKP 68

Query: 828 ADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINK 649
           ADIFLWR+KKVSG V+G  T  WVLFEL EYHLL  +CH  I ALA  FLWSNA TFI+K
Sbjct: 69  ADIFLWRNKKVSGGVLGAVTASWVLFELFEYHLLAFLCHFAIFALAALFLWSNACTFIHK 128

Query: 648 SPPQIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGN 469
           S P IP V +P+D +L + S LRIEINR L +LR IASGKDVKKF+ VIAGLWVLS++G+
Sbjct: 129 STPHIPEVHIPEDPILQLVSGLRIEINRGLTLLRNIASGKDVKKFILVIAGLWVLSIIGS 188

Query: 468 SFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKYL----SKIP 301
            +NFLTLFY   VLL T+P+LYEKYED+VDA+ EKA  EI KQYAVL+EK L    SKIP
Sbjct: 189 CYNFLTLFYTATVLLFTIPVLYEKYEDKVDAYGEKAMREIKKQYAVLDEKVLRKVISKIP 248

Query: 300 KGPLKDKK 277
           +G L  KK
Sbjct: 249 RGALNKKK 256



>gb:AP002900_1823718 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0443E07.>gb:AP002902_1823780 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0492F05.
          Length = 279

 Score =  301 bits (770), Expect = 2e-80
 Identities = 150/264 (56%), Positives = 188/264 (71%), Gaps = 23/264 (8%)
 Frame = -3

Query: 999 ETVMEKISDKLQ-GHXXXXXXXXXXXXDKPSADA----------------------VKAK 889
           ET+MEKI+DKL  G              +P   A                       KAK
Sbjct: 15  ETLMEKIADKLHIGGDGSSSDSDADERKQPKPSAPPAPAEVATESFVDSAAAAAAEAKAK 74

Query: 888 IYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHI 709
           ++RLFGRE  +HKVLGGGKPAD+FLWR++ +S  V+G AT IW+LFEL+ YHLLT VCH 
Sbjct: 75  VFRLFGREEPIHKVLGGGKPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHG 134

Query: 708 LILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVLREIASGK 529
           LI +L + FLWSNAS+FINKSPP+IP VI+P+D V+N+A + R EINR  A LR+IA G+
Sbjct: 135 LIFSLGLLFLWSNASSFINKSPPRIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGR 194

Query: 528 DVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEI 349
           D+KKFL VIAGLW+LSV+G+  NFLTL Y++ V+LHTVP+LYEKYEDQ+D++ EK   EI
Sbjct: 195 DIKKFLIVIAGLWLLSVLGSCCNFLTLVYIVFVVLHTVPILYEKYEDQIDSYGEKGWVEI 254

Query: 348 MKQYAVLNEKYLSKIPKGPLKDKK 277
            KQYAVL+ K LSK+P+GPLKDKK
Sbjct: 255 KKQYAVLDAKVLSKVPRGPLKDKK 278



>pir|E84899|E84899 hypothetical protein At2g46170 [imported] -
           Arabidopsis thaliana>gb:AC005397_1532659 Arabidopsis
           thaliana chromosome 2 clone T3F17 map CIC02E07, complete
           sequence.>gb:AY053421_1562934 Arabidopsis thaliana
           At2g46170/T3F17.18 mRNA, complete
           cds.>gb:AY074836_1567689 Arabidopsis thaliana
           At2g46170/T3F17.18 mRNA, complete cds.
          Length = 255

 Score =  300 bits (768), Expect = 3e-80
 Identities = 151/241 (62%), Positives = 184/241 (76%), Gaps = 1/241 (0%)
 Frame = -3

Query: 999 ETVMEKISDKLQGHXXXXXXXXXXXXDKP-SADAVKAKIYRLFGRERHVHKVLGGGKPAD 823
           E++MEKIS+K+  H             KP S  AVKAKIYR+FGRE+ VHKVLGGGKPAD
Sbjct: 13  ESLMEKISEKIHHHDSSSSSESEYE--KPDSPSAVKAKIYRMFGREKPVHKVLGGGKPAD 70

Query: 822 IFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSP 643
           +FLWRDKK+SGAV+G AT IWVLFEL+EYHLL+L+CHI ILAL   FLWSNA T INK+ 
Sbjct: 71  VFLWRDKKLSGAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTLINKTS 130

Query: 642 PQIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSF 463
           PQIP + +P++  L VAS+LR E+N+   +LR IA G+D+KKFL V+ GLW++SV+GN F
Sbjct: 131 PQIPEIHVPEEAFLVVASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISVVGNWF 190

Query: 462 NFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKD 283
           NFLTL Y+  V+LHTVPMLYEK+ED+VD  AEKA  E+ KQY V +EK LSKIP   LK 
Sbjct: 191 NFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFDEKVLSKIPIASLKA 250

Query: 282 K 280
           K
Sbjct: 251 K 251



>gb:AE005173_894068 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC007764_1536177 Genomic sequence
           for Arabidopsis thaliana BAC F22C12 from chromosome I,
           complete sequence.>gb:AY064065_1566003 Arabidopsis
           thaliana unknown protein (At1g64090) mRNA, complete
           cds.>gb:AY117343_1579384 Arabidopsis thaliana unknown
           protein (At1g64090) mRNA, complete cds.
          Length = 255

 Score =  291 bits (744), Expect = 2e-77
 Identities = 151/239 (63%), Positives = 182/239 (76%), Gaps = 4/239 (1%)
 Frame = -3

Query: 999 ETVMEKISDKLQGHXXXXXXXXXXXXDKPSADAVKAKIYRLFGRERHVHKVLGGGKPADI 820
           E++MEKIS+K+ GH            DK SA ++K KIYRLFGRE+ +HK+ GGGKPADI
Sbjct: 9   ESIMEKISEKIHGHDDSSSSSSDSDDDKNSA-SLKTKIYRLFGREQPLHKLFGGGKPADI 67

Query: 819 FLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPP 640
           FLWR+KKVSG V+G AT  W+LFEL+EY+LLTL  HI ILALA+ FLWS+ASTFI+KSP 
Sbjct: 68  FLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWSSASTFIHKSPL 127

Query: 639 QIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFN 460
            IP V +P+D VL +AS LRIEINR   VLR+IASG+D+KKFL VIAGLWVLS +G+S N
Sbjct: 128 HIPEVHIPEDVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSKVGSSCN 187

Query: 459 FLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLN----EKYLSKIPKG 295
           FLTL Y+  VLL T+P+LYEKYED+VD F EKA  EI KQY   +     K +SKIPKG
Sbjct: 188 FLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKAMREIKKQYVEFDVKVLSKVMSKIPKG 246



>gb:BT014988_1641958 Arabidopsis thaliana At3g61560 gene, complete
           cds.>gb:BT020345_1642740 Arabidopsis thaliana At3g61560
           gene, complete cds.
          Length = 253

 Score =  283 bits (723), Expect = 6e-75
 Identities = 142/241 (58%), Positives = 178/241 (73%), Gaps = 1/241 (0%)
 Frame = -3

Query: 999 ETVMEKISDKLQGHXXXXXXXXXXXXDKP-SADAVKAKIYRLFGRERHVHKVLGGGKPAD 823
           E++MEKI+DK+  H             KP S  A+KAKIYRLFGRE+ VHKVLGGG PAD
Sbjct: 13  ESLMEKIADKIHDHDSSSSSDSEHE--KPESPSALKAKIYRLFGREKPVHKVLGGGLPAD 70

Query: 822 IFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSP 643
           +FLWRDKK+S +V+G AT IWVLFEL+EYH L+LVCHILI ALA  FL SNA  F+NK+P
Sbjct: 71  VFLWRDKKLSASVLGVATAIWVLFELVEYHFLSLVCHILIFALAALFLLSNAHAFMNKTP 130

Query: 642 PQIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSF 463
           P+IP + + ++  L + SALR E+N+   +LR IA G+D+KKFL V+ GLW++SV+GN F
Sbjct: 131 PKIPEIHIKEEHFLMIVSALRNELNQAFVILRSIALGRDLKKFLMVVFGLWIISVVGNWF 190

Query: 462 NFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLKD 283
           NFLTL Y+  V+LHTVPMLYEK+ED+VD  AEK   E+ K Y V +EK LSK+P   LK 
Sbjct: 191 NFLTLVYICFVVLHTVPMLYEKHEDKVDPVAEKTLKELKKHYMVFDEKVLSKLPVASLKA 250

Query: 282 K 280
           K
Sbjct: 251 K 251



>gb:AP003527_1830478 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0564B04.
          Length = 265

 Score =  259 bits (662), Expect = 7e-68
 Identities = 124/211 (58%), Positives = 162/211 (76%)
 Frame = -3

Query: 909 ADAVKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHL 730
           A AV+++ +RL G +  VHK LGGGK AD+ LW+DKK S  V+G AT IW+LFE+++YHL
Sbjct: 54  APAVRSRGFRLLGEDTSVHKALGGGKTADVLLWKDKKTSAVVIGGATVIWILFEVLDYHL 113

Query: 729 LTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVL 550
           LTL+ H++I ALAI FLWS A+TFI KSPP IP V +P+D  +NV+ ALR +INR L + 
Sbjct: 114 LTLLSHVMIGALAILFLWSKATTFIKKSPPDIPVVQIPEDVAVNVSRALRSDINRALHLF 173

Query: 549 REIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFA 370
           REIA G D+KKFL VI  LWVLS +G+  +FLTL Y+ V++LHTVP+LY+KY+D+VD FA
Sbjct: 174 REIALGHDLKKFLGVIVALWVLSEVGSCCDFLTLIYVAVLMLHTVPILYDKYQDKVDHFA 233

Query: 369 EKAEAEIMKQYAVLNEKYLSKIPKGPLKDKK 277
            +A +E  K Y VL+ K LSKIP+GP+K KK
Sbjct: 234 GRAHSEACKHYEVLDAKVLSKIPRGPVKPKK 264



>gb:AP004683_1843309 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0006C08.
          Length = 230

 Score =  254 bits (648), Expect = 3e-66
 Identities = 120/209 (57%), Positives = 160/209 (76%)
 Frame = -3

Query: 903 AVKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLT 724
           A + + +RL G ++ VH+ LGGGK AD+ LW+DKK+S AV+G AT +WVLFE+++YH LT
Sbjct: 20  AARPRGFRLLGGDKSVHQALGGGKAADVLLWKDKKISAAVIGGATVLWVLFEVVDYHFLT 79

Query: 723 LVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVLRE 544
           L+ H+LI  LAI FLWS A+ FI KSPP IP V + +D  +NVA ALR +IN+ L +LRE
Sbjct: 80  LISHVLIGVLAILFLWSKATIFIKKSPPNIPEVKISEDLAVNVALALRTDINQALHLLRE 139

Query: 543 IASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEK 364
           I+ G D+ KFL VI  LW+LS +G+  +FLTLFY+ V++LHTVP+LY KY+D+VD FA K
Sbjct: 140 ISLGHDLMKFLGVIVALWILSEIGSLCDFLTLFYVAVLMLHTVPILYHKYQDKVDHFAGK 199

Query: 363 AEAEIMKQYAVLNEKYLSKIPKGPLKDKK 277
           A  E+ +QY+VL+ K LSKIP+GP KDKK
Sbjct: 200 AHVELSRQYSVLDAKVLSKIPRGPAKDKK 228



>gb:AC084320_1733526 Oryza sativa chromosome 3 BAC OSJNBa0091J19
            genomic sequence, complete sequence.
          Length = 247

 Score =  205 bits (522), Expect = 1e-51
 Identities = 103/253 (40%), Positives = 160/253 (63%)
 Frame = -3

Query: 1035 MADHAGDHDSLAETVMEKISDKLQGHXXXXXXXXXXXXDKPSADAVKAKIYRLFGRERHV 856
            M +H+   +S  E +M  I D +  +               ++D +K K   LFGR++ +
Sbjct: 1    MLEHS---ESATEKIMSSIMDTIAENLPKQKSGKFDVGA--ASDKMKEK---LFGRQKTI 52

Query: 855  HKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLW 676
            H+VLGGGKPAD+ LWR+KK+S +V+  AT IWV FE ++YH LT+V   L+L + + F+W
Sbjct: 53   HRVLGGGKPADVLLWRNKKISSSVLALATAIWVFFEWLDYHFLTIVSFALVLGMVVQFVW 112

Query: 675  SNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            SN S+ ++ SP ++P V LP++  +N+A A+  ++N+ L+ L++++  +++K F+  I G
Sbjct: 113  SNFSSALSGSPSKVPRVELPEELFVNIAVAVGTQVNKFLSFLQDVSCERNLKHFVLAIVG 172

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
            LW  +V+G   NFLT+ Y+  V  HT+P+LYEKYEDQVD F       +  QY  L++  
Sbjct: 173  LWAAAVIGGWCNFLTVIYIGFVSAHTLPVLYEKYEDQVDDFLYNILGLLRDQYQKLDQGV 232

Query: 315  LSKIPKGPLKDKK 277
            LSKIPKG +K KK
Sbjct: 233  LSKIPKGNMKFKK 245



>pir|B85016|B85016 hypothetical protein AT4g01230 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV3_1544809 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No. 3.
          Length = 242

 Score =  202 bits (515), Expect = 7e-51
 Identities = 102/200 (51%), Positives = 135/200 (67%)
 Frame = -3

Query: 900 VKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTL 721
           + A IYR+FGRER +H VLGG   AD+ LWRDKKV+  ++   T IW+LF      LLT 
Sbjct: 47  INAPIYRMFGRERPIHMVLGGA--ADVLLWRDKKVTLGLLSAVTVIWLLFGFGGRRLLTS 104

Query: 720 VCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVLREI 541
           +C   IL L +SFLWSNA   +NKSP  +  + +P+  +L  ASA+  E+N   A LR I
Sbjct: 105 LCRGSILFLLLSFLWSNA---LNKSPENMMDIYIPEKPLLQAASAMTFELNCAFATLRSI 161

Query: 540 ASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKA 361
           A  +D+K F+  + GLW++SV+GN F+FL+L Y+  VL+HTVPMLYEKYED++D  AEKA
Sbjct: 162 ALERDIKNFVMAVIGLWLVSVIGNWFSFLSLLYICFVLIHTVPMLYEKYEDEIDPIAEKA 221

Query: 360 EAEIMKQYAVLNEKYLSKIP 301
             E+ K Y V   K+LSKIP
Sbjct: 222 VIEMKKHYQVFEAKFLSKIP 241



>gb:ATAC009400_1542964 Arabidopsis thaliana chromosome III BAC
           F14P13 genomic sequence, complete
           sequence.>gb:AY045830_1561343 Arabidopsis thaliana
           unknown protein (At3g10260) mRNA, complete
           cds.>gb:AY085435_1570504 Arabidopsis thaliana clone
           15153 mRNA, complete sequence.>gb:AY091368_1574571
           Arabidopsis thaliana unknown protein (At3g10260) mRNA,
           complete cds.
          Length = 247

 Score =  198 bits (504), Expect = 1e-49
 Identities = 93/210 (44%), Positives = 142/210 (67%)
 Frame = -3

Query: 906 DAVKAKIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLL 727
           D+V ++  RLF R++ +H VLGGGK AD+ LWR+KK+S +V+  AT IWVLFE + +H L
Sbjct: 36  DSVSSRFNRLFDRQKPIHHVLGGGKSADVLLWRNKKISASVLMGATAIWVLFEWINFHFL 95

Query: 726 TLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVLR 547
           +LVC+ L+L +   F+WSNAS F+N+S  ++P ++LP+D    V  A+  E+NR L  L+
Sbjct: 96  SLVCYALLLGMIAQFVWSNASGFLNRSQSRVPRLVLPKDFFAEVGVAVGKEVNRGLLFLQ 155

Query: 546 EIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAE 367
           ++A   ++K+FL  + GLWV +++G+  NFLT+ Y+  V  HT+P+LYE+YED+VD F +
Sbjct: 156 DLACKGNLKQFLMAVIGLWVAAMVGSCCNFLTVLYIGFVGAHTMPVLYERYEDEVDGFMD 215

Query: 366 KAEAEIMKQYAVLNEKYLSKIPKGPLKDKK 277
               +    Y  L+  +LS+IP G    KK
Sbjct: 216 SMIMKFHSHYKKLDTGFLSRIPSGKFGLKK 245



>gb:AP004010_1836325 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1351_C05.
          Length = 246

 Score =  192 bits (489), Expect = 8e-48
 Identities = 86/202 (42%), Positives = 134/202 (66%)
 Frame = -3

Query: 882 RLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI 703
           RLFG ++ VH VLGGGK AD+ LWR+KK+S +V+  AT +WV FE ++YH LT+ C +L+
Sbjct: 43  RLFGGQKSVHHVLGGGKSADVLLWRNKKISSSVLAVATAVWVFFEWLDYHFLTIACFVLV 102

Query: 702 LALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDV 523
           L + + F WS  +  +N SP ++P V LP +   N+ SA+  ++N+ L  L++++ G+D+
Sbjct: 103 LGMVVQFAWSTFAGMLNGSPSKVPRVELPDELFANIGSAIGTQVNKFLGTLQDVSCGRDL 162

Query: 522 KKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMK 343
           K FL VIAG +  +++G+  N LT+ Y+  V  HT+P+LYEK +++VD F       +  
Sbjct: 163 KNFLLVIAGFFAAAIIGSWCNLLTVIYIGFVCAHTLPVLYEKNQEKVDEFLYNTLGLLQN 222

Query: 342 QYAVLNEKYLSKIPKGPLKDKK 277
           QY  L++  L K+PKG +K KK
Sbjct: 223 QYQKLDKGVLGKVPKGIIKLKK 244



>pir|T47948|T47948 hypothetical protein F2A19.160 - Arabidopsis
           thaliana>gb:ATF2A19_1550431 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F2A19.
          Length = 264

 Score =  191 bits (484), Expect = 3e-47
 Identities = 114/256 (44%), Positives = 148/256 (57%), Gaps = 16/256 (6%)
 Frame = -3

Query: 999 ETVMEKISDKLQGHXXXXXXXXXXXXDKP-SADAVKAKIYRLFGRERHVHKVLGGGKPAD 823
           E++MEKI+DK+  H             KP S  A+KAKIYRLFGRE+ VHKVLGGG PAD
Sbjct: 13  ESLMEKIADKIHDHDSSSSSDSEHE--KPESPSALKAKIYRLFGREKPVHKVLGGGLPAD 70

Query: 822 IFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINK-- 649
           +FLWRDKK+S +V+G AT IWVLFEL+EYH L+LVCHILI ALA  FL SNA  F+NK  
Sbjct: 71  VFLWRDKKLSASVLGVATAIWVLFELVEYHFLSLVCHILIFALAALFLLSNAHAFMNKGT 130

Query: 648 --------SPPQIPSVILPQDTVL-----NVASALRIEINRTLAVLREIASGKDVKKFLA 508
                        P +   ++  L      ++  L      T +++  +        ++ 
Sbjct: 131 FPYDCFCTEKRAEPGLCYFKEHCLRKGLEEISHELIQSTYETFSIMGFVTR---TSIYIG 187

Query: 507 VIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVL 328
           +  G W +  +G     + L     V+LHTVPMLYEK+ED+VD  AEK   E+ K Y V 
Sbjct: 188 ISGGFWAVDNLGCG-KLVQLLDSCFVVLHTVPMLYEKHEDKVDPVAEKTLKELKKHYMVF 246

Query: 327 NEKYLSKIPKGPLKDK 280
           +EK LSK+P   LK K
Sbjct: 247 DEKVLSKLPVASLKAK 262



>gb:AY087239_1572273 Arabidopsis thaliana clone 33183 mRNA, complete
           sequence.
          Length = 225

 Score =  171 bits (432), Expect = 3e-41
 Identities = 77/205 (37%), Positives = 127/205 (61%)
 Frame = -3

Query: 891 KIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCH 712
           K  +LF R+R +H + GGGK ADI LWR+ K++  +V   + +W L E++EY+ +TL+CH
Sbjct: 19  KTTKLFTRQRSIHSIFGGGKVADILLWREPKIAATLVIGVSILWFLMEVVEYNFITLICH 78

Query: 711 ILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVLREIASG 532
             + ++   F+WS AS F+N   P IP V+L + +   +A +  +  N+ L  L ++A G
Sbjct: 79  ASMTSMLFFFIWSTASDFLNWERPIIPEVVLDESSFKQLARSFHVRFNQILTKLLDVACG 138

Query: 531 KDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAE 352
           +D   F      L+++S++G  FNF+ L ++  V++ T+P++YE YED VD  A K   +
Sbjct: 139 RDPPLFFLTTISLYIVSIIGTYFNFMNLLFIGFVIMQTLPVMYEMYEDDVDTAAGKLMRK 198

Query: 351 IMKQYAVLNEKYLSKIPKGPLKDKK 277
           + K Y  ++   LSKIP+G +K+KK
Sbjct: 199 MKKLYKKVDTNVLSKIPRGTVKNKK 223



>gb:AP000414_1820088 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MIE15.
          Length = 225

 Score =  169 bits (428), Expect = 9e-41
 Identities = 77/205 (37%), Positives = 126/205 (61%)
 Frame = -3

Query: 891 KIYRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCH 712
           K  +LF R+R +H + GGGK ADI LWR+ K++  +V   + +W L E++EY+ +TL+CH
Sbjct: 19  KTTKLFTRQRSIHSIFGGGKVADILLWREPKIAATLVIGVSILWFLMEVVEYNFITLICH 78

Query: 711 ILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVLREIASG 532
             + ++   F+WS AS F+N   P IP V+L + +   +A +  +  N+ L  L ++A G
Sbjct: 79  ASMTSMLFFFIWSTASDFLNWERPLIPEVVLDESSFKQLARSFHVRFNQILTKLLDVACG 138

Query: 531 KDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAE 352
           +D   F      L+++S++G  FNF+ L ++  V + T+P++YE YED VD  A K   +
Sbjct: 139 RDPPLFFLTTISLYIVSIIGTYFNFVNLLFIGFVSMQTLPVMYEMYEDDVDTAAGKLMRK 198

Query: 351 IMKQYAVLNEKYLSKIPKGPLKDKK 277
           + K Y  ++   LSKIP+G +K+KK
Sbjct: 199 MKKLYKKVDTNVLSKIPRGTVKNKK 223



>gb:AP002913_1823904 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0480E02.>gb:AP003250_1826301 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0443D08.
          Length = 213

 Score =  166 bits (419), Expect = 1e-39
 Identities = 78/196 (39%), Positives = 120/196 (61%)
 Frame = -3

Query: 882 RLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI 703
           +LFGRER +H  LGG K ADI LWR+++VS ++V  AT  W LFE+ EYH L+L C++ +
Sbjct: 12  KLFGRERPLHDALGGHKAADIILWRERRVSASIVAGATVAWYLFEVAEYHFLSLACYLAM 71

Query: 702 LALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDV 523
           L + + F+W+NAS F N   P+IP + + + T   V  AL   +   +  L +IA GKD+
Sbjct: 72  LGMLVVFIWANASAFFNLPAPRIPEIFVSERTTRQVILALHSRLTWFVHRLYDIACGKDI 131

Query: 522 KKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMK 343
           K F+  +  L++ SV+ + F+ LTL YL+V+   T+P++YE YE +VD     A  ++  
Sbjct: 132 KMFILTVFSLFIASVIASCFSSLTLLYLVVLGTMTLPVMYENYESEVDHLVSTAVHDLRS 191

Query: 342 QYAVLNEKYLSKIPKG 295
               ++     KIP+G
Sbjct: 192 HVGDIDSGVFKKIPRG 207



>gb:BT005108_1638054 Arabidopsis thaliana clone U50321 unknown
           protein (At3g10915) mRNA, complete
           cds.>gb:AK117619_1815644 Arabidopsis thaliana mRNA for
           unknown protein, complete cds, clone: RAFL17-27-G20.
          Length = 226

 Score =  138 bits (347), Expect = 2e-31
 Identities = 65/202 (32%), Positives = 115/202 (56%)
 Frame = -3

Query: 885 YRLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHIL 706
           YRL GR+  VH+ +GGGK AD+ LWR + +S  V+  +T  W++FE      L++   +L
Sbjct: 23  YRLLGRQITVHQFMGGGKAADLLLWRRRHLSLGVIIISTVAWLIFEFSGLPFLSVSSDVL 82

Query: 705 ILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKD 526
           ++ + ISF+ +  S F N+    +P ++L ++ V + A++ RI++N  L +  ++  G D
Sbjct: 83  LIVIMISFVHARVSAFRNRQLHSLPELVLSEEMVNSAAASFRIKLNHLLVMAHDVTVGND 142

Query: 525 VKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIM 346
            + F  V+  LW+LS +G+  +  TL Y+  +L  T+P LY KY+ +VD         + 
Sbjct: 143 FRLFFKVVICLWLLSAIGSYISLCTLLYIGTILSVTIPALYSKYQSKVDKCCGTIHRRLS 202

Query: 345 KQYAVLNEKYLSKIPKGPLKDK 280
             Y +++E  +S++     KDK
Sbjct: 203 HHYKIVDENVISRLSWSLSKDK 224



>gb:BT010716_1640662 Arabidopsis thaliana At2g15280 mRNA, complete
           cds.>gb:BT010986_1640932 Arabidopsis thaliana At2g15280
           mRNA, complete cds.
          Length = 201

 Score =  137 bits (346), Expect = 3e-31
 Identities = 72/199 (36%), Positives = 113/199 (56%), Gaps = 1/199 (0%)
 Frame = -3

Query: 867 ERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAI 688
           E  VH+ +  G  AD+ +W++++    ++G  T +W LFE   Y     V +  +L++ I
Sbjct: 2   EESVHQSIRFGSVADLIMWKNRRGGFLLLGSTTLLWFLFEKCGYSFFPFVVNTQLLSVVI 61

Query: 687 SFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLA 508
            FLW+ ++   N+  PQ+P++ + ++ V  VA A+R+ IN  LAV REI  G++ K+   
Sbjct: 62  LFLWAKSAILFNRPMPQLPNLEITEEFVFMVADAIRVWINTVLAVAREIYVGRNAKQLFR 121

Query: 507 VIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVL 328
           V   LW +S +GN  NFLT+ YL VVL   +P LYE+Y+D +D         I  QY  +
Sbjct: 122 VSVVLWTVSFVGNFLNFLTILYLGVVLSLLIPFLYERYQDLIDEKLSLTHRVIQTQYRKI 181

Query: 327 NEKYLSKIPKGPL-KDKKL 274
           +E+ L KI   P  K KK+
Sbjct: 182 DERLLQKIIAKPTNKIKKM 200



>gb:OSJN00032_1693603 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0043A12, complete sequence.
          Length = 199

 Score =  130 bits (328), Expect = 4e-29
 Identities = 68/162 (41%), Positives = 98/162 (60%)
 Frame = -3

Query: 864 RHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAIS 685
           R +H +LGGG  AD+ LWR + VS A V  AT +W LFE   Y   +++ + L+L +AI 
Sbjct: 7   RSLHALLGGGAVADLVLWRRRNVSAAAVAGATAVWFLFERAGYSFPSVMANALLLLVAIL 66

Query: 684 FLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAV 505
           F W+ +++ +N+  P +P + +    V   A    + IN+ LAV  +IA  +D   F+ V
Sbjct: 67  FFWAKSASLLNRPLPPLPKLEVSDVVVEKAADRALVWINKVLAVGHDIAIKRDRSVFIKV 126

Query: 504 IAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVD 379
           I  LWV+S +G  FNFLTL Y+ V+    VP LYEKY+DQVD
Sbjct: 127 ILILWVVSYIGMLFNFLTLIYIGVMFSLLVPPLYEKYQDQVD 168



>pir|T47571|T47571 hypothetical protein F24B22.80 - Arabidopsis
           thaliana>gb:ATF24B22_1549821 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F24B22.>gb:BT010698_1640644
           Arabidopsis thaliana At3g54120 mRNA, complete
           cds.>gb:BT010978_1640924 Arabidopsis thaliana At3g54120
           mRNA, complete cds.
          Length = 203

 Score =  130 bits (327), Expect = 5e-29
 Identities = 61/167 (36%), Positives = 102/167 (61%)
 Frame = -3

Query: 882 RLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI 703
           +LF R+R +H++LGGG  AD+ LWR K VS  +V      W++FE   Y + TL+  +L+
Sbjct: 7   KLFNRDRTIHEILGGGIVADVMLWRKKNVSVGIVTVTIASWMVFEAFAYTIFTLISSVLL 66

Query: 702 LALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDV 523
           L L+I FLWS +++ +N+  P +P   + +      +  LRI +N+ L V  +IA  +D 
Sbjct: 67  LLLSILFLWSKSASILNRPSPPLPEFQISEAMAEEASIWLRIHVNKLLQVSHDIAMARDS 126

Query: 522 KKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQV 382
           + +  V   L++LS++G+  +F TL +  V+++ TVP  YE+YED +
Sbjct: 127 ELYTKVAVSLFLLSLIGSLMDFQTLCHTSVLVVMTVPAFYERYEDYI 173



>pir|A84527|A84527 hypothetical protein At2g15280 [imported] -
           Arabidopsis thaliana>gb:AC007267_1535751 Arabidopsis
           thaliana chromosome 2 clone F27O10 map mi398, complete
           sequence.
          Length = 183

 Score =  127 bits (318), Expect = 5e-28
 Identities = 66/182 (36%), Positives = 104/182 (57%), Gaps = 1/182 (0%)
 Frame = -3

Query: 816 LWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQ 637
           +W++++    ++G  T +W LFE   Y     V +  +L++ I FLW+ ++   N+  PQ
Sbjct: 1   MWKNRRGGFLLLGSTTLLWFLFEKCGYSFFPFVVNTQLLSVVILFLWAKSAILFNRPMPQ 60

Query: 636 IPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNF 457
           +P++ + ++ V  VA A+R+ IN  LAV REI  G++ K+   V   LW +S +GN  NF
Sbjct: 61  LPNLEITEEFVFMVADAIRVWINTVLAVAREIYVGRNAKQLFRVSVVLWTVSFVGNFLNF 120

Query: 456 LTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPL-KDK 280
           LT+ YL VVL   +P LYE+Y+D +D         I  QY  ++E+ L KI   P  K K
Sbjct: 121 LTILYLGVVLSLLIPFLYERYQDLIDEKLSLTHRVIQTQYRKIDERLLQKIIAKPTNKIK 180

Query: 279 KL 274
           K+
Sbjct: 181 KM 182



>gb:AP004072_1837296 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0529H11.
          Length = 203

 Score =  125 bits (315), Expect = 1e-27
 Identities = 62/179 (34%), Positives = 106/179 (59%), Gaps = 1/179 (0%)
 Frame = -3

Query: 882 RLFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELME-YHLLTLVCHIL 706
           RL G +R +H +LGGG  AD+ LWR K+V+G  +      WVLF  +  Y LL+ V  +L
Sbjct: 9   RLLGAQRSLHGLLGGGAMADVVLWRRKEVAGWSLAAVAASWVLFYCLPGYTLLSFVSSVL 68

Query: 705 ILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKD 526
           ++ L + F+W+ A+  +N+ PP +P + + +D++   A+A+   +++ L     IA GKD
Sbjct: 69  MIVLVVLFVWAKAARLLNRPPPPVPLIKISEDSMSKAAAAVGNILHKALQGFENIAHGKD 128

Query: 525 VKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEI 349
              F  +++ L ++S++G   + +TL Y  +VL  T+P L +KYE+ +  F  +A A I
Sbjct: 129 SSLFYKMVSVLLLISIVGRVTDLITLVYACLVLALTIPALVDKYEENIAKFLNQASANI 187



>gb:AP003450_1829608 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0034C09.
          Length = 202

 Score =  124 bits (312), Expect = 3e-27
 Identities = 66/211 (31%), Positives = 115/211 (54%), Gaps = 12/211 (5%)
 Frame = -3

Query: 876 FGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILA 697
           F   + +HK+LGGG+                             +EY+++ L+C I ILA
Sbjct: 19  FHGHKSIHKLLGGGQ-----------------------------VEYNIIPLLCQIAILA 49

Query: 696 LAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKK 517
           + + F+WSNA+  ++++PP+IP +I+ +     +A  +  ++  T++VL +IA GKD+K+
Sbjct: 50  MLVIFIWSNAAPLLDRAPPRIPEIIISEHAFREMALTVHYKLTYTVSVLYDIACGKDLKR 109

Query: 516 FL------------AVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAF 373
           FL             V+  L VLS +G+S +  +L Y+  +  HT+P+LY++Y+ +VD  
Sbjct: 110 FLLFWTNNQIVYDIKVVGSLLVLSAIGSSCSLTSLLYIGFLCAHTLPVLYQRYKTEVDHL 169

Query: 372 AEKAEAEIMKQYAVLNEKYLSKIPKGPLKDK 280
             K   +I K Y  ++   L+KIP+GP+K K
Sbjct: 170 VAKGSDDIKKFYKKVDSNLLNKIPRGPVKTK 200



>gb:AB025624_1516476 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MLD14.>gb:BT005221_1638161 Arabidopsis
           thaliana At3g19460 mRNA, complete
           cds.>gb:AK117258_1815302 Arabidopsis thaliana At3g19460
           mRNA for unknown protein, complete cds, clone:
           RAFL16-81-G21.
          Length = 200

 Score =  120 bits (300), Expect = 6e-26
 Identities = 58/160 (36%), Positives = 99/160 (61%)
 Frame = -3

Query: 858 VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL 679
           VH+ LG G  AD+ LWR++  +  ++  +T  W LFE   Y+LL+ V ++L+L +AI FL
Sbjct: 13  VHQSLGAGSVADLLLWRNRTGAVILLISSTGFWFLFERAGYNLLSFVSNVLLLLVAIFFL 72

Query: 678 WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIA 499
           W+ ++T +N+  P +P++ +P++     A  LR+ IN  L++  +I   ++  + L V  
Sbjct: 73  WAKSATVLNRPLPPVPNMEIPEEFANKAADDLRVWINYVLSIASDITIARNPIRLLQVSL 132

Query: 498 GLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVD 379
            LW +S +G   N LTL Y+ V+L  + P++YEKY+D +D
Sbjct: 133 VLWAISYVGTLINSLTLVYIGVLLSLSFPIVYEKYQDHID 172



>gb:AY087614_1572644 Arabidopsis thaliana clone 37065 mRNA, complete
           sequence.
          Length = 200

 Score =  118 bits (295), Expect = 2e-25
 Identities = 57/160 (35%), Positives = 98/160 (61%)
 Frame = -3

Query: 858 VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL 679
           VH+ LG G  AD+ LWR++  +  ++  +T  W LFE   Y+LL+ V ++L+L + I FL
Sbjct: 13  VHQSLGAGSVADLLLWRNRTGAVILLISSTGFWFLFERAGYNLLSFVSNVLLLLVPIFFL 72

Query: 678 WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIA 499
           W+ ++T +N+  P +P++ +P++     A  LR+ IN  L++  +I   ++  + L V  
Sbjct: 73  WAKSATVLNRPLPPVPNMEIPEEFANKAADDLRVWINYVLSIASDITIARNPIRLLQVSL 132

Query: 498 GLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVD 379
            LW +S +G   N LTL Y+ V+L  + P++YEKY+D +D
Sbjct: 133 VLWAISYVGTLINSLTLVYIGVLLSLSFPIVYEKYQDHID 172



>gb:AF004806_1760738 Glycine max 24 kDa seed maturation protein
           mRNA, complete cds.
          Length = 212

 Score =  113 bits (282), Expect = 8e-24
 Identities = 60/183 (32%), Positives = 102/183 (55%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKS 646
           D+ LWR KK++ +V+  AT  WVL E+ E++ LTL+  + IL LA  FL++N    + K 
Sbjct: 28  DVVLWRRKKINISVLVAATAAWVLMEVFEFNFLTLISWVAILGLASIFLYANMLRLLGKE 87

Query: 645 PPQIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNS 466
           PP +  + + + T   +A  +R  I   +  L  + + K+   F+  +AGL  LS +G+ 
Sbjct: 88  PPNLLGLEVSEKTTTRIAHTVRAWIEEGIRWLFLVGAEKEWPVFVGAVAGLLSLSYLGSC 147

Query: 465 FNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKYLSKIPKGPLK 286
            + LTL Y+  ++   VP+ Y K ED++  F E    +  + Y +++EK + KI    +K
Sbjct: 148 MDLLTLVYMGTLVGMAVPLTYVKNEDKIKRFVEWLREKHKRYYQIIDEKTIQKIKSRIVK 207

Query: 285 DKK 277
           +KK
Sbjct: 208 EKK 210



>gb:OSJN00230_1697086 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0016N04, complete sequence.
          Length = 210

 Score = 99.8 bits (247), Expect = 9e-20
 Identities = 57/195 (29%), Positives = 97/195 (49%), Gaps = 25/195 (12%)
 Frame = -3

Query: 816 LWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQ 637
           +WR   VS  ++    + W+LF    Y  L+L  ++L+L L + FLW+ A+  +N+  P 
Sbjct: 1   MWRRGDVSACLLAATVSGWLLFGSGGYTFLSLASNVLLLLLTVLFLWAKAARLLNRPEPP 60

Query: 636 IPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNF 457
           IP + + Q  V  VA+ L   +N   +V  +IA GKD   F  V   LW++S++G+  +F
Sbjct: 61  IPEMRISQQVVNEVAALLHSGMNTVFSVFHDIALGKDSVLFYQVFLSLWIISIIGSLTDF 120

Query: 456 LTLFYLI-------------------------VVLLHTVPMLYEKYEDQVDAFAEKAEAE 352
            TL Y I                         +V + T+P LY+KYE+ +D +   A   
Sbjct: 121 TTLCYTIPLVQWFGIGMIDRKHALFLCLMLTGIVAVLTIPALYQKYEECIDRYMRFAYLN 180

Query: 351 IMKQYAVLNEKYLSK 307
            ++ Y ++ E++ +K
Sbjct: 181 -LQMYEMVYERFSAK 194



>pir|G96705|G96705 unknown protein, 71680-70944 [imported] -
           Arabidopsis thaliana>gb:AE005173_894444 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC016447_1538145 Arabidopsis thaliana
           chromosome 1 BAC T22E19 genomic sequence, complete
           sequence.
          Length = 151

 Score = 96.7 bits (239), Expect = 8e-19
 Identities = 54/144 (37%), Positives = 81/144 (56%)
 Frame = -3

Query: 870 RERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA 691
           R R ++  LGGG+ ADI  W++KK SG ++G  T IW LFE++EY  +T +C IL+L + 
Sbjct: 18  RRRSLYHNLGGGRFADIMFWKNKKESGTILGVFTLIWFLFEVVEYPFITFLCQILLLFIF 77

Query: 690 ISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFL 511
           I         F+   PP I  + + +         L  +IN  +  L +I+SGKD +   
Sbjct: 78  I---------FLICKPPSINDLRISESN----WRFLFNKINWFIIKLYDISSGKDFRLLF 124

Query: 510 AVIAGLWVLSVMGNSFNFLTLFYL 439
             +  LW+LSV+GN F+ LTL Y+
Sbjct: 125 LAVVSLWILSVVGNYFSSLTLLYI 148



>pir|T01153|T01153 probable seed maturation protein [imported] -
           Arabidopsis thaliana>gb:AC003040_1531039 Arabidopsis
           thaliana chromosome 2 clone F26B6 map CIC06C07, complete
           sequence.>gb:AC004482_1531768 Arabidopsis thaliana
           chromosome 2 clone F27L4 map CIC06C07, complete
           sequence.
          Length = 206

 Score = 84.3 bits (207), Expect = 4e-15
 Identities = 43/171 (25%), Positives = 89/171 (52%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKS 646
           DI+LWR KK++ + +  +T+ W+L     +  +T+V  I I  +++ FLW +    ++K 
Sbjct: 18  DIYLWRRKKLAFSTLLVSTSTWILLSFYGFTTITIVSWIGIAVVSMIFLWGSLLRLLSKV 77

Query: 645 PPQIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNS 466
            P++  + + ++ V+    + R+ +   +  +  + +  +   F   + G W+LS +GN 
Sbjct: 78  EPELSGLEVSEEFVVETVRSCRMLMEEMVRWMFRVGAESEWFVFARTVLGFWILSRIGNL 137

Query: 465 FNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKYL 313
            +F T  ++ +V+  TVP L+E+Y DQ+       + +    Y   +EK L
Sbjct: 138 LDFHTCLFIGLVMGLTVPKLWEEYGDQIQKHLGSLKDKSKGAYNTTHEKIL 188



>gb:AY316184_2526636 Xenopus laevis RTN4.2-C (RTN4) mRNA, complete
           cds; alternatively spliced.
          Length = 199

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 54/188 (28%), Positives = 99/188 (52%), Gaps = 10/188 (5%)
 Frame = -3

Query: 834 KPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNAS 664
           K  D+  WRD K SG V  F  ++++L  L  + +++++ +I +  L++ ISF ++    
Sbjct: 11  KVVDLIYWRDIKRSGVV--FGASLFLLLSLSVFSIVSVLAYIALALLSVTISFRIYKGVL 68

Query: 663 TFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAV 505
             I KS    P       ++ LP+D V    +    ++NRT+A LR +   +D+   L  
Sbjct: 69  QAIQKSEEGHPFRSILESNLALPEDVVQKHCTVALNQVNRTVAELRRLFLVEDLVDSLKF 128

Query: 504 IAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLN 325
              +WV + +G  FN LTL  + ++ L ++P++YE+++ QVD +     A I K     +
Sbjct: 129 AVLMWVFTYIGALFNGLTLLIVALISLFSIPVIYERHQTQVDHYL----ALINKNLKNTS 184

Query: 324 EKYLSKIP 301
           +  L+K+P
Sbjct: 185 DLILAKVP 192



>gb:BX088722_2567046 Zebrafish DNA sequence from clone CH211-253P18
           in linkage group 20 Contains the gene for a novel
           protein similar to vertebrate protein phosphatase 1A
           (formerly 2C) magnesium-dependent alpha isoform (PPM1A),
           two novel genes, the rtn1 gene for reticulon 1 and the
           5' end of a novel apoptosis-stimulating protein of p53,
           complete sequence.
          Length = 212

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 49/179 (27%), Positives = 95/179 (53%), Gaps = 10/179 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA--ISF-LWSNASTFI 655
           ++  WRD K SG V  F + + +LF L ++ ++++V ++ + +L+  ISF ++ +    +
Sbjct: 27  ELLYWRDLKKSGLV--FGSLLLMLFSLTQFSVVSVVAYLALASLSATISFRVYKSVLQAV 84

Query: 654 NKSPPQIPSVI-------LPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            K+    P  +       L  D +   A  ++  IN TL  LR +   +D+   L     
Sbjct: 85  QKTDEGHPFKVYLDVEMSLSHDQMQKYAENVQYYINSTLKELRRLFLVQDLVDSLKFAVL 144

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
           +W+L+ +G  FN LTL  ++VV + ++P++YEKY+ Q+D + +    ++    A + EK
Sbjct: 145 MWLLTYVGALFNGLTLLIMVVVCMFSMPVVYEKYQAQIDQYVDLIRTQVNSVVAKIQEK 203



>gb:AY316190_2526642 Xenopus laevis RTN4.2-A1 (RTN4) mRNA, complete
            cds; alternatively spliced.
          Length = 1032

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 53/185 (28%), Positives = 98/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
            D+  WRD K SG V  F  ++++L  L  + +++++ +I +  L++ ISF ++      I
Sbjct: 847  DLIYWRDIKRSGVV--FGASLFLLLSLSVFSIVSVLAYIALALLSVTISFRIYKGVLQAI 904

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P       ++ LP+D V    +    ++NRT+A LR +   +D+   L     
Sbjct: 905  QKSEEGHPFRSILESNLALPEDVVQKHCTVALNQVNRTVAELRRLFLVEDLVDSLKFAVL 964

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
            +WV + +G  FN LTL  + ++ L ++P++YE+++ QVD +     A I K     ++  
Sbjct: 965  MWVFTYIGALFNGLTLLIVALISLFSIPVIYERHQTQVDHYL----ALINKNLKNTSDLI 1020

Query: 315  LSKIP 301
            L+K+P
Sbjct: 1021 LAKVP 1025



>gb:AY316189_2526641 Xenopus laevis RTN4.2-A2 (RTN4) mRNA, complete
            cds; alternatively spliced.
          Length = 1044

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 53/185 (28%), Positives = 98/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
            D+  WRD K SG V  F  ++++L  L  + +++++ +I +  L++ ISF ++      I
Sbjct: 859  DLIYWRDIKRSGVV--FGASLFLLLSLSVFSIVSVLAYIALALLSVTISFRIYKGVLQAI 916

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P       ++ LP+D V    +    ++NRT+A LR +   +D+   L     
Sbjct: 917  QKSEEGHPFRSILESNLALPEDVVQKHCTVALNQVNRTVAELRRLFLVEDLVDSLKFAVL 976

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
            +WV + +G  FN LTL  + ++ L ++P++YE+++ QVD +     A I K     ++  
Sbjct: 977  MWVFTYIGALFNGLTLLIVALISLFSIPVIYERHQTQVDHYL----ALINKNLKNTSDLI 1032

Query: 315  LSKIP 301
            L+K+P
Sbjct: 1033 LAKVP 1037



>gb:AY316188_2526640 Xenopus laevis RTN4.2-A3 (RTN4) mRNA, complete
            cds; alternatively spliced.
          Length = 1013

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 53/185 (28%), Positives = 98/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
            D+  WRD K SG V  F  ++++L  L  + +++++ +I +  L++ ISF ++      I
Sbjct: 828  DLIYWRDIKRSGVV--FGASLFLLLSLSVFSIVSVLAYIALALLSVTISFRIYKGVLQAI 885

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P       ++ LP+D V    +    ++NRT+A LR +   +D+   L     
Sbjct: 886  QKSEEGHPFRSILESNLALPEDVVQKHCTVALNQVNRTVAELRRLFLVEDLVDSLKFAVL 945

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
            +WV + +G  FN LTL  + ++ L ++P++YE+++ QVD +     A I K     ++  
Sbjct: 946  MWVFTYIGALFNGLTLLIVALISLFSIPVIYERHQTQVDHYL----ALINKNLKNTSDLI 1001

Query: 315  LSKIP 301
            L+K+P
Sbjct: 1002 LAKVP 1006



>gb:AY316187_2526639 Xenopus laevis RTN4.2-B1 (RTN4) mRNA, complete
           cds; alternatively spliced.
          Length = 304

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 53/185 (28%), Positives = 98/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
           D+  WRD K SG V  F  ++++L  L  + +++++ +I +  L++ ISF ++      I
Sbjct: 119 DLIYWRDIKRSGVV--FGASLFLLLSLSVFSIVSVLAYIALALLSVTISFRIYKGVLQAI 176

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            KS    P       ++ LP+D V    +    ++NRT+A LR +   +D+   L     
Sbjct: 177 QKSEEGHPFRSILESNLALPEDVVQKHCTVALNQVNRTVAELRRLFLVEDLVDSLKFAVL 236

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
           +WV + +G  FN LTL  + ++ L ++P++YE+++ QVD +     A I K     ++  
Sbjct: 237 MWVFTYIGALFNGLTLLIVALISLFSIPVIYERHQTQVDHYL----ALINKNLKNTSDLI 292

Query: 315 LSKIP 301
           L+K+P
Sbjct: 293 LAKVP 297



>gb:AY316186_2526638 Xenopus laevis RTN4.2-B2 (RTN4) mRNA, complete
           cds; alternatively spliced.
          Length = 323

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 53/185 (28%), Positives = 98/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
           D+  WRD K SG V  F  ++++L  L  + +++++ +I +  L++ ISF ++      I
Sbjct: 138 DLIYWRDIKRSGVV--FGASLFLLLSLSVFSIVSVLAYIALALLSVTISFRIYKGVLQAI 195

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            KS    P       ++ LP+D V    +    ++NRT+A LR +   +D+   L     
Sbjct: 196 QKSEEGHPFRSILESNLALPEDVVQKHCTVALNQVNRTVAELRRLFLVEDLVDSLKFAVL 255

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
           +WV + +G  FN LTL  + ++ L ++P++YE+++ QVD +     A I K     ++  
Sbjct: 256 MWVFTYIGALFNGLTLLIVALISLFSIPVIYERHQTQVDHYL----ALINKNLKNTSDLI 311

Query: 315 LSKIP 301
           L+K+P
Sbjct: 312 LAKVP 316



>gb:AY316185_2526637 Xenopus laevis RTN4.2-B3 (RTN4) mRNA, complete
           cds; alternatively spliced.
          Length = 316

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 53/185 (28%), Positives = 98/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
           D+  WRD K SG V  F  ++++L  L  + +++++ +I +  L++ ISF ++      I
Sbjct: 131 DLIYWRDIKRSGVV--FGASLFLLLSLSVFSIVSVLAYIALALLSVTISFRIYKGVLQAI 188

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            KS    P       ++ LP+D V    +    ++NRT+A LR +   +D+   L     
Sbjct: 189 QKSEEGHPFRSILESNLALPEDVVQKHCTVALNQVNRTVAELRRLFLVEDLVDSLKFAVL 248

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
           +WV + +G  FN LTL  + ++ L ++P++YE+++ QVD +     A I K     ++  
Sbjct: 249 MWVFTYIGALFNGLTLLIVALISLFSIPVIYERHQTQVDHYL----ALINKNLKNTSDLI 304

Query: 315 LSKIP 301
           L+K+P
Sbjct: 305 LAKVP 309



>gb:AY316183_2526635 Xenopus laevis RTN4.2-N (RTN4) mRNA, complete
           cds; alternatively spliced.
          Length = 193

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 53/185 (28%), Positives = 98/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
           D+  WRD K SG V  F  ++++L  L  + +++++ +I +  L++ ISF ++      I
Sbjct: 8   DLIYWRDIKRSGVV--FGASLFLLLSLSVFSIVSVLAYIALALLSVTISFRIYKGVLQAI 65

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            KS    P       ++ LP+D V    +    ++NRT+A LR +   +D+   L     
Sbjct: 66  QKSEEGHPFRSILESNLALPEDVVQKHCTVALNQVNRTVAELRRLFLVEDLVDSLKFAVL 125

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
           +WV + +G  FN LTL  + ++ L ++P++YE+++ QVD +     A I K     ++  
Sbjct: 126 MWVFTYIGALFNGLTLLIVALISLFSIPVIYERHQTQVDHYL----ALINKNLKNTSDLI 181

Query: 315 LSKIP 301
           L+K+P
Sbjct: 182 LAKVP 186



>gb:AY750848_1961663 Homo sapiens RTN3-A1 (RTN3) mRNA, complete cds.
          Length = 1032

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 51/185 (27%), Positives = 97/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
            D+  WRD K +G V  F TT+ +L  L  + ++++V ++++  L++ ISF ++ +    +
Sbjct: 846  DLIFWRDVKKTGFV--FGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAV 903

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P        + L  +   N  +A  + INR L ++  +   +D+   L +   
Sbjct: 904  QKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVF 963

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
            +W+++ +G  FN +TL  L  +L+ +VP++YEKY+ Q+D +   A      Q   + EK 
Sbjct: 964  MWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIAR----DQTKSIVEKI 1019

Query: 315  LSKIP 301
             +K+P
Sbjct: 1020 QAKLP 1024



>gb:AY427821_1950251 Homo sapiens reticulon 3-A (RTN3) mRNA, complete
            cds.
          Length = 1013

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 51/185 (27%), Positives = 97/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
            D+  WRD K +G V  F TT+ +L  L  + ++++V ++++  L++ ISF ++ +    +
Sbjct: 827  DLIFWRDVKKTGFV--FGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAV 884

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P        + L  +   N  +A  + INR L ++  +   +D+   L +   
Sbjct: 885  QKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVF 944

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
            +W+++ +G  FN +TL  L  +L+ +VP++YEKY+ Q+D +   A      Q   + EK 
Sbjct: 945  MWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIAR----DQTKSIVEKI 1000

Query: 315  LSKIP 301
             +K+P
Sbjct: 1001 QAKLP 1005



>gb:CQ754324_1451567 Sequence 62 from Patent WO2004001069.
          Length = 950

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 51/185 (27%), Positives = 97/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
            D+  WRD K +G V  F TT+ +L  L  + ++++V ++++  L++ ISF ++ +    +
Sbjct: 764  DLIFWRDVKKTGFV--FGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAV 821

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P        + L  +   N  +A  + INR L ++  +   +D+   L +   
Sbjct: 822  QKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVF 881

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
            +W+++ +G  FN +TL  L  +L+ +VP++YEKY+ Q+D +   A      Q   + EK 
Sbjct: 882  MWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIAR----DQTKSIVEKI 937

Query: 315  LSKIP 301
             +K+P
Sbjct: 938  QAKLP 942



>gb:CQ754320_1451565 Sequence 58 from Patent WO2004001069.
          Length = 676

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 51/185 (27%), Positives = 97/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
            D+  WRD K +G V  F TT+ +L  L  + ++++V ++++  L++ ISF ++ +    +
Sbjct: 490  DLIFWRDVKKTGFV--FGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAV 547

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P        + L  +   N  +A  + INR L ++  +   +D+   L +   
Sbjct: 548  QKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVF 607

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
            +W+++ +G  FN +TL  L  +L+ +VP++YEKY+ Q+D +   A      Q   + EK 
Sbjct: 608  MWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIAR----DQTKSIVEKI 663

Query: 315  LSKIP 301
             +K+P
Sbjct: 664  QAKLP 668



>gb:CQ754318_1451564 Sequence 56 from Patent WO2004001069.
          Length = 1012

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 51/185 (27%), Positives = 97/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
            D+  WRD K +G V  F TT+ +L  L  + ++++V ++++  L++ ISF ++ +    +
Sbjct: 826  DLIFWRDVKKTGFV--FGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAV 883

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P        + L  +   N  +A  + INR L ++  +   +D+   L +   
Sbjct: 884  QKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVF 943

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
            +W+++ +G  FN +TL  L  +L+ +VP++YEKY+ Q+D +   A      Q   + EK 
Sbjct: 944  MWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIAR----DQTKSIVEKI 999

Query: 315  LSKIP 301
             +K+P
Sbjct: 1000 QAKLP 1004



>gb:CQ754316_1451563 Sequence 54 from Patent WO2004001069.
          Length = 255

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 51/185 (27%), Positives = 97/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
           D+  WRD K +G V  F TT+ +L  L  + ++++V ++++  L++ ISF ++ +    +
Sbjct: 69  DLIFWRDVKKTGFV--FGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAV 126

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            KS    P        + L  +   N  +A  + INR L ++  +   +D+   L +   
Sbjct: 127 QKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVF 186

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
           +W+++ +G  FN +TL  L  +L+ +VP++YEKY+ Q+D +   A      Q   + EK 
Sbjct: 187 MWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIAR----DQTKSIVEKI 242

Query: 315 LSKIP 301
            +K+P
Sbjct: 243 QAKLP 247



>gb:CQ754314_1451562 Sequence 52 from Patent WO2004001069.
          Length = 695

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 51/185 (27%), Positives = 97/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
            D+  WRD K +G V  F TT+ +L  L  + ++++V ++++  L++ ISF ++ +    +
Sbjct: 509  DLIFWRDVKKTGFV--FGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAV 566

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P        + L  +   N  +A  + INR L ++  +   +D+   L +   
Sbjct: 567  QKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVF 626

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
            +W+++ +G  FN +TL  L  +L+ +VP++YEKY+ Q+D +   A      Q   + EK 
Sbjct: 627  MWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIAR----DQTKSIVEKI 682

Query: 315  LSKIP 301
             +K+P
Sbjct: 683  QAKLP 687



>gb:CQ754312_1451561 Sequence 50 from Patent WO2004001069.
          Length = 1031

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 51/185 (27%), Positives = 97/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
            D+  WRD K +G V  F TT+ +L  L  + ++++V ++++  L++ ISF ++ +    +
Sbjct: 845  DLIFWRDVKKTGFV--FGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAV 902

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P        + L  +   N  +A  + INR L ++  +   +D+   L +   
Sbjct: 903  QKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVF 962

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
            +W+++ +G  FN +TL  L  +L+ +VP++YEKY+ Q+D +   A      Q   + EK 
Sbjct: 963  MWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIAR----DQTKSIVEKI 1018

Query: 315  LSKIP 301
             +K+P
Sbjct: 1019 QAKLP 1023



>gb:CR858619_1182786 Pongo pygmaeus mRNA; cDNA DKFZp459J0533 (from
           clone DKFZp459J0533).
          Length = 236

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 51/185 (27%), Positives = 97/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
           D+  WRD K +G V  F TT+ +L  L  + ++++V ++++  L++ ISF ++ +    +
Sbjct: 50  DLIFWRDVKKTGFV--FGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAV 107

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            KS    P        + L  +   N  +A  + INR L ++  +   +D+   L +   
Sbjct: 108 QKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVF 167

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
           +W+++ +G  FN +TL  L  +L+ +VP++YEKY+ Q+D +   A      Q   + EK 
Sbjct: 168 MWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIAR----DQTKSIVEKI 223

Query: 315 LSKIP 301
            +K+P
Sbjct: 224 QAKLP 228



>sp|O95197|RTN3_HUMAN Reticulon protein 3 (Neuroendocrine-specific
           protein-like 2) (NSP-like protein II)
           (NSPLII).>gb:CQ754322_1451566 Sequence 60 from Patent
           WO2004001069.>gb:AX136395_1462075 Sequence 317 from
           Patent EP1067182.>gb:AF059524_1879752 Homo sapiens
           reticulon gene family protein (RTN3) mRNA, complete
           cds.>gb:AF119297_1884749 Homo sapiens
           neuroendocrine-specific protein-like protein 1 (NSPL1)
           mRNA, complete cds.>gb:BC000634_1966899 Homo sapiens
           reticulon 3, transcript variant 1, mRNA (cDNA clone
           IMAGE:3344908), complete cds.>gb:BC010556_1972696 Homo
           sapiens reticulon 3, transcript variant 1, mRNA (cDNA
           clone IMAGE:4154804), complete cds.>gb:BC011394_1972976
           Homo sapiens reticulon 3, transcript variant 1, mRNA
           (cDNA clone IMAGE:3873400), complete
           cds.>gb:BC022993_1978059 Homo sapiens reticulon 3,
           transcript variant 1, mRNA (cDNA clone IMAGE:4940867),
           complete cds.>gb:HSNSP5_2019226 Homo sapiens reticulon
           gene family protein (RTN3) gene, exon 7 and complete
           cds.
          Length = 236

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 51/185 (27%), Positives = 97/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
           D+  WRD K +G V  F TT+ +L  L  + ++++V ++++  L++ ISF ++ +    +
Sbjct: 50  DLIFWRDVKKTGFV--FGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAV 107

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            KS    P        + L  +   N  +A  + INR L ++  +   +D+   L +   
Sbjct: 108 QKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVF 167

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
           +W+++ +G  FN +TL  L  +L+ +VP++YEKY+ Q+D +   A      Q   + EK 
Sbjct: 168 MWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIAR----DQTKSIVEKI 223

Query: 315 LSKIP 301
            +K+P
Sbjct: 224 QAKLP 228



>gb:BC059623_2552597 Danio rerio reticulon 1, mRNA (cDNA clone
           MGC:73298 IMAGE:4787473), complete cds.
          Length = 203

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 47/183 (25%), Positives = 92/183 (50%), Gaps = 10/183 (5%)
 Frame = -3

Query: 837 GKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHIL--ILALAISF-LWSNA 667
           G+  D+  WRD K SG V  F + + +LF L ++ +++++ ++   +L+  ISF ++ + 
Sbjct: 15  GQVVDLVHWRDLKQSGLV--FGSVLLLLFSLTQFSVVSVIAYLALAVLSATISFRVYKSV 72

Query: 666 STFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLA 508
              + K+    P        + L  D +       ++ IN T+  LR +   +D+   + 
Sbjct: 73  LQAVQKTDEGHPFKSYLEVEISLSADQISKYVDKTQLYINTTMKELRRLFLVQDLVDSIK 132

Query: 507 VIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVL 328
               +W+L+ +G  FN LTL  L V+ + +VP++YEKY+ Q+D +      ++      +
Sbjct: 133 FAVLMWLLTYVGALFNGLTLLILAVISMFSVPVVYEKYQTQIDQYLGLVRTQVNSVMGKI 192

Query: 327 NEK 319
            EK
Sbjct: 193 REK 195



>gb:BC030455_2096814 Mus musculus reticulon 1, mRNA (cDNA clone
            MGC:40985 IMAGE:5401661), complete
            cds.>gb:BC053926_2101601 Mus musculus reticulon 1, mRNA
            (cDNA clone MGC:56910 IMAGE:6312477), complete
            cds.>gb:BC058579_2103333 Mus musculus reticulon 1, mRNA
            (cDNA clone MGC:67769 IMAGE:6490092), complete cds.
          Length = 780

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 50/182 (27%), Positives = 92/182 (50%), Gaps = 10/182 (5%)
 Frame = -3

Query: 834  KPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA--ISF-LWSNAS 664
            K  D+  WRD K +G V  F + + +LF L ++ ++++V ++ + AL+  ISF ++ +  
Sbjct: 592  KAIDLLYWRDIKQTGIV--FGSFLLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVL 649

Query: 663  TFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAV 505
              + K+    P        + L Q+ +      L++ +N TL  LR +   +D+   L  
Sbjct: 650  QAVQKTDEGHPFKAYLELEITLSQEQIQKYTDCLQLYVNSTLKELRRLFLVQDLVDSLKF 709

Query: 504  IAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLN 325
               +W+L+ +G  FN LTL  + VV + T+P++Y K++ QVD +       I    A + 
Sbjct: 710  AVLMWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQVDQYLGLVRTHINTVVAKIQ 769

Query: 324  EK 319
             K
Sbjct: 770  AK 771



>gb:AB074899_2047567 Mus musculus Rtn-1A mRNA for reticulon 1A,
            complete cds.
          Length = 780

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 50/182 (27%), Positives = 92/182 (50%), Gaps = 10/182 (5%)
 Frame = -3

Query: 834  KPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA--ISF-LWSNAS 664
            K  D+  WRD K +G V  F + + +LF L ++ ++++V ++ + AL+  ISF ++ +  
Sbjct: 592  KAIDLLYWRDIKQTGIV--FGSFLLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVL 649

Query: 663  TFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAV 505
              + K+    P        + L Q+ +      L++ +N TL  LR +   +D+   L  
Sbjct: 650  QAVQKTDEGHPFKAYLELEITLSQEQIQKYTDCLQLYVNSTLKELRRLFLVQDLVDSLKF 709

Query: 504  IAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLN 325
               +W+L+ +G  FN LTL  + VV + T+P++Y K++ QVD +       I    A + 
Sbjct: 710  AVLMWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQVDQYLGLVRTHINTVVAKIQ 769

Query: 324  EK 319
             K
Sbjct: 770  AK 771



>sp|Q64548|RTN1_RAT Reticulon 1 (Neuroendocrine-specific protein)
            (S-rex).>gb:RNU17604_2136949 Rattus norvegicus rS-Rex-b
            mRNA, complete cds.
          Length = 777

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 50/182 (27%), Positives = 92/182 (50%), Gaps = 10/182 (5%)
 Frame = -3

Query: 834  KPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA--ISF-LWSNAS 664
            K  D+  WRD K +G V  F + + +LF L ++ ++++V ++ + AL+  ISF ++ +  
Sbjct: 589  KAIDLLYWRDIKQTGIV--FGSFLLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVL 646

Query: 663  TFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAV 505
              + K+    P        + L Q+ +      L++ +N TL  LR +   +D+   L  
Sbjct: 647  QAVQKTDEGHPFKAYLELEITLSQEQIQKYTDCLQLYVNSTLKELRRLFLVQDLVDSLKF 706

Query: 504  IAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLN 325
               +W+L+ +G  FN LTL  + VV + T+P++Y K++ QVD +       I    A + 
Sbjct: 707  AVLMWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQVDQYLGLVRTHINTVVAKIQ 766

Query: 324  EK 319
             K
Sbjct: 767  AK 768



>gb:BC084044_2563451 Xenopus laevis hypothetical LOC494980, mRNA
           (cDNA clone IMAGE:7197484), partial cds.
          Length = 236

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 49/185 (26%), Positives = 97/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
           D+  WRD K +G V  F TT+ +L  L  + ++++V ++++  L++ ISF ++ +    +
Sbjct: 50  DLIFWRDVKKTGFV--FGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRVYKSVIQAV 107

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            KS    P        + L  +   N  +A  + +N+ L ++  +   +D+   L +   
Sbjct: 108 QKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHVNKALKLIIRLFLVEDLVDSLKLAVF 167

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
           +W+++ +G  FN +TL  L  +L+ +VP++YEKY+ Q+D +   A      Q   + EK 
Sbjct: 168 MWLMTYVGAVFNGITLLILAELLVFSVPIVYEKYKTQIDHYVGIAR----DQTKSIVEKI 223

Query: 315 LSKIP 301
            +K+P
Sbjct: 224 QAKLP 228



>gb:AY750849_2088396 Mus musculus RTN3-A1 (Rtn3) mRNA, complete
            cds.>gb:BC079882_2107696 Mus musculus reticulon 3,
            transcript variant 1, mRNA (cDNA clone MGC:105197
            IMAGE:6839323), complete cds.
          Length = 964

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 49/185 (26%), Positives = 97/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
            D+  WRD K +G V  F TT+ +L  L  + ++++V ++++  L++ ISF ++ +    +
Sbjct: 778  DLIFWRDVKKTGFV--FGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRVYKSVIQAV 835

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P        + L  +   N  +A  + +N+ L ++  +   +D+   L +   
Sbjct: 836  QKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHVNKALKLIIRLFLVEDLVDSLKLAVF 895

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
            +W+++ +G  FN +TL  L  +L+ +VP++YEKY+ Q+D +   A      Q   + EK 
Sbjct: 896  MWLMTYVGAVFNGITLLILAELLVFSVPIVYEKYKTQIDHYVGIAR----DQTKSIVEKI 951

Query: 315  LSKIP 301
             +K+P
Sbjct: 952  QAKLP 956



>gb:AY507127_2085670 Mus musculus reticulon 3 B isoform (Rtn3) mRNA,
            complete cds, alternatively spliced.
          Length = 882

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 49/185 (26%), Positives = 97/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
            D+  WRD K +G V  F TT+ +L  L  + ++++V ++++  L++ ISF ++ +    +
Sbjct: 696  DLIFWRDVKKTGFV--FGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRVYKSVIQAV 753

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P        + L  +   N  +A  + +N+ L ++  +   +D+   L +   
Sbjct: 754  QKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHVNKALKLIIRLFLVEDLVDSLKLAVF 813

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
            +W+++ +G  FN +TL  L  +L+ +VP++YEKY+ Q+D +   A      Q   + EK 
Sbjct: 814  MWLMTYVGAVFNGITLLILAELLVFSVPIVYEKYKTQIDHYVGIAR----DQTKSIVEKI 869

Query: 315  LSKIP 301
             +K+P
Sbjct: 870  QAKLP 874



>gb:AY507126_2085669 Mus musculus reticulon 3 A1 isoform (Rtn3)
           mRNA, complete cds, alternatively spliced.
          Length = 237

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 49/185 (26%), Positives = 97/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
           D+  WRD K +G V  F TT+ +L  L  + ++++V ++++  L++ ISF ++ +    +
Sbjct: 51  DLIFWRDVKKTGFV--FGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRVYKSVIQAV 108

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            KS    P        + L  +   N  +A  + +N+ L ++  +   +D+   L +   
Sbjct: 109 QKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHVNKALKLIIRLFLVEDLVDSLKLAVF 168

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
           +W+++ +G  FN +TL  L  +L+ +VP++YEKY+ Q+D +   A      Q   + EK 
Sbjct: 169 MWLMTYVGAVFNGITLLILAELLVFSVPIVYEKYKTQIDHYVGIAR----DQTKSIVEKI 224

Query: 315 LSKIP 301
            +K+P
Sbjct: 225 QAKLP 229



>gb:AY427822_2084868 Mus musculus RTN3-A mRNA, complete cds.
          Length = 945

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 49/185 (26%), Positives = 97/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
            D+  WRD K +G V  F TT+ +L  L  + ++++V ++++  L++ ISF ++ +    +
Sbjct: 759  DLIFWRDVKKTGFV--FGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRVYKSVIQAV 816

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P        + L  +   N  +A  + +N+ L ++  +   +D+   L +   
Sbjct: 817  QKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHVNKALKLIIRLFLVEDLVDSLKLAVF 876

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
            +W+++ +G  FN +TL  L  +L+ +VP++YEKY+ Q+D +   A      Q   + EK 
Sbjct: 877  MWLMTYVGAVFNGITLLILAELLVFSVPIVYEKYKTQIDHYVGIAR----DQTKSIVEKI 932

Query: 315  LSKIP 301
             +K+P
Sbjct: 933  QAKLP 937



>gb:AK075883_1171077 Mus musculus adult male tongue cDNA, RIKEN
           full-length enriched library, clone:2310024O16
           product:reticulon 3, full insert sequence.
          Length = 237

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 49/185 (26%), Positives = 97/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
           D+  WRD K +G V  F TT+ +L  L  + ++++V ++++  L++ ISF ++ +    +
Sbjct: 51  DLIFWRDVKKTGFV--FGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRVYKSVIQAV 108

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            KS    P        + L  +   N  +A  + +N+ L ++  +   +D+   L +   
Sbjct: 109 QKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHVNKALKLIIRLFLVEDLVDSLKLAVF 168

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
           +W+++ +G  FN +TL  L  +L+ +VP++YEKY+ Q+D +   A      Q   + EK 
Sbjct: 169 MWLITYVGAVFNGITLLILAELLVFSVPIVYEKYKTQIDHYVGIAR----DQTKSIVEKI 224

Query: 315 LSKIP 301
            +K+P
Sbjct: 225 QAKLP 229



>gb:AK032109_1162752 Mus musculus adult male medulla oblongata cDNA,
           RIKEN full-length enriched library, clone:6330592M02
           product:reticulon 3, full insert sequence.
          Length = 643

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 49/185 (26%), Positives = 97/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
           D+  WRD K +G V  F TT+ +L  L  + ++++V ++++  L++ ISF ++ +    +
Sbjct: 457 DLIFWRDVKKTGFV--FGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRVYKSVIQAV 514

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            KS    P        + L  +   N  +A  + +N+ L ++  +   +D+   L +   
Sbjct: 515 QKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHVNKALKLIIRLFLVEDLVDSLKLAVF 574

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
           +W+++ +G  FN +TL  L  +L+ +VP++YEKY+ Q+D +   A      Q   + EK 
Sbjct: 575 MWLMTYVGAVFNGITLLILAELLVFSVPIVYEKYKTQIDHYVGIAR----DQTKSIVEKI 630

Query: 315 LSKIP 301
            +K+P
Sbjct: 631 QAKLP 635



>sp|Q9ES97|RTN3_MOUSE Reticulon protein 3.>gb:AK036892_1164670 Mus
           musculus adult female vagina cDNA, RIKEN full-length
           enriched library, clone:9930022D09 product:reticulon 3,
           full insert sequence.>gb:AK049845_1169000 Mus musculus
           adult male hippocampus cDNA, RIKEN full-length enriched
           library, clone:C630003C02 product:reticulon 3, full
           insert sequence.>gb:AK088670_1175544 Mus musculus 2 days
           neonate thymus thymic cells cDNA, RIKEN full-length
           enriched library, clone:E430023D14 product:reticulon 3,
           full insert sequence.>gb:AB046114_2046038 Mus musculus
           mRNA for reticulon 3, complete cds.>gb:AF195940_2058703
           Mus musculus reticulon 3 (Rtn3) mRNA, complete
           cds.>gb:AY164700_2077401 Mus musculus RTN3-A1 (Rtn3)
           mRNA, complete cds; alternatively
           spliced.>gb:BC014697_2091959 Mus musculus reticulon 3,
           transcript variant 4, mRNA (cDNA clone IMAGE:4506129),
           complete cds.>gb:BC036717_2097903 Mus musculus reticulon
           3, transcript variant 4, mRNA (cDNA clone
           IMAGE:3968572), complete cds.
          Length = 237

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 49/185 (26%), Positives = 97/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
           D+  WRD K +G V  F TT+ +L  L  + ++++V ++++  L++ ISF ++ +    +
Sbjct: 51  DLIFWRDVKKTGFV--FGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRVYKSVIQAV 108

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            KS    P        + L  +   N  +A  + +N+ L ++  +   +D+   L +   
Sbjct: 109 QKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHVNKALKLIIRLFLVEDLVDSLKLAVF 168

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
           +W+++ +G  FN +TL  L  +L+ +VP++YEKY+ Q+D +   A      Q   + EK 
Sbjct: 169 MWLMTYVGAVFNGITLLILAELLVFSVPIVYEKYKTQIDHYVGIAR----DQTKSIVEKI 224

Query: 315 LSKIP 301
            +K+P
Sbjct: 225 QAKLP 229



>gb:AY164724_2516213 Gallus gallus RTN1-A (RTN1) mRNA, complete
            cds.>gb:GGU17606_2573513 Gallus gallus chS-Rex-b mRNA,
            complete cds.
          Length = 760

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 48/182 (26%), Positives = 92/182 (50%), Gaps = 10/182 (5%)
 Frame = -3

Query: 834  KPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA--ISF-LWSNAS 664
            K  ++  WRD K +G V  F + + +LF L ++ ++++V ++ +  L+  ISF ++ +  
Sbjct: 572  KAINLLYWRDIKQTGIV--FGSLLLLLFSLTQFSVVSVVAYLALAGLSATISFRIYKSVL 629

Query: 663  TFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAV 505
              + K+    P        + L QD +      L++ +N T+  LR +   +D+   L  
Sbjct: 630  QAVQKTDEGHPFKAYLDMEMNLSQDQIQKYTDCLQLYVNSTVKELRRLFLVQDLVDSLKF 689

Query: 504  IAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLN 325
               +W+L+ +G  FN LTL  + VV + T+P++Y+KY+ Q+D +       I    A + 
Sbjct: 690  AVLMWLLTYVGALFNGLTLLIMAVVSMFTLPVVYDKYQAQIDQYLGLVRTHINTVVAKIQ 749

Query: 324  EK 319
             K
Sbjct: 750  AK 751



>gb:RNU17603_2136948 Rattus norvegicus rS-Rex-s mRNA, complete cds.
          Length = 208

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 49/179 (27%), Positives = 91/179 (50%), Gaps = 10/179 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA--ISF-LWSNASTFI 655
           D+  WRD K +G V  F + + +LF L ++ ++++V ++ + AL+  ISF ++ +    +
Sbjct: 23  DLLYWRDIKQTGIV--FGSFLLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVLQAV 80

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            K+    P        + L Q+ +      L++ +N TL  LR +   +D+   L     
Sbjct: 81  QKTDEGHPFKAYLELEITLSQEQIQKYTDCLQLYVNSTLKELRRLFLVQDLVDSLKFAVL 140

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
           +W+L+ +G  FN LTL  + VV + T+P++Y K++ QVD +       I    A +  K
Sbjct: 141 MWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQVDQYLGLVRTHINTVVAKIQAK 199



>gb:HUMNSPB_2035203 Homo sapiens neuroendocrine-specific protein B
           (NSP) mRNA, complete cds.
          Length = 356

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 49/182 (26%), Positives = 91/182 (50%), Gaps = 10/182 (5%)
 Frame = -3

Query: 834 KPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA--ISF-LWSNAS 664
           K  D+  WRD K +G V  F + + +LF L ++ ++++V ++ + AL+  ISF ++ +  
Sbjct: 168 KAIDLLYWRDIKQTGIV--FGSFLLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVL 225

Query: 663 TFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAV 505
             + K+    P        + L Q+ +      L+  +N TL  LR +   +D+   L  
Sbjct: 226 QAVQKTDEGHPFKAYLELEITLSQEQIQKYTDCLQFYVNSTLKELRRLFLVQDLVDSLKF 285

Query: 504 IAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLN 325
              +W+L+ +G  FN LTL  + VV + T+P++Y K++ Q+D +       I    A + 
Sbjct: 286 AVLMWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQ 345

Query: 324 EK 319
            K
Sbjct: 346 AK 347



>gb:AY665269_1958574 Pan troglodytes reticulon 1 mRNA, complete cds.
          Length = 776

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 49/182 (26%), Positives = 91/182 (50%), Gaps = 10/182 (5%)
 Frame = -3

Query: 834  KPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA--ISF-LWSNAS 664
            K  D+  WRD K +G V  F + + +LF L ++ ++++V ++ + AL+  ISF ++ +  
Sbjct: 588  KAIDLLYWRDIKQTGIV--FGSFLLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVL 645

Query: 663  TFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAV 505
              + K+    P        + L Q+ +      L+  +N TL  LR +   +D+   L  
Sbjct: 646  QAVQKTDEGHPFKAYLELEITLSQEQIQKYTDCLQFYVNSTLKELRRLFLVQDLVDSLKF 705

Query: 504  IAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLN 325
               +W+L+ +G  FN LTL  + VV + T+P++Y K++ Q+D +       I    A + 
Sbjct: 706  AVLMWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQ 765

Query: 324  EK 319
             K
Sbjct: 766  AK 767



>pir|A60021|A60021 tropomyosin-related protein, neuronal -
           rat>gb:RSC113_2138330 Rat mRNA for C1-13 gene product.
          Length = 267

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 49/179 (27%), Positives = 91/179 (50%), Gaps = 10/179 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA--ISF-LWSNASTFI 655
           D+  WRD K +G V  F + + +LF L ++ ++++V ++ + AL+  ISF ++ +    +
Sbjct: 14  DLLYWRDIKQTGIV--FGSFLLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVLQAV 71

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            K+    P        + L Q+ +      L++ +N TL  LR +   +D+   L     
Sbjct: 72  QKTDEGHPFKAYLELEITLSQEQIQKYTDCLQLYVNSTLKELRRLFLVQDLVDSLKFAVL 131

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
           +W+L+ +G  FN LTL  + VV + T+P++Y K++ QVD +       I    A +  K
Sbjct: 132 MWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQVDQYLGLVRTHINTVVAKIQAK 190



>sp|Q16799|RTN1_HUMAN Reticulon 1 (Neuroendocrine-specific
            protein).>pir|A46583|A46583 neuroendocrine-specific
            protein, splice form A - human>gb:HUMNSPA_2035202 Homo
            sapiens neuroendocrine-specific protein A (NSP) mRNA,
            complete cds.
          Length = 776

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 49/182 (26%), Positives = 91/182 (50%), Gaps = 10/182 (5%)
 Frame = -3

Query: 834  KPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA--ISF-LWSNAS 664
            K  D+  WRD K +G V  F + + +LF L ++ ++++V ++ + AL+  ISF ++ +  
Sbjct: 588  KAIDLLYWRDIKQTGIV--FGSFLLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVL 645

Query: 663  TFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAV 505
              + K+    P        + L Q+ +      L+  +N TL  LR +   +D+   L  
Sbjct: 646  QAVQKTDEGHPFKAYLELEITLSQEQIQKYTDCLQFYVNSTLKELRRLFLVQDLVDSLKF 705

Query: 504  IAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLN 325
               +W+L+ +G  FN LTL  + VV + T+P++Y K++ Q+D +       I    A + 
Sbjct: 706  AVLMWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQ 765

Query: 324  EK 319
             K
Sbjct: 766  AK 767



>gb:AY316192_2526644 Xenopus laevis RTN4.1-C (RTN4) mRNA, complete
           cds; alternatively spliced.>gb:BC059960_2552740 Xenopus
           laevis hypothetical protein MGC68489, mRNA (cDNA clone
           MGC:68489 IMAGE:4030449), complete cds.
          Length = 199

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 48/188 (25%), Positives = 94/188 (50%), Gaps = 10/188 (5%)
 Frame = -3

Query: 834 KPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF---LWSNAS 664
           K  D+  WRD K SG V  F  ++++L  L  + +++++ +I +  L+++    ++    
Sbjct: 11  KVVDLIYWRDIKRSGVV--FGASLFLLLSLSVFSIVSVLAYIALALLSVTISLRIYKGIL 68

Query: 663 TFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAV 505
             I KS    P       ++ +P+D V    +     +N T+  LR +   +D+   L  
Sbjct: 69  QAIQKSEEGHPFRSILESNLAVPEDLVQKYCNVALNHVNCTVKELRHLFLVEDLVDSLKF 128

Query: 504 IAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLN 325
              +WV + +G  FN LTL  + ++ L ++P++YE+++ QVD +     A + K     +
Sbjct: 129 AVLMWVFTYIGALFNGLTLLIVALISLFSIPVIYERHQTQVDHYL----ALVNKNLKSTS 184

Query: 324 EKYLSKIP 301
           +  LSK+P
Sbjct: 185 DLILSKVP 192



>gb:BC062068_2104842 Rattus norvegicus reticulon 3, transcript
           variant 2, mRNA (cDNA clone IMAGE:5599355), complete
           cds.
          Length = 237

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 48/185 (25%), Positives = 97/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
           D+  WRD K +G V  F TT+ +L  L  + ++++V ++++  L++ ISF ++ +    +
Sbjct: 51  DLIFWRDVKKTGFV--FGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRVYKSVIQAV 108

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            KS    P        + L  +   +  +A  + +N+ L ++  +   +D+   L +   
Sbjct: 109 QKSEEGHPFKAYLDVDITLSSEAFHSYMNAAMVHVNKALKLIIRLFLVEDLVDSLKLAVF 168

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
           +W+++ +G  FN +TL  L  +L+ +VP++YEKY+ Q+D +   A      Q   + EK 
Sbjct: 169 MWLMTYVGAVFNGITLLILAELLVFSVPIVYEKYKTQIDHYVGIAR----DQTKSIVEKI 224

Query: 315 LSKIP 301
            +K+P
Sbjct: 225 QAKLP 229



>gb:AY496443_2085620 Rattus norvegicus RTN3-A mRNA, complete cds.
          Length = 940

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 48/185 (25%), Positives = 97/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
            D+  WRD K +G V  F TT+ +L  L  + ++++V ++++  L++ ISF ++ +    +
Sbjct: 754  DLIFWRDVKKTGFV--FGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRVYKSVIQAV 811

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P        + L  +   +  +A  + +N+ L ++  +   +D+   L +   
Sbjct: 812  QKSEEGHPFKAYLDVDITLSSEAFHSYMNAAMVHVNKALKLIIRLFLVEDLVDSLKLAVF 871

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
            +W+++ +G  FN +TL  L  +L+ +VP++YEKY+ Q+D +   A      Q   + EK 
Sbjct: 872  MWLMTYVGAVFNGITLLILAELLVFSVPIVYEKYKTQIDHYVGIAR----DQTKSIVEKI 927

Query: 315  LSKIP 301
             +K+P
Sbjct: 928  QAKLP 932



>gb:AF442357_2065871 Rattus norvegicus reticulon 3 protein isoform a
           mRNA, complete cds; alternatively
           spliced.>gb:AF442358_2065872 Rattus norvegicus reticulon
           3 protein isoform b mRNA, complete cds; alternatively
           spliced.>gb:AY164698_2077400 Rattus norvegicus RTN3-A1
           (Rtn3) mRNA, complete cds; alternatively spliced.
          Length = 236

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 48/185 (25%), Positives = 97/185 (52%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
           D+  WRD K +G V  F TT+ +L  L  + ++++V ++++  L++ ISF ++ +    +
Sbjct: 50  DLIFWRDVKKTGFV--FGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRVYKSVIQAV 107

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            KS    P        + L  +   +  +A  + +N+ L ++  +   +D+   L +   
Sbjct: 108 QKSEEGHPFKAYLDVDITLSSEAFHSYMNAAMVHVNKALKLIIRLFLVEDLVDSLKLAVF 167

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
           +W+++ +G  FN +TL  L  +L+ +VP++YEKY+ Q+D +   A      Q   + EK 
Sbjct: 168 MWLMTYVGAVFNGITLLILAELLVFSVPIVYEKYKTQIDHYVGIAR----DQTKSIVEKI 223

Query: 315 LSKIP 301
            +K+P
Sbjct: 224 QAKLP 228



>gb:CR457030_1993237 Homo sapiens full open reading frame cDNA clone
           RZPDo834D0215D for gene RTN1, reticulon 1; complete cds,
           incl. stopcodon.
          Length = 208

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 48/179 (26%), Positives = 90/179 (50%), Gaps = 10/179 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA--ISF-LWSNASTFI 655
           D+  WRD K +G V  F + + +LF L ++ ++++V ++ + AL+  ISF ++ +    +
Sbjct: 23  DLLYWRDIKQTGIV--FGSFLLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVLQAV 80

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            K+    P        + L Q+ +      L+  +N TL  LR +   +D+   L     
Sbjct: 81  QKTDEGHPFKAYLELEITLSQEQIQKYTDCLQFYVNSTLKELRRLFLVQDLVDSLKFAVL 140

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
           +W+L+ +G  FN LTL  + VV + T+P++Y K++ Q+D +       I    A +  K
Sbjct: 141 MWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAK 199



>pir|I60904|I60904 neuroendocrine-specific protein C -
           human>gb:BC000314_1966606 Homo sapiens reticulon 1,
           transcript variant 3, mRNA (cDNA clone IMAGE:2821214),
           complete cds.>gb:BC003003_1968600 Homo sapiens reticulon
           1, transcript variant 3, mRNA (cDNA clone
           IMAGE:2821214), complete cds.>gb:HUMNSPC_2035204 Homo
           sapiens neuroendocrine-specific protein C (NSP) mRNA,
           complete cds.
          Length = 208

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 48/179 (26%), Positives = 90/179 (50%), Gaps = 10/179 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA--ISF-LWSNASTFI 655
           D+  WRD K +G V  F + + +LF L ++ ++++V ++ + AL+  ISF ++ +    +
Sbjct: 23  DLLYWRDIKQTGIV--FGSFLLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVLQAV 80

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            K+    P        + L Q+ +      L+  +N TL  LR +   +D+   L     
Sbjct: 81  QKTDEGHPFKAYLELEITLSQEQIQKYTDCLQFYVNSTLKELRRLFLVQDLVDSLKFAVL 140

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
           +W+L+ +G  FN LTL  + VV + T+P++Y K++ Q+D +       I    A +  K
Sbjct: 141 MWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAK 199



>gb:AY316194_2526646 Xenopus laevis RTN4.1-B1 (RTN4) mRNA, complete
           cds; alternatively spliced.
          Length = 311

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 48/190 (25%), Positives = 94/190 (49%), Gaps = 10/190 (5%)
 Frame = -3

Query: 840 GGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF---LWSN 670
           G    D+  WRD K SG V  F  ++++L  L  + +++++ +I +  L+++    ++  
Sbjct: 121 GSVVVDLIYWRDIKRSGVV--FGASLFLLLSLSVFSIVSVLAYIALALLSVTISLRIYKG 178

Query: 669 ASTFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFL 511
               I KS    P       ++ +P+D V    +     +N T+  LR +   +D+   L
Sbjct: 179 ILQAIQKSEEGHPFRSILESNLAVPEDLVQKYCNVALNHVNCTVKELRHLFLVEDLVDSL 238

Query: 510 AVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAV 331
                +WV + +G  FN LTL  + ++ L ++P++YE+++ QVD +     A + K    
Sbjct: 239 KFAVLMWVFTYIGALFNGLTLLIVALISLFSIPVIYERHQTQVDHYL----ALVNKNLKS 294

Query: 330 LNEKYLSKIP 301
            ++  LSK+P
Sbjct: 295 TSDLILSKVP 304



>gb:AL732544_2504429 Zebrafish DNA sequence from clone BUSM1-6I1 in
           linkage group 7 Contains the nitr6b_1 gene for novel
           immune-type receptor 6b, allele 1, the rtn3 gene for
           reticulon 3, the men1 gene for multiple endocrine
           neoplasia type 1, the nitr6c_1 gene for novel
           immune-type receptor 6c, allele 1 and the map4k2l gene
           for mitogen-activated protein kinase kinase kinase
           kinase 2-like, complete sequence.>gb:BC049315_2550172
           Danio rerio reticulon 3, mRNA (cDNA clone MGC:56439
           IMAGE:5612211), complete cds.>gb:BC062828_2553417 Danio
           rerio reticulon 3, mRNA (cDNA clone MGC:77630
           IMAGE:6996793), complete cds.
          Length = 221

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 49/179 (27%), Positives = 88/179 (49%), Gaps = 10/179 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
           D+  WRD K SG V  F  ++ +L  L  + ++++V ++L+  L + ISF ++ +    +
Sbjct: 34  DLVHWRDPKKSGVV--FGVSLLLLLSLAAFSVISVVSYLLLSLLCVTISFRIYKSVIQAV 91

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            KS    P        V +P +T           +NR L  +  +   +D+   L +   
Sbjct: 92  QKSNEGHPFKALMDKDVTVPPETFRKHVDGCLSHVNRALKQMSRLFLVEDLVDSLKLAVV 151

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
           +W+L+ +G  FN +T+  L  +LL +VP +YEK + Q+D + + A  +     A L EK
Sbjct: 152 MWLLTYVGAVFNGITILILADILLFSVPPIYEKNKTQIDHYIDIARTQFNTTVAKLQEK 210



>gb:AY198409_2518506 Xenopus laevis Nogo-B (Nogo) mRNA, complete
           cds; alternatively spliced.
          Length = 311

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 48/190 (25%), Positives = 94/190 (49%), Gaps = 10/190 (5%)
 Frame = -3

Query: 840 GGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF---LWSN 670
           G    D+  WRD K SG V  F  ++++L  L  + +++++ +I +  L+++    ++  
Sbjct: 121 GSVVVDLIYWRDIKRSGVV--FGASLFLLLSLSVFSIVSVLAYIALALLSVTISLRIYKG 178

Query: 669 ASTFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFL 511
               I KS    P       ++ +P+D V    +     +N T+  LR +   +D+   L
Sbjct: 179 ILQAIQKSEGGHPFRSILESNLAVPEDLVQKYCNVALNHVNCTVKELRHLFLVEDLVDSL 238

Query: 510 AVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAV 331
                +WV + +G  FN LTL  + ++ L ++P++YE+++ QVD +     A + K    
Sbjct: 239 KFAVLMWVFTYIGALFNGLTLLIVALISLFSIPVIYERHQTQVDHYL----ALVNKNLKS 294

Query: 330 LNEKYLSKIP 301
            ++  LSK+P
Sbjct: 295 TSDLILSKVP 304



>gb:AY316197_2526649 Xenopus laevis RTN4.1-A1 (RTN4) mRNA, complete
            cds; alternatively spliced.
          Length = 1043

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 47/185 (25%), Positives = 93/185 (50%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF---LWSNASTFI 655
            D+  WRD K SG V  F  ++++L  L  + +++++ +I +  L+++    ++      I
Sbjct: 858  DLIYWRDIKRSGVV--FGASLFLLLSLSVFSIVSVLAYIALALLSVTISLRIYKGILQAI 915

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P       ++ +P+D V    +     +N T+  LR +   +D+   L     
Sbjct: 916  QKSEEGHPFRSILESNLAVPEDLVQKYCNVALNHVNCTVKELRHLFLVEDLVDSLKFAVL 975

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
            +WV + +G  FN LTL  + ++ L ++P++YE+++ QVD +     A + K     ++  
Sbjct: 976  MWVFTYIGALFNGLTLLIVALISLFSIPVIYERHQTQVDHYL----ALVNKNLKSTSDLI 1031

Query: 315  LSKIP 301
            LSK+P
Sbjct: 1032 LSKVP 1036



>gb:AY316196_2526648 Xenopus laevis RTN4.1-A2 (RTN4) mRNA, complete
            cds; alternatively spliced.
          Length = 1055

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 47/185 (25%), Positives = 93/185 (50%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF---LWSNASTFI 655
            D+  WRD K SG V  F  ++++L  L  + +++++ +I +  L+++    ++      I
Sbjct: 870  DLIYWRDIKRSGVV--FGASLFLLLSLSVFSIVSVLAYIALALLSVTISLRIYKGILQAI 927

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P       ++ +P+D V    +     +N T+  LR +   +D+   L     
Sbjct: 928  QKSEEGHPFRSILESNLAVPEDLVQKYCNVALNHVNCTVKELRHLFLVEDLVDSLKFAVL 987

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
            +WV + +G  FN LTL  + ++ L ++P++YE+++ QVD +     A + K     ++  
Sbjct: 988  MWVFTYIGALFNGLTLLIVALISLFSIPVIYERHQTQVDHYL----ALVNKNLKSTSDLI 1043

Query: 315  LSKIP 301
            LSK+P
Sbjct: 1044 LSKVP 1048



>gb:AY316195_2526647 Xenopus laevis RTN4.1-A3 (RTN4) mRNA, complete
            cds; alternatively spliced.
          Length = 1024

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 47/185 (25%), Positives = 93/185 (50%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF---LWSNASTFI 655
            D+  WRD K SG V  F  ++++L  L  + +++++ +I +  L+++    ++      I
Sbjct: 839  DLIYWRDIKRSGVV--FGASLFLLLSLSVFSIVSVLAYIALALLSVTISLRIYKGILQAI 896

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P       ++ +P+D V    +     +N T+  LR +   +D+   L     
Sbjct: 897  QKSEEGHPFRSILESNLAVPEDLVQKYCNVALNHVNCTVKELRHLFLVEDLVDSLKFAVL 956

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
            +WV + +G  FN LTL  + ++ L ++P++YE+++ QVD +     A + K     ++  
Sbjct: 957  MWVFTYIGALFNGLTLLIVALISLFSIPVIYERHQTQVDHYL----ALVNKNLKSTSDLI 1012

Query: 315  LSKIP 301
            LSK+P
Sbjct: 1013 LSKVP 1017



>gb:AY316193_2526645 Xenopus laevis RTN4.1-B2 (RTN4) mRNA, complete
           cds; alternatively spliced.
          Length = 330

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 47/185 (25%), Positives = 93/185 (50%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF---LWSNASTFI 655
           D+  WRD K SG V  F  ++++L  L  + +++++ +I +  L+++    ++      I
Sbjct: 145 DLIYWRDIKRSGVV--FGASLFLLLSLSVFSIVSVLAYIALALLSVTISLRIYKGILQAI 202

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            KS    P       ++ +P+D V    +     +N T+  LR +   +D+   L     
Sbjct: 203 QKSEEGHPFRSILESNLAVPEDLVQKYCNVALNHVNCTVKELRHLFLVEDLVDSLKFAVL 262

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
           +WV + +G  FN LTL  + ++ L ++P++YE+++ QVD +     A + K     ++  
Sbjct: 263 MWVFTYIGALFNGLTLLIVALISLFSIPVIYERHQTQVDHYL----ALVNKNLKSTSDLI 318

Query: 315 LSKIP 301
           LSK+P
Sbjct: 319 LSKVP 323



>gb:AY198408_2518505 Xenopus laevis Nogo-A (Nogo) mRNA, complete cds;
            alternatively spliced.
          Length = 1043

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 47/185 (25%), Positives = 93/185 (50%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF---LWSNASTFI 655
            D+  WRD K SG V  F  ++++L  L  + +++++ +I +  L+++    ++      I
Sbjct: 858  DLIYWRDIKRSGVV--FGASLFLLLSLSVFSIVSVLAYIALALLSVTISLRIYKGILQAI 915

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P       ++ +P+D V    +     +N T+  LR +   +D+   L     
Sbjct: 916  QKSEEGHPFRSILESNLAVPEDLVQKYCNVALNHVNCTVKELRHLFLVEDLVDSLKFAVL 975

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
            +WV + +G  FN LTL  + ++ L ++P++YE+++ QVD +     A + K     ++  
Sbjct: 976  MWVFTYIGALFNGLTLLIVALISLFSIPVIYERHQTQVDHYL----ALVNKNLKSTSDLI 1031

Query: 315  LSKIP 301
            LSK+P
Sbjct: 1032 LSKVP 1036



>gb:AY198407_2518504 Xenopus laevis Nogo-C (Nogo) mRNA, complete
           cds; alternatively spliced.>gb:AY316191_2526643 Xenopus
           laevis RTN4.1-N (RTN4) mRNA, complete cds; alternatively
           spliced.
          Length = 193

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 47/185 (25%), Positives = 93/185 (50%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF---LWSNASTFI 655
           D+  WRD K SG V  F  ++++L  L  + +++++ +I +  L+++    ++      I
Sbjct: 8   DLIYWRDIKRSGVV--FGASLFLLLSLSVFSIVSVLAYIALALLSVTISLRIYKGILQAI 65

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            KS    P       ++ +P+D V    +     +N T+  LR +   +D+   L     
Sbjct: 66  QKSEEGHPFRSILESNLAVPEDLVQKYCNVALNHVNCTVKELRHLFLVEDLVDSLKFAVL 125

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
           +WV + +G  FN LTL  + ++ L ++P++YE+++ QVD +     A + K     ++  
Sbjct: 126 MWVFTYIGALFNGLTLLIVALISLFSIPVIYERHQTQVDHYL----ALVNKNLKSTSDLI 181

Query: 315 LSKIP 301
           LSK+P
Sbjct: 182 LSKVP 186



>gb:AY164723_2516212 Gallus gallus RTN1-C (RTN1) mRNA, complete
           cds.>gb:GGU17605_2573512 Gallus gallus chS-Rex-s mRNA,
           complete cds.
          Length = 208

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 46/179 (25%), Positives = 91/179 (50%), Gaps = 10/179 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA--ISF-LWSNASTFI 655
           ++  WR+ K +G V  F + + +LF L ++ ++++V ++ +  L+  ISF ++ +    +
Sbjct: 23  NLLYWREIKQTGIV--FGSLLLLLFSLTQFSVVSVVAYLALAGLSATISFRIYKSVLQAV 80

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            K+    P        + L QD +      L++ +N T+  LR +   +D+   L     
Sbjct: 81  QKTDEGHPFKAYLDMEMNLSQDQIQKYTDCLQLYVNSTVKELRRLFLVQDLVDSLKFAVL 140

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
           +W+L+ +G  FN LTL  + VV + T+P++Y+KY+ Q+D +       I    A +  K
Sbjct: 141 MWLLTYVGALFNGLTLLIMAVVSMFTLPVVYDKYQAQIDQYLGLVRTHINTVVAKIQAK 199



>gb:BC080089_2561521 Xenopus laevis MGC84232 protein, mRNA (cDNA
           clone MGC:84232 IMAGE:6955529), complete cds.
          Length = 214

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 50/192 (26%), Positives = 97/192 (50%), Gaps = 10/192 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
           D+  WRD K SG V  F  T+ +L  L  + +++++ ++++  L++ ISF ++ +    +
Sbjct: 28  DLLYWRDVKQSGMV--FGGTMVLLLSLAAFSIISVISYLVLSLLSVTISFRVYKSVLQAV 85

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            K+    P        + L  D+     S+    +N  L  +  +   +D+   L +   
Sbjct: 86  QKTEEGHPFKPLLEKDIALSSDSFQKGLSSSLAHVNHALKSIVRLFLVEDLVDSLKLALL 145

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
           +W+++ +G  FN +TL  L V+L  T P++YEKY+ Q+D +     +++      + EK 
Sbjct: 146 MWLMTYIGAVFNGITLLILGVLLAFTTPLVYEKYKVQIDHYVSLVHSQVKS----ITEKI 201

Query: 315 LSKIPKGPLKDK 280
            +K+P G LK K
Sbjct: 202 QAKLP-GALKKK 212



>gb:BC073245_2557097 Xenopus laevis MGC80590 protein, mRNA (cDNA
           clone MGC:80590 IMAGE:5505741), complete cds.
          Length = 214

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 47/192 (24%), Positives = 93/192 (48%), Gaps = 10/192 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF---LWSNASTFI 655
           D+  WRD K SG V  F  T+ +L  L  + +++++ ++++  L ++    ++ +    +
Sbjct: 28  DLLYWRDVKQSGMV--FGGTMVLLLSLAAFSIISVISYLVLSLLTVTISYRVYKSVLQAV 85

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            K+    P        + L  D+     +A    +N  L  +  +    D+   L +   
Sbjct: 86  QKTDEGHPFKPLLEKDITLSSDSFQKALTASLAHVNHALKYIVRLFLVDDLVDSLKLALL 145

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
           +W+++ +G  FN +TL  L V+L  T P++YEKY+ Q+D +     +++      + EK 
Sbjct: 146 MWLMTYVGAVFNGITLLILGVLLTFTAPIVYEKYKVQIDHYVSLVHSQVKS----ITEKI 201

Query: 315 LSKIPKGPLKDK 280
            +K+P G LK K
Sbjct: 202 QAKLP-GALKKK 212



>gb:AY182251_2517260 Xenopus laevis reticulon 1-C.1 mRNA, complete
           cds.
          Length = 207

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 42/161 (26%), Positives = 86/161 (53%), Gaps = 10/161 (6%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA--ISF-LWSNASTFI 655
           D+  WRD K +G V  F + + +LF L+++ +++++ ++ + AL+  ISF ++ +    +
Sbjct: 23  DLLYWRDIKQTGIV--FGSVLLMLFSLIQFSVVSVMAYLALAALSATISFRIYKSVLQAV 80

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            K+    P        + L Q+ +      L++  N     LR +   +D+   L     
Sbjct: 81  QKTDEGHPFKSYLDMEISLSQEQIQKYTDCLQVYTNSIAKELRRLFLVQDLVDSLKFAVL 140

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAF 373
           +W+L+ +G  FN LTL  + VV + ++P++Y+KY+ Q+D +
Sbjct: 141 MWLLTYVGALFNGLTLLIMAVVSMFSLPVVYDKYQAQIDQY 181



>gb:AY164737_2516214 Gallus gallus RTN4-C (RTN4) mRNA, complete cds.
          Length = 199

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 48/182 (26%), Positives = 88/182 (48%), Gaps = 10/182 (5%)
 Frame = -3

Query: 834 KPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNAS 664
           K  D+  WRD K +G V  F  ++++L  L  + ++++  +I +  L++ ISF ++    
Sbjct: 11  KVVDLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVI 68

Query: 663 TFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAV 505
             I KS    P        V + +D +   +S +   IN T+  LR +    D+   L  
Sbjct: 69  QAIQKSDEGHPFRAYLESDVAVSEDLIQKYSSVVLGHINGTVKELRRLFLVDDLVDSLKF 128

Query: 504 IAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLN 325
              +WV + +G  FN LTL  L ++ L +VP++YE+++ Q+D +       +    A + 
Sbjct: 129 AVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLVNKNVKDAMAKIQ 188

Query: 324 EK 319
            K
Sbjct: 189 AK 190



>gb:AY114153_2076262 Mus musculus nogo-B mRNA, complete cds.
          Length = 357

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 47/184 (25%), Positives = 90/184 (48%), Gaps = 10/184 (5%)
 Frame = -3

Query: 840 GGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSN 670
           G    D+  WRD K +G VV F  ++++L  L  + ++++  +I +  L++ ISF ++  
Sbjct: 166 GSVVVDLLYWRDIKKTG-VVYFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKG 224

Query: 669 ASTFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFL 511
               I KS    P        V + ++ V   +++    +N T+  LR +    D+   L
Sbjct: 225 VIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLFLVDDLVDSL 284

Query: 510 AVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAV 331
                +WV + +G  FN LTL  L ++ L ++P++YE+++ Q+D +   A   +    A 
Sbjct: 285 KFAVLMWVFTYVGALFNGLTLLILALISLFSIPVIYERHQAQIDHYLGLANKSVKDAMAK 344

Query: 330 LNEK 319
           +  K
Sbjct: 345 IQAK 348



>gb:AY495964_2535079 Xenopus laevis RTN3 (RTN3) mRNA, complete cds.
          Length = 214

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 46/192 (23%), Positives = 93/192 (48%), Gaps = 10/192 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF---LWSNASTFI 655
           D+  WRD K SG V  F  T+ +L  L  + +++++ ++++  L ++    ++ +    +
Sbjct: 28  DLLYWRDVKQSGMV--FGGTMVLLLSLAAFSIISVISYLVLSLLTVTISYRVYKSVLQAV 85

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            K+    P        + L  D+     +A    +N  L  +  +    D+   L +   
Sbjct: 86  QKTDEGHPFKPLLEKDITLSSDSFQKALTASLAHVNHALKYIVRLFLVDDLVDSLKLALL 145

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
           +W+++ +G  FN +TL  L V+L  T P++YE+Y+ Q+D +     +++      + EK 
Sbjct: 146 MWLMTYIGAVFNGITLLILGVLLAFTTPLVYERYKVQIDHYVSLVHSQVKS----ITEKI 201

Query: 315 LSKIPKGPLKDK 280
            +K+P G LK K
Sbjct: 202 QAKLP-GALKKK 212



>sp|Q99P72|RTN4_MOUSE Reticulon 4 (Neurite outgrowth inhibitor)
           (Nogo protein).>gb:AF326337_2063078 Mus musculus
           vp20/RTN4C protein mRNA, complete
           cds.>gb:AL929371_2073164 Mouse DNA sequence from clone
           RP23-176O5 on chromosome 11 Contains a ribosomal protein
           S2 (Rps2) pseudogene, a novel gene, an
           apurinic/apyrimidinic endonuclease 2 (Apex2) pseudogene,
           the Rtn4 gene for reticulon 4, the 3' end of the gene
           for a novel protein (C230094A16Rik) (MGC38936) and a CpG
           island, complete sequence.>gb:AY102283_2076231 Mus
           musculus RTN4 (Rtn4) mRNA, complete cds, alternatively
           spliced.>gb:AY102286_2076237 Mus musculus RTN4 (Rtn4)
           gene, complete cds, alternatively spliced.
          Length = 199

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 46/182 (25%), Positives = 89/182 (48%), Gaps = 10/182 (5%)
 Frame = -3

Query: 834 KPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNAS 664
           K  D+  WRD K +G V  F  ++++L  L  + ++++  +I +  L++ ISF ++    
Sbjct: 11  KVVDLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVI 68

Query: 663 TFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAV 505
             I KS    P        V + ++ V   +++    +N T+  LR +    D+   L  
Sbjct: 69  QAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLFLVDDLVDSLKF 128

Query: 504 IAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLN 325
              +WV + +G  FN LTL  L ++ L ++P++YE+++ Q+D +   A   +    A + 
Sbjct: 129 AVLMWVFTYVGALFNGLTLLILALISLFSIPVIYERHQAQIDHYLGLANKSVKDAMAKIQ 188

Query: 324 EK 319
            K
Sbjct: 189 AK 190



>gb:AY114152_2076261 Mus musculus nogo-A mRNA, complete cds.
          Length = 1163

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 46/179 (25%), Positives = 89/179 (49%), Gaps = 10/179 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
            D+  WRD K +G VV F  ++++L  L  + ++++  +I +  L++ ISF ++      I
Sbjct: 977  DLLYWRDIKKTG-VVYFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAI 1035

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P        V + ++ V   +++    +N T+  LR +    D+   L     
Sbjct: 1036 QKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLFLVDDLVDSLKFAVL 1095

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
            +WV + +G  FN LTL  L ++ L ++P++YE+++ Q+D +   A   +    A +  K
Sbjct: 1096 MWVFTYVGALFNGLTLLILALISLFSIPVIYERHQAQIDHYLGLANKSVKDAMAKIQAK 1154



>gb:AL929371_2073162 Mouse DNA sequence from clone RP23-176O5 on
           chromosome 11 Contains a ribosomal protein S2 (Rps2)
           pseudogene, a novel gene, an apurinic/apyrimidinic
           endonuclease 2 (Apex2) pseudogene, the Rtn4 gene for
           reticulon 4, the 3' end of the gene for a novel protein
           (C230094A16Rik) (MGC38936) and a CpG island, complete
           sequence.>gb:AY102281_2076229 Mus musculus RTN4 (Rtn4)
           mRNA, complete cds, alternatively
           spliced.>gb:AY102286_2076235 Mus musculus RTN4 (Rtn4)
           gene, complete cds, alternatively spliced.
          Length = 356

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 46/184 (25%), Positives = 89/184 (48%), Gaps = 10/184 (5%)
 Frame = -3

Query: 840 GGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSN 670
           G    D+  WRD K +G V  F  ++++L  L  + ++++  +I +  L++ ISF ++  
Sbjct: 166 GSVVVDLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKG 223

Query: 669 ASTFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFL 511
               I KS    P        V + ++ V   +++    +N T+  LR +    D+   L
Sbjct: 224 VIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLFLVDDLVDSL 283

Query: 510 AVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAV 331
                +WV + +G  FN LTL  L ++ L ++P++YE+++ Q+D +   A   +    A 
Sbjct: 284 KFAVLMWVFTYVGALFNGLTLLILALISLFSIPVIYERHQAQIDHYLGLANKSVKDAMAK 343

Query: 330 LNEK 319
           +  K
Sbjct: 344 IQAK 347



>gb:AL929371_2073161 Mouse DNA sequence from clone RP23-176O5 on
           chromosome 11 Contains a ribosomal protein S2 (Rps2)
           pseudogene, a novel gene, an apurinic/apyrimidinic
           endonuclease 2 (Apex2) pseudogene, the Rtn4 gene for
           reticulon 4, the 3' end of the gene for a novel protein
           (C230094A16Rik) (MGC38936) and a CpG island, complete
           sequence.>gb:AY102282_2076230 Mus musculus RTN4 (Rtn4)
           mRNA, complete cds, alternatively
           spliced.>gb:AY102286_2076234 Mus musculus RTN4 (Rtn4)
           gene, complete cds, alternatively
           spliced.>gb:BC086168_2564748 Xenopus laevis hypothetical
           LOC495639, mRNA (cDNA clone MGC:98618 IMAGE:7199896),
           complete cds.
          Length = 375

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 48/197 (24%), Positives = 92/197 (46%), Gaps = 10/197 (5%)
 Frame = -3

Query: 879 LFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI- 703
           LF        V+      D+  WRD K +G V  F  ++++L  L  + ++++  +I + 
Sbjct: 172 LFALPAASEPVIPSSAVVDLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALA 229

Query: 702 -LALAISF-LWSNASTFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVL 550
            L++ ISF ++      I KS    P        V + ++ V   +++    +N T+  L
Sbjct: 230 LLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKEL 289

Query: 549 REIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFA 370
           R +    D+   L     +WV + +G  FN LTL  L ++ L ++P++YE+++ Q+D + 
Sbjct: 290 RRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSIPVIYERHQAQIDHYL 349

Query: 369 EKAEAEIMKQYAVLNEK 319
             A   +    A +  K
Sbjct: 350 GLANKSVKDAMAKIQAK 366



>gb:AF051335_2052494 Rattus norvegicus GLUT4 vesicle 20kDa protein
           mRNA, complete cds.>gb:RNO242963_2135455 Rattus
           norvegicus mRNA for Nogo-C protein.
          Length = 199

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 46/182 (25%), Positives = 89/182 (48%), Gaps = 10/182 (5%)
 Frame = -3

Query: 834 KPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNAS 664
           K  D+  WRD K +G V  F  ++++L  L  + ++++  +I +  L++ ISF ++    
Sbjct: 11  KVVDLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVI 68

Query: 663 TFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAV 505
             I KS    P        V + ++ V   +++    +N T+  LR +    D+   L  
Sbjct: 69  QAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLFLVDDLVDSLKF 128

Query: 504 IAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLN 325
              +WV + +G  FN LTL  L ++ L ++P++YE+++ Q+D +   A   +    A + 
Sbjct: 129 AVLMWVFTYVGALFNGLTLLILALISLFSIPVIYERHQVQIDHYLGLANKSVKDAMAKIQ 188

Query: 324 EK 319
            K
Sbjct: 189 AK 190



>gb:AF077050_1149734 Homo sapiens neuroendocrine-specific protein C
           homolog mRNA, complete cds.>gb:AY164744_1425949 Bos
           taurus RTN4-C (RTN4) mRNA, complete
           cds.>gb:AF087901_1881915 Homo sapiens reticulon 4c mRNA,
           complete cds.>gb:AF132048_1885450 Homo sapiens foocen-s
           mRNA, complete cds.>gb:AF177332_1888075 Homo sapiens
           clone SP1507 unknown mRNA.>gb:AY102276_1936453 Homo
           sapiens RTN4 isoform C (RTN4) mRNA, complete cds;
           alternatively spliced.>gb:AY102285_1936461 Homo sapiens
           RTN4 (RTN4) gene, complete sequence, alternatively
           spliced.>gb:BC001035_1967231 Homo sapiens reticulon 4,
           transcript variant 3, mRNA (cDNA clone IMAGE:3139770),
           complete cds.>gb:BC007109_1970529 Homo sapiens reticulon
           4, transcript variant 3, mRNA (cDNA clone
           IMAGE:4291127), complete cds.>gb:BC014366_1974559 Homo
           sapiens reticulon 4, transcript variant 3, mRNA (cDNA
           clone IMAGE:3933041), complete cds.>gb:HSA251385_2001640
           Homo sapiens mRNA for Nogo-C protein (Nogo gene).
          Length = 199

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 47/182 (25%), Positives = 89/182 (48%), Gaps = 10/182 (5%)
 Frame = -3

Query: 834 KPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNAS 664
           K  D+  WRD K +G V  F  ++++L  L  + ++++  +I +  L++ ISF ++    
Sbjct: 11  KVVDLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVI 68

Query: 663 TFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAV 505
             I KS    P        V + ++ V   +++    +N T+  LR +    D+   L  
Sbjct: 69  QAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKF 128

Query: 504 IAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLN 325
              +WV + +G  FN LTL  L ++ L +VP++YE+++ Q+D +   A   +    A + 
Sbjct: 129 AVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQ 188

Query: 324 EK 319
            K
Sbjct: 189 AK 190



>gb:AY164740_2077402 Rattus norvegicus RTN4-B1 (Rtn4) mRNA, complete
           cds; alternatively spliced.>gb:BC070879_2106329 Rattus
           norvegicus reticulon 4, mRNA (cDNA clone IMAGE:7096609),
           complete cds.>gb:RNO242962_2135454 Rattus norvegicus
           mRNA for Nogo-B protein.
          Length = 360

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 46/184 (25%), Positives = 89/184 (48%), Gaps = 10/184 (5%)
 Frame = -3

Query: 840 GGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSN 670
           G    D+  WRD K +G V  F  ++++L  L  + ++++  +I +  L++ ISF ++  
Sbjct: 170 GSVVVDLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKG 227

Query: 669 ASTFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFL 511
               I KS    P        V + ++ V   +++    +N T+  LR +    D+   L
Sbjct: 228 VIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLFLVDDLVDSL 287

Query: 510 AVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAV 331
                +WV + +G  FN LTL  L ++ L ++P++YE+++ Q+D +   A   +    A 
Sbjct: 288 KFAVLMWVFTYVGALFNGLTLLILALISLFSIPVIYERHQVQIDHYLGLANKSVKDAMAK 347

Query: 330 LNEK 319
           +  K
Sbjct: 348 IQAK 351



>gb:AF132045_2055795 Rattus norvegicus foocen-m2 mRNA, alternate
           splice product, complete cds.>gb:AY164741_2077403 Rattus
           norvegicus RTN4-B2 (Rtn4) mRNA, complete cds;
           alternatively spliced.
          Length = 379

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 48/197 (24%), Positives = 92/197 (46%), Gaps = 10/197 (5%)
 Frame = -3

Query: 879 LFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI- 703
           LF        V+      D+  WRD K +G V  F  ++++L  L  + ++++  +I + 
Sbjct: 176 LFALPAASEPVIPSSAVVDLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALA 233

Query: 702 -LALAISF-LWSNASTFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVL 550
            L++ ISF ++      I KS    P        V + ++ V   +++    +N T+  L
Sbjct: 234 LLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKEL 293

Query: 549 REIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFA 370
           R +    D+   L     +WV + +G  FN LTL  L ++ L ++P++YE+++ Q+D + 
Sbjct: 294 RRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSIPVIYERHQVQIDHYL 353

Query: 369 EKAEAEIMKQYAVLNEK 319
             A   +    A +  K
Sbjct: 354 GLANKSVKDAMAKIQAK 370



>gb:BC071848_1988822 Homo sapiens reticulon 4, mRNA (cDNA clone
           IMAGE:4635625), complete cds.
          Length = 343

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 47/184 (25%), Positives = 89/184 (48%), Gaps = 10/184 (5%)
 Frame = -3

Query: 840 GGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSN 670
           G    D+  WRD K +G V  F  ++++L  L  + ++++  +I +  L++ ISF ++  
Sbjct: 153 GSVVVDLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKG 210

Query: 669 ASTFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFL 511
               I KS    P        V + ++ V   +++    +N T+  LR +    D+   L
Sbjct: 211 VIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSL 270

Query: 510 AVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAV 331
                +WV + +G  FN LTL  L ++ L +VP++YE+++ Q+D +   A   +    A 
Sbjct: 271 KFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAK 330

Query: 330 LNEK 319
           +  K
Sbjct: 331 IQAK 334



>gb:AY102278_1936455 Homo sapiens RTN4 isoform B2 (RTN4) mRNA,
           complete cds; alternatively spliced.>gb:AY102285_1936458
           Homo sapiens RTN4 (RTN4) gene, complete sequence,
           alternatively spliced.>gb:BC016165_1975493 Homo sapiens
           reticulon 4, transcript variant 4, mRNA (cDNA clone
           IMAGE:3505850), complete cds.
          Length = 392

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 49/197 (24%), Positives = 92/197 (46%), Gaps = 10/197 (5%)
 Frame = -3

Query: 879 LFGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI- 703
           LF        V+      D+  WRD K +G V  F  ++++L  L  + ++++  +I + 
Sbjct: 189 LFALPAASEPVIRSSAVVDLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALA 246

Query: 702 -LALAISF-LWSNASTFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVL 550
            L++ ISF ++      I KS    P        V + ++ V   +++    +N T+  L
Sbjct: 247 LLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKEL 306

Query: 549 REIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFA 370
           R +    D+   L     +WV + +G  FN LTL  L ++ L +VP++YE+++ Q+D + 
Sbjct: 307 RRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYL 366

Query: 369 EKAEAEIMKQYAVLNEK 319
             A   +    A +  K
Sbjct: 367 GLANKNVKDAMAKIQAK 383



>gb:AB040463_1866784 Homo sapiens mRNA for RTN-xS, complete
           cds.>gb:AF132047_1885449 Homo sapiens foocen-m mRNA,
           complete cds.>gb:AF148538_1886173 Homo sapiens reticulon
           4b mRNA, complete cds.>gb:AY102277_1936454 Homo sapiens
           RTN4 isoform B1 (RTN4) mRNA, complete cds; alternatively
           spliced.>gb:AY102285_1936459 Homo sapiens RTN4 (RTN4)
           gene, complete sequence, alternatively
           spliced.>gb:BC010737_1972778 Homo sapiens reticulon 4,
           transcript variant 2, mRNA (cDNA clone IMAGE:3901353),
           complete cds.>gb:BC012619_1973714 Homo sapiens reticulon
           4, transcript variant 2, mRNA (cDNA clone
           IMAGE:4082756), complete cds.>gb:BC026788_1978836 Homo
           sapiens reticulon 4, transcript variant 2, mRNA (cDNA
           clone IMAGE:3862911), complete cds.>gb:BC068991_1987731
           Homo sapiens reticulon 4, transcript variant 2, mRNA
           (cDNA clone IMAGE:4634289), complete
           cds.>gb:HSA251384_2001639 Homo sapiens mRNA for Nogo-B
           protein (Nogo gene).
          Length = 373

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 47/184 (25%), Positives = 89/184 (48%), Gaps = 10/184 (5%)
 Frame = -3

Query: 840 GGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSN 670
           G    D+  WRD K +G V  F  ++++L  L  + ++++  +I +  L++ ISF ++  
Sbjct: 183 GSVVVDLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKG 240

Query: 669 ASTFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFL 511
               I KS    P        V + ++ V   +++    +N T+  LR +    D+   L
Sbjct: 241 VIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSL 300

Query: 510 AVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAV 331
                +WV + +G  FN LTL  L ++ L +VP++YE+++ Q+D +   A   +    A 
Sbjct: 301 KFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAK 360

Query: 330 LNEK 319
           +  K
Sbjct: 361 IQAK 364



>gb:AB015639_1864742 Homo sapiens ASY mRNA, complete cds.
          Length = 373

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 47/184 (25%), Positives = 89/184 (48%), Gaps = 10/184 (5%)
 Frame = -3

Query: 840 GGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSN 670
           G    D+  WRD K +G V  F  ++++L  L  + ++++  +I +  L++ ISF ++  
Sbjct: 183 GSVVVDLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKG 240

Query: 669 ASTFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFL 511
               I KS    P        V + ++ V   +++    +N T+  LR +    D+   L
Sbjct: 241 VIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSL 300

Query: 510 AVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAV 331
                +WV + +G  FN LTL  L ++ L +VP++YE+++ Q+D +   A   +    A 
Sbjct: 301 KFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAK 360

Query: 330 LNEK 319
           +  K
Sbjct: 361 IQAK 364



>gb:CQ783030_1452267 Sequence 3170 from Patent EP1396543.
          Length = 291

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 47/184 (25%), Positives = 89/184 (48%), Gaps = 10/184 (5%)
 Frame = -3

Query: 840 GGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSN 670
           G    D+  WRD K +G V  F  ++++L  L  + ++++  +I +  L++ ISF ++  
Sbjct: 101 GSVVVDLLYWRDIKKTGVV--FGVSLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKG 158

Query: 669 ASTFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFL 511
               I KS    P        V + ++ V   +++    +N T+  LR +    D+   L
Sbjct: 159 VIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSL 218

Query: 510 AVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAV 331
                +WV + +G  FN LTL  L ++ L +VP++YE+++ Q+D +   A   +    A 
Sbjct: 219 KFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAK 278

Query: 330 LNEK 319
           +  K
Sbjct: 279 IQAK 282



>gb:BC032192_2097342 Mus musculus reticulon 4, mRNA (cDNA clone
           MGC:38204 IMAGE:5323152), complete cds.
          Length = 639

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 45/179 (25%), Positives = 88/179 (49%), Gaps = 10/179 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
           D+  WRD K +G V  F  ++++L  L  + ++++  +I +  L++ ISF ++      I
Sbjct: 454 DLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAI 511

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            KS    P        V + ++ V   +++    +N T+  LR +    D+   L     
Sbjct: 512 QKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLFLVDDLVDSLKFAVL 571

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
           +WV + +G  FN LTL  L ++ L ++P++YE+++ Q+D +   A   +    A +  K
Sbjct: 572 MWVFTYVGALFNGLTLLILALISLFSIPVIYERHQAQIDHYLGLANKSVKDAMAKIQAK 630



>gb:AL929371_2073163 Mouse DNA sequence from clone RP23-176O5 on
            chromosome 11 Contains a ribosomal protein S2 (Rps2)
            pseudogene, a novel gene, an apurinic/apyrimidinic
            endonuclease 2 (Apex2) pseudogene, the Rtn4 gene for
            reticulon 4, the 3' end of the gene for a novel protein
            (C230094A16Rik) (MGC38936) and a CpG island, complete
            sequence.>gb:AY102280_2076228 Mus musculus RTN4 (Rtn4)
            mRNA, complete cds, alternatively
            spliced.>gb:AY102286_2076236 Mus musculus RTN4 (Rtn4)
            gene, complete cds, alternatively spliced.
          Length = 1046

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 45/179 (25%), Positives = 88/179 (49%), Gaps = 10/179 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
            D+  WRD K +G V  F  ++++L  L  + ++++  +I +  L++ ISF ++      I
Sbjct: 861  DLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAI 918

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P        V + ++ V   +++    +N T+  LR +    D+   L     
Sbjct: 919  QKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLFLVDDLVDSLKFAVL 978

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
            +WV + +G  FN LTL  L ++ L ++P++YE+++ Q+D +   A   +    A +  K
Sbjct: 979  MWVFTYVGALFNGLTLLILALISLFSIPVIYERHQAQIDHYLGLANKSVKDAMAKIQAK 1037



>gb:AL929371_2073160 Mouse DNA sequence from clone RP23-176O5 on
            chromosome 11 Contains a ribosomal protein S2 (Rps2)
            pseudogene, a novel gene, an apurinic/apyrimidinic
            endonuclease 2 (Apex2) pseudogene, the Rtn4 gene for
            reticulon 4, the 3' end of the gene for a novel protein
            (C230094A16Rik) (MGC38936) and a CpG island, complete
            sequence.>gb:AY102284_2076232 Mus musculus RTN4 (Rtn4)
            mRNA, complete cds, alternatively
            spliced.>gb:AY102286_2076233 Mus musculus RTN4 (Rtn4)
            gene, complete cds, alternatively spliced.
          Length = 1162

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 45/179 (25%), Positives = 88/179 (49%), Gaps = 10/179 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
            D+  WRD K +G V  F  ++++L  L  + ++++  +I +  L++ ISF ++      I
Sbjct: 977  DLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAI 1034

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P        V + ++ V   +++    +N T+  LR +    D+   L     
Sbjct: 1035 QKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLFLVDDLVDSLKFAVL 1094

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
            +WV + +G  FN LTL  L ++ L ++P++YE+++ Q+D +   A   +    A +  K
Sbjct: 1095 MWVFTYVGALFNGLTLLILALISLFSIPVIYERHQAQIDHYLGLANKSVKDAMAKIQAK 1153



>gb:AB073672_2047500 Mus musculus mRNA for Nogo-A, partial cds.
          Length = 578

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 45/179 (25%), Positives = 88/179 (49%), Gaps = 10/179 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
           D+  WRD K +G V  F  ++++L  L  + ++++  +I +  L++ ISF ++      I
Sbjct: 393 DLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAI 450

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            KS    P        V + ++ V   +++    +N T+  LR +    D+   L     
Sbjct: 451 QKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLFLVDDLVDSLKFAVL 510

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
           +WV + +G  FN LTL  L ++ L ++P++YE+++ Q+D +   A   +    A +  K
Sbjct: 511 MWVFTYVGALFNGLTLLILALISLFSIPVIYERHQAQIDHYLGLANKSVKDAMAKIQAK 569



>gb:CR861110_1185126 Pongo pygmaeus mRNA; cDNA DKFZp459C0314 (from
           clone DKFZp459C0314).
          Length = 199

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 44/182 (24%), Positives = 87/182 (47%), Gaps = 10/182 (5%)
 Frame = -3

Query: 834 KPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF---LWSNAS 664
           K  D+  WRD K +G V  F  ++++L  L  + ++++  +I +  L+++    ++    
Sbjct: 11  KVVDLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALALLSVTISSRIYKGVI 68

Query: 663 TFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAV 505
             I KS    P        V + ++ V   +++    +N T+  LR +    D+   L  
Sbjct: 69  QAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKF 128

Query: 504 IAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLN 325
              +WV + +G  FN LTL  L ++ L +VP++YE+++ Q+D +   A   +    A + 
Sbjct: 129 AVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQ 188

Query: 324 EK 319
            K
Sbjct: 189 AK 190



>gb:HSA251383_2001638 Homo sapiens mRNA for Nogo-A protein (Nogo
            gene).
          Length = 1192

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 46/179 (25%), Positives = 88/179 (49%), Gaps = 10/179 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
            D+  WRD K +G V  F  ++++L  L  + ++++  +I +  L++ ISF ++      I
Sbjct: 1007 DLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAI 1064

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P        V + ++ V   +++    +N T+  LR +    D+   L     
Sbjct: 1065 QKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVL 1124

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
            +WV + +G  FN LTL  L ++ L +VP++YE+++ Q+D +   A   +    A +  K
Sbjct: 1125 MWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAK 1183



>gb:AY102285_1936460 Homo sapiens RTN4 (RTN4) gene, complete sequence,
            alternatively spliced.>gb:AY123245_1936672 Homo sapiens
            RTN4 isoform Aa (RTN4) mRNA, complete cds; alternatively
            spliced.>gb:AY123246_1936673 Homo sapiens RTN4 isoform Ab
            (RTN4) mRNA, complete cds; alternatively
            spliced.>gb:AY123247_1936674 Homo sapiens RTN4 isoform D
            (RTN4) mRNA, complete cds; alternatively
            spliced.>gb:AY123248_1936675 Homo sapiens RTN4 isoform E
            (RTN4) mRNA, complete cds; alternatively
            spliced.>gb:AY123249_1936676 Homo sapiens RTN4 isoform F
            (RTN4) mRNA, complete cds; alternatively
            spliced.>gb:AY123250_1936677 Homo sapiens RTN4 isoform G
            (RTN4) mRNA, complete cds; alternatively spliced.
          Length = 986

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 46/179 (25%), Positives = 88/179 (49%), Gaps = 10/179 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
            D+  WRD K +G V  F  ++++L  L  + ++++  +I +  L++ ISF ++      I
Sbjct: 801  DLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAI 858

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P        V + ++ V   +++    +N T+  LR +    D+   L     
Sbjct: 859  QKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVL 918

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
            +WV + +G  FN LTL  L ++ L +VP++YE+++ Q+D +   A   +    A +  K
Sbjct: 919  MWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAK 977



>gb:AF333336_1897145 Homo sapiens testis specific reticulon 5 protein
            mRNA, complete cds.
          Length = 986

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 46/179 (25%), Positives = 88/179 (49%), Gaps = 10/179 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
            D+  WRD K +G V  F  ++++L  L  + ++++  +I +  L++ ISF ++      I
Sbjct: 801  DLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAI 858

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P        V + ++ V   +++    +N T+  LR +    D+   L     
Sbjct: 859  QKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVL 918

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
            +WV + +G  FN LTL  L ++ L +VP++YE+++ Q+D +   A   +    A +  K
Sbjct: 919  MWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAK 977



>gb:AF320999_1896622 Homo sapiens Nogo-A protein short form mRNA,
            complete cds, alternatively spliced.
          Length = 960

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 46/179 (25%), Positives = 88/179 (49%), Gaps = 10/179 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
            D+  WRD K +G V  F  ++++L  L  + ++++  +I +  L++ ISF ++      I
Sbjct: 775  DLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAI 832

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P        V + ++ V   +++    +N T+  LR +    D+   L     
Sbjct: 833  QKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVL 892

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
            +WV + +G  FN LTL  L ++ L +VP++YE+++ Q+D +   A   +    A +  K
Sbjct: 893  MWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAK 951



>gb:AF063601_1880224 Homo sapiens brain my043 protein mRNA, complete
           cds.
          Length = 647

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 46/179 (25%), Positives = 88/179 (49%), Gaps = 10/179 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
           D+  WRD K +G V  F  ++++L  L  + ++++  +I +  L++ ISF ++      I
Sbjct: 462 DLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAI 519

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            KS    P        V + ++ V   +++    +N T+  LR +    D+   L     
Sbjct: 520 QKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVL 579

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
           +WV + +G  FN LTL  L ++ L +VP++YE+++ Q+D +   A   +    A +  K
Sbjct: 580 MWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAK 638



>gb:AB020693_1865291 Homo sapiens mRNA for KIAA0886 protein, partial
            cds.
          Length = 1233

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 46/179 (25%), Positives = 88/179 (49%), Gaps = 10/179 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
            D+  WRD K +G V  F  ++++L  L  + ++++  +I +  L++ ISF ++      I
Sbjct: 1048 DLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAI 1105

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P        V + ++ V   +++    +N T+  LR +    D+   L     
Sbjct: 1106 QKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVL 1165

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
            +WV + +G  FN LTL  L ++ L +VP++YE+++ Q+D +   A   +    A +  K
Sbjct: 1166 MWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAK 1224



>sp|Q9JK11|RTN4_RAT Reticulon 4 (Neurite outgrowth inhibitor) (Nogo
            protein) (Foocen) (Glut4 vesicle 20 kDa
            protein).>gb:CQ829507_1453691 Sequence 25 from Patent
            WO2004052932.>gb:RNO242961_2135453 Rattus norvegicus mRNA
            for Nogo-A protein.
          Length = 1163

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 45/179 (25%), Positives = 88/179 (49%), Gaps = 10/179 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
            D+  WRD K +G V  F  ++++L  L  + ++++  +I +  L++ ISF ++      I
Sbjct: 978  DLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAI 1035

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P        V + ++ V   +++    +N T+  LR +    D+   L     
Sbjct: 1036 QKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLFLVDDLVDSLKFAVL 1095

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
            +WV + +G  FN LTL  L ++ L ++P++YE+++ Q+D +   A   +    A +  K
Sbjct: 1096 MWVFTYVGALFNGLTLLILALISLFSIPVIYERHQVQIDHYLGLANKSVKDAMAKIQAK 1154



>sp|Q9NQC3|RTN4_HUMAN Reticulon 4 (Neurite outgrowth inhibitor) (Nogo
            protein) (Foocen) (Neuroendocrine-specific protein) (NSP)
            (Neuroendocrine specific protein C homolog) (RTN-x)
            (Reticulon 5) (My043 protein).>gb:CQ829486_1453688
            Sequence 4 from Patent WO2004052932.>gb:AX195249_1463814
            Sequence 5 from Patent WO0151520.>gb:AB040462_1866783
            Homo sapiens mRNA for RTN-xL, complete
            cds.>gb:AF148537_1886172 Homo sapiens reticulon 4a mRNA,
            complete cds.>gb:AY102279_1936456 Homo sapiens RTN4
            isoform A (RTN4) mRNA, complete cds; alternatively
            spliced.>gb:AY102285_1936457 Homo sapiens RTN4 (RTN4)
            gene, complete sequence, alternatively spliced.
          Length = 1192

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 46/179 (25%), Positives = 88/179 (49%), Gaps = 10/179 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
            D+  WRD K +G V  F  ++++L  L  + ++++  +I +  L++ ISF ++      I
Sbjct: 1007 DLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAI 1064

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P        V + ++ V   +++    +N T+  LR +    D+   L     
Sbjct: 1065 QKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVL 1124

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
            +WV + +G  FN LTL  L ++ L +VP++YE+++ Q+D +   A   +    A +  K
Sbjct: 1125 MWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAK 1183



>gb:AY843529_2546910 Gallus gallus NOGO isoform A2 (NOGO) mRNA,
            complete cds, alternatively spliced.
          Length = 1065

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 46/179 (25%), Positives = 87/179 (48%), Gaps = 10/179 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
            D+  WRD K +G V  F  ++++L  L  + ++++  +I +  L++ ISF ++      I
Sbjct: 880  DLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAI 937

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P        V + ++ +   +S +   IN T+  LR +    D+   L     
Sbjct: 938  QKSDEGHPFRAYLESDVAVSEELIQKYSSVVLGHINGTVKELRRLFLVDDLVDSLKFAVL 997

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
            +WV + +G  FN LTL  L ++ L +VP++YE+++ Q+D +       +    A +  K
Sbjct: 998  MWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLVNKNVKDAMAKIQAK 1056



>gb:AY494005_2534835 Gallus gallus neurite outgrowth inhibitor NOGO-A
            (NOGO) mRNA, partial cds.
          Length = 658

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 46/179 (25%), Positives = 87/179 (48%), Gaps = 10/179 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
            D+  WRD K +G V  F  ++++L  L  + ++++  +I +  L++ ISF ++      I
Sbjct: 473  DLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAI 530

Query: 654  NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             KS    P        V + ++ +   +S +   IN T+  LR +    D+   L     
Sbjct: 531  QKSDEGHPFRAYLESDVAVSEELIQKYSSVVLGHINGTVKELRRLFLVDDLVDSLKFAVL 590

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
            +WV + +G  FN LTL  L ++ L +VP++YE+++ Q+D +       +    A +  K
Sbjct: 591  MWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLVNKNVKDAMAKIQAK 649



>gb:AY484582_2534028 Xenopus laevis reticulon 1-A (RTN1-A) mRNA,
            complete cds.
          Length = 752

 Score = 66.6 bits (161), Expect = 8e-10
 Identities = 42/164 (25%), Positives = 84/164 (51%), Gaps = 10/164 (6%)
 Frame = -3

Query: 834  KPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA--ISF-LWSNAS 664
            K  D+  WRD K +G V  F + + +LF L  + +++++ ++ + AL+  ISF ++ +  
Sbjct: 565  KAIDLLYWRDVKQTGIV--FGSILLMLFSLTLFSVVSVIAYLALAALSATISFRIYKSVL 622

Query: 663  TFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAV 505
              + K+    P        + L Q+ +       ++  N     LR +   +D+   L  
Sbjct: 623  QAVQKTDEGHPFKSYLDIEISLSQEQIQKYTGCFQLYTNSIAKELRRLFLVQDLVDSLKF 682

Query: 504  IAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAF 373
               +W+L+ +G  FN LTL  + VV + ++P++Y+KY+ Q+D +
Sbjct: 683  AVLMWLLTYVGALFNGLTLLIMAVVSMFSLPVVYDKYQAQIDQY 726



>gb:BC084108_2563514 Xenopus laevis cDNA clone MGC:84121
           IMAGE:6950395, complete cds.
          Length = 207

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 41/161 (25%), Positives = 83/161 (51%), Gaps = 10/161 (6%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA--ISF-LWSNASTFI 655
           D+  WRD K +G V  F + + +LF L  + +++++ ++ + AL+  ISF ++ +    +
Sbjct: 23  DLLYWRDVKQTGIV--FGSILLMLFSLTLFSVVSVIAYLALAALSATISFRIYKSVLQAV 80

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            K+    P        + L Q+ +       ++  N     LR +   +D+   L     
Sbjct: 81  QKTDEGHPFKSYLDIEISLSQEQIQKYTGCFQLYTNSIAKELRRLFLVQDLVDSLKFAVL 140

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAF 373
           +W+L+ +G  FN LTL  + VV + ++P++Y+KY+ Q+D +
Sbjct: 141 MWLLTYVGALFNGLTLLIMAVVSMFSLPVVYDKYQAQIDQY 181



>gb:AF498369_2498171 Xenopus laevis reticulon 1-C.2 (Rtn1-C.2) mRNA,
           complete cds.
          Length = 207

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 40/161 (24%), Positives = 83/161 (51%), Gaps = 10/161 (6%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA--ISF-LWSNASTFI 655
           D+  WRD K +G V  F + + +LF L  + +++++ ++ + AL+  ISF ++ +    +
Sbjct: 23  DLLYWRDVKQTGIV--FGSILLMLFSLTLFSVVSVIAYLALAALSATISFRIYKSVLQAV 80

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            K+    P        + L Q+ +       ++  N     LR +   +D+   L     
Sbjct: 81  QKTDEGHPFKSYLDIEISLSQEQIQKYTGCFQLYTNSIAKELRRLFLVQDLVDSLKFAVL 140

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAF 373
           +W+L+ +G  FN LTL  + VV + ++P++Y+KY+ Q++ +
Sbjct: 141 MWLLTYVGALFNGLTLLIMAVVSMFSLPVVYDKYQAQIEQY 181



>gb:AF132046_2055796 Rattus norvegicus foocen-m1 mRNA, alternate
           splice product, complete cds.
          Length = 358

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 46/184 (25%), Positives = 88/184 (47%), Gaps = 10/184 (5%)
 Frame = -3

Query: 840 GGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSN 670
           G    D+  WRD K +G V  F  ++++L  L  + ++++  +I +  L++ ISF ++  
Sbjct: 170 GSVVVDLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKG 227

Query: 669 ASTFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFL 511
               I KS    P        V + ++ V   +++    +N T+  LR +    D+   L
Sbjct: 228 VIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLFLVDDLVDSL 287

Query: 510 AVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAV 331
                +WV + +G  FN LTL  L ++ L ++P++YE++  Q+D +   A   +    A 
Sbjct: 288 KFAVLMWVFTYVGALFNGLTLLILALISLFSIPVIYERH--QIDHYLGLANKSVKDAMAK 345

Query: 330 LNEK 319
           +  K
Sbjct: 346 IQAK 349



>gb:BC071446_2556186 Danio rerio reticulon 1, mRNA (cDNA clone
           MGC:86778 IMAGE:6900192), complete cds.
          Length = 164

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 43/173 (24%), Positives = 79/173 (45%)
 Frame = -3

Query: 837 GKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTF 658
           G+  D+  WRD K SG V G   ++ +LF L ++        +++    IS      S +
Sbjct: 15  GQVVDLVHWRDLKQSGPVFG---SVLLLFSLTQFS-------VVLSGGGISLSADQISKY 64

Query: 657 INKSPPQIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSV 478
           ++K+                     ++ IN T+  LR +   +D+   +     +W+L+ 
Sbjct: 65  VDKT---------------------QLYINTTMKELRRLFLVQDLVDSIKFAVLMWLLTY 103

Query: 477 MGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
           +G  FN LTL  L V+ + +VP++YEKY+ Q+D +      ++      + EK
Sbjct: 104 VGALFNGLTLLILAVISMFSVPVVYEKYQTQIDQYLGLVRTQVNSVMGKIREK 156



>gb:AF038537_2051871 Mus musculus NSP-like 1 (Nspl1) gene,
           alternatively spliced products, complete
           cds.>gb:AF038539_2051873 Mus musculus muscle NSP-like 1
           (Nspl1) mRNA, complete cds.
          Length = 204

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 46/190 (24%), Positives = 88/190 (46%), Gaps = 10/190 (5%)
 Frame = -3

Query: 840 GGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF---LWSN 670
           G K AD+  W+D + SGAV  F   +  L  L+ + ++++  H+ +L L  +    ++  
Sbjct: 2   GSKVADLLYWKDTRTSGAV--FTGLMASLLCLLHFSIVSVAAHLALLGLCATISLRVYRK 59

Query: 669 ASTFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFL 511
               +++     P        + L ++    ++  +   +  T   LR     +D+   L
Sbjct: 60  VLQAVHRGDGTNPFQAYLDMDLTLTREQTERLSQQIASHVVSTATQLRHFFLVEDLVDSL 119

Query: 510 AVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAV 331
            +    ++L+ +G  FN LTL  L VV L TVP+LY +++ Q+D +       +  Q + 
Sbjct: 120 KLALLFYILTFVGAIFNGLTLVILGVVALFTVPLLYRQHQAQIDQYV----GLVTNQLSH 175

Query: 330 LNEKYLSKIP 301
           +  K  +KIP
Sbjct: 176 IKAKIRAKIP 185



>gb:BC081614_2562408 Danio rerio zgc:92163, mRNA (cDNA clone
           MGC:92163 IMAGE:7050304), complete cds.
          Length = 197

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 44/185 (23%), Positives = 89/185 (48%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
           ++  WRD + +G V  F   +++L  L    +++++ ++ +  L++ +SF ++      +
Sbjct: 12  ELLYWRDLQRTGVV--FGAGLFLLLSLSMCSIISVLSYVALALLSVTVSFRIYKGILQAV 69

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            KS    P          LP + V   + +  + IN  +  LR +   +D+   L     
Sbjct: 70  QKSEDGHPFKMYLDKDTALPAEMVHKYSDSTLVHINTVIKELRRLFLVEDLVDSLKFAVL 129

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
           +W+L+ +G  FN LTL  L  +   + P++YEK++ Q+D +       + KQ+  +  K 
Sbjct: 130 MWILTYVGALFNGLTLIILGFIGAFSCPVIYEKHQAQIDHY----YGLVNKQFKDVVGKI 185

Query: 315 LSKIP 301
            +KIP
Sbjct: 186 QAKIP 190



>sp|O70622|RTN2_MOUSE Reticulon protein 2 (Neuroendocrine-specific
           protein-like 1) (NSP-like protein 1)
           (NSPLI).>gb:AF038537_2051870 Mus musculus NSP-like 1
           (Nspl1) gene, alternatively spliced products, complete
           cds.>gb:AF038538_2051872 Mus musculus brain NSP-like 1
           (Nspl1) mRNA, complete cds.>gb:AF093624_2054216 Mus
           musculus Nsp-like 1 protein (Nspl1) gene, complete cds;
           tRNA-Sec gene, complete sequence; and FosB protein
           (Fosb) gene, complete cds.>gb:BC031370_2097036 Mus
           musculus reticulon 2 (Z-band associated protein), mRNA
           (cDNA clone MGC:35990 IMAGE:5359358), complete cds.
          Length = 471

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 44/186 (23%), Positives = 86/186 (46%), Gaps = 10/186 (5%)
 Frame = -3

Query: 828 ADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF---LWSNASTF 658
           AD+  W+D + SGAV  F   +  L  L+ + ++++  H+ +L L  +    ++      
Sbjct: 273 ADLLYWKDTRTSGAV--FTGLMASLLCLLHFSIVSVAAHLALLGLCATISLRVYRKVLQA 330

Query: 657 INKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIA 499
           +++     P        + L ++    ++  +   +  T   LR     +D+   L +  
Sbjct: 331 VHRGDGTNPFQAYLDMDLTLTREQTERLSQQIASHVVSTATQLRHFFLVEDLVDSLKLAL 390

Query: 498 GLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
             ++L+ +G  FN LTL  L VV L TVP+LY +++ Q+D +       +  Q + +  K
Sbjct: 391 LFYILTFVGAIFNGLTLVILGVVALFTVPLLYRQHQAQIDQYV----GLVTNQLSHIKAK 446

Query: 318 YLSKIP 301
             +KIP
Sbjct: 447 IRAKIP 452



>gb:AY279211_2081554 Rattus norvegicus reticulon 2 mRNA, complete
           cds.
          Length = 469

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 43/186 (23%), Positives = 86/186 (46%), Gaps = 10/186 (5%)
 Frame = -3

Query: 828 ADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF---LWSNASTF 658
           AD+  W+D + SGA+  F   +  L  L+ + ++++  H+ +L L  +    ++      
Sbjct: 271 ADLLYWKDTRTSGAI--FTGLMASLLCLLHFSIVSVAAHLALLGLCATISLRVYRKVLQA 328

Query: 657 INKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIA 499
           +++     P        + L ++    ++  +   +  T   LR     +D+   L +  
Sbjct: 329 VHRGDGTNPFQAYLDMDLTLTREQTERLSQQIASHVVSTATQLRHFFLVEDLVDSLKLAL 388

Query: 498 GLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
             ++L+ +G  FN LTL  L VV L TVP+LY +++ Q+D +       +  Q + +  K
Sbjct: 389 LFYILTFVGAIFNGLTLVILGVVALFTVPLLYRQHQAQIDQYV----GLVTSQLSHIKAK 444

Query: 318 YLSKIP 301
             +KIP
Sbjct: 445 IRAKIP 450



>pir|C84422|C84422 hypothetical protein At2g01240 [imported] -
           Arabidopsis thaliana>gb:AC006200_1533563 Arabidopsis
           thaliana chromosome 2 clone F10A8 map rga, complete
           sequence.
          Length = 160

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 42/145 (28%), Positives = 76/145 (52%), Gaps = 4/145 (2%)
 Frame = -3

Query: 714 HILILALAISFLWSNASTFINKSPPQIPSVILPQ----DTVLNVASALRIEINRTLAVLR 547
           H L++ L +     ++++ +N   P   S+ L Q    D+ L    AL   +   L +L 
Sbjct: 17  HTLLVPLGVHGSSISSASLLNLVTPHAHSLPLGQLNQPDSPLK---ALFSMMEGHLLMLY 73

Query: 546 EIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAE 367
           EIA GKD K FL  I  + ++  +G+  + LT+ Y+ +V   T+P++Y ++++ +D+F  
Sbjct: 74  EIAYGKDNKTFLKTILYVAIIYNIGSYISLLTILYICLVCSMTIPVVYMQFQELIDSFMG 133

Query: 366 KAEAEIMKQYAVLNEKYLSKIPKGP 292
           K   E      V  ++ +SKIP+ P
Sbjct: 134 KVSEEKNNLLEVF-KQVVSKIPRAP 157



>pir|T26213|T26213 hypothetical protein W06A7.3b - Caenorhabditis
           elegans>gb:CEW06A7_1368956 Caenorhabditis elegans cosmid
           W06A7, complete sequence.
          Length = 222

 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 50/183 (27%), Positives = 85/183 (46%), Gaps = 10/183 (5%)
 Frame = -3

Query: 837 GKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF---LWSNA 667
           GK  D+  WRD K S  V+  A  + VLF L +Y LLT+V + L+LAL  +    ++   
Sbjct: 25  GKILDVIYWRDAKKSAIVLSLA--LLVLFVLAKYPLLTVVTYSLLLALGAAAGFRVFKKV 82

Query: 666 STFINKSPPQIP-SVILPQDTVL---NVASALRIEINRTLAVLREIASGKDVKKFLAVIA 499
              I K+  + P S IL QD  L    V +   + +     +  ++     V+  L  I 
Sbjct: 83  EAQIKKTDSEHPFSEILAQDLTLPQEKVHAQADVFVEHATCIANKLKKLVFVESPLESIK 142

Query: 498 G---LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVL 328
               LW L+ + + F+  TL  L ++ + +VP +YE  ++ +D         +     ++
Sbjct: 143 FGLVLWSLTYIASWFSGFTLAILGLLGVFSVPKVYESNQEAIDPHLATISGHLKNVQNII 202

Query: 327 NEK 319
           +EK
Sbjct: 203 DEK 205



>gb:AB049853_1867778 Macaca fascicularis brain cDNA,
           clone:QnpA-18952.
          Length = 179

 Score = 56.6 bits (135), Expect = 9e-07
 Identities = 40/165 (24%), Positives = 80/165 (48%), Gaps = 10/165 (6%)
 Frame = -3

Query: 783 VGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFINKSPPQIP------ 631
           V F  ++++L  L  + ++++  +I +  L++ ISF ++      I KS    P      
Sbjct: 6   VVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYRGVIQAIQKSDEGHPFRAYLE 65

Query: 630 -SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFL 454
             V + ++ V   +++    +N T+  LR +    D+   L     +WV + +G  FN L
Sbjct: 66  SEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLRFAVLMWVFTYVGALFNGL 125

Query: 453 TLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
           TL  L ++ L +VP++YE+++ Q+D +   A   +    A +  K
Sbjct: 126 TLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAK 170



>gb:AF125103_1150109 Homo sapiens neuroendocrine specific protein c
           homolog mRNA, complete cds.
          Length = 199

 Score = 56.6 bits (135), Expect = 9e-07
 Identities = 44/182 (24%), Positives = 83/182 (45%), Gaps = 10/182 (5%)
 Frame = -3

Query: 834 KPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNAS 664
           K  D+  WRD K +G V  F  ++++L  L  + ++++  +I +  L++ ISF ++    
Sbjct: 11  KVVDLLYWRDIKKTGVV--FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVI 68

Query: 663 TFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAV 505
             I KS    P        V + ++ V   +++    +N T+  LR +    D+   L  
Sbjct: 69  QAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKF 128

Query: 504 IAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLN 325
              +WV + +G  FN LTL  L ++ L       E+++ Q+D +   A   +    A + 
Sbjct: 129 AVLMWVFTYVGALFNGLTLLILALISLLQCSCYLERHQAQIDHYLGLANKNVKDAMAKIQ 188

Query: 324 EK 319
            K
Sbjct: 189 AK 190



>gb:AE014134_1127583 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003608_1217690 Drosophila melanogaster
           chromosome 2L, section 17 of 83 of the complete
           sequence.
          Length = 222

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 46/199 (23%), Positives = 89/199 (44%), Gaps = 10/199 (5%)
 Frame = -3

Query: 837 GKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILAL--AISF-LWSNA 667
           G    +  WRD K SG V  F   +  L  +  + ++++  ++ +L L   ++F ++ + 
Sbjct: 24  GPVESLIYWRDVKKSGIV--FGAGLITLAAISSFSVISVFAYLSLLTLFGTVAFRIYKSV 81

Query: 666 STFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLA 508
           +  + K+    P        + L  + V N+A      IN  ++ LR +   +D+   + 
Sbjct: 82  TQAVQKTNEGHPFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLFLVEDIIDSIK 141

Query: 507 VIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVL 328
               LWV + +G  FN +TL  L  V L T+P +YE  +  +D   +   +++ +    +
Sbjct: 142 FGVILWVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSIDTHLDLVRSKLTE----I 197

Query: 327 NEKYLSKIPKGPLKDKKLA 271
            +K    IP G  K +  A
Sbjct: 198 TDKIRVAIPIGNKKPEAAA 216



>gb:AE014134_1127578 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003608_1217685 Drosophila melanogaster
           chromosome 2L, section 17 of 83 of the complete
           sequence.
          Length = 595

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 46/199 (23%), Positives = 89/199 (44%), Gaps = 10/199 (5%)
 Frame = -3

Query: 837 GKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILAL--AISF-LWSNA 667
           G    +  WRD K SG V  F   +  L  +  + ++++  ++ +L L   ++F ++ + 
Sbjct: 397 GLVESLIYWRDVKKSGIV--FGAGLITLAAISSFSVISVFAYLSLLTLFGTVAFRIYKSV 454

Query: 666 STFINKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLA 508
           +  + K+    P        + L  + V N+A      IN  ++ LR +   +D+   + 
Sbjct: 455 TQAVQKTNEGHPFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLFLVEDIIDSIK 514

Query: 507 VIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVL 328
               LWV + +G  FN +TL  L  V L T+P +YE  +  +D   +   +++ +    +
Sbjct: 515 FGVILWVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSIDTHLDLVRSKLTE----I 570

Query: 327 NEKYLSKIPKGPLKDKKLA 271
            +K    IP G  K +  A
Sbjct: 571 TDKIRVAIPIGNKKPEAAA 589



>gb:BC073874_1989151 Homo sapiens reticulon 2, transcript variant 1,
           mRNA (cDNA clone MGC:90317 IMAGE:5242827), complete cds.
          Length = 545

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 47/190 (24%), Positives = 85/190 (44%), Gaps = 10/190 (5%)
 Frame = -3

Query: 840 GGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF---LWSN 670
           G K AD+  W+D + SG V  F   +  L  L+ + ++++  H+ +L L  +    ++  
Sbjct: 342 GSKVADLLYWKDTRTSGVV--FTGLMVSLLCLLHFSIVSVAAHLALLLLCGTISLRVYRK 399

Query: 669 ASTFINKSPPQIP-SVILPQDTVLNVASALRIEINRTLAV------LREIASGKDVKKFL 511
               +++     P    L  D  L      R+    T  V      LR     +D+   L
Sbjct: 400 VLQAVHRGDGANPFQAYLDVDLTLTREQTERLSHQITSRVVSAATQLRHFFLVEDLVDSL 459

Query: 510 AVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAV 331
            +    ++L+ +G  FN LTL  L V+ L T+P+LY +++ Q+D +       +  Q + 
Sbjct: 460 KLALLFYILTFVGAIFNGLTLLILGVIGLFTIPLLYRQHQAQIDQYV----GLVTNQLSH 515

Query: 330 LNEKYLSKIP 301
           +  K  +KIP
Sbjct: 516 IKAKIRAKIP 525



>gb:AF004224_1875851 Homo sapiens RTN2-C (RTN2) mRNA, complete cds.
          Length = 205

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 47/190 (24%), Positives = 85/190 (44%), Gaps = 10/190 (5%)
 Frame = -3

Query: 840 GGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF---LWSN 670
           G K AD+  W+D + SG V  F   +  L  L+ + ++++  H+ +L L  +    ++  
Sbjct: 2   GSKVADLLYWKDTRTSGVV--FTGLMVSLLCLLHFSIVSVAAHLALLLLCGTISLRVYRK 59

Query: 669 ASTFINKSPPQIP-SVILPQDTVLNVASALRIEINRTLAV------LREIASGKDVKKFL 511
               +++     P    L  D  L      R+    T  V      LR     +D+   L
Sbjct: 60  VLQAVHRGDGANPFQAYLDVDLTLTREQTERLSHQITSRVVSAATQLRHFFLVEDLVDSL 119

Query: 510 AVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAV 331
            +    ++L+ +G  FN LTL  L V+ L T+P+LY +++ Q+D +       +  Q + 
Sbjct: 120 KLALLFYILTFVGAIFNGLTLLILGVIGLFTIPLLYRQHQAQIDQYV----GLVTNQLSH 175

Query: 330 LNEKYLSKIP 301
           +  K  +KIP
Sbjct: 176 IKAKIRAKIP 185



>gb:AP005735_1856857 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC
           clone:OSJNBb0034B12.>gb:AP006756_1862914 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, PAC
           clone:P0450E05.
          Length = 570

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 52/187 (27%), Positives = 83/187 (44%), Gaps = 11/187 (5%)
 Frame = -3

Query: 876 FGRERHVHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILA 697
           FG  +   K+LG G  ADI LWRD+K       + T +++LF        T V     + 
Sbjct: 374 FGSSK-AEKLLGSGITADILLWRDEK---KTFSYVTVLFLLFYWFLLSDRTFVSSAAKIL 429

Query: 696 LAISFLWSNASTFIN-KSPPQIPSVI----------LPQDTVLNVASALRIEINRTLAVL 550
           L IS      + FI+   PPQ+              + Q+T+ N    +    N  +  L
Sbjct: 430 LVISL-----ALFIHGVLPPQVFGFTVEKVTSDYFEVSQETLKNTLVWMASIWNGGIYKL 484

Query: 549 REIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFA 370
           R +A G D   FL   A L+ + VM N   F  L  L++  +  V ++YE+ E+++D+  
Sbjct: 485 RVLAEGDDWTTFLKAFAFLYCVKVMLN-LQFRMLMGLVLAFMFVVFIVYEQCEEEIDSLV 543

Query: 369 EKAEAEI 349
             A  ++
Sbjct: 544 AFASVKV 550



>gb:BT011111_1357718 Drosophila melanogaster LD43688 full insert
           cDNA.
          Length = 458

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 45/194 (23%), Positives = 88/194 (45%), Gaps = 10/194 (5%)
 Frame = -3

Query: 822 IFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILAL--AISF-LWSNASTFIN 652
           +  WRD K SG V  F   +  L  +  + ++++  ++ +L L   ++F ++ + +  + 
Sbjct: 265 LIYWRDVKKSGIV--FGAGLITLAAISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQ 322

Query: 651 KSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAGL 493
           K+    P        + L  + V N+A      IN  ++ LR +   +D+   +     L
Sbjct: 323 KTNEGHPFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLFLVEDIIDSIKFGVIL 382

Query: 492 WVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKYL 313
           WV + +G  FN +TL  L  V L T+P +YE  +  +D   +   +++ +    + +K  
Sbjct: 383 WVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSIDTHLDLVRSKLTE----ITDKIR 438

Query: 312 SKIPKGPLKDKKLA 271
             IP G  K +  A
Sbjct: 439 VAIPIGNKKPEAAA 452



>gb:AE014134_1127584 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003608_1217691 Drosophila melanogaster
           chromosome 2L, section 17 of 83 of the complete
           sequence.
          Length = 202

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 45/194 (23%), Positives = 88/194 (45%), Gaps = 10/194 (5%)
 Frame = -3

Query: 822 IFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILAL--AISF-LWSNASTFIN 652
           +  WRD K SG V  F   +  L  +  + ++++  ++ +L L   ++F ++ + +  + 
Sbjct: 9   LIYWRDVKKSGIV--FGAGLITLAAISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQ 66

Query: 651 KSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAGL 493
           K+    P        + L  + V N+A      IN  ++ LR +   +D+   +     L
Sbjct: 67  KTNEGHPFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLFLVEDIIDSIKFGVIL 126

Query: 492 WVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKYL 313
           WV + +G  FN +TL  L  V L T+P +YE  +  +D   +   +++ +    + +K  
Sbjct: 127 WVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSIDTHLDLVRSKLTE----ITDKIR 182

Query: 312 SKIPKGPLKDKKLA 271
             IP G  K +  A
Sbjct: 183 VAIPIGNKKPEAAA 196



>gb:AE014134_1127581 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE014134_1127582 Drosophila melanogaster
           chromosome 2L, complete sequence.>gb:AE003608_1217688
           Drosophila melanogaster chromosome 2L, section 17 of 83
           of the complete sequence.>gb:AE003608_1217689 Drosophila
           melanogaster chromosome 2L, section 17 of 83 of the
           complete sequence.
          Length = 224

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 45/194 (23%), Positives = 88/194 (45%), Gaps = 10/194 (5%)
 Frame = -3

Query: 822 IFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILAL--AISF-LWSNASTFIN 652
           +  WRD K SG V  F   +  L  +  + ++++  ++ +L L   ++F ++ + +  + 
Sbjct: 31  LIYWRDVKKSGIV--FGAGLITLAAISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQ 88

Query: 651 KSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAGL 493
           K+    P        + L  + V N+A      IN  ++ LR +   +D+   +     L
Sbjct: 89  KTNEGHPFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLFLVEDIIDSIKFGVIL 148

Query: 492 WVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKYL 313
           WV + +G  FN +TL  L  V L T+P +YE  +  +D   +   +++ +    + +K  
Sbjct: 149 WVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSIDTHLDLVRSKLTE----ITDKIR 204

Query: 312 SKIPKGPLKDKKLA 271
             IP G  K +  A
Sbjct: 205 VAIPIGNKKPEAAA 218



>gb:AE014134_1127579 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE014134_1127580 Drosophila melanogaster
           chromosome 2L, complete sequence.>gb:AE003608_1217686
           Drosophila melanogaster chromosome 2L, section 17 of 83
           of the complete sequence.>gb:AE003608_1217687 Drosophila
           melanogaster chromosome 2L, section 17 of 83 of the
           complete sequence.>gb:AY069432_1294162 Drosophila
           melanogaster LD14068 full length cDNA.
          Length = 234

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 45/194 (23%), Positives = 88/194 (45%), Gaps = 10/194 (5%)
 Frame = -3

Query: 822 IFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILAL--AISF-LWSNASTFIN 652
           +  WRD K SG V  F   +  L  +  + ++++  ++ +L L   ++F ++ + +  + 
Sbjct: 41  LIYWRDVKKSGIV--FGAGLITLAAISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQ 98

Query: 651 KSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAGL 493
           K+    P        + L  + V N+A      IN  ++ LR +   +D+   +     L
Sbjct: 99  KTNEGHPFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLFLVEDIIDSIKFGVIL 158

Query: 492 WVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKYL 313
           WV + +G  FN +TL  L  V L T+P +YE  +  +D   +   +++ +    + +K  
Sbjct: 159 WVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSIDTHLDLVRSKLTE----ITDKIR 214

Query: 312 SKIPKGPLKDKKLA 271
             IP G  K +  A
Sbjct: 215 VAIPIGNKKPEAAA 228



>sp|O75298|RTN2_HUMAN Reticulon protein 2 (Neuroendocrine-specific
           protein-like 1) (NSP-like protein 1)
           (NSPLI).>gb:AF004222_1875849 Homo sapiens RTN2-A (RTN2)
           mRNA, complete cds.
          Length = 545

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 47/190 (24%), Positives = 85/190 (44%), Gaps = 10/190 (5%)
 Frame = -3

Query: 840 GGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF---LWSN 670
           G K AD+  W+D + SG V  F   +  L  L+ + ++++  H+ +L L  +    ++  
Sbjct: 342 GSKVADLLYWKDTRTSGVV--FTGLMVSLLCLLHFSIVSVAAHLALLLLCGTISLRVYRK 399

Query: 669 ASTFINKSPPQIP-SVILPQDTVLNVASALRIEINRTLAV------LREIASGKDVKKFL 511
               +++     P    L  D  L      R+    T  V      LR     +D+   L
Sbjct: 400 VLQAVHRGDGANPFQAYLDVDLTLTREQTERLSHQITSRVVSAATQLRHFFLVEDLVDSL 459

Query: 510 AVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAV 331
            +    ++L+ +G  FN LTL  L V+ L T+P+LY +++ Q+D +       +  Q + 
Sbjct: 460 KLALLFYILTFVGAIFNGLTLLILGVIGLFTIPLLYRQHQAQIDQYV----GLVTNQLSH 515

Query: 330 LNEKYLSKIP 301
           +  K  +KIP
Sbjct: 516 IKAKIRAKIP 525



>gb:CEW06A7_1368957 Caenorhabditis elegans cosmid W06A7, complete
           sequence.
          Length = 204

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 49/182 (26%), Positives = 84/182 (46%), Gaps = 10/182 (5%)
 Frame = -3

Query: 834 KPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF---LWSNAS 664
           K  D+  WRD K S  V+  A  + VLF L +Y LLT+V + L+LAL  +    ++    
Sbjct: 8   KVLDVIYWRDAKKSAIVLSLA--LLVLFVLAKYPLLTVVTYSLLLALGAAAGFRVFKKVE 65

Query: 663 TFINKSPPQIP-SVILPQDTVL---NVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
             I K+  + P S IL QD  L    V +   + +     +  ++     V+  L  I  
Sbjct: 66  AQIKKTDSEHPFSEILAQDLTLPQEKVHAQADVFVEHATCIANKLKKLVFVESPLESIKF 125

Query: 495 ---LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLN 325
              LW L+ + + F+  TL  L ++ + +VP +YE  ++ +D         +     +++
Sbjct: 126 GLVLWSLTYIASWFSGFTLAILGLLGVFSVPKVYESNQEAIDPHLATISGHLKNVQNIID 185

Query: 324 EK 319
           EK
Sbjct: 186 EK 187



>gb:CEW06A7_1368955 Caenorhabditis elegans cosmid W06A7, complete
           sequence.
          Length = 570

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 48/179 (26%), Positives = 83/179 (46%), Gaps = 10/179 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF---LWSNASTFI 655
           D+  WRD K S  V+  A  + VLF L +Y LLT+V + L+LAL  +    ++      I
Sbjct: 377 DVIYWRDAKKSAIVLSLA--LLVLFVLAKYPLLTVVTYSLLLALGAAAGFRVFKKVEAQI 434

Query: 654 NKSPPQIP-SVILPQDTVL---NVASALRIEINRTLAVLREIASGKDVKKFLAVIAG--- 496
            K+  + P S IL QD  L    V +   + +     +  ++     V+  L  I     
Sbjct: 435 KKTDSEHPFSEILAQDLTLPQEKVHAQADVFVEHATCIANKLKKLVFVESPLESIKFGLV 494

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
           LW L+ + + F+  TL  L ++ + +VP +YE  ++ +D         +     +++EK
Sbjct: 495 LWSLTYIASWFSGFTLAILGLLGVFSVPKVYESNQEAIDPHLATISGHLKNVQNIIDEK 553



>pir|T26216|T26216 hypothetical protein W06A7.3c - Caenorhabditis
            elegans>gb:CEW06A7_1368953 Caenorhabditis elegans cosmid
            W06A7, complete sequence.
          Length = 2484

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 48/179 (26%), Positives = 83/179 (46%), Gaps = 10/179 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF---LWSNASTFI 655
            D+  WRD K S  V+  A  + VLF L +Y LLT+V + L+LAL  +    ++      I
Sbjct: 2291 DVIYWRDAKKSAIVLSLA--LLVLFVLAKYPLLTVVTYSLLLALGAAAGFRVFKKVEAQI 2348

Query: 654  NKSPPQIP-SVILPQDTVL---NVASALRIEINRTLAVLREIASGKDVKKFLAVIAG--- 496
             K+  + P S IL QD  L    V +   + +     +  ++     V+  L  I     
Sbjct: 2349 KKTDSEHPFSEILAQDLTLPQEKVHAQADVFVEHATCIANKLKKLVFVESPLESIKFGLV 2408

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
            LW L+ + + F+  TL  L ++ + +VP +YE  ++ +D         +     +++EK
Sbjct: 2409 LWSLTYIASWFSGFTLAILGLLGVFSVPKVYESNQEAIDPHLATISGHLKNVQNIIDEK 2467



>pir|T26215|T26215 hypothetical protein W06A7.3a - Caenorhabditis
            elegans>gb:CEW06A7_1368954 Caenorhabditis elegans cosmid
            W06A7, complete sequence.
          Length = 2607

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 48/179 (26%), Positives = 83/179 (46%), Gaps = 10/179 (5%)
 Frame = -3

Query: 825  DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF---LWSNASTFI 655
            D+  WRD K S  V+  A  + VLF L +Y LLT+V + L+LAL  +    ++      I
Sbjct: 2414 DVIYWRDAKKSAIVLSLA--LLVLFVLAKYPLLTVVTYSLLLALGAAAGFRVFKKVEAQI 2471

Query: 654  NKSPPQIP-SVILPQDTVL---NVASALRIEINRTLAVLREIASGKDVKKFLAVIAG--- 496
             K+  + P S IL QD  L    V +   + +     +  ++     V+  L  I     
Sbjct: 2472 KKTDSEHPFSEILAQDLTLPQEKVHAQADVFVEHATCIANKLKKLVFVESPLESIKFGLV 2531

Query: 495  LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
            LW L+ + + F+  TL  L ++ + +VP +YE  ++ +D         +     +++EK
Sbjct: 2532 LWSLTYIASWFSGFTLAILGLLGVFSVPKVYESNQEAIDPHLATISGHLKNVQNIIDEK 2590



>gb:AY164754_2516216 Carassius auratus RTN4-M (RTN4) mRNA, complete
           cds.
          Length = 214

 Score = 53.9 bits (128), Expect = 6e-06
 Identities = 43/185 (23%), Positives = 87/185 (47%), Gaps = 10/185 (5%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILI--LALAISF-LWSNASTFI 655
           D+  WRD + +G V  F  ++ +L  L    +++++ ++ +  L++ ISF ++      +
Sbjct: 29  DLLYWRDLQRTGVV--FGASLLLLLSLSVCSIISVISYVALALLSVTISFRIYKGILQAV 86

Query: 654 NKSPPQIP-------SVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAG 496
            KS    P        + +  + V   +      IN  +  LR +   +D+   L     
Sbjct: 87  QKSEDGHPFKMYLDKDIGISSELVQKYSDTALAHINCVIKELRRLFLVEDLVDSLKFAVF 146

Query: 495 LWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
           +W+L+ +G  FN LTL  + ++   + P++YEK++ Q+D +       + KQ   +  K 
Sbjct: 147 MWILTYVGALFNGLTLLIMGLIGTFSWPVIYEKHQAQIDHY----YGLVNKQIKDVMGKI 202

Query: 315 LSKIP 301
            +KIP
Sbjct: 203 QAKIP 207



>gb:AK176177_1818165 Arabidopsis thaliana mRNA for
           3-beta-hydroxysteroid dehydrogenase, complete cds,
           clone: RAFL23-04-I23.
          Length = 473

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 43/181 (23%), Positives = 85/181 (46%), Gaps = 3/181 (1%)
 Frame = -3

Query: 852 KVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWS 673
           ++LGGGK AD  LW+D K +   +    +I+  F      ++T +   L++A    FL  
Sbjct: 286 RILGGGKVADTLLWKDLKQTLIAIFILISIYYNFVATGSTVVTALSKALLVASVFLFLHG 345

Query: 672 -NASTFINKSPPQIPS--VILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVI 502
                    +  +IP+    L +D+  +++ ++    N T+  LR +  G D   F  V+
Sbjct: 346 ILPEKIFGYTVEKIPASQFHLSKDSSHDLSLSVISSWNTTVKALRSLCQGNDWSFFFKVV 405

Query: 501 AGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNE 322
             L  LS+ G + +  ++F + + +     ++YEK E ++D+     ++   K  + + E
Sbjct: 406 FVLLALSLAG-AISLHSIFVIGLPIAFLAFLVYEKKEQEIDSIVVSFKSFACKHKSDVYE 464

Query: 321 K 319
           K
Sbjct: 465 K 465



>gb:AY120728_1579610 Arabidopsis thaliana 3-beta-hydroxysteroid
           dehydrogenase (At2g26260) mRNA, complete cds.
          Length = 363

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 43/181 (23%), Positives = 85/181 (46%), Gaps = 3/181 (1%)
 Frame = -3

Query: 852 KVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWS 673
           ++LGGGK AD  LW+D K +   +    +I+  F      ++T +   L++A    FL  
Sbjct: 176 RILGGGKVADTLLWKDLKQTLIAIFILISIYYNFVATGSTVVTALSKALLVASVFLFLHG 235

Query: 672 -NASTFINKSPPQIPS--VILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVI 502
                    +  +IP+    L +D+  +++ ++    N T+  LR +  G D   F  V+
Sbjct: 236 ILPEKIFGYTVEKIPASQFHLSKDSSHDLSLSVISSWNTTVKALRSLCQGNDWSFFFKVV 295

Query: 501 AGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNE 322
             L  LS+ G + +  ++F + + +     ++YEK E ++D+     ++   K  + + E
Sbjct: 296 FVLLALSLAG-AISLHSIFVIGLPIAFLAFLVYEKKEQEIDSIVVSFKSFACKHKSDVYE 354

Query: 321 K 319
           K
Sbjct: 355 K 355



>gb:AF038540_1878129 Homo sapiens brain NSP-like 1 (NSPL1) mRNA,
           partial cds.
          Length = 365

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 45/186 (24%), Positives = 83/186 (44%), Gaps = 10/186 (5%)
 Frame = -3

Query: 828 ADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF---LWSNASTF 658
           AD+  W+D + SG V  F   +  L  L+ + ++++  H+ +L L  +    ++      
Sbjct: 166 ADLLYWKDTRTSGVV--FTGLMVSLLCLLHFSIVSVAAHLALLLLCGTISLRVYRKVLQA 223

Query: 657 INKSPPQIP-SVILPQDTVLNVASALRIEINRTLAV------LREIASGKDVKKFLAVIA 499
           +++     P    L  D  L      R+    T  V      LR     +D+   L +  
Sbjct: 224 VHRGDGANPFQAYLDVDLTLTREQTERLSHQITSRVVSAATQLRHFFLVEDLVDSLKLAL 283

Query: 498 GLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
             ++L+ +G  FN LTL  L V+ L T+P+LY +++ Q+D +       +  Q + +  K
Sbjct: 284 LFYILTFVGAIFNGLTLLILGVIGLFTIPLLYRQHQAQIDQYV----GLVTNQLSHIKAK 339

Query: 318 YLSKIP 301
             +KIP
Sbjct: 340 IRAKIP 345



>gb:AF004223_1875850 Homo sapiens RTN2-B (RTN2) mRNA, partial cds.
          Length = 304

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 45/186 (24%), Positives = 83/186 (44%), Gaps = 10/186 (5%)
 Frame = -3

Query: 828 ADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISF---LWSNASTF 658
           AD+  W+D + SG V  F   +  L  L+ + ++++  H+ +L L  +    ++      
Sbjct: 105 ADLLYWKDTRTSGVV--FTGLMVSLLCLLHFSIVSVAAHLALLLLCGTISLRVYRKVLQA 162

Query: 657 INKSPPQIP-SVILPQDTVLNVASALRIEINRTLAV------LREIASGKDVKKFLAVIA 499
           +++     P    L  D  L      R+    T  V      LR     +D+   L +  
Sbjct: 163 VHRGDGANPFQAYLDVDLTLTREQTERLSHQITSRVVSAATQLRHFFLVEDLVDSLKLAL 222

Query: 498 GLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
             ++L+ +G  FN LTL  L V+ L T+P+LY +++ Q+D +       +  Q + +  K
Sbjct: 223 LFYILTFVGAIFNGLTLLILGVIGLFTIPLLYRQHQAQIDQYV----GLVTNQLSHIKAK 278

Query: 318 YLSKIP 301
             +KIP
Sbjct: 279 IRAKIP 284



>gb:AF123892_1242912 Leishmania infantum 22 kDa potentially
           aggravating protein papLe22 mRNA, complete cds.
          Length = 197

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 40/184 (21%), Positives = 78/184 (42%)
 Frame = -3

Query: 858 VHKVLGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFL 679
           + K   G    D+  WR    SG +     T+W +F   EY L T V  I+ + L     
Sbjct: 4   IAKEFKGLTTKDVVTWRRPVASGLIFSSFFTMWAIFVFAEYTLTTFVSRIVSILLIAGAA 63

Query: 678 WSNASTFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIA 499
            +     I  SP  + + +       +V   +   ++ T+++L         K F+  + 
Sbjct: 64  AAVTKRTIVTSPEDVTASM--DRAYESVRPCVTKFVDCTISLLTWRDYAASAKFFMTTL- 120

Query: 498 GLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEK 319
              V++ +GN  +  TL  +I+++  T P+ YEK +++++   ++  A   K   ++   
Sbjct: 121 ---VMAFLGNWMSDTTLMLVILIVAFTAPVAYEKKQNEIEHAVQQVRAYADKYLGMIKTH 177

Query: 318 YLSK 307
             SK
Sbjct: 178 AESK 181



>gb:AY495963_2535078 Xenopus laevis RTN2-C (RTN2-C) mRNA, complete
           cds.
          Length = 192

 Score = 50.1 bits (118), Expect = 8e-05
 Identities = 43/190 (22%), Positives = 80/190 (42%), Gaps = 8/190 (4%)
 Frame = -3

Query: 825 DIFLWRDKKVS-GAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINK 649
           D+  WRD  +S G + G   ++  L +     +    C I++       L++     + +
Sbjct: 7   DLLYWRDTLLSTGCLTGVTLSLLCLSQFSVISVFAYGCLIILSVTLTLRLYTKLLHALKR 66

Query: 648 SPPQIP-SVILPQDTVLNVASALRI------EINRTLAVLREIASGKDVKKFLAVIAGLW 490
                P    L  D  L    A  I        + TL  LR +   +++K  L  +  ++
Sbjct: 67  GNGANPFQYYLDTDLKLTTKQAEEIVARAFSRASTTLCTLRSLFLVEELKDSLKFLVIVY 126

Query: 489 VLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKYLS 310
           +L+ +G  FN +T+  L V+   T P+LY++++ QVD +     + + K+      K+  
Sbjct: 127 LLTYVGAVFNGITVLLLCVIGAFTFPILYKQHQTQVDHYV----SLVSKKVNAFRSKFQG 182

Query: 309 KIPKGPLKDK 280
              K P K K
Sbjct: 183 AAKKPPAKQK 192



>gb:AY495962_2535077 Xenopus laevis RTN2-B (RTN2-B) mRNA, complete
           cds.
          Length = 321

 Score = 50.1 bits (118), Expect = 8e-05
 Identities = 43/190 (22%), Positives = 80/190 (42%), Gaps = 8/190 (4%)
 Frame = -3

Query: 825 DIFLWRDKKVS-GAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINK 649
           D+  WRD  +S G + G   ++  L +     +    C I++       L++     + +
Sbjct: 136 DLLYWRDTLLSTGCLTGVTLSLLCLSQFSVISVFAYGCLIILSVTLTLRLYTKLLHALKR 195

Query: 648 SPPQIP-SVILPQDTVLNVASALRI------EINRTLAVLREIASGKDVKKFLAVIAGLW 490
                P    L  D  L    A  I        + TL  LR +   +++K  L  +  ++
Sbjct: 196 GNGANPFQYYLDTDLKLTTKQAEEIVARAFSRASTTLCTLRSLFLVEELKDSLKFLVIVY 255

Query: 489 VLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKYLS 310
           +L+ +G  FN +T+  L V+   T P+LY++++ QVD +     + + K+      K+  
Sbjct: 256 LLTYVGAVFNGITVLLLCVIGAFTFPILYKQHQTQVDHYV----SLVSKKVNAFRSKFQG 311

Query: 309 KIPKGPLKDK 280
              K P K K
Sbjct: 312 AAKKPPAKQK 321



>gb:AE016815_1746130 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome II, complete sequence.
          Length = 278

 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 53/203 (26%), Positives = 85/203 (41%), Gaps = 24/203 (11%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFINKS 646
           D+ LWR+   +G V  F   +  L  L + +L+T    +L   L +S     AS F+   
Sbjct: 5   DLLLWRNPVETGKV--FGGLLVALLVLKKVNLVTFFLRVLYTTLFLSSAVEFASKFV--- 59

Query: 645 PPQIPSVILPQDTVL--------NVASALRIEINRTLAVL-------REIASGKDVKKFL 511
                   L Q  V         NVA  LR ++   LA L       R +      ++  
Sbjct: 60  --------LGQGLVTKYGVQECPNVAGMLRPKLEAALARLPAYQTQVRRLVFAASPQQTF 111

Query: 510 AVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVD-------AFAEKAEAE 352
                L+VL ++ + F+  TL  L VV   T+P++Y KY+ ++D       A A+   AE
Sbjct: 112 KAAGLLYVLHILVSFFSVWTLALLSVVGAFTLPVVYHKYQREIDDAVHQGLALAKAKSAE 171

Query: 351 IMKQYAVLNEKYLSKIPK--GPL 289
             K  +     Y+ +I +  GP+
Sbjct: 172 AQKMASETAAPYIKQIDEKFGPV 194



>gb:AY164748_2516215 Carassius auratus RTN3w (RTN3) mRNA, partial
           cds.
          Length = 107

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 23/83 (27%), Positives = 43/83 (51%)
 Frame = -3

Query: 627 VILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTL 448
           V +P +T           +NR L  +  +   +D+   L +   +W+++ +G  FN +T+
Sbjct: 25  VTVPPETFRKHVDVCLTHVNRALKQMSRLFLVEDLVDSLKLAVVMWLMTYVGAVFNGITI 84

Query: 447 FYLIVVLLHTVPMLYEKYEDQVD 379
             L  +LL +VP +YEK + Q+D
Sbjct: 85  LILADILLFSVPPIYEKNKTQID 107



>gb:CR380948_1649309 Candida glabrata strain CBS138 chromosome B
           complete sequence.
          Length = 294

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 43/177 (24%), Positives = 85/177 (48%), Gaps = 7/177 (3%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTL---VCHILILALAI----SFLWSNA 667
           D+ LWR+   +G V  F TT+  L  L + +LLT    V + ++L+ A+    + L    
Sbjct: 14  DLLLWRNPLETGKV--FGTTLVALLILKKVNLLTFFLRVGYTILLSTALLEFSTKLVLGQ 71

Query: 666 STFINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAVIAGLWV 487
                  P   P+V+     V++  +AL+ ++    A +R++      K+       L++
Sbjct: 72  GLVTKYGPKDCPNVVGMIKPVID--NALK-QMPVKQAKMRQLVFANSPKQTFKAAVVLYL 128

Query: 486 LSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQYAVLNEKY 316
           L    + F+  T+ ++  + L T+P++Y+ Y+ ++DA      AE++K      +KY
Sbjct: 129 LHKFFSWFSVWTILFVGDIALFTLPLVYKTYQKEIDAVV----AEVLKITRQKTQKY 181



>gb:CR382134_1667175 Debaryomyces hansenii chromosome B of strain
           CBS767 of Debaryomyces hansenii.
          Length = 279

 Score = 45.1 bits (105), Expect = 0.003
 Identities = 38/163 (23%), Positives = 69/163 (42%), Gaps = 13/163 (7%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALAISFLWSNASTFI--- 655
           D+  W+D   +G V  F T I+ L  L   +L  +  H   + L +S +      F+   
Sbjct: 21  DLLTWKDPVKTGKV--FGTIIFTLLVLKTVNLFNIFFHFAYIGLLVSAILEYVGKFVVGE 78

Query: 654 ---NKSPP-------QIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFLAV 505
              +K  P       +I   +LP     N          +  A +++I    D++  L  
Sbjct: 79  GFVSKYKPATKTYAKKINDELLPHVAEFN---------EKFEAEIQKILYAHDIEATLKA 129

Query: 504 IAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDA 376
               ++L  + + F+  TL  ++VVL  TVP +Y + + ++DA
Sbjct: 130 AGISYILYKITSLFSLYTLITIVVVLAFTVPAVYVRNKKEIDA 172



>gb:AC133932_1741632 Oryza sativa chromosome 3 BAC OSJNBb0074M06
           genomic sequence, complete sequence.
          Length = 561

 Score = 44.3 bits (103), Expect = 0.004
 Identities = 42/166 (25%), Positives = 74/166 (44%), Gaps = 10/166 (6%)
 Frame = -3

Query: 846 LGGGKPADIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLT-----LVCHILILALAISF 682
           LG G  A   LW D K +        T+ +L  ++ YHL T     +     + +L   F
Sbjct: 377 LGNGNLAKTVLWEDMKQT-------MTVLLLLAVIYYHLFTCGYTFITAMAKLFSLTALF 429

Query: 681 LWSN----ASTFINKSPPQIPSVI-LPQDTVLNVASALRIEINRTLAVLREIASGKDVKK 517
           L+ +    A+ F +K     PS   + Q    ++A ++    N  + VL+ +  G D   
Sbjct: 430 LFIHGILPANVFGHKVEKLEPSNFHITQVEAHHIAHSVSSTWNSLVGVLKSLCRGNDWPL 489

Query: 516 FLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVD 379
           F  V+  L V+S++ +S +  + F + + +       YEK+ED +D
Sbjct: 490 FFKVVFSLLVVSIL-SSMSSQSAFKIGISMAFLGFKAYEKWEDTID 534



>gb:AY880373_1180415 Gekko japonicus GekBS142P mRNA, complete cds.
          Length = 126

 Score = 43.5 bits (101), Expect = 0.008
 Identities = 21/60 (35%), Positives = 35/60 (58%)
 Frame = -3

Query: 552 LREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAF 373
           LR +    D+   L     +WV + +G  FN LTL  L V+ L ++P++YEK++ Q+D +
Sbjct: 40  LRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLMILAVISLFSIPVIYEKHQVQIDHY 99



>gb:BT005457_1638397 Arabidopsis thaliana clone U51255 unknown
           protein (At1g78895) mRNA, complete
           cds.>gb:AK118839_1816797 Arabidopsis thaliana At1g78895
           mRNA for unknown protein, complete cds, clone:
           RAFL21-17-A13.
          Length = 164

 Score = 43.1 bits (100), Expect = 0.010
 Identities = 37/141 (26%), Positives = 64/141 (45%)
 Frame = -3

Query: 756 LFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRI 577
           L  L     + L+C + IL L    L  N S  ++    QI      QDT  N+ + L  
Sbjct: 28  LLSLFSDVFIVLLCSLAILGLLFRQL--NVSVPVDPLEWQIS-----QDTASNIVARLAN 80

Query: 576 EINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEK 397
            +     VLR  A+G D + F+ V+  L+ LS +G   + +T+ Y   + L  + ML + 
Sbjct: 81  TVGAAEGVLRVAATGHDKRLFVKVVICLYFLSALGRLISGVTVAY-AGLCLFCLSMLCQT 139

Query: 396 YEDQVDAFAEKAEAEIMKQYA 334
            +   +   ++   +I++Q A
Sbjct: 140 SQSLGNCVLKRGNGQILEQEA 160



>gb:AY085180_1570259 Arabidopsis thaliana clone 13607 mRNA, complete
           sequence.
          Length = 161

 Score = 43.1 bits (100), Expect = 0.010
 Identities = 37/141 (26%), Positives = 64/141 (45%)
 Frame = -3

Query: 756 LFELMEYHLLTLVCHILILALAISFLWSNASTFINKSPPQIPSVILPQDTVLNVASALRI 577
           L  L     + L+C + IL L    L  N S  ++    QI      QDT  N+ + L  
Sbjct: 25  LLSLFSDVFIVLLCSLAILGLLFRQL--NVSVPVDPLEWQIS-----QDTASNIVARLAN 77

Query: 576 EINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEK 397
            +     VLR  A+G D + F+ V+  L+ LS +G   + +T+ Y   + L  + ML + 
Sbjct: 78  TVGAAEGVLRVAATGHDKRLFVKVVICLYFLSALGRLISGVTVAY-AGLCLFCLSMLCQT 136

Query: 396 YEDQVDAFAEKAEAEIMKQYA 334
            +   +   ++   +I++Q A
Sbjct: 137 SQSLGNCVLKRGNGQILEQEA 157



>gb:AC002335_1530408 Arabidopsis thaliana chromosome 2 clone T1O24
           map CIC10F02, complete sequence.>gb:AY045841_1561353
           Arabidopsis thaliana putative sterol dehydrogenase
           (At2g43420) mRNA, complete cds.>gb:AK117930_1815937
           Arabidopsis thaliana At2g43420 mRNA for putative sterol
           dehydrogenase, complete cds, clone: RAFL19-11-N11.
          Length = 561

 Score = 43.1 bits (100), Expect = 0.010
 Identities = 41/160 (25%), Positives = 74/160 (46%), Gaps = 6/160 (3%)
 Frame = -3

Query: 852 KVLGGGKPADIFLWRDKK---VSGAVVGFATTIWVLF--ELMEYHLLTLVCHILILALAI 688
           ++LG GK ADI LWR++K   VS  V+      W  F           L+    +    +
Sbjct: 372 QLLGCGKVADILLWRNEKKTFVSFLVLNL-FYYWFFFSGNTFTSSAAQLLFIFAVALYGV 430

Query: 687 SFLWSNASTF-INKSPPQIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKKFL 511
           SF+ S    F +NK PP      + +  V +++S + +  N+ +   + ++SG D  KF 
Sbjct: 431 SFVPSKIFGFQVNKIPPW--RFEISESAVRDLSSDIVVVWNQGVRSFKSLSSGGDWIKFF 488

Query: 510 AVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYE 391
            +   L++L ++  S +     + ++    T   +YE+YE
Sbjct: 489 KIAGSLYLLKLI-VSRSLAAFLFTVMSFSFTGFFIYEQYE 527



>pir|S59439|S59439 probable membrane protein YDR233c - yeast
           (Saccharomyces cerevisiae)>gb:AY164798_1586155
           Saccharomyces cerevisiae Rtn1p (Rtn1) mRNA, complete
           cds.>gb:AY558579_1614806 Saccharomyces cerevisiae clone
           FLH001943.01X YDR233C gene, complete
           cds.>gb:SC9934_1706337 S.cerevisiae chromosome IV cosmid
           9934.
          Length = 295

 Score = 35.4 bits (80), Expect = 2.1
 Identities = 36/176 (20%), Positives = 70/176 (39%), Gaps = 14/176 (7%)
 Frame = -3

Query: 825 DIFLWRDKKVSGAVVGFATTIWVLFELMEYHLLTLVCHILILALA-------ISFLWSNA 667
           D+ LWR+   +G    F  ++  L  L + +L+T    +    L        +S L+   
Sbjct: 22  DLLLWRNPVQTGKY--FGGSLLALLILKKVNLITFFLKVAYTILFTTGSIEFVSKLFLGQ 79

Query: 666 STFINKSPPQIPSVILPQDTVLNVASALRIEINRTL-------AVLREIASGKDVKKFLA 508
                  P + P          N+A  ++  I+  L       A +R+    +  K    
Sbjct: 80  GLITKYGPKECP----------NIAGFIKPHIDEALKQLPVFQAHIRKTVFAQVPKHTFK 129

Query: 507 VIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAFAEKAEAEIMKQ 340
               L++L    + F+  T+ ++  +   T+P++Y  Y+ ++DA   +   EI KQ
Sbjct: 130 TAVALFLLHKFFSWFSIWTIVFVADIFTFTLPVIYHSYKHEIDATVAQG-VEISKQ 184



>gb:AY119228_1300950 Drosophila melanogaster SD17344 full insert
           cDNA.
          Length = 222

 Score = 35.0 bits (79), Expect = 2.7
 Identities = 15/26 (57%), Positives = 19/26 (73%)
 Frame = +1

Query: 508 SKKFLHIFPRCNFSEHSKSSIDFNSQ 585
           +K+ LHI PRC+FS+ S  S D NSQ
Sbjct: 4   TKRLLHIHPRCSFSKRSHPSADRNSQ 29



>gb:AE014134_1128320 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003623_1218427 Drosophila melanogaster
           chromosome 2L, section 32 of 83 of the complete
           sequence.
          Length = 222

 Score = 35.0 bits (79), Expect = 2.7
 Identities = 15/26 (57%), Positives = 19/26 (73%)
 Frame = +1

Query: 508 SKKFLHIFPRCNFSEHSKSSIDFNSQ 585
           +K+ LHI PRC+FS+ S  S D NSQ
Sbjct: 4   TKRLLHIHPRCSFSKRSHPSADRNSQ 29



>pir|T01721|T01721 hypothetical protein A_IG002N01.8 - Arabidopsis
           thaliana>gb:IG002N01_1683043 Arabidopsis thaliana BAC
           IG002N01.
          Length = 444

 Score = 35.0 bits (79), Expect = 2.7
 Identities = 14/21 (66%), Positives = 17/21 (80%)
 Frame = -3

Query: 900 VKAKIYRLFGRERHVHKVLGG 838
           + A IYR+FGRER +H VLGG
Sbjct: 47  INAPIYRMFGRERPIHMVLGG 67



>pir|T28928|T28928 hypothetical protein C48B6.9 - Caenorhabditis
           elegans>gb:U97189_1407147 Caenorhabditis elegans cosmid
           C48B6, complete sequence.
          Length = 263

 Score = 34.7 bits (78), Expect = 3.5
 Identities = 30/121 (24%), Positives = 52/121 (42%), Gaps = 15/121 (12%)
 Frame = -3

Query: 732 LLTLVCHILILALAISFLWSNASTFIN--KSPPQ--------IPSVILPQDTVLNVASAL 583
           L   VC  L   +A+ F +SNA  F+   KSP          I  VI   D  + + S L
Sbjct: 86  LFMSVCSALFTVVALQFHFSNAERFLRTAKSPASAYRGVIDVIRDVIASFDVAIVILSIL 145

Query: 582 -----RIEINRTLAVLREIASGKDVKKFLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHT 418
                 +++   + ++++     D+   L  I     L ++  SF F ++   ++VL+ T
Sbjct: 146 AFFVSALQLLFLMKIVKQTQQPDDIDVALRYIKSTSFLRIVAFSFWFASIIVFVIVLMLT 205

Query: 417 V 415
           V
Sbjct: 206 V 206



>gb:AY278317_1315327 Pachypsylla venusta mitochondrion, complete
           genome.
          Length = 224

 Score = 33.9 bits (76), Expect = 6.0
 Identities = 24/108 (22%), Positives = 53/108 (49%), Gaps = 2/108 (1%)
 Frame = -3

Query: 690 ISFLWSNAST--FINKSPPQIPSVILPQDTVLNVASALRIEINRTLAVLREIASGKDVKK 517
           ISF W N +   F +  P   P++++P   ++ + S     I R LA+         V+ 
Sbjct: 115 ISFYWLNLTKLMFSHLVPSGTPNILMPLMVIIELTS----NIIRPLAL--------SVRL 162

Query: 516 FLAVIAGLWVLSVMGNSFNFLTLFYLIVVLLHTVPMLYEKYEDQVDAF 373
              +IAG  +++++GN+ N   + +  ++ + T+ +++E     + A+
Sbjct: 163 TANLIAGHLLMALLGNTLNMTQIQWPAIMFIQTLFLMFELMVALIQAY 210



>gb:AE017154_392626 Haemophilus ducreyi strain 35000HP section 4 of
           6 of the complete genome.>gb:AE017143_1026888
           Haemophilus ducreyi strain 35000HP complete genome.
          Length = 311

 Score = 33.9 bits (76), Expect = 6.0
 Identities = 21/63 (33%), Positives = 36/63 (57%), Gaps = 2/63 (3%)
 Frame = +1

Query: 796 NFLVPPQENISRFSSA*DLVHVSLAAE--EAIDLGLNSVGRWLVGMIVLGIGRRGIVALQ 969
           N+L    E +S +S A D +  +L     +A+++ LN  GR    ++V GIG+ G+V  +
Sbjct: 2   NYLTQATETLSLYSQAIDRLQHNLDQHFNQAVEMILNCAGR----VVVAGIGKSGLVGKK 57

Query: 970 LVA 978
           +VA
Sbjct: 58  MVA 60


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,123,117,865
Number of Sequences: 1806583
Number of extensions: 23225986
Number of successful extensions: 63309
Number of sequences better than 10.0: 170
Number of HSP's better than 10.0 without gapping: 60146
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 63158
length of database: 581,917,975
effective HSP length: 126
effective length of database: 354,288,517
effective search space used: 85383532597
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)