BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10048
         (984 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|H96589|H96589 hypothetical protein T22H22.19 [imported] - Ar...   372   e-102   Arabidopsis thaliana [mouse-ear cress]
gb:AC135418_1742226 Oryza sativa (japonica cultivar-group) chrom...   365   e-100   
gb:AP008231_579920 Synechococcus elongatus PCC 6301 DNA, complet...   115   2e-24   
pir|AE2318|AE2318 hypothetical protein alr4100 [imported] - Nost...   109   7e-23   Nostoc sp. PCC 7120
pir|S75671|S75671 hypothetical protein sll1390 - Synechocystis s...   100   4e-20   Synechocystis sp. PCC 6803
gb:BA000039_726188 Thermosynechococcus elongatus BP-1 DNA, compl...    98   3e-19   
gb:GTAJ10592_1681087 Guillardia theta DNA for complete sequence ...    80   5e-14   
gb:BX572097_798089 Prochlorococcus marinus MIT9313 complete geno...    74   3e-12   
gb:AE012178_280055 Xanthomonas campestris pv. campestris str. AT...    42   0.019   
gb:AE014134_1127553 Drosophila melanogaster chromosome 2L, compl...    36   1.0     
gb:AE016925_359194 Chromobacterium violaceum ATCC 12472 section ...    36   1.0     
gb:ATAC010927_1543220 Arabidopsis thaliana chromosome III BAC T2...    36   1.3     
gb:BACPHGLE1_1503967 Leptospira biflexa temperate bacteriophage ...    35   2.3     
gb:AE016819_1748744 Ashbya gossypii (= Eremothecium gossypii) AT...    35   3.0     
gb:AE016817_1747799 Ashbya gossypii (= Eremothecium gossypii) AT...    35   3.0     
gb:CR543861_105110 Acinetobacter sp. ADP1 complete genome.             34   3.9     
gb:AY326256_2083593 Rattus norvegicus limbic system-associated m...    34   5.0     
gb:HSA298318_2003039 Homo sapiens partial MUC5AC gene for mucin ...    34   5.0     
gb:BC033803_1981072 Homo sapiens limbic system-associated membra...    34   5.0     
gb:AX704805_1473488 Sequence 37 from Patent WO03014151.                34   5.0     
gb:AK044845_1167163 Mus musculus 9.5 days embryo parthenogenote ...    34   5.0     
gb:AP006841_571442 Bacteroides fragilis YCH46 DNA, complete genome.    34   5.0     
sp|Q62813|LAMP_RAT|LAMP_RAT Limbic system-associated membrane protein pre...    34   5.0     Rattus norvegicus [brown rat]
sp|Q13449|LAMP_HUMAN|LAMP_HUMAN Limbic system-associated membrane protein p...    34   5.0     Homo sapiens [man]
gb:SPBC1683_1719072 Schizosaccharomyces pombe cosmids c1683.           33   6.6     
pir|E83465|E83465 conserved hypothetical protein PA1451 [importe...    33   6.6     Pseudomonas aeruginosa
gb:AF082520_1239679 Cryptosporidium parvum Hsp60 gene, complete ...    33   8.6     
gb:CP000024_876697 Streptococcus thermophilus CNRZ1066, complete...    33   8.6     


>pir|H96589|H96589 hypothetical protein T22H22.19 [imported] -
           Arabidopsis thaliana>gb:AE005173_893372 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:ATH560718_1552895 Arabidopsis thaliana mRNA
           for lumenal protein subunit of photosystem
           II.>gb:AY062467_1565123 Arabidopsis thaliana Unknown
           protein (At1g54780; T22H22.19) mRNA, complete
           cds.>gb:AY081295_1568641 Arabidopsis thaliana unknown
           protein mRNA, complete cds.>gb:AY087803_1572830
           Arabidopsis thaliana clone 3853 mRNA, complete
           sequence.>gb:AY093282_1575236 Arabidopsis thaliana
           unknown protein (At1g54780) mRNA, complete
           cds.>gb:AY143889_1583346 Arabidopsis thaliana
           At1g54780/T22H22_19 mRNA, complete
           cds.>gb:BT000389_1634667 Arabidopsis thaliana unknown
           protein mRNA, complete cds.>gb:T22H22_1723784 Sequence
           of BAC T22H22 from Arabidopsis thaliana chromosome 1,
           complete sequence.>gb:AF375432_1792937 Arabidopsis
           thaliana At1g54780/T22H22_19 mRNA, complete cds.
          Length = 285

 Score =  372 bits (955), Expect = e-102
 Identities = 200/297 (67%), Positives = 231/297 (77%), Gaps = 6/297 (2%)
 Frame = -3

Query: 961 METLLSTPSFCPLFNPKPSRPSLSSQHRSNFLTLPKPLSCSLRREHSLPERQHLSL---- 794
           METLLS  +  P  NPKP      S H+    T P   S SL +  +    +HLS     
Sbjct: 1   METLLSPRALSPPLNPKPL-----SLHQ----TKPTSHSLSLSKPTTFSGPKHLSTRFTK 51

Query: 793 --PKTWISHVHQGLAALAISLALNFCPVLPSASALASEFDVLNEGPPKESYVVDDAGVLS 620
              + W+    QGLAALA+SL L F PV    +ALASEF++LN+GPPKE+YVVDDAGVLS
Sbjct: 52  PESRNWLIDAKQGLAALALSLTLTFSPV---GTALASEFNILNDGPPKETYVVDDAGVLS 108

Query: 619 RVTRSXXXXXXXXXEFRKGYHINFVTVRKLTSKADAFEYADQVLERWYPTVEEGSNKGIV 440
           RVT+S         E+RK   +NF+TVRKLTSKADAFEYADQVLE+WYP++EEG+NKGIV
Sbjct: 109 RVTKSDLKKLLSDLEYRKKLRLNFITVRKLTSKADAFEYADQVLEKWYPSIEEGNNKGIV 168

Query: 439 VLVTSQKEGAITGGPEFVKAVGDTILDATVSENLPVLATEEKYNEAVYSTAKRLVAAIDG 260
           VL+TSQKEGAITGGP F++AVG+ ILDATVSENLPVLAT+EKYNEAVYS+AKRLVAAIDG
Sbjct: 169 VLITSQKEGAITGGPAFIEAVGENILDATVSENLPVLATDEKYNEAVYSSAKRLVAAIDG 228

Query: 259 LPDPGGPVFKDNKRESNFKTKEETEEKRGQFSLVVGGLLVIAFVVPMAQYYAYVSKK 89
            PDPGGP  KD+KRESNFKTKEET+EKRGQFSLVVGGLLVIAFVVPMAQY+AYVS+K
Sbjct: 229 QPDPGGPTVKDSKRESNFKTKEETDEKRGQFSLVVGGLLVIAFVVPMAQYFAYVSRK 285



>gb:AC135418_1742226 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0035J16, complete sequence.
          Length = 299

 Score =  365 bits (938), Expect = e-100
 Identities = 197/301 (65%), Positives = 228/301 (75%), Gaps = 10/301 (3%)
 Frame = -3

Query: 961 METLLSTPSFCPLFNPKPSRPSLSSQHRSNFLTLP--KPLSCSLRREHSLPERQHLSLPK 788
           METLLS  +          +P+  +   S+  + P    +SC+LRR+   P+        
Sbjct: 1   METLLSPSTLLSPLRGSKKKPASPAASASSSSSSPARSVVSCALRRQQPPPQAVAAWRGD 60

Query: 787 --------TWISHVHQGLAALAISLALNFCPVLPSASALASEFDVLNEGPPKESYVVDDA 632
                   +W + +  GLAA A+SLA++  P    A A+ASEFDVLN GPP+++YVVDDA
Sbjct: 61  GGRGGGVGSWATFLQHGLAAAALSLAISMAPA--PAPAVASEFDVLNGGPPEDTYVVDDA 118

Query: 631 GVLSRVTRSXXXXXXXXXEFRKGYHINFVTVRKLTSKADAFEYADQVLERWYPTVEEGSN 452
           GVLSRVT+S         E RK   INF+TVRKLTSKADAFEYADQVLE+WYPTVEEG+N
Sbjct: 119 GVLSRVTKSDVKRLVRDLESRKNIRINFITVRKLTSKADAFEYADQVLEKWYPTVEEGNN 178

Query: 451 KGIVVLVTSQKEGAITGGPEFVKAVGDTILDATVSENLPVLATEEKYNEAVYSTAKRLVA 272
           KGIVVLVTSQKEGAITGGP FV+AVGD ILD+TVSENLPVLAT+EKYNEA+Y+TAKRL A
Sbjct: 179 KGIVVLVTSQKEGAITGGPAFVQAVGDEILDSTVSENLPVLATDEKYNEAIYTTAKRLAA 238

Query: 271 AIDGLPDPGGPVFKDNKRESNFKTKEETEEKRGQFSLVVGGLLVIAFVVPMAQYYAYVSK 92
           AIDGLPDPGGP FKDNKRESNFKTKEETEEKRGQF+LVVGGLLVIAFVVPMAQYYAY+SK
Sbjct: 239 AIDGLPDPGGPTFKDNKRESNFKTKEETEEKRGQFTLVVGGLLVIAFVVPMAQYYAYISK 298

Query: 91  K 89
           K
Sbjct: 299 K 299



>gb:AP008231_579920 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 208

 Score =  115 bits (287), Expect = 2e-24
 Identities = 68/187 (36%), Positives = 98/187 (52%), Gaps = 2/187 (1%)
 Frame = -3

Query: 652 SYVVDDAGVLSRVTRSXXXXXXXXXEFRKGYHINFVTVRKLTSKADAFEYADQVLERWYP 473
           +++VD+A  LSR+  S           + G  + FVT+R+L        + DQ+ +RWYP
Sbjct: 21  TWIVDEAQSLSRINESQLTGELQPLSQKTGIEVRFVTLRRLDYGETIDSFVDQLFKRWYP 80

Query: 472 TVEEGSNKGIVVLVTSQKEGAITGGPEFVKAVGDTILDATVSENLPV-LATEEKYNEAVY 296
             E  +N+ ++ L T      I  G    + +   I  + + E + V L    KYN+A+ 
Sbjct: 81  DAEAQANQVLIALDTITNTIGIRVGEVAAERLTPAIATSVIDETMQVPLRQGNKYNQAIL 140

Query: 295 STAKRLVAAIDGLPDPGGPVFKDNKR-ESNFKTKEETEEKRGQFSLVVGGLLVIAFVVPM 119
             + RLVA + G PDPG PV  D  R E  F + EETEE RG  ++VV   LV+A V+PM
Sbjct: 141 DASDRLVAVLSGEPDPGPPVVIDTTRVEGTFASAEETEESRGNSTVVVIVSLVLATVIPM 200

Query: 118 AQYYAYV 98
           A YY YV
Sbjct: 201 ATYYWYV 207



>pir|AE2318|AE2318 hypothetical protein alr4100 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_685089 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 245

 Score =  109 bits (273), Expect = 7e-23
 Identities = 72/218 (33%), Positives = 107/218 (49%), Gaps = 3/218 (1%)
 Frame = -3

Query: 739 LALNFCPVLPSASALASE-FDVLNEGPPKESYVVDDAGVLSRVTRSXXXXXXXXXEFRKG 563
           LA+     L SA ALAS  + + N      ++V+D   V+SR+                G
Sbjct: 23  LAIILAASLSSAPALASGVYQIPNLTAGDSTWVLDQGDVISRINEGAISSSLEDLAKETG 82

Query: 562 YHINFVTVRKLTSKADAFEYADQVLERWYPTVEEGSNKGIVVLVTSQKEGAITGGPEFVK 383
             + FVT+ +L        +A  + E+W+P+ E  +N+ ++VL T     AI  G E   
Sbjct: 83  KEVRFVTIHRLDYGETPESFAQALFEKWFPSKEAQANQILLVLDTVTNGTAIITGDEVKP 142

Query: 382 AVGDTILDATVSENLPV-LATEEKYNEAVYSTAKRLVAAIDGLPDPGGPVFKDNKR-ESN 209
            + DTI ++   E L   L    KYN+A    + RLVA + G PDPG P   D  + E  
Sbjct: 143 LLTDTIANSVAEETLAAPLRDGNKYNQAFLDASDRLVAVLSGQPDPGPPQIVDKVQVEGT 202

Query: 208 FKTKEETEEKRGQFSLVVGGLLVIAFVVPMAQYYAYVS 95
           FK  EET+  +G  +  V GLL+ A ++PMA YY Y++
Sbjct: 203 FKKAEETD--KGNATAWVVGLLIAATIIPMATYYIYLA 238



>pir|S75671|S75671 hypothetical protein sll1390 - Synechocystis sp.
           (strain PCC 6803)>gb:BA000022_689011 Synechocystis sp.
           PCC 6803 DNA, complete genome.
          Length = 249

 Score =  100 bits (249), Expect = 4e-20
 Identities = 70/243 (28%), Positives = 108/243 (44%), Gaps = 7/243 (2%)
 Frame = -3

Query: 805 HLSLPKTWISHVHQGLAALA------ISLALNFCPVLPSASALASEFDVLNEGPPKESYV 644
           H  LP T   H    L+         + L L    + P+ S     +D+    P  ++++
Sbjct: 4   HRQLPMTVAPHHPFNLSIFCKRLLSFLFLTLVLLGLSPAPSLATGVYDLPILSPGSKTFL 63

Query: 643 VDDAGVLSRVTRSXXXXXXXXXEFRKGYHINFVTVRKLTSKADAFEYADQVLERWYPTVE 464
           VD A  +S    +             G    FV +R+L   A    + + + ERWYP   
Sbjct: 64  VDQAEAISLANENRLNSDLKKLAQSSGQEARFVVIRRLDFDATIDGFVNDLFERWYPDEA 123

Query: 463 EGSNKGIVVLVTSQKEGAITGGPEFVKAVGDTILDATVSENLPV-LATEEKYNEAVYSTA 287
             SN+ ++VL T     A+  G      + D ++D+ + E L V L    KYN+A+    
Sbjct: 124 SQSNQTLLVLDTLTNSTALRRGETAESLLTDEMVDSLLRETLAVPLKDGAKYNQALIEAD 183

Query: 286 KRLVAAIDGLPDPGGPVFKDNKRESNFKTKEETEEKRGQFSLVVGGLLVIAFVVPMAQYY 107
           KRL A + G PDPG P  ++   E  F T EET++      +VV  LL +A ++PM  Y+
Sbjct: 184 KRLGAILAGQPDPGPPALEEISLEGTFTTAEETDDTSATVWVVV--LLALATLIPMVTYF 241

Query: 106 AYV 98
            YV
Sbjct: 242 WYV 244



>gb:BA000039_726188 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 228

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 56/188 (29%), Positives = 92/188 (48%)
 Frame = -3

Query: 664 PPKESYVVDDAGVLSRVTRSXXXXXXXXXEFRKGYHINFVTVRKLTSKADAFEYADQVLE 485
           P   + V+D+  VLS VT+              G +++ VT+ +L        + D +  
Sbjct: 39  PGTATGVIDEGNVLSAVTQGSVGRSLQDLSEATGINVHVVTLHRLDYGETPQSFVDDLFS 98

Query: 484 RWYPTVEEGSNKGIVVLVTSQKEGAITGGPEFVKAVGDTILDATVSENLPVLATEEKYNE 305
           +W+P  E  +N+ I+ L T     AI  G    + +     ++ V E + V   E  YN+
Sbjct: 99  QWFPDPESQANQVIIALDTVTNGTAIHYGDAVAERLNPETAESIVQETMRVPLREGNYNQ 158

Query: 304 AVYSTAKRLVAAIDGLPDPGGPVFKDNKRESNFKTKEETEEKRGQFSLVVGGLLVIAFVV 125
           AV  T  RL   + G PDPG PV ++   E  +K+KEET+++    +++V  LL+ A V+
Sbjct: 159 AVLDTVDRLGKVLKGEPDPGPPVVREVVVEKTYKSKEETDDRSA--TIIVVALLIAATVI 216

Query: 124 PMAQYYAY 101
           PM  Y+ Y
Sbjct: 217 PMVTYFMY 224



>gb:GTAJ10592_1681087 Guillardia theta DNA for complete sequence of
           nucleomorph chromosome 2.
          Length = 249

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 50/183 (27%), Positives = 93/183 (50%)
 Frame = -3

Query: 646 VVDDAGVLSRVTRSXXXXXXXXXEFRKGYHINFVTVRKLTSKADAFEYADQVLERWYPTV 467
           V D++GVL++ +           +   G+ ++F+++R L    D  +Y+  +       +
Sbjct: 69  VNDESGVLTKSSIVYLEKSSEKLQADFGFKLHFLSIRSLPYDVDISKYSKDIFNE----M 124

Query: 466 EEGSNKGIVVLVTSQKEGAITGGPEFVKAVGDTILDATVSENLPVLATEEKYNEAVYSTA 287
             G+   ++VL +    G+I  G + V  +   I ++ + +   V A EE+Y+ A     
Sbjct: 125 NLGNKDVLIVLSSKLASGSIVWGDD-VSLLNSQISESIIKDTYAVKAREEQYSSATIDVT 183

Query: 286 KRLVAAIDGLPDPGGPVFKDNKRESNFKTKEETEEKRGQFSLVVGGLLVIAFVVPMAQYY 107
            RL++ +    D       +   +SNFK+ + TEEKR +++ ++  LLVIAFVVPM Q++
Sbjct: 184 NRLISLLSNKGDIMPIERLNQSSQSNFKSAKATEEKRSKYAAIIIILLVIAFVVPMVQFF 243

Query: 106 AYV 98
            YV
Sbjct: 244 YYV 246



>gb:BX572097_798089 Prochlorococcus marinus MIT9313 complete genome;
           segment 3/7.
          Length = 227

 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 61/220 (27%), Positives = 105/220 (47%), Gaps = 5/220 (2%)
 Frame = -3

Query: 745 ISLALNFCPVLPSASALASE-FDVLNEGPPKESYVVDDAGVLSRVTRSXXXXXXXXXEFR 569
           IS+ L    ++P A A+ +E F V       E +V D A VLSRV+RS            
Sbjct: 14  ISILLGLILLVPGAFAITTEDFPVARP----EGHVFDSADVLSRVSRSQIEGRLVELGNE 69

Query: 568 KGYHINFVTVRKLTSKADAFEYADQVLERWYPTVEEGSNKGIVVLVTSQ-KEGAITGGPE 392
           +      +T+RKL        +   +++RW     E     +V+L+ +Q K+  +     
Sbjct: 70  R-LDARLITLRKLDYGVSLSNFGISLIDRWSTNAGEKELPLLVMLIDAQTKQTVVLADTS 128

Query: 391 FVKAVGDTILDAT--VSENLPVLATEEKYNEAVYSTAKRLVAAIDGLPDPGGPVFKDNK- 221
               + D +L +T   + N PV+  E +Y +A +    RL   +DG  DPG P+   +  
Sbjct: 129 LRSILPDALLQSTGRTTMNKPVVGGE-RYQQASFEAIARLQVVLDGGEDPGPPIETFSAI 187

Query: 220 RESNFKTKEETEEKRGQFSLVVGGLLVIAFVVPMAQYYAY 101
           +E+N  ++E+T+      +LVV  L+V+  +VPMA ++ +
Sbjct: 188 KETNIPSQEQTQSSNA--TLVVVVLMVVGTIVPMATWWVF 225



>gb:AE012178_280055 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 86 of 460 of the complete
           genome.>gb:AE008922_913337 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 305

 Score = 42.0 bits (97), Expect = 0.019
 Identities = 42/164 (25%), Positives = 68/164 (41%), Gaps = 4/164 (2%)
 Frame = -3

Query: 727 FCPVLPSASALASEFDVLNEGPPKESYVVDDAGVLSRVTRSXXXXXXXXXEFRKGYHINF 548
           FC +LP A+ +A +   +   PP  S VVD  G L               + RKG  +  
Sbjct: 18  FCALLP-ATVVAQDLAAI---PPLRSPVVDTTGTLDATQLQQLEQQALALQQRKGAQLQI 73

Query: 547 VTVRKLTSKADAFE-YADQVLERWYPTVEEGSNKGIVVLVT-SQKEGAITGGPEFVKAVG 374
           + V   T++ +A E Y  +V ++W     +G + G+++LV    +   I  G     A+ 
Sbjct: 74  LIVP--TTQPEAIEQYTQRVFDQW-KIGRKGVDDGVLLLVAKDDRRVRIQPGYGLEGAIP 130

Query: 373 DTILDATVSENLPVLATEEKYNEAVYSTAKRLVAAIDG--LPDP 248
           D + +  + E L     E  Y   +      L   I+G  LP P
Sbjct: 131 DIVANRIIQEYLAPRFREGDYGGGIRDATATLAGLIEGEALPAP 174



>gb:AE014134_1127553 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003575_1216117 Drosophila melanogaster
           chromosome 2L, section 16 of 83 of the complete
           sequence.
          Length = 1286

 Score = 36.2 bits (82), Expect = 1.0
 Identities = 44/198 (22%), Positives = 60/198 (30%)
 Frame = +3

Query: 126 TTKAITNKPPTTSENCPXXXXXXXXXXXXXXXXXXXNTGPPGSGSPSMXXXXXXXXXXXX 305
           TT   T++P TT+  C                    +T  P + +P              
Sbjct: 323 TTTTSTSRPTTTTPRCTTTPSTSRPTTTTPRSTTKTSTCAPTTTTPRPTTTPSTSRPTTT 382

Query: 306 SLYFSSVAKTGRFSETVASRIVSPTAFTNSGPPVIAPSF*LVTSTTMPLLLPSSTVGYQR 485
           +   ++   T R + T      S T  T   P    P     TST+ P      T    R
Sbjct: 383 TPRSTTTTSTSRPTTTTPR---STTTTTTRRPTTTTPRSTTTTSTSRP------TTTTPR 433

Query: 486 SKTWSAYSNASALLVSLRTVTKLMW*PFXXXXXXXXXXXXDRVTRLRTPASSTT*DSLGG 665
           S T +  S  +       T T     P              R T   TP S+TT  S  G
Sbjct: 434 STTTTTTSRPTTT-TPRSTTTTCTCSPTTTTPRSTTTTSTSRPTTT-TPRSTTT-TSTSG 490

Query: 666 PSLRTSNSDASAEAEGKT 719
           P+  T  S  +    G T
Sbjct: 491 PTTTTPRSTTTTTTSGPT 508



 Score = 34.7 bits (78), Expect = 3.0
 Identities = 41/198 (20%), Positives = 59/198 (29%)
 Frame = +3

Query: 126  TTKAITNKPPTTSENCPXXXXXXXXXXXXXXXXXXXNTGPPGSGSPSMXXXXXXXXXXXX 305
            TT   T++P TT+                       +T  P + +P              
Sbjct: 563  TTTTSTSRPTTTTPRSTTTTTTSRPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTT 622

Query: 306  SLYFSSVAKTGRFSETVASRIVSPTAFTNSGPPVIAPSF*LVTSTTMPLLLPSSTVGYQR 485
            +   ++   T   + T      S T  + SGP    P     TST+ P      T    R
Sbjct: 623  TPRSTTTTSTSGPTTTTPR---STTTTSTSGPTTTTPRSTTTTSTSGP------TTTTPR 673

Query: 486  SKTWSAYSNASALLVSLRTVTKLMW*PFXXXXXXXXXXXXDRVTRLRTPASSTT*DSLGG 665
            S T ++ S  +       T T                      T   TP S+TT  S  G
Sbjct: 674  STTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTT--TPRSTTT-TSTSG 730

Query: 666  PSLRTSNSDASAEAEGKT 719
            P+  T  S  +    G T
Sbjct: 731  PTTTTPRSTTTTSTSGPT 748



 Score = 33.1 bits (74), Expect = 8.6
 Identities = 41/198 (20%), Positives = 58/198 (29%)
 Frame = +3

Query: 126  TTKAITNKPPTTSENCPXXXXXXXXXXXXXXXXXXXNTGPPGSGSPSMXXXXXXXXXXXX 305
            TT   T+ P TT+                       +T  P + +P              
Sbjct: 723  TTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTT 782

Query: 306  SLYFSSVAKTGRFSETVASRIVSPTAFTNSGPPVIAPSF*LVTSTTMPLLLPSSTVGYQR 485
            +   ++   T   + T      S T  + SGP    P     TST+ P      T    R
Sbjct: 783  TPRSTTTTSTSGPTTTTPR---STTTTSTSGPTTTTPRSTTTTSTSGP------TTTTPR 833

Query: 486  SKTWSAYSNASALLVSLRTVTKLMW*PFXXXXXXXXXXXXDRVTRLRTPASSTT*DSLGG 665
            S T ++ S  +       T T                      T   TP S+TT  S  G
Sbjct: 834  STTTTSTSGPTTTTPRSTTTTSTSGPTTTTPRSTTTTSTSGPTTT--TPRSTTT-TSTSG 890

Query: 666  PSLRTSNSDASAEAEGKT 719
            P+  T  S  +    G T
Sbjct: 891  PTTTTPRSTTTTSTSGPT 908



>gb:AE016925_359194 Chromobacterium violaceum ATCC 12472 section 16
           of 16 of the complete genome.>gb:AE016825_1044348
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 281

 Score = 36.2 bits (82), Expect = 1.0
 Identities = 29/144 (20%), Positives = 58/144 (40%), Gaps = 2/144 (1%)
 Frame = -3

Query: 664 PPKESYVVDDAGVLSRVTRSXXXXXXXXXEFRKGYHINFVTVRKLTSKADAFEYADQVLE 485
           PP  S V+D A  L+   R            RKG  +  + V  +  +   F+Y  +V++
Sbjct: 26  PPPTSPVIDQAAFLTDAERGELEKQLLDFRQRKGSQLAVLIVPTVDPETP-FDYGTRVMD 84

Query: 484 RWYPTVEEGSNKGIVVLVTSQKEGAITGGPEFVKAVGDTILDATVSENLPVLATEEKYNE 305
            W    +   +  ++++V   ++  +  G     A+ D      + + L  L  +    +
Sbjct: 85  SWKLGRKGVDDGALLLIVAESRKTQLLVGRGLEGAIPDIYAKRILQDTLRPLFKQGLRFQ 144

Query: 304 AVYSTAKRLVAAIDG--LPDPGGP 239
            + +   ++   IDG  LP+P  P
Sbjct: 145 GIQAATAQIEGLIDGEKLPEPAKP 168



>gb:ATAC010927_1543220 Arabidopsis thaliana chromosome III BAC
           T22K18 genomic sequence, complete
           sequence.>gb:AY463613_1607702 Arabidopsis thaliana TAF12
           (TAF12) mRNA, partial cds.>gb:AF344878_1789900
           Arabidopsis thaliana putative TBP-associated 58 kDa
           subunit protein (TAFII58) mRNA, complete cds.
          Length = 539

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 29/97 (29%), Positives = 43/97 (44%), Gaps = 4/97 (4%)
 Frame = -3

Query: 970 TVQMETLLSTPSFCPLFNPKPS---RPSLSSQHRSNFLTLPKPLSCSLRREHSLPER-QH 803
           T Q +  L  PS+ P  N  PS   RP +  QH S     P+P     +++H   E+ Q 
Sbjct: 284 TPQGKPPLPPPSYRPQVN-SPSMQQRPHIPQQHISTSAATPQPQQQQSQQQHQPQEQLQQ 342

Query: 802 LSLPKTWISHVHQGLAALAISLALNFCPVLPSASALA 692
           L  P+  ++H HQ      +       PV+PS   +A
Sbjct: 343 LRSPQQPLAHPHQPTRVQGLVNQKVTSPVMPSQPPVA 379



>gb:BACPHGLE1_1503967 Leptospira biflexa temperate bacteriophage
           LE1.
          Length = 859

 Score = 35.0 bits (79), Expect = 2.3
 Identities = 33/133 (24%), Positives = 56/133 (42%), Gaps = 16/133 (12%)
 Frame = -3

Query: 463 EGSNKGIVVLVTSQKEGAIT--GGPEFVKAVGDTILDATVSENLPVLATEEKYNEAVYST 290
           +G + G  + V   KEG +T   G     AV + I +  + ++ P+   EEKYN    S 
Sbjct: 519 KGFDPGSPIKVDRDKEGKLTVVDGHHRFTAVKELISEGKLPKDTPIYVIEEKYN----SE 574

Query: 289 AKRLVAAIDGLPDPGGPVFKDNKRE--------------SNFKTKEETEEKRGQFSLVVG 152
           + RL+A +             NKRE              +  K+ +E  E+ G+ +  V 
Sbjct: 575 SDRLLAQVSA---------NKNKREVERLDDAKAYAKLIAQGKSVQEISERTGESAEYVK 625

Query: 151 GLLVIAFVVPMAQ 113
           G + +  ++P  Q
Sbjct: 626 GTIALNNLIPELQ 638



>gb:AE016819_1748744 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome VI, complete sequence.
          Length = 935

 Score = 34.7 bits (78), Expect = 3.0
 Identities = 27/100 (27%), Positives = 41/100 (41%), Gaps = 7/100 (7%)
 Frame = -3

Query: 448  GIVVLVTSQKEGAITGGPEFVKAVGDTILDATVSE--NLPVLATEEKYNEAVY-----ST 290
            G    +T   E  +T  P    +V  +   +   E  N+P+  T   Y+ +       ST
Sbjct: 748  GSAEYLTGTSEQPVTATPSTKSSVKASSFQSETKEDTNIPISVTSISYSSSGTQASRTST 807

Query: 289  AKRLVAAIDGLPDPGGPVFKDNKRESNFKTKEETEEKRGQ 170
            A+   AA+ G+P+  G    DN+  S     E  EE  GQ
Sbjct: 808  AEYGTAAVTGIPESSGGPANDNETASEEAETELPEESYGQ 847



>gb:AE016817_1747799 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 757

 Score = 34.7 bits (78), Expect = 3.0
 Identities = 21/54 (38%), Positives = 28/54 (51%)
 Frame = -1

Query: 954 PFSPLHLSVHSSIPNLQDLHFLPNTDQIFSLYQNPFLAASEESILCLKDNIFLY 793
           P   L LS +  I   Q LH LPNT Q  +L+ NP  AA++     L + + LY
Sbjct: 697 PLRSLDLSHNCIINTTQLLHALPNTLQELNLFGNPLWAANDSDRRMLVEAVRLY 750



>gb:CR543861_105110 Acinetobacter sp. ADP1 complete genome.
          Length = 349

 Score = 34.3 bits (77), Expect = 3.9
 Identities = 29/176 (16%), Positives = 71/176 (40%)
 Frame = -3

Query: 664 PPKESYVVDDAGVLSRVTRSXXXXXXXXXEFRKGYHINFVTVRKLTSKADAFEYADQVLE 485
           P     V+D A +LS   R           ++ G     V +   T + D F+YA +V E
Sbjct: 83  PSLNEPVIDQANLLSSEQRQALSDQIRQL-YQTGKAQMAVVIVPTTGQEDIFDYAMRVGE 141

Query: 484 RWYPTVEEGSNKGIVVLVTSQKEGAITGGPEFVKAVGDTILDATVSENLPVLATEEKYNE 305
           +W     +  N  ++ +  + +   I  G      + D ++   + + +     + +Y +
Sbjct: 142 KWQLGSAKRDNGILMAIAVNDRRIQILTGYGLEGVLPDIVVGRIIRDQITPYFKQAQYAQ 201

Query: 304 AVYSTAKRLVAAIDGLPDPGGPVFKDNKRESNFKTKEETEEKRGQFSLVVGGLLVI 137
            + S    +   ++  P+      +D K+    + ++   E++ +  ++V  L+++
Sbjct: 202 GIQSGVNEIEKIVNMDPEIAQQAAQDLKQ----RQEQALHEQQARSQMMVYSLIIV 253



>gb:AY326256_2083593 Rattus norvegicus limbic system-associated
           membrane protein 6c-isoform (Lsamp) mRNA, complete
           cds.>gb:BC087607_2110096 Rattus norvegicus limbic
           system-associated membrane protein, mRNA (cDNA clone
           MGC:105298 IMAGE:7314244), complete cds.
          Length = 361

 Score = 33.9 bits (76), Expect = 5.0
 Identities = 35/137 (25%), Positives = 49/137 (35%), Gaps = 31/137 (22%)
 Frame = -3

Query: 472 TVEEGSNKGIVVLVTSQKEGAIT------------GGPEFVKAVGDT------------- 368
           TV EGSN  +V +   + E  IT            G  E+++ +G T             
Sbjct: 142 TVNEGSNVTLVCMANGRPEPVITWRHLTPLGREFEGEEEYLEILGITREQSGKYECKAAN 201

Query: 367 ------ILDATVSENLPVLATEEKYNEAVYSTAKRLVAAIDGLPDPGGPVFKDNKRESNF 206
                 +    V+ N P   TE K NEA       L      +P P    ++D+ R  N 
Sbjct: 202 EVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTR-INS 260

Query: 205 KTKEETEEKRGQFSLVV 155
               E +   GQ SL V
Sbjct: 261 ANGLEIKSTEGQSSLTV 277



>gb:HSA298318_2003039 Homo sapiens partial MUC5AC gene for mucin 5,
            clone A.
          Length = 1349

 Score = 33.9 bits (76), Expect = 5.0
 Identities = 32/136 (23%), Positives = 50/136 (36%), Gaps = 5/136 (3%)
 Frame = +3

Query: 129  TKAITNKPPTTSENCPXXXXXXXXXXXXXXXXXXXNTGPP-----GSGSPSMXXXXXXXX 293
            T + T+ P T++ + P                    T  P      S + S         
Sbjct: 756  TTSTTSAPITSTISAPTTSTTSTPQTSTISSPTTSTTPTPQTSTTSSPTTSTTSAPTTST 815

Query: 294  XXXXSLYFSSVAKTGRFSETVASRIVSPTAFTNSGPPVIAPSF*LVTSTTMPLLLPSSTV 473
                +   +S  +T   S   +S   +PTA T S P     SF   ++T+ P    SST 
Sbjct: 816  TSAPTTSTTSTPQTSISSAPTSSTTSAPTASTISAPTTSTTSFHTTSTTSPPTSSTSSTP 875

Query: 474  GYQRSKTWSAYSNASA 521
              Q SKT +A S+ ++
Sbjct: 876  --QTSKTSAATSSTTS 889



>gb:BC033803_1981072 Homo sapiens limbic system-associated membrane
           protein, mRNA (cDNA clone MGC:45341 IMAGE:5188760),
           complete cds.
          Length = 338

 Score = 33.9 bits (76), Expect = 5.0
 Identities = 35/137 (25%), Positives = 49/137 (35%), Gaps = 31/137 (22%)
 Frame = -3

Query: 472 TVEEGSNKGIVVLVTSQKEGAIT------------GGPEFVKAVGDT------------- 368
           TV EGSN  +V +   + E  IT            G  E+++ +G T             
Sbjct: 142 TVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAAN 201

Query: 367 ------ILDATVSENLPVLATEEKYNEAVYSTAKRLVAAIDGLPDPGGPVFKDNKRESNF 206
                 +    V+ N P   TE K NEA       L      +P P    ++D+ R  N 
Sbjct: 202 EVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTR-INS 260

Query: 205 KTKEETEEKRGQFSLVV 155
               E +   GQ SL V
Sbjct: 261 ANGLEIKSTEGQSSLTV 277



>gb:AX704805_1473488 Sequence 37 from Patent WO03014151.
          Length = 383

 Score = 33.9 bits (76), Expect = 5.0
 Identities = 35/137 (25%), Positives = 49/137 (35%), Gaps = 31/137 (22%)
 Frame = -3

Query: 472 TVEEGSNKGIVVLVTSQKEGAIT------------GGPEFVKAVGDT------------- 368
           TV EGSN  +V +   + E  IT            G  E+++ +G T             
Sbjct: 139 TVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAAN 198

Query: 367 ------ILDATVSENLPVLATEEKYNEAVYSTAKRLVAAIDGLPDPGGPVFKDNKRESNF 206
                 +    V+ N P   TE K NEA       L      +P P    ++D+ R  N 
Sbjct: 199 EVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTR-INS 257

Query: 205 KTKEETEEKRGQFSLVV 155
               E +   GQ SL V
Sbjct: 258 ANGLEIKSTEGQSSLTV 274



>gb:AK044845_1167163 Mus musculus 9.5 days embryo parthenogenote
           cDNA, RIKEN full-length enriched library,
           clone:B130007O04 product:LIMBIC SYSTEM-ASSOCIATED
           MEMBRANE PROTEIN PRECURSOR (LSAMP) homolog [Rattus
           norvegicus], full insert sequence.
          Length = 341

 Score = 33.9 bits (76), Expect = 5.0
 Identities = 35/137 (25%), Positives = 49/137 (35%), Gaps = 31/137 (22%)
 Frame = -3

Query: 472 TVEEGSNKGIVVLVTSQKEGAIT------------GGPEFVKAVGDT------------- 368
           TV EGSN  +V +   + E  IT            G  E+++ +G T             
Sbjct: 142 TVNEGSNVTLVCMANGRPEPVITWRHLTPLGREFEGEEEYLEILGITREQSGKYECKAAN 201

Query: 367 ------ILDATVSENLPVLATEEKYNEAVYSTAKRLVAAIDGLPDPGGPVFKDNKRESNF 206
                 +    V+ N P   TE K NEA       L      +P P    ++D+ R  N 
Sbjct: 202 EVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTR-INS 260

Query: 205 KTKEETEEKRGQFSLVV 155
               E +   GQ SL V
Sbjct: 261 ANGLEIKSTEGQSSLTV 277



>gb:AP006841_571442 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 306

 Score = 33.9 bits (76), Expect = 5.0
 Identities = 29/133 (21%), Positives = 54/133 (40%)
 Frame = -3

Query: 658 KESYVVDDAGVLSRVTRSXXXXXXXXXEFRKGYHINFVTVRKLTSKADAFEYADQVLERW 479
           K  YV + AG+LS+             E + G       V  +  K D FE++ Q+L +W
Sbjct: 37  KMQYVCNPAGILSQQACDEIDAMLYALEQQTGIETVVAIVPSIGDK-DCFEFSHQLLNQW 95

Query: 478 YPTVEEGSNKGIVVLVTSQKEGAITGGPEFVKAVGDTILDATVSENLPVLATEEKYNEAV 299
               +   N  +++LVT Q+      G      + D I      + +     + ++N+ +
Sbjct: 96  GVGKKGKDNGLVILLVTDQRCIQFYTGYGLEGILPDAICKRIQMQEMIPYLKKGEWNQGM 155

Query: 298 YSTAKRLVAAIDG 260
            +  K +   +DG
Sbjct: 156 LAGVKAVCQRLDG 168



>sp|Q62813|LAMP_RAT Limbic system-associated membrane protein
           precursor (LSAMP).>gb:RNU31554_2137118 Rattus norvegicus
           limbic system-associated membrane protein mRNA, complete
           cds.
          Length = 338

 Score = 33.9 bits (76), Expect = 5.0
 Identities = 35/137 (25%), Positives = 49/137 (35%), Gaps = 31/137 (22%)
 Frame = -3

Query: 472 TVEEGSNKGIVVLVTSQKEGAIT------------GGPEFVKAVGDT------------- 368
           TV EGSN  +V +   + E  IT            G  E+++ +G T             
Sbjct: 142 TVNEGSNVTLVCMANGRPEPVITWRHLTPLGREFEGEEEYLEILGITREQSGKYECKAAN 201

Query: 367 ------ILDATVSENLPVLATEEKYNEAVYSTAKRLVAAIDGLPDPGGPVFKDNKRESNF 206
                 +    V+ N P   TE K NEA       L      +P P    ++D+ R  N 
Sbjct: 202 EVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTR-INS 260

Query: 205 KTKEETEEKRGQFSLVV 155
               E +   GQ SL V
Sbjct: 261 ANGLEIKSTEGQSSLTV 277



>sp|Q13449|LAMP_HUMAN Limbic system-associated membrane protein
           precursor (LSAMP).>pir|JC4776|JC4776
           limbic-system-associated membrane protein precursor -
           human>gb:HSU41901_2024204 Human limbic system-associated
           membrane protein LAMP mRNA, complete cds.
          Length = 338

 Score = 33.9 bits (76), Expect = 5.0
 Identities = 35/137 (25%), Positives = 49/137 (35%), Gaps = 31/137 (22%)
 Frame = -3

Query: 472 TVEEGSNKGIVVLVTSQKEGAIT------------GGPEFVKAVGDT------------- 368
           TV EGSN  +V +   + E  IT            G  E+++ +G T             
Sbjct: 142 TVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAAN 201

Query: 367 ------ILDATVSENLPVLATEEKYNEAVYSTAKRLVAAIDGLPDPGGPVFKDNKRESNF 206
                 +    V+ N P   TE K NEA       L      +P P    ++D+ R  N 
Sbjct: 202 EVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTR-INS 260

Query: 205 KTKEETEEKRGQFSLVV 155
               E +   GQ SL V
Sbjct: 261 ANGLEIKSTEGQSSLTV 277



>gb:SPBC1683_1719072 Schizosaccharomyces pombe cosmids c1683.
          Length = 310

 Score = 33.5 bits (75), Expect = 6.6
 Identities = 30/108 (27%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -3

Query: 556 INFVTVRKLTSKADAFEYADQVLERWYPTVEEGSNKGIVVLVTSQKE-GAITGGPEFVKA 380
           I   T+  LT+ A A   A +V++R          K IV++  +  E G IT   EF   
Sbjct: 118 ITICTIGPLTNIALALNKAPEVIQR---------AKQIVMMAGAFSEVGNITPAAEFNIY 168

Query: 379 VGDTILDATVSENLPVLATEEKYNEAVYSTAKRLVAAIDGLPDPGGPV 236
           V        +S  +P++         ++++AKR +A ++ LP+  GPV
Sbjct: 169 VDPHAAQMVLSSGIPIVMMPLDITHQLHTSAKR-IARMEALPNRVGPV 215



>pir|E83465|E83465 conserved hypothetical protein PA1451 [imported]
           - Pseudomonas aeruginosa (strain PAO1)>gb:AE004574_55687
           Pseudomonas aeruginosa PAO1, section 135 of 529 of the
           complete genome.>gb:AE004091_969787 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 447

 Score = 33.5 bits (75), Expect = 6.6
 Identities = 38/145 (26%), Positives = 58/145 (40%), Gaps = 4/145 (2%)
 Frame = -3

Query: 670 EGPPKESYVVDDAGVLSRVTRSXXXXXXXXXEFRKGYHINFVTVRKLTSKADAFE-YADQ 494
           E P     V D    L    R+         E RKG  +  + V   ++  D+ E YA +
Sbjct: 68  EVPALARRVTDLTATLDAAERARLEASLAALEARKGAQVAILMVP--STYPDSIEAYATR 125

Query: 493 VLERWYPTVEEGSNKGIVVLVTSQ-KEGAITGGPEFVKAVGDTILDATVSENLPVLATEE 317
           V E W     +G + G++VLV    +   I  G      + D      + E +     ++
Sbjct: 126 VFEAW-KLGRKGIDDGVLVLVAKDDRRMRIEVGYGLEGTITDIDAGRIIREYMTPAFRQQ 184

Query: 316 KYNEAVYSTAKRLVAAIDG--LPDP 248
            Y   + + A+RLV  IDG  LP P
Sbjct: 185 DYAGGLEAAAQRLVRLIDGEALPPP 209



>gb:AF082520_1239679 Cryptosporidium parvum Hsp60 gene, complete
           cds.>gb:BX538353_1359143 Cryptosporidium parvum
           chromosome 6, complete sequence; segment 4/4.
          Length = 618

 Score = 33.1 bits (74), Expect = 8.6
 Identities = 24/71 (33%), Positives = 37/71 (52%)
 Frame = +3

Query: 306 SLYFSSVAKTGRFSETVASRIVSPTAFTNSGPPVIAPSF*LVTSTTMPLLLPSSTVGYQR 485
           S +F   A+TG+F + + S I+ PT    SG    A    L+T+T + +  PS+    Q 
Sbjct: 538 SKHFGFDAQTGQFVDMIESGILDPTKVVKSGLRDAASIASLMTTTQVSVFEPSN----QS 593

Query: 486 SKTWSAYSNAS 518
            K  S+ SN+S
Sbjct: 594 EKNNSSGSNSS 604



>gb:CP000024_876697 Streptococcus thermophilus CNRZ1066, complete
           genome.
          Length = 514

 Score = 33.1 bits (74), Expect = 8.6
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 10/58 (17%)
 Frame = -3

Query: 523 KADAFEYADQVLERWYPTVEEGSN----------KGIVVLVTSQKEGAITGGPEFVKA 380
           KAD F Y ++ +E W P VE+  N          KG+++L  +++E    GG E   A
Sbjct: 86  KADTFVYLNENMETWVPKVEKNINTKHTKVIKASKGMILLPGTEEEDHDHGGEEHYHA 143


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,053,019,057
Number of Sequences: 1806583
Number of extensions: 22319109
Number of successful extensions: 64943
Number of sequences better than 10.0: 28
Number of HSP's better than 10.0 without gapping: 61424
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 64848
length of database: 581,917,975
effective HSP length: 125
effective length of database: 356,095,100
effective search space used: 71931210200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)