BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig10043
         (1317 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY084519_1569608 Arabidopsis thaliana clone 110392 mRNA, comp...   347   e-115   
gb:BT003139_1636720 Arabidopsis thaliana At5g19680 mRNA, complet...   347   e-115   
gb:AP005756_1857309 Oryza sativa (japonica cultivar-group) genom...   343   e-109   
pir|S68209|S68209 sds22 protein homolog - human>gb:BC000910_1967...   188   3e-48   Homo sapiens [man]
gb:HSPPPR7_2019688 Homo sapiens protein phosphatase-1 regulatory...   188   3e-48   
gb:CR857075_1181328 Pongo pygmaeus mRNA; cDNA DKFZp468I1227 (fro...   187   4e-48   
gb:AF067129_2053192 Mus musculus protein phosphatase-1 regulator...   185   1e-47   
gb:BC088868_2110644 Rattus norvegicus protein phosphatase 1, reg...   185   2e-47   
gb:CR382136_1669089 Debaryomyces hansenii chromosome D of strain...   163   5e-40   
gb:CR382128_1660928 Yarrowia lipolytica chromosome B of strain C...   164   4e-39   
gb:CR382124_1656456 Kluyveromyces lactis strain NRRL Y-1140 chro...   155   7e-39   
gb:BC075482_2558585 Xenopus tropicalis protein phosphatase 1, re...   161   2e-38   
gb:AE014297_1140020 Drosophila melanogaster chromosome 3R, compl...   159   9e-38   
gb:AF214664_1251334 Drosophila melanogaster putative mitotic pro...   159   2e-37   
gb:AE014185_937896 Plasmodium falciparum 3D7 chromosome 10 compl...   157   6e-37   
sp|P36047|SD22_YEAST|SD22_YEAST Protein phosphatases PP1 regulatory subunit...   154   1e-36   Saccharomyces cerevisiae [brewer's yeast]
gb:AE017344_1756316 Cryptococcus neoformans var. neoformans JEC2...   154   3e-36   
sp|P22194|SD22_SCHPO|SD22_SCHPO Protein phosphatases PP1 regulatory subunit...   154   3e-36   Schizosaccharomyces pombe
gb:YSPSDS22_1731221 S.pombe sds22+ gene, complete cds.                154   3e-36   
gb:CR380950_1649807 Candida glabrata strain CBS138 chromosome D ...   154   4e-36   
gb:AE016818_1748252 Ashbya gossypii (= Eremothecium gossypii) AT...   149   1e-34   
sp|P45969|YNZ9_CAEEL|YNZ9_CAEEL Hypothetical protein T09A5.9 in chromosome ...   142   2e-32   Caenorhabditis elegans [roundworm]
gb:LMFL8138_1388420 Leishmania major Friedlin chromosome 5 cosmi...   142   2e-32   
gb:AF239995_1253966 Leishmania major strain Friedlin chromosome ...   142   2e-32   
gb:BT009897_2151285 Synthetic construct Homo sapiens protein pho...   128   2e-30   
gb:BC012397_1973595 Homo sapiens protein phosphatase 1, regulato...   128   2e-30   
gb:HSPPPR5_2019686 Homo sapiens protein phosphatase-1 regulatory...   128   2e-30   
gb:U21322_1402014 Caenorhabditis elegans cosmid K10D2, complete ...   130   6e-29   
pir|E88451|E88451 protein K10D2.1 [imported] - Caenorhabditis el...   130   6e-29   Caenorhabditis elegans [roundworm]
pir|T15422|T15422 hypothetical protein C06A8.6 - Caenorhabditis ...   118   2e-25   Caenorhabditis elegans [roundworm]
gb:DD1039PPR2_1376825 Dictyostelium discoideum PprA (pprA) gene,...   118   3e-25   
gb:AE017178_397993 Porphyromonas gingivalis W83 section 7 of 8 o...   112   1e-23   
gb:AK009870_1155408 Mus musculus adult male tongue cDNA, RIKEN f...   101   1e-22   
pir|AE1515|AE1515 internalin like protein (LPXTG motif) [importe...    94   5e-18   Listeria innocua
gb:AE015937_319684 Clostridium tetani E88, section 2 of 10 of th...    94   6e-18   
gb:AE014134_1127435 Drosophila melanogaster chromosome 2L, compl...    93   1e-17   
gb:AE014134_1127434 Drosophila melanogaster chromosome 2L, compl...    93   1e-17   
pir|C97303|C97303 hypothetical protein CAC3280 [imported] - Clos...    92   2e-17   Clostridium acetobutylicum
gb:LIV271621_140733 Listeria ivanovii partial putative ysnb gene...    92   3e-17   
gb:AF497168_516458 Listeria monocytogenes strain FSLw1110 intern...    91   4e-17   
gb:LISINLAB_140565 Listeria monocytogenes internalin (inlA, inlB...    91   7e-17   
pir|C39930|C39930 hypothetical protein (internalin region) - Lis...    91   7e-17   Listeria monocytogenes
sp|P25147|INLB_LISMO|INLB_LISMO Internalin B precursor.>pir|AC1129|AC1129 I...    90   9e-17   
gb:AF497165_516455 Listeria monocytogenes strain FSLJ1158 intern...    87   2e-16   
gb:AF497167_516457 Listeria monocytogenes strain FSLX1002 intern...    89   2e-16   
gb:AF497154_516444 Listeria monocytogenes strain FSLJ2068 intern...    89   2e-16   
gb:AE017323_442811 Listeria monocytogenes str. 4b F2365, section...    89   2e-16   
pir|AE1479|AE1479 probable cell surface protein (LPXTG motif) [i...    89   2e-16   Listeria innocua
gb:AP004365_1840825 Oryza sativa (japonica cultivar-group) genom...    89   3e-16   
gb:AY228472_599550 Listeria monocytogenes strain F6214 internali...    88   3e-16   
gb:AF497166_516456 Listeria monocytogenes strain FSLW1111 intern...    88   3e-16   
gb:AE015937_319683 Clostridium tetani E88, section 2 of 10 of th...    88   3e-16   
gb:AE012908_286995 Chlorobium tepidum TLS section 129 of 194 of ...    88   3e-16   
gb:AY228471_599549 Listeria monocytogenes strain 10403S internal...    88   4e-16   
gb:AJ784775_532441 Listeria monocytogenes partial inlA gene for ...    88   4e-16   
gb:AF497163_516453 Listeria monocytogenes strain FSLj2064 intern...    88   4e-16   
gb:AF497156_516446 Listeria monocytogenes strain FSLj1038 intern...    88   4e-16   
gb:LMU25448_141648 Listeria monocytogenes F5782 internalin (inlA...    88   4e-16   
gb:LISINLAB_140564 Listeria monocytogenes internalin (inlA, inlB...    88   4e-16   
pir|S37387|S37387 internalin A precursor - Listeria monocytogenes      88   4e-16   Listeria monocytogenes
gb:BC037982_1982268 Homo sapiens hypothetical protein FLJ20156, ...    87   6e-16   
gb:CR859837_1183939 Pongo pygmaeus mRNA; cDNA DKFZp469H1034 (fro...    87   6e-16   
gb:AJ784776_532442 Listeria monocytogenes partial inlA gene for ...    87   8e-16   
gb:AF497158_516448 Listeria monocytogenes strain FSLj1051 intern...    87   8e-16   
gb:AE017323_442906 Listeria monocytogenes str. 4b F2365, section...    87   8e-16   
gb:AK000163_1907731 Homo sapiens cDNA FLJ20156 fis, clone COL08823.    87   1e-15   
gb:AE017290_433054 Leptospira interrogans serovar Copenhageni st...    87   1e-15   
gb:BC016574_2092381 Mus musculus RIKEN cDNA D430025H09 gene, mRN...    86   1e-15   
gb:AK049268_1168694 Mus musculus ES cells cDNA, RIKEN full-lengt...    86   1e-15   
gb:LMU25454_141654 Listeria monocytogenes F6789 internalin (inlA...    86   1e-15   
gb:LMU25451_141651 Listeria monocytogenes F4233 internalin (inlA...    86   1e-15   
gb:AJ784777_532443 Listeria monocytogenes partial inlA gene for ...    86   2e-15   
gb:AF497155_516445 Listeria monocytogenes strain FSLJ1022 intern...    86   2e-15   
gb:AE011492_273555 Leptospira interrogans serovar lai str. 56601...    86   2e-15   
gb:LMU25445_141645 Listeria monocytogenes F2365 internalin (inlA...    86   2e-15   
sp|P25146|INLA_LISMO|INLA_LISMO Internalin A precursor.>pir|AB1129|AB1129 I...    86   2e-15   
gb:CP000001_851841 Bacillus cereus ZK, complete genome.                86   2e-15   
gb:AY436594_617571 Listeria monocytogenes isolate F6900 internal...    85   3e-15   
gb:AY436593_617570 Listeria monocytogenes isolate J0161 internal...    85   3e-15   
gb:AF497160_516450 Listeria monocytogenes strain FSLj2017 intern...    85   3e-15   
gb:AF497159_516449 Listeria monocytogenes strain FSLj2003 intern...    85   3e-15   
gb:AF250284_2221604 Amsacta moorei entomopoxvirus, complete genome.    84   8e-15   
gb:AE017269_422672 Bacillus cereus ATCC 10987, section 6 of 18 o...    83   1e-14   
gb:AE017002_376270 Bacillus cereus ATCC 14579 section 5 of 18 of...    82   2e-14   
gb:LMU77367_141681 Listeria monocytogenes internalin (inlF) gene...    82   2e-14   
gb:LMO012386_141562 Listeria monocytogenes inlG gene, partial.         82   2e-14   
pir|AB1126|AB1126 internalin, peptidoglycan bound protein (LPxTG...    82   2e-14   Listeria monocytogenes
gb:AE017323_442719 Listeria monocytogenes str. 4b F2365, section...    82   2e-14   
gb:AK057348_1911992 Homo sapiens cDNA FLJ32786 fis, clone TESTI2...    82   3e-14   
gb:AE017290_433051 Leptospira interrogans serovar Copenhageni st...    82   3e-14   
gb:AE015937_319705 Clostridium tetani E88, section 2 of 10 of th...    81   4e-14   
gb:AK014976_1158219 Mus musculus adult male testis cDNA, RIKEN f...    81   5e-14   
gb:AE017355_462531 Bacillus thuringiensis serovar konkukian str....    80   7e-14   
gb:AE017028_381536 Bacillus anthracis str. Ames section 5 of 18 ...    80   7e-14   
gb:LIAJ4808_140496 Listeria ivanovii i-inlB, i-inlJ, i-inlI, i-i...    69   8e-14   
gb:LMU77368_141682 Listeria monocytogenes internalin (inlC2), in...    80   1e-13   
gb:LMO012385_141559 Listeria monocytogenes inlF, inlD and inlE g...    80   1e-13   
pir|AH1107|AH1107 internalin H [imported] - Listeria monocytogen...    80   1e-13   Listeria monocytogenes
gb:AE017266_421841 Bacillus cereus ATCC 10987, section 3 of 18 o...    79   3e-13   
pir|E97302|E97302 hypothetical protein CAC3274 [imported] - Clos...    79   3e-13   Clostridium acetobutylicum
pir|B97303|B97303 hypothetical protein CAC3279 [imported] - Clos...    77   8e-13   Clostridium acetobutylicum
gb:CNS07EGI_1374434 chromosome IX of strain GB-M1 of Encephalito...    76   1e-12   
gb:AE017323_442787 Listeria monocytogenes str. 4b F2365, section...    76   1e-12   
gb:AB051551_1868063 Homo sapiens mRNA for KIAA1764 protein, part...    76   2e-12   
gb:AB007651_1510259 Arabidopsis thaliana genomic DNA, chromosome...    76   2e-12   
gb:BX294139_767129 Pirellula sp. strain 1 complete genome; segme...    75   2e-12   
gb:AF121026_480750 Listeria monocytogenes strain 125 internalin ...    75   2e-12   
gb:AF121025_480749 Listeria monocytogenes strain 83 internalin B...    75   2e-12   
gb:AF121024_480748 Listeria monocytogenes strain 77 internalin B...    75   2e-12   
gb:LIY14181_140741 Listeria ivanovii i-inlF gene.                      75   2e-12   
gb:LIIN1E_140505 Listeria ivanovii i-inlF and i-inlE genes and g...    75   2e-12   
pir|AF1116|AF1116 internalin proteins, probable peptidoglycan bo...    72   2e-12   Listeria monocytogenes
gb:AF121032_480756 Listeria monocytogenes strain 524 internalin ...    75   3e-12   
gb:LMU77368_141683 Listeria monocytogenes internalin (inlC2), in...    75   3e-12   
gb:AE011492_273559 Leptospira interrogans serovar lai str. 56601...    75   4e-12   
gb:BC053114_2550508 Danio rerio zgc:63856, mRNA (cDNA clone MGC:...    74   9e-12   
gb:CP000001_851086 Bacillus cereus ZK, complete genome.                74   9e-12   
gb:AE017025_380815 Bacillus anthracis str. Ames section 2 of 18 ...    74   9e-12   
gb:BC070092_1988429 Homo sapiens KIAA1764 protein, mRNA (cDNA cl...    73   1e-11   
gb:AE014296_1134802 Drosophila melanogaster chromosome 3L, compl...    73   1e-11   
gb:BC047873_1984033 Homo sapiens hypothetical protein DKFZp586M1...    73   1e-11   
gb:BC040276_1982774 Homo sapiens hypothetical protein DKFZp586M1...    73   1e-11   
gb:BC030701_1979923 Homo sapiens KIAA1764 protein, mRNA (cDNA cl...    73   1e-11   
gb:CR382128_1661122 Yarrowia lipolytica chromosome B of strain C...    73   1e-11   
gb:AF427998_1270118 Drosophila melanogaster protein phosphatase ...    73   1e-11   
gb:AF427495_1270019 Drosophila melanogaster protein phosphatase ...    73   1e-11   
gb:HSM801891_1186545 Homo sapiens mRNA; cDNA DKFZp586M1120 (from...    73   1e-11   
gb:AE017290_433052 Leptospira interrogans serovar Copenhageni st...    73   1e-11   
gb:AE016999_375528 Bacillus cereus ATCC 14579 section 2 of 18 of...    73   1e-11   
gb:BC072707_2556637 Danio rerio zgc:91834, mRNA (cDNA clone MGC:...    72   2e-11   
gb:AF250284_2221587 Amsacta moorei entomopoxvirus, complete geno...    72   3e-11   
gb:AF121028_480752 Listeria monocytogenes strain 1065 internalin...    72   3e-11   
gb:AE011451_273099 Leptospira interrogans serovar lai str. 56601...    72   3e-11   
gb:BC041085_1982963 Homo sapiens leucine-rich repeats and IQ mot...    72   3e-11   
gb:AF121044_480768 Listeria monocytogenes strain 498 internalin ...    71   4e-11   
gb:AL772146_2504462 Zebrafish DNA sequence from clone CH211-12P8...    71   6e-11   
gb:AK019545_1160129 Mus musculus adult male testis cDNA, RIKEN f...    71   6e-11   
gb:AE017323_442720 Listeria monocytogenes str. 4b F2365, section...    70   7e-11   
gb:BC075175_2558286 Xenopus laevis MGC82111 protein, mRNA (cDNA ...    65   8e-11   
gb:AF121040_480764 Listeria monocytogenes strain 122 internalin ...    70   1e-10   
gb:AE017290_433053 Leptospira interrogans serovar Copenhageni st...    70   1e-10   
gb:AK012971_1157255 Mus musculus 10, 11 days embryo whole body c...    70   1e-10   
gb:AE017323_442864 Listeria monocytogenes str. 4b F2365, section...    70   1e-10   
gb:AE011272_271111 Leptospira interrogans serovar lai str. 56601...    70   1e-10   
gb:BC084248_2563636 Xenopus laevis hypothetical LOC495083, mRNA ...    66   2e-10   
gb:BX538350_1358723 Cryptosporidium parvum chromosome 6, complet...    69   2e-10   
gb:AK029981_1161758 Mus musculus adult male testis cDNA, RIKEN f...    69   2e-10   
gb:AF121041_480765 Listeria monocytogenes strain 123 internalin ...    69   2e-10   
gb:AE017298_434925 Leptospira interrogans serovar Copenhageni st...    69   2e-10   
gb:AE017248_415645 Treponema denticola ATCC 35405, section 3 of ...    69   2e-10   
gb:LIINLC_140508 L.ivanovii 23S rRNA, 5S rRNA, tRNA-Asn, tRNA-Th...    69   2e-10   
gb:PFA929358_1393518 Plasmodium falciparum strain 3D7, chromosom...    68   4e-10   
pir|AC1469|AC1469 internalin like protein (LPXTG motif) [importe...    68   4e-10   Listeria innocua
pir|AD1822|AD1822 leucine-rich-repeat protein [imported] - Nosto...    63   5e-10   Nostoc sp. PCC 7120
gb:BC073119_2557024 Xenopus laevis MGC83642 protein, mRNA (cDNA ...    68   5e-10   
gb:AC002397_2049807 Mouse chromosome 6 BAC-284H12 (Research Gene...    68   5e-10   
gb:CR380950_1649791 Candida glabrata strain CBS138 chromosome D ...    68   5e-10   
gb:AE017291_433396 Leptospira interrogans serovar Copenhageni st...    68   5e-10   
pir|D97302|D97302 hypothetical protein CAC3273 [imported] - Clos...    68   5e-10   Clostridium acetobutylicum
pir|C97302|C97302 hypothetical protein CAC3272 [imported] - Clos...    68   5e-10   Clostridium acetobutylicum
sp|P49606|CYAA_USTMA|CYAA_USTMA Adenylate cyclase (EC 4.6.1.1) (ATP pyropho...    68   5e-10   Ustilago maydis
gb:BC088034_2565547 Xenopus tropicalis hypothetical LOC496765, m...    67   6e-10   
gb:AL596090_2070793 Mouse DNA sequence from clone RP23-135F6 on ...    67   6e-10   
gb:AK049695_1168926 Mus musculus 12 days embryo spinal cord cDNA...    67   6e-10   
gb:AK015430_1158383 Mus musculus adult male testis cDNA, RIKEN f...    67   6e-10   
gb:LIAJ4808_140500 Listeria ivanovii i-inlB, i-inlJ, i-inlI, i-i...    67   6e-10   
gb:BC083838_2108901 Rattus norvegicus cDNA clone MGC:94955 IMAGE...    67   8e-10   
gb:AK173256_2070190 Mus musculus mRNA for mKIAA1764 protein.           67   8e-10   
gb:AB016816_1864811 Homo sapiens MASL1 mRNA, complete cds.             67   8e-10   
gb:AF154916_1772937 Chlamydomonas reinhardtii variable flagellar...    67   8e-10   
gb:AC013430_1537933 Genomic sequence for Arabidopsis thaliana BA...    67   8e-10   
gb:AK029802_1161665 Mus musculus adult male testis cDNA, RIKEN f...    67   8e-10   
gb:AE012851_286314 Chlorobium tepidum TLS section 72 of 194 of t...    67   8e-10   
pir|G96811|G96811 unknown protein T11I11.17 [imported] - Arabido...    67   8e-10   Arabidopsis thaliana [mouse-ear cress]
gb:BC062888_2105043 Mus musculus scribbled homolog (Drosophila),...    67   1e-09   
gb:BC060689_2104139 Mus musculus scribbled homolog (Drosophila),...    67   1e-09   
gb:AK122211_2068876 Mus musculus mRNA for mKIAA0147 protein.           67   1e-09   
gb:AF441233_2065835 Mus musculus PDZ-domain protein scribble mRN...    67   1e-09   
gb:AK128037_1917010 Homo sapiens cDNA FLJ46156 fis, clone TESTI4...    67   1e-09   
gb:AK040079_1165552 Mus musculus 0 day neonate thymus cDNA, RIKE...    67   1e-09   
gb:AK016559_1158779 Mus musculus adult male testis cDNA, RIKEN f...    67   1e-09   
gb:AE017323_442727 Listeria monocytogenes str. 4b F2365, section...    67   1e-09   
gb:BC070827_2555796 Xenopus laevis hypothetical protein MGC83921...    66   1e-09   
gb:BC065773_2105620 Mus musculus cDNA clone MGC:73529 IMAGE:3418...    66   1e-09   
gb:AY062238_1935516 Homo sapiens scribble (SCRIB) mRNA, complete...    66   1e-09   
gb:AF271734_1894095 Homo sapiens SCRIB1 variant N1 (SCRIB1) mRNA...    66   1e-09   
gb:AF240677_1892467 Homo sapiens CRIB1 (CRIB1) mRNA, complete cd...    66   1e-09   
gb:AC121489_1740239 Oryza sativa (japonica cultivar-group) chrom...    66   1e-09   
gb:AK080249_1172910 Mus musculus adult male aorta and vein cDNA,...    66   1e-09   
gb:AE017291_433313 Leptospira interrogans serovar Copenhageni st...    66   1e-09   
gb:AE011460_273202 Leptospira interrogans serovar lai str. 56601...    66   1e-09   
gb:CR382138_1670776 Debaryomyces hansenii chromosome F of strain...    66   2e-09   
gb:AK039037_1165260 Mus musculus adult male hypothalamus cDNA, R...    66   2e-09   
gb:LMIRPA_141505 L.monocytogenes irpA gene.                            66   2e-09   
gb:LMINLCINF_141501 L.monocytogenes ORF2, ORF1, rplS, inlC, infC...    66   2e-09   
pir|AB1298|AB1298 internalin C [imported] - Listeria monocytogen...    66   2e-09   Listeria monocytogenes
gb:BC061202_2104412 Mus musculus RIKEN cDNA 1200008A14 gene, mRN...    65   2e-09   
gb:AK122473_2069138 Mus musculus mRNA for mKIAA1225 protein.           65   2e-09   
gb:AK004646_1152478 Mus musculus adult male lung cDNA, RIKEN ful...    65   2e-09   
gb:AE014187_938771 Plasmodium falciparum 3D7 chromosome 14 compl...    65   2e-09   
pir|AI1174|AI1174 internalin, probable peptidoglycan bound prote...    65   2e-09   Listeria monocytogenes
gb:BC064859_2553900 Xenopus tropicalis hypothetical protein MGC7...    65   3e-09   
gb:AY623659_1341386 Schistosoma mansoni Sm50 protein mRNA, compl...    65   3e-09   
gb:AK082721_1173637 Mus musculus 0 day neonate cerebellum cDNA, ...    65   3e-09   
gb:AE017328_444234 Listeria monocytogenes str. 4b F2365, section...    65   3e-09   
pir|T41119|T41119 internalin- related, Leucine rich repeat conta...    65   3e-09   Schizosaccharomyces pombe
gb:BC050692_1984486 Homo sapiens erbb2 interacting protein, mRNA...    65   4e-09   
gb:AF276423_1894367 Homo sapiens densin-180-like protein mRNA, c...    65   4e-09   
gb:AX277638_1465109 Sequence 1 from Patent WO0177323.>gb:AB03305...    65   4e-09   
gb:AE013599_1130840 Drosophila melanogaster chromosome 2R, compl...    65   4e-09   
pir|AH1216|AH1216 internalin, probable peptidoglycan bound prote...    65   4e-09   Listeria monocytogenes
gb:BC073124_2557027 Xenopus laevis MGC84527 protein, mRNA (cDNA ...    64   5e-09   
gb:AE017343_1755590 Cryptococcus neoformans var. neoformans JEC2...    64   5e-09   
gb:CNS07EGI_1374407 chromosome IX of strain GB-M1 of Encephalito...    64   5e-09   
gb:AK047468_1168113 Mus musculus 10 days neonate cerebellum cDNA...    64   5e-09   
gb:AE014296_1136355 Drosophila melanogaster chromosome 3L, compl...    64   5e-09   
gb:AF332199_1897064 Homo sapiens leucine-rich repeats protein mR...    62   6e-09   
gb:BC087542_2110054 Mus musculus leucine rich repeat containing ...    64   7e-09   
gb:BC046591_2099296 Mus musculus leucine rich repeat containing ...    64   7e-09   
gb:AE011492_273558 Leptospira interrogans serovar lai str. 56601...    64   7e-09   
gb:AE011492_273556 Leptospira interrogans serovar lai str. 56601...    64   7e-09   
gb:AY577975_2538309 Petromyzon marinus clone 12.33 variable lymp...    64   9e-09   
gb:AY510704_2085800 Mus musculus toll-like receptor 11 (Tlr11) m...    64   9e-09   
gb:AL445928_1927740 Human DNA sequence from clone RP11-305E17 on...    64   9e-09   
gb:AL445928_1927739 Human DNA sequence from clone RP11-305E17 on...    64   9e-09   
gb:AY444997_1606514 Paracoccidioides brasiliensis adenylate cycl...    64   9e-09   
gb:AY043351_1560999 Emericella nidulans adenylate cyclase (cyaA)...    64   9e-09   
gb:AY231707_1177000 Drosophila yakuba clone yak-em_sds22 mRNA se...    64   9e-09   
gb:AE016959_1022238 Oryza sativa (japonica cultivar-group) chrom...    64   9e-09   
pir|AD1570|AD1570 internalin, probable peptidoglycan bound prote...    64   9e-09   Listeria innocua
sp|P23466|CYAA_SACKL|CYAA_SACKL Adenylate cyclase (EC 4.6.1.1) (ATP pyropho...    64   9e-09   Lachancea kluyveri
gb:AB079056_1197944 Ciona intestinalis LRR37 mRNA for axonemal l...    63   1e-08   
gb:PFMAL13_1191528 Plasmodium falciparum 3D7 chromosome 13, *** ...    63   1e-08   
gb:AE014187_938962 Plasmodium falciparum 3D7 chromosome 14 compl...    63   1e-08   
gb:AE017253_417269 Treponema denticola ATCC 35405, section 8 of ...    63   1e-08   
gb:BC029858_1979652 Homo sapiens B7 gene, transcript variant 1, ...    63   2e-08   
gb:BC024009_1978208 Homo sapiens similar to RIKEN cDNA 4930457P1...    63   2e-08   
gb:AK057238_1911943 Homo sapiens cDNA FLJ32676 fis, clone TESTI1...    63   2e-08   
gb:AF290191_1783582 Cryptococcus neoformans var. grubii adenylat...    63   2e-08   
gb:AE017347_1758010 Cryptococcus neoformans var. neoformans JEC2...    63   2e-08   
gb:AE016814_1745668 Ashbya gossypii (= Eremothecium gossypii) AT...    63   2e-08   
gb:A90928_1451119 Sequence 1 from Patent WO9829538.                    63   2e-08   
gb:AC125735_1208073 Leishmania major strain Friedlin chromosome ...    63   2e-08   
gb:HSM804649_1187246 Homo sapiens mRNA; cDNA DKFZp686C1634 (from...    63   2e-08   
gb:HSM804641_1187244 Homo sapiens mRNA; cDNA DKFZp686E1933 (from...    63   2e-08   
gb:LIAJ4808_140499 Listeria ivanovii i-inlB, i-inlJ, i-inlI, i-i...    63   2e-08   
pir|AH1469|AH1469 internalin protein homolog lin0295 [imported] ...    63   2e-08   Listeria innocua
gb:AK122498_2069163 Mus musculus mRNA for mKIAA1365 protein.           62   2e-08   
gb:AF068716_1238363 Caenorhabditis elegans cosmid F26D11, comple...    62   2e-08   
gb:AF068716_1238362 Caenorhabditis elegans cosmid F26D11, comple...    62   2e-08   
gb:CR857209_1181456 Pongo pygmaeus mRNA; cDNA DKFZp469B0832 (fro...    62   2e-08   
gb:AK034978_1163945 Mus musculus 12 days embryo embryonic body b...    62   2e-08   
gb:AK017814_1159335 Mus musculus 8 days embryo whole body cDNA, ...    62   2e-08   
gb:AK011726_1156560 Mus musculus 10 days embryo whole body cDNA,...    62   2e-08   
gb:AE017355_461787 Bacillus thuringiensis serovar konkukian str....    62   2e-08   
pir|T31434|T31434 densin-180 - rat>gb:RNU66707_2137599 Rattus no...    62   2e-08   Rattus norvegicus [brown rat]
gb:AF250284_2221862 Amsacta moorei entomopoxvirus, complete genome.    62   3e-08   
gb:BC003407_1968817 Homo sapiens hypothetical protein FLJ20331, ...    62   3e-08   
gb:CR382131_1664717 Yarrowia lipolytica chromosome E of strain C...    62   3e-08   
gb:AX405866_1467794 Sequence 281 from Patent WO0222660.>gb:AX882...    62   3e-08   
gb:AE017293_433712 Leptospira interrogans serovar Copenhageni st...    62   3e-08   
gb:BC079028_2107167 Rattus norvegicus cDNA clone MGC:93955 IMAGE...    62   3e-08   
gb:AF112476_1769093 Chlamydomonas reinhardtii outer arm dynein l...    62   3e-08   
gb:AE017323_442721 Listeria monocytogenes str. 4b F2365, section...    62   3e-08   
gb:BC038386_2098258 Mus musculus centrosomal protein 1, mRNA (cD...    61   4e-08   
gb:HSU18728_2022607 Human lumican mRNA, complete cds.                  61   4e-08   
gb:AP004673_1843134 Oryza sativa (japonica cultivar-group) genom...    61   4e-08   
gb:AK041715_1166084 Mus musculus 3 days neonate thymus cDNA, RIK...    61   4e-08   
gb:AK031338_1162396 Mus musculus 13 days embryo male testis cDNA...    61   4e-08   
gb:LMO564719_141618 Listeria monocytogenes partial inlA gene for...    61   6e-08   
gb:BC083278_2563155 Danio rerio zgc:101782, mRNA (cDNA clone MGC...    60   8e-08   
gb:BC079423_2107534 Rattus norvegicus cDNA clone MGC:94964 IMAGE...    60   8e-08   
gb:BC089415_1990012 Homo sapiens cDNA clone IMAGE:3101227, parti...    60   8e-08   
gb:AL157948_1921211 Human DNA sequence from clone RP4-686N16 on ...    60   8e-08   
gb:AL137068_1919418 Human DNA sequence from clone RP11-165P4 on ...    60   8e-08   
gb:AF513978_1905617 Homo sapiens CENTRIOLIN mRNA, complete cds.        60   8e-08   
gb:AF434715_1902063 Homo sapiens densin-180 mRNA, complete cds.>...    60   8e-08   
gb:AY167906_1306145 Drosophila melanogaster clone G scribbled (s...    60   8e-08   
gb:AC115606_1205896 Dictyostelium discoideum chromosome 2 map 15...    60   8e-08   
gb:AB070579_1197348 Bombyx mori Bm18w gene for 18 wheeler, compl...    60   8e-08   
gb:CR749629_1181186 Homo sapiens mRNA; cDNA DKFZp686I1147 (from ...    60   8e-08   
gb:AK020148_1160337 Mus musculus 12 days embryo male wolffian du...    60   8e-08   
gb:AE014296_1134664 Drosophila melanogaster chromosome 3L, compl...    60   8e-08   
gb:AE014296_1134663 Drosophila melanogaster chromosome 3L, compl...    60   8e-08   
gb:AE014296_1134662 Drosophila melanogaster chromosome 3L, compl...    60   8e-08   
gb:AE014296_1134661 Drosophila melanogaster chromosome 3L, compl...    60   8e-08   
gb:AE011412_272684 Leptospira interrogans serovar lai str. 56601...    60   8e-08   
gb:LIINLC_140509 L.ivanovii 23S rRNA, 5S rRNA, tRNA-Asn, tRNA-Th...    60   8e-08   
gb:BT008006_2150938 Synthetic construct Homo sapiens lumican mRN...    60   1e-07   
gb:AB080948_1198103 Ciona intestinalis LRR-DLC mRNA for leucine-...    60   1e-07   
gb:AY166685_594221 Listeria monocytogenes strain ScottA internal...    60   1e-07   
gb:AE011413_272687 Leptospira interrogans serovar lai str. 56601...    60   1e-07   
gb:LMO564717_141616 Listeria monocytogenes partial inlA gene for...    60   1e-07   
gb:LMO012385_141558 Listeria monocytogenes inlF, inlD and inlE g...    60   1e-07   
pir|AG1107|AG1107 internalin G [imported] - Listeria monocytogen...    60   1e-07   
sp|P51884|LUM_HUMAN|LUM_HUMAN Lumican precursor (Keratan sulfate proteogly...    60   1e-07   
gb:AB014462_2460610 Xenopus laevis XNLRR-1 mRNA, complete cds.         60   1e-07   
gb:CR382132_1665191 Yarrowia lipolytica chromosome F of strain C...    60   1e-07   
gb:CGI549813_1372079 Crassostrea gigas mRNA for glycoprotein hor...    60   1e-07   
gb:AY167903_1306142 Drosophila melanogaster clone E scribbled (s...    60   1e-07   
gb:AC115592_1205734 Dictyostelium discoideum chromosome 2 map 1-...    60   1e-07   
gb:AE014297_1140024 Drosophila melanogaster chromosome 3R, compl...    60   1e-07   
gb:BC045963_2549477 Danio rerio zgc:56169, mRNA (cDNA clone MGC:...    59   2e-07   
gb:AB019230_1514148 Arabidopsis thaliana genomic DNA, chromosome...    59   2e-07   
gb:AY166686_594222 Listeria monocytogenes strain LO28 internalin...    59   2e-07   
gb:AJ608706_526870 Listeria monocytogenes partial inlA gene for ...    59   2e-07   
gb:AE017325_443571 Listeria monocytogenes str. 4b F2365, section...    59   2e-07   
gb:AE014233_306227 Streptococcus agalactiae 2603V/R section 43 o...    59   2e-07   
gb:LMO578445_141620 Listeria monocytogenes partial inlA gene for...    59   2e-07   
gb:LMO564718_141617 Listeria monocytogenes partial inlA gene for...    59   2e-07   
gb:LMO564712_141611 Listeria monocytogenes partial inlA gene for...    59   2e-07   
gb:BC082218_2562565 Xenopus laevis hypothetical LOC494635, mRNA ...    59   2e-07   
gb:BC055223_2551302 Danio rerio zgc:63729, mRNA (cDNA clone MGC:...    59   2e-07   
gb:AY394934_2531677 Danio rerio clone RK044A2H10 hypothetical pr...    59   2e-07   
gb:MAN251971_1685601 Metarhizium anisopliae var. anisopliae part...    59   2e-07   
gb:AX647053_1472152 Sequence 1245 from Patent EP1270724.               59   2e-07   
gb:BT003235_1356746 Drosophila melanogaster LP05663 full insert ...    59   2e-07   
gb:AY128499_1302134 Drosophila melanogaster RH55123 full insert ...    59   2e-07   
gb:CR857197_1181444 Pongo pygmaeus mRNA; cDNA DKFZp468L1116 (fro...    59   2e-07   
gb:CP000003_861008 Streptococcus pyogenes MGAS10394, complete ge...    59   2e-07   
gb:AE014157_304512 Streptococcus pyogenes MGAS315, section 22 of...    59   2e-07   
gb:AE006574_220313 Streptococcus pyogenes M1 GAS, section 103 of...    59   2e-07   
sp|Q8TF66|LR15_HUMAN|LR15_HUMAN Leucine-rich repeat-containing protein 15 p...    59   2e-07   
gb:AB010054_1193182 Anthocidaris crassispina mRNA for outer arm ...    59   3e-07   
gb:AK019775_1160188 Mus musculus adult male testis cDNA, RIKEN f...    59   3e-07   
gb:AK015024_1158245 Mus musculus adult male testis cDNA, RIKEN f...    59   3e-07   
gb:AK005826_1153248 Mus musculus adult male testis cDNA, RIKEN f...    59   3e-07   
gb:BC084086_2563492 Xenopus laevis hypothetical LOC495000, mRNA ...    58   4e-07   
gb:BC059292_2552331 Xenopus laevis neuronal leucine-rich repeat ...    58   4e-07   
gb:NCB7N14_1690226 Neurospora crassa DNA linkage group II BAC cl...    58   4e-07   
gb:BT002463_1636066 Arabidopsis thaliana putative protein phosph...    58   4e-07   
gb:U61957_1405560 Caenorhabditis elegans cosmid AC7, complete se...    58   4e-07   
gb:AF152174_1245577 Trypanosoma brucei phosphatase (Pho1) gene, ...    58   4e-07   
gb:LMO564713_141612 Listeria monocytogenes partial inlA gene for...    58   4e-07   
pir|T28171|T28171 hypothetical protein ORF10 - Melanoplus sangui...    58   4e-07   
pir|T42998|T42998 Ras-binding protein SUR-8 - Caenorhabditis ele...    58   4e-07   
pir|D85041|D85041 hypothetical protein AT4g03260 [imported] - Ar...    58   4e-07   
pir|S27783|S27783 hypothetical protein 1 - Caenorhabditis elegans      52   4e-07   
gb:CR382126_1659050 Kluyveromyces lactis strain NRRL Y-1140 chro...    58   5e-07   
gb:AK039277_1165348 Mus musculus adult male spinal cord cDNA, RI...    58   5e-07   
gb:AE014134_1129146 Drosophila melanogaster chromosome 2L, compl...    58   5e-07   
gb:AE014187_938723 Plasmodium falciparum 3D7 chromosome 14 compl...    58   5e-07   
gb:AY878348_648268 Listeria seeligeri strain ATCC 35967 prfA vir...    58   5e-07   
gb:LSE249738_142152 Listeria seeligeri ORFA, ORFB, ORFH, ORFI, O...    58   5e-07   
gb:LMO564720_141619 Listeria monocytogenes partial inlA gene for...    58   5e-07   
pir|T30947|T30947 hypothetical protein AC7.2 - Caenorhabditis el...    58   5e-07   
pir|A88684|A88684 protein AC7.2 [imported] - Caenorhabditis elegans    58   5e-07   
gb:BC061939_2553322 Xenopus laevis hypothetical protein MGC68797...    57   6e-07   
gb:AE016817_1747799 Ashbya gossypii (= Eremothecium gossypii) AT...    57   6e-07   
gb:AY376852_1603794 Lycopersicon esculentum leucine rich repeat ...    57   6e-07   
gb:AY232271_1311380 Dictyostelium discoideum putative protein Ro...    57   6e-07   
gb:AY124195_1301655 Aedes aegypti Toll-related protein (Tehao) g...    57   6e-07   
gb:AF391294_1267454 Branchiostoma floridae cosmid MPMGc117K0348,...    57   6e-07   
gb:AF274591_1257836 Drosophila melanogaster leucine-rich repeat-...    57   6e-07   
gb:AF142343_1244362 Drosophila melanogaster glycoprotein hormone...    57   6e-07   
gb:AE014134_1129137 Drosophila melanogaster chromosome 2L, compl...    57   6e-07   
gb:AE014298_1124608 Drosophila melanogaster chromosome X, comple...    57   6e-07   
gb:AE017246_415260 Treponema denticola ATCC 35405, section 1 of ...    57   6e-07   
gb:SAG766848_170445 Streptococcus agalactiae NEM316 complete gen...    57   6e-07   
gb:AC156434_2467678 Sequence of the F. rubipres toll receptor 22...    57   8e-07   
gb:CR548612_1375186 Paramecium tetraurelia macronuclear largest ...    57   8e-07   
gb:LIAJ4808_140497 Listeria ivanovii i-inlB, i-inlJ, i-inlI, i-i...    57   8e-07   
gb:AY016023_2508350 Sphoeroides nephelus alpha globin gene clust...    57   1e-06   
gb:AY358312_1947191 Homo sapiens clone DNA66667 NLRR (UNQ693) mR...    57   1e-06   
gb:AB058704_1868539 Homo sapiens mRNA for KIAA1801 protein, part...    57   1e-06   
gb:AB040930_1866859 Homo sapiens mRNA for KIAA1497 protein, part...    57   1e-06   
gb:PFA929352_1392995 Plasmodium falciparum strain 3D7, chromosom...    57   1e-06   
gb:AK051043_1169556 Mus musculus 9 days embryo whole body cDNA, ...    57   1e-06   
gb:AE011413_272689 Leptospira interrogans serovar lai str. 56601...    57   1e-06   
sp|P82963|CHAO_TRICA|CHAO_TRICA Chaoptin (Photoreceptor cell-specific membr...    57   1e-06   
gb:BC031122_2096952 Mus musculus leucine rich repeat protein 1, ...    56   1e-06   
gb:AK173186_2070120 Mus musculus mRNA for mKIAA1497 protein.           56   1e-06   
gb:BX908798_829594 Parachlamydia-related symbiont UWE25, complet...    56   1e-06   
gb:AY259769_603498 Listeria monocytogenes strain J1-158 InlC (in...    56   1e-06   
gb:AK123908_1915492 Homo sapiens cDNA FLJ41914 fis, clone PERIC2...    56   2e-06   
gb:PFMAL8P1_1192114 Plasmodium falciparum 3D7 chromosome 8, *** ...    56   2e-06   
gb:AK076637_1171476 Mus musculus adult male testis cDNA, RIKEN f...    56   2e-06   
gb:AE011332_271767 Leptospira interrogans serovar lai str. 56601...    56   2e-06   
gb:BC034047_1981188 Homo sapiens leucine rich repeat neuronal 5,...    55   2e-06   
gb:AY358290_1947169 Homo sapiens clone DNA37151 GAC1 (UNQ256) mR...    55   2e-06   
gb:AL512306_1928379 Human DNA sequence from clone RP11-430C7 on ...    55   2e-06   
gb:BT012334_1358075 Drosophila melanogaster AT17592 full insert ...    55   2e-06   
gb:BT003605_1357007 Drosophila melanogaster GH22674 full insert ...    55   2e-06   
gb:AC125735_1208145 Leishmania major strain Friedlin chromosome ...    55   2e-06   
gb:AE014297_1139432 Drosophila melanogaster chromosome 3R, compl...    55   2e-06   
gb:AE014297_1139431 Drosophila melanogaster chromosome 3R, compl...    55   2e-06   
gb:AE016959_1020675 Oryza sativa (japonica cultivar-group) chrom...    55   2e-06   
sp|O75325|GAMP_HUMAN|GAMP_HUMAN Glioma amplified on chromosome 1 protein pr...    55   2e-06   
gb:BC087488_2565327 Xenopus laevis hypothetical LOC496073, mRNA ...    55   3e-06   
gb:BC076064_2558946 Danio rerio zgc:92542, mRNA (cDNA clone MGC:...    55   3e-06   
gb:BC056458_2102393 Mus musculus leucine rich repeat protein 2, ...    55   3e-06   
gb:BC005343_1969789 Homo sapiens chromosome 14 open reading fram...    55   3e-06   
gb:AF053995_1764489 Lycopersicon esculentum Hcr2-0B (Hcr2-0B) ge...    55   3e-06   
gb:AE017252_417044 Treponema denticola ATCC 35405, section 7 of ...    55   3e-06   
gb:AE011413_272685 Leptospira interrogans serovar lai str. 56601...    55   3e-06   
pir|T31911|T31911 hypothetical protein T05H4.3 - Caenorhabditis ...    55   3e-06   
gb:BC087459_2565300 Xenopus laevis hypothetical LOC496055, mRNA ...    55   4e-06   
gb:AY362823_2084088 Mus musculus neuronal leucine rich repeat 2 ...    55   4e-06   
gb:BC034947_1981418 Homo sapiens leucine rich repeat neuronal 1,...    55   4e-06   
gb:AK048260_1168336 Mus musculus 16 days embryo head cDNA, RIKEN...    55   4e-06   
gb:AY259760_603489 Listeria monocytogenes strain X1-002 InlC (in...    55   4e-06   
gb:AY259744_603473 Listeria monocytogenes strain J1-101 InlC (in...    55   4e-06   
gb:AE017295_434415 Leptospira interrogans serovar Copenhageni st...    55   4e-06   
sp|Q9DE67|LUM_COTJA|LUM_COTJA Lumican precursor (Keratan sulfate proteogly...    55   4e-06   
gb:BC075955_2558842 Danio rerio zgc:92240, mRNA (cDNA clone MGC:...    54   5e-06   
gb:BC079038_2107177 Rattus norvegicus cDNA clone MGC:93967 IMAGE...    54   5e-06   
gb:SCXCOSM83_1710823 S.cerevisiae chromosome X DNA (cosmid 83).        54   5e-06   
gb:AK019633_1160155 Mus musculus adult male testis cDNA, RIKEN f...    54   5e-06   
gb:AE014134_1129141 Drosophila melanogaster chromosome 2L, compl...    54   5e-06   
sp|P08678|CYAA_YEAST|CYAA_YEAST Adenylate cyclase (EC 4.6.1.1) (ATP pyropho...    54   5e-06   
gb:BC074062_2557591 Danio rerio zgc:91989, mRNA (cDNA clone MGC:...    54   7e-06   
gb:AF287264_2061573 Mus musculus cytoskeletal actin-modulating p...    54   7e-06   
gb:AF142329_2056163 Mus musculus Fliih protein (Fliih) gene, com...    54   7e-06   
gb:LMFL3180_1387934 Leishmania major Friedlin chromosome 13 cosm...    54   7e-06   
gb:DROSADH02_1382726 Drosophila melanogaster, chromosome 2L, reg...    54   7e-06   
gb:AY259751_603480 Listeria monocytogenes strain J1-038 InlC (in...    54   7e-06   
pir|T19939|T19939 hypothetical protein C44H4.3 - Caenorhabditis ...    54   7e-06   
pir|T31798|T31798 hypothetical protein R02F11.4 - Caenorhabditis...    54   7e-06   
gb:AY618925_2540572 Danio rerio seahorse mRNA, complete cds.           54   9e-06   
gb:BC085829_2109389 Rattus norvegicus flightless I homolog (Dros...    54   9e-06   
gb:BC065142_2105556 Mus musculus leucine-rich repeats and immuno...    54   9e-06   
gb:AY505341_2085652 Mus musculus leucine-rich and immunoglobulin...    54   9e-06   
gb:AP003948_1835636 Oryza sativa (japonica cultivar-group) genom...    54   9e-06   
gb:AX887808_1483261 Sequence 3671 from Patent EP1033401.               54   9e-06   
gb:AK035166_1164011 Mus musculus 12 days embryo embryonic body b...    54   9e-06   
gb:AE014296_1136521 Drosophila melanogaster chromosome 3L, compl...    54   9e-06   
gb:AY259756_603485 Listeria monocytogenes strain J1-169 InlC (in...    54   9e-06   
gb:AY259750_603479 Listeria monocytogenes strain J1-177 InlC (in...    54   9e-06   
gb:AY259747_603476 Listeria monocytogenes strain J2-003 InlC (in...    54   9e-06   
gb:AY259746_603475 Listeria monocytogenes strain R2-499 InlC (in...    54   9e-06   
gb:AE017330_444787 Listeria monocytogenes str. 4b F2365, section...    54   9e-06   
pir|C84552|C84552 hypothetical protein At2g17440 [imported] - Ar...    54   9e-06   
sp|Q8GUQ5|BRI1_LYCES|BRI1_LYCES Brassinosteroid LRR receptor kinase precurs...    54   9e-06   
gb:AF290542_2061707 Mus musculus LRRC4-like protein mRNA, comple...    53   1e-05   
gb:AK172751_1918126 Homo sapiens cDNA FLJ23912 fis, clone CAE042...    53   1e-05   
gb:AF196976_1889655 Homo sapiens brain tumor associated protein ...    53   1e-05   
gb:AC005586_1874988 Homo sapiens PAC clone RP4-584D14 from 7, co...    53   1e-05   
gb:YSCCYR1_1728662 Yeast (S.cerevisiae) adenylate cyclase gene (...    53   1e-05   
gb:AX877169_1476869 Sequence 12074 from Patent EP1074617.>gb:AK0...    53   1e-05   
gb:DME271647_1379101 Drosophila melanogaster mRNA for the vartul...    53   1e-05   
gb:DME252084_1379074 Drosophila melanogaster mRNA for Vartul-1 p...    53   1e-05   
gb:BT003535_1356937 Drosophila melanogaster RE09158 full insert ...    53   1e-05   
gb:AY167904_1306143 Drosophila melanogaster clone D scribbled (s...    53   1e-05   
gb:AE014296_1135169 Drosophila melanogaster chromosome 3L, compl...    53   1e-05   
gb:AE014134_1129341 Drosophila melanogaster chromosome 2L, compl...    53   1e-05   
pir|T28172|T28172 hypothetical protein ORF11 - Melanoplus sangui...    53   1e-05   
sp|Q8R5M3|LR15_RAT|LR15_RAT Leucine-rich repeat-containing protein 15 pre...    53   1e-05   
gb:BC082649_2562797 Xenopus laevis hypothetical LOC494672, mRNA ...    53   2e-05   
gb:AC079678_1732703 Arabidopsis thaliana chromosome 1 BAC F9E11 ...    53   2e-05   
gb:AY123995_1580074 Arabidopsis thaliana AT3g15410/MJK13_7 mRNA,...    53   2e-05   
gb:ATY16046_1557529 Arabidopsis thaliana mRNA for leucine rich r...    53   2e-05   
gb:AC024081_1539267 Arabidopsis thaliana chromosome III P1 MJK13...    53   2e-05   
gb:AK046486_1167799 Mus musculus adult male corpora quadrigemina...    53   2e-05   
gb:AY259770_603499 Listeria monocytogenes strain W1-110 InlC (in...    53   2e-05   
sp|P51890|LUM_CHICK|LUM_CHICK Lumican precursor (Keratan sulfate proteogly...    53   2e-05   
gb:AC156433_2467677 Sequence of the F. rubipres toll receptor 21...    52   2e-05   
gb:AB101002_2464968 Takifugu rubripes TLR21 mRNA for Toll-like r...    52   2e-05   
gb:AK172945_2069879 Mus musculus mRNA for mKIAA0405 protein.           52   2e-05   
gb:AF013262_2050745 Mus musculus lumican (Ldc) gene, complete cd...    52   2e-05   
gb:BC055413_1985247 Homo sapiens cDNA clone MGC:62030 IMAGE:6614...    52   2e-05   
gb:AB007865_1863991 Homo sapiens KIAA0405 mRNA, partial cds.           52   2e-05   
gb:AY090611_1574160 Brassica nigra PSR9 (psr9) mRNA, partial cds.      52   2e-05   
gb:AX884874_1480327 Sequence 737 from Patent EP1033401.                52   2e-05   
gb:AK041311_1165945 Mus musculus adult male aorta and vein cDNA,...    52   2e-05   
gb:AE013599_1131964 Drosophila melanogaster chromosome 2R, compl...    52   2e-05   
gb:AY557392_628173 Listeria monocytogenes isolate MP-PCR-17 inte...    52   2e-05   
gb:AY557376_628157 Listeria monocytogenes isolate MP-PCR-1 inter...    52   2e-05   
gb:AY259758_603487 Listeria monocytogenes strain J1-168 InlC (in...    52   2e-05   
gb:AE017298_435063 Leptospira interrogans serovar Copenhageni st...    52   2e-05   
gb:AE011256_270939 Leptospira interrogans serovar lai str. 56601...    52   2e-05   
sp|Q05443|LUM_BOVIN|LUM_BOVIN Lumican precursor (Keratan sulfate proteogly...    52   2e-05   
sp|P51887|FMOD_CHICK|FMOD_CHICK Fibromodulin precursor (FM) (Keratan sulfat...    52   2e-05   
sp|O43155|FLR2_HUMAN|FLR2_HUMAN Leucine-rich repeat transmembrane protein F...    52   2e-05   
gb:AY653733_2371230 Mimivirus, complete genome.                        52   3e-05   
gb:SCNUD1_1708877 S.cerevisiae nud1 gene.                              52   3e-05   
gb:CR382135_1668524 Debaryomyces hansenii chromosome C of strain...    52   3e-05   
gb:AX301822_1465538 Sequence 1 from Patent WO0185768.>gb:AX30182...    52   3e-05   
gb:AE013599_1130569 Drosophila melanogaster chromosome 2R, compl...    52   3e-05   
pir|T33295|T33295 hypothetical protein F26D11.11 - Caenorhabditi...    52   3e-05   
sp|P32336|NUD1_YEAST|NUD1_YEAST NUD1 protein.>pir|S67285|S67285 NUD1 protei...    52   3e-05   
gb:AY616582_2540549 Danio rerio toll-like receptor 3 (tlr3) mRNA...    52   4e-05   
gb:BC010412_1972616 Homo sapiens hypothetical gene MGC16309, mRN...    52   4e-05   
gb:AB056760_1868444 Macaca fascicularis brain cDNA clone:QccE-19...    52   4e-05   
gb:AP004776_1844888 Oryza sativa (japonica cultivar-group) genom...    52   4e-05   
gb:AP004564_1841660 Oryza sativa (japonica cultivar-group) genom...    52   4e-05   
gb:AY634619_1618777 Lycopersicon peruvianum peru 2 gene, complet...    52   4e-05   
gb:BT015240_1358317 Drosophila melanogaster RE02389 full insert ...    52   4e-05   
gb:AY049773_1289833 Drosophila melanogaster defective transmitte...    52   4e-05   
gb:AF190774_1249502 Drosophila melanogaster Scribble (scrib) mRN...    52   4e-05   
gb:CR749811_1181273 Homo sapiens mRNA; cDNA DKFZp781E21107 (from...    52   4e-05   
gb:AK084466_1174243 Mus musculus 13 days embryo heart cDNA, RIKE...    52   4e-05   
gb:AE014297_1141568 Drosophila melanogaster chromosome 3R, compl...    52   4e-05   
gb:AE014297_1141566 Drosophila melanogaster chromosome 3R, compl...    52   4e-05   
gb:AE014297_1141565 Drosophila melanogaster chromosome 3R, compl...    52   4e-05   
gb:AE014296_1134797 Drosophila melanogaster chromosome 3L, compl...    52   4e-05   
gb:AE014134_1130034 Drosophila melanogaster chromosome 2L, compl...    52   4e-05   
gb:AY557378_628159 Listeria monocytogenes isolate MP-PCR-3 inter...    52   4e-05   
gb:AY259759_603488 Listeria monocytogenes strain J1-031 InlC (in...    52   4e-05   
gb:AE017293_433711 Leptospira interrogans serovar Copenhageni st...    52   4e-05   
gb:AE005674_71339 Shigella flexneri 2a str. 301, complete genome...    52   4e-05   


>gb:AY084519_1569608 Arabidopsis thaliana clone 110392 mRNA,
           complete sequence.
          Length = 328

 Score =  347 bits (889), Expect(2) = e-115
 Identities = 169/224 (75%), Positives = 194/224 (86%)
 Frame = -2

Query: 950 VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN 771
           VSIF KLLV+D+SFNEITS  G+SK SSTLKELYVS N++ KI EIEH H LQILELGSN
Sbjct: 105 VSIFTKLLVYDISFNEITSLEGISKASSTLKELYVSKNEVNKIMEIEHLHNLQILELGSN 164

Query: 770 KLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEEL 591
           +LRVMENL+  T L+ELWLGRNRI+ +NLCGLKCIKKIS+QSNRLTSMKG EECVALEEL
Sbjct: 165 RLRVMENLENFTKLEELWLGRNRIKVVNLCGLKCIKKISLQSNRLTSMKGFEECVALEEL 224

Query: 590 YLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEA 411
           YLSHNGI KMEGLS LVNLRVLDVS NKLT++ +I NLTKLEDLWLNDN I S+E I EA
Sbjct: 225 YLSHNGISKMEGLSALVNLRVLDVSNNKLTSVDDIQNLTKLEDLWLNDNQIESLEAITEA 284

Query: 410 VAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA 279
           V GS +KLTT+YLE NPCA S +Y++ +RQIFPN++Q+DS +FA
Sbjct: 285 VTGSKEKLTTIYLENNPCAKSSDYVAAVRQIFPNVEQIDSNIFA 328



 Score = 92.8 bits (229), Expect(2) = e-115
 Identities = 53/101 (52%), Positives = 61/101 (60%)
 Frame = -3

Query: 1255 SDSTPDNGETSSSSPTVLDLTSFQXXXXXXXXXXXXXXXXXLTANRLSALDPRISHLSNL 1076
            SD   +  E    S  VLDLTS+Q                 LTANRLS LD RI+ LS L
Sbjct: 3    SDKEEEPLEEIGDSNNVLDLTSYQLHSLDTVELPPNLIELDLTANRLSGLDSRIAQLSTL 62

Query: 1075 NKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP 953
             K SLRQNLI D+A+EPLS W  +S LEELVLRDN+L K+P
Sbjct: 63   KKLSLRQNLIDDSAVEPLSHWDALSDLEELVLRDNKLAKVP 103



 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 41/150 (27%), Positives = 84/150 (56%), Gaps = 8/150 (5%)
 Frame = -2

Query: 845 SNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN--LCGLK 672
           S+ +   +EEI   +   +L+L S +L  ++ ++   NL EL L  NR+  ++  +  L 
Sbjct: 3   SDKEEEPLEEIGDSNN--VLDLTSYQLHSLDTVELPPNLIELDLTANRLSGLDSRIAQLS 60

Query: 671 CIKKISIQSNRL--TSMKGLEECVAL---EELYLSHNGIEKMEGLSTLVNLRVLDVSANK 507
            +KK+S++ N +  ++++ L    AL   EEL L  N + K+  +S    L V D+S N+
Sbjct: 61  TLKKLSLRQNLIDDSAVEPLSHWDALSDLEELVLRDNKLAKVPDVSIFTKLLVYDISFNE 120

Query: 506 LTAISNIANLTK-LEDLWLNDNNISSVEDI 420
           +T++  I+  +  L++L+++ N ++ + +I
Sbjct: 121 ITSLEGISKASSTLKELYVSKNEVNKIMEI 150



>gb:BT003139_1636720 Arabidopsis thaliana At5g19680 mRNA, complete
           cds.
          Length = 328

 Score =  347 bits (891), Expect(2) = e-115
 Identities = 170/224 (75%), Positives = 194/224 (86%)
 Frame = -2

Query: 950 VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN 771
           VSIF KLLV+D+SFNEITS  G+SK SSTLKELYVS N++ KI EIEH H LQILELGSN
Sbjct: 105 VSIFTKLLVYDISFNEITSLEGISKASSTLKELYVSKNEVNKIMEIEHLHNLQILELGSN 164

Query: 770 KLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEEL 591
           +LRVMENL+  T L+ELWLGRNRI+ +NLCGLKCIKKIS+QSNRLTSMKG EECVALEEL
Sbjct: 165 RLRVMENLENFTKLEELWLGRNRIKVVNLCGLKCIKKISLQSNRLTSMKGFEECVALEEL 224

Query: 590 YLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEA 411
           YLSHNGI KMEGLS LVNLRVLDVS NKLT++ +I NLTKLEDLWLNDN I S+E I EA
Sbjct: 225 YLSHNGISKMEGLSALVNLRVLDVSNNKLTSVDDIQNLTKLEDLWLNDNQIESLEAITEA 284

Query: 410 VAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA 279
           V GS +KLTT+YLE NPCA S +Y++ +RQIFPN++Q+DS LFA
Sbjct: 285 VTGSKEKLTTIYLENNPCAKSSDYVAAVRQIFPNVEQIDSNLFA 328



 Score = 91.3 bits (225), Expect(2) = e-115
 Identities = 51/93 (54%), Positives = 58/93 (62%)
 Frame = -3

Query: 1231 ETSSSSPTVLDLTSFQXXXXXXXXXXXXXXXXXLTANRLSALDPRISHLSNLNKFSLRQN 1052
            E    S  VLDLTS+Q                 LTANRLS LD RI+ LS L K SLRQN
Sbjct: 11   EEIGDSNNVLDLTSYQLHSLDTVELPPNLIELDLTANRLSGLDSRIAQLSTLKKLSLRQN 70

Query: 1051 LITDAALEPLSSWHTISQLEELVLRDNQLKKIP 953
            LI D+A+EPLS W  +S LEELVLRDN+L K+P
Sbjct: 71   LIDDSAVEPLSHWDALSDLEELVLRDNKLAKVP 103



 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 37/132 (28%), Positives = 76/132 (57%), Gaps = 8/132 (6%)
 Frame = -2

Query: 791 ILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN--LCGLKCIKKISIQSNRL--TSMK 624
           +L+L S +L  ++ ++   NL EL L  NR+  ++  +  L  +KK+S++ N +  ++++
Sbjct: 19  VLDLTSYQLHSLDTVELPPNLIELDLTANRLSGLDSRIAQLSTLKKLSLRQNLIDDSAVE 78

Query: 623 GLEECVAL---EELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTK-LEDLW 456
            L    AL   EEL L  N + K+  +S    L V D+S N++T++  I+  +  L++L+
Sbjct: 79  PLSHWDALSDLEELVLRDNKLAKVPDVSIFTKLLVYDISFNEITSLEGISKASSTLKELY 138

Query: 455 LNDNNISSVEDI 420
           ++ N ++ + +I
Sbjct: 139 VSKNEVNKIMEI 150



>gb:AP005756_1857309 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBb0035N08.
          Length = 333

 Score =  343 bits (880), Expect(2) = e-109
 Identities = 168/223 (75%), Positives = 198/223 (88%)
 Frame = -2

Query: 947 SIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNK 768
           SIFK LLVFDVSFNEI+S  GLSKVSSTLKELYVS N++AK+EE+EHFH LQILELGSN+
Sbjct: 111 SIFKGLLVFDVSFNEISSLKGLSKVSSTLKELYVSKNEVAKMEELEHFHALQILELGSNR 170

Query: 767 LRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELY 588
           LRVMENL+TL NLQELWLGRNRI+ INLC LK IKK+S+QSNRLTSM GL+EC+ALEELY
Sbjct: 171 LRVMENLETLANLQELWLGRNRIKTINLCSLKAIKKLSLQSNRLTSMNGLQECIALEELY 230

Query: 587 LSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAV 408
           LSHNGI+KMEGLSTL NLRVLDVS+NKLTAI ++  L++LEDLWLNDN I S++ I  A+
Sbjct: 231 LSHNGIQKMEGLSTLQNLRVLDVSSNKLTAIEDVETLSRLEDLWLNDNQIPSLDGIESAL 290

Query: 407 AGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA 279
           A S +KLTT+YLERNPCA +PNY STL+ IFPN++Q+DS++ A
Sbjct: 291 ASSREKLTTIYLERNPCAKAPNYSSTLKTIFPNLEQLDSDMLA 333



 Score = 77.8 bits (190), Expect(2) = e-109
 Identities = 47/105 (44%), Positives = 58/105 (55%), Gaps = 1/105 (0%)
 Frame = -3

Query: 1264 GHPSDSTPDNGETSS-SSPTVLDLTSFQXXXXXXXXXXXXXXXXXLTANRLSALDPRISH 1088
            G P D+     E+    +   LDLTS Q                 LTANRL+A+DPRI  
Sbjct: 4    GDPVDAPAAAAESMEVEADQCLDLTSCQLHDLSEVEIPPTLEELELTANRLAAVDPRIGR 63

Query: 1087 LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP 953
            L  L K S RQNL+ DAA+ PLS+W  I+ L+ELV RDN+L  IP
Sbjct: 64   LPGLRKLSFRQNLLDDAAVAPLSTWADIAGLQELVFRDNKLTTIP 108



>pir|S68209|S68209 sds22 protein homolog - human>gb:BC000910_1967121
           Homo sapiens protein phosphatase 1, regulatory subunit
           7, mRNA (cDNA clone MGC:5224 IMAGE:2985840), complete
           cds.>gb:BT020134_1991404 Homo sapiens protein
           phosphatase 1, regulatory subunit 7 mRNA, complete
           cds.>gb:HSPPPR7_2019687 Homo sapiens protein
           phosphatase-1 regulatory subunit 7 (PPP1R7) gene, exon
           11, complete cds and alternatively spliced
           product.>gb:HSSDS22MR_2020296 H.sapiens sds22-like mRNA.
          Length = 360

 Score =  188 bits (477), Expect(2) = 3e-48
 Identities = 95/216 (43%), Positives = 150/216 (69%), Gaps = 1/216 (0%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R +
Sbjct: 143 ELEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAI 201

Query: 755 ENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSH 579
           EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLSH
Sbjct: 202 ENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSH 261

Query: 578 NGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGS 399
           NGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E     
Sbjct: 262 NGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGA- 320

Query: 398 LQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS 291
            + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct: 321 -RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA 355



 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 51/194 (26%), Positives = 97/194 (50%), Gaps = 14/194 (7%)
 Frame = -2

Query: 881 SKVSSTLKELYVSNNQIAKIEEIEHFHELQI-------------LELGSNKLRVMENLQT 741
           S + + L E  + + +    E+ E  HEL +             ++L   ++  +E  + 
Sbjct: 37  SGIVADLSEQSLKDGEERGEEDPEEEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEV 96

Query: 740 LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEK 564
           L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S N +  
Sbjct: 97  LKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRN 156

Query: 563 MEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLT 384
           +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      +L  L 
Sbjct: 157 IEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----DTLTNLE 211

Query: 383 TLYLERNPCANSPN 342
           +L+L +N      N
Sbjct: 212 SLFLGKNKITKLQN 225



 Score = 28.1 bits (61), Expect(2) = 3e-48
 Identities = 19/50 (38%), Positives = 25/50 (50%)
 Frame = -3

Query: 1087 LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL 938
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct: 97   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL 141



>gb:HSPPPR7_2019688 Homo sapiens protein phosphatase-1 regulatory
           subunit 7 (PPP1R7) gene, exon 11, complete cds and
           alternatively spliced product.
          Length = 317

 Score =  188 bits (477), Expect(2) = 3e-48
 Identities = 95/216 (43%), Positives = 150/216 (69%), Gaps = 1/216 (0%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R +
Sbjct: 100 ELEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAI 158

Query: 755 ENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSH 579
           EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLSH
Sbjct: 159 ENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSH 218

Query: 578 NGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGS 399
           NGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E     
Sbjct: 219 NGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGA- 277

Query: 398 LQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS 291
            + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct: 278 -RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA 312



 Score = 91.3 bits (225), Expect = 4e-17
 Identities = 56/167 (33%), Positives = 104/167 (62%), Gaps = 1/167 (0%)
 Frame = -2

Query: 860 KELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-NL 684
           +++ +++ +I KIE  E   +++ L L  N ++ +ENL+ L +L+EL L  N+I+ I NL
Sbjct: 36  EDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENL 95

Query: 683 CGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKL 504
             L  ++ + I  N L +++G+++   L++L+L +N I K+E LS L  L++L++ +N++
Sbjct: 96  EALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRI 155

Query: 503 TAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
            AI NI  LT LE L+L  N I+ ++++      +L  LT L ++ N
Sbjct: 156 RAIENIDTLTNLESLFLGKNKITKLQNL-----DALTNLTVLSMQSN 197



 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 45/162 (27%), Positives = 87/162 (53%), Gaps = 1/162 (0%)
 Frame = -2

Query: 824 IEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQ 648
           +E I    + + ++L   ++  +E  + L  ++ L L +N I+ I NL  L+ ++++ + 
Sbjct: 26  METINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLY 85

Query: 647 SNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKL 468
            N++  ++ LE    LE L +S N +  +EG+  L  L+ L +  NK++ I N++NL +L
Sbjct: 86  DNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQL 145

Query: 467 EDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPN 342
           + L L  N I ++E+I      +L  L +L+L +N      N
Sbjct: 146 QMLELGSNRIRAIENI-----DTLTNLESLFLGKNKITKLQN 182



 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 49/154 (31%), Positives = 79/154 (51%), Gaps = 1/154 (0%)
 Frame = -2

Query: 821 EEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQS 645
           E +E  HEL +          ME +    + +++ L   RI  I     LK +K + ++ 
Sbjct: 14  EMMEEEHELPV---------DMETINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQ 64

Query: 644 NRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLE 465
           N +  ++ LEE  +L EL L  N I+K+E L  L  L +LD+S N L  I  +  LT+L+
Sbjct: 65  NLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLK 124

Query: 464 DLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
            L+L +N IS +E+++     +L +L  L L  N
Sbjct: 125 KLFLVNNKISKIENLS-----NLHQLQMLELGSN 153



 Score = 28.1 bits (61), Expect(2) = 3e-48
 Identities = 19/50 (38%), Positives = 25/50 (50%)
 Frame = -3

Query: 1087 LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL 938
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct: 54   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL 98



>gb:CR857075_1181328 Pongo pygmaeus mRNA; cDNA DKFZp468I1227 (from
           clone DKFZp468I1227).
          Length = 360

 Score =  187 bits (476), Expect(2) = 4e-48
 Identities = 95/216 (43%), Positives = 150/216 (69%), Gaps = 1/216 (0%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           +L + D+SFN + +  G+ KV+  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R +
Sbjct: 143 ELEILDISFNLLRNIEGVDKVTQ-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAI 201

Query: 755 ENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSH 579
           EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L+ELYLSH
Sbjct: 202 ENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLQELYLSH 261

Query: 578 NGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGS 399
           NGIE +EGL     L +LD+++N++  I NI++LT+ ++ W+NDN + S  D+ E     
Sbjct: 262 NGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTEPQEFWMNDNLLESWSDLDELKGA- 320

Query: 398 LQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS 291
            + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct: 321 -RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA 355



 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 50/194 (25%), Positives = 97/194 (50%), Gaps = 14/194 (7%)
 Frame = -2

Query: 881 SKVSSTLKELYVSNNQIAKIEEIEHFHELQI-------------LELGSNKLRVMENLQT 741
           S + + L E  + + +    E+ E  HEL +             ++L   ++  +E  + 
Sbjct: 37  SGIVADLSEQSLKDGEERGEEDPEEEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEV 96

Query: 740 LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEK 564
           L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S N +  
Sbjct: 97  LKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRN 156

Query: 563 MEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLT 384
           +EG+  +  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      +L  L 
Sbjct: 157 IEGVDKVTQLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----DTLTNLE 211

Query: 383 TLYLERNPCANSPN 342
           +L+L +N      N
Sbjct: 212 SLFLGKNKITKLQN 225



 Score = 28.1 bits (61), Expect(2) = 4e-48
 Identities = 19/50 (38%), Positives = 25/50 (50%)
 Frame = -3

Query: 1087 LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL 938
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct: 97   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL 141



>gb:AF067129_2053192 Mus musculus protein phosphatase-1 regulatory
           subunit 7 (Ppp1r7) gene, exons 1 through 11 and complete
           cds.>gb:AF222867_2059669 Mus musculus protein
           phosphatase-1 regulatory subunit 7 (Ppp1r7) mRNA,
           complete cds.>gb:BC013524_2091807 Mus musculus protein
           phosphatase 1, regulatory (inhibitor) subunit 7, mRNA
           (cDNA clone MGC:19201 IMAGE:4237290), complete cds.
          Length = 361

 Score =  185 bits (470), Expect(2) = 1e-47
 Identities = 95/216 (43%), Positives = 148/216 (68%), Gaps = 1/216 (0%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           +L V D+SFN + +  G+ K++  LK+L++ NN+I KIE I + H+LQ+LELGSN++R +
Sbjct: 144 ELEVLDISFNMLRNIEGIDKLTQ-LKKLFLVNNKINKIENISNLHQLQMLELGSNRIRAI 202

Query: 755 ENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSH 579
           EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRL  ++GL+  V L ELYLS+
Sbjct: 203 ENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSVQSNRLAKIEGLQSLVNLRELYLSN 262

Query: 578 NGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGS 399
           NGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E     
Sbjct: 263 NGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGA- 321

Query: 398 LQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS 291
            + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct: 322 -RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA 356



 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 56/170 (32%), Positives = 106/170 (62%), Gaps = 1/170 (0%)
 Frame = -2

Query: 860 KELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-NL 684
           +++ +++ +I KIE +E   +++ L L  N ++ +ENL+ L +L+EL L  N+I+ I NL
Sbjct: 80  EDVDLTHYRIGKIEGLEVLKKVKSLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENL 139

Query: 683 CGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKL 504
             L  ++ + I  N L +++G+++   L++L+L +N I K+E +S L  L++L++ +N++
Sbjct: 140 EALTELEVLDISFNMLRNIEGIDKLTQLKKLFLVNNKINKIENISNLHQLQMLELGSNRI 199

Query: 503 TAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCA 354
            AI NI  LT LE L+L  N I+ ++++      +L  LT L ++ N  A
Sbjct: 200 RAIENIDTLTNLESLFLGKNKITKLQNL-----DALTNLTVLSVQSNRLA 244



 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 47/162 (29%), Positives = 87/162 (53%), Gaps = 1/162 (0%)
 Frame = -2

Query: 824 IEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQ 648
           +E I    + + ++L   ++  +E L+ L  ++ L L +N I+ I NL  L+ ++++ + 
Sbjct: 70  METINLDRDAEDVDLTHYRIGKIEGLEVLKKVKSLCLRQNLIKCIENLEELQSLRELDLY 129

Query: 647 SNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKL 468
            N++  ++ LE    LE L +S N +  +EG+  L  L+ L +  NK+  I NI+NL +L
Sbjct: 130 DNQIKKIENLEALTELEVLDISFNMLRNIEGIDKLTQLKKLFLVNNKINKIENISNLHQL 189

Query: 467 EDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPN 342
           + L L  N I ++E+I      +L  L +L+L +N      N
Sbjct: 190 QMLELGSNRIRAIENI-----DTLTNLESLFLGKNKITKLQN 226



 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 52/154 (33%), Positives = 80/154 (51%), Gaps = 1/154 (0%)
 Frame = -2

Query: 821 EEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQS 645
           E+ E  HEL +          ME +    + +++ L   RI  I  L  LK +K + ++ 
Sbjct: 58  EDPEEEHELAV---------DMETINLDRDAEDVDLTHYRIGKIEGLEVLKKVKSLCLRQ 108

Query: 644 NRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLE 465
           N +  ++ LEE  +L EL L  N I+K+E L  L  L VLD+S N L  I  I  LT+L+
Sbjct: 109 NLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEVLDISFNMLRNIEGIDKLTQLK 168

Query: 464 DLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
            L+L +N I+ +E+I+     +L +L  L L  N
Sbjct: 169 KLFLVNNKINKIENIS-----NLHQLQMLELGSN 197



 Score = 28.5 bits (62), Expect(2) = 1e-47
 Identities = 19/50 (38%), Positives = 25/50 (50%)
 Frame = -3

Query: 1087 LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL 938
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct: 98   LKKVKSLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL 142



>gb:BC088868_2110644 Rattus norvegicus protein phosphatase 1,
           regulatory (inhibitor) subunit 7 (predicted), mRNA (cDNA
           clone MGC:105784 IMAGE:7321115), complete cds.
          Length = 360

 Score =  185 bits (469), Expect(2) = 2e-47
 Identities = 96/216 (44%), Positives = 147/216 (68%), Gaps = 1/216 (0%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           +L V D+SFN + +  G+ K++  LK+L++ NN+I KIE I    +LQ+LELGSN++R +
Sbjct: 143 ELEVLDISFNLLRNIEGIDKLTQ-LKKLFLVNNKINKIENISTLQQLQMLELGSNRIRAI 201

Query: 755 ENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSH 579
           EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLSH
Sbjct: 202 ENIDTLTNLESLFLGKNKITKLQNLDALSNLTVLSMQSNRLTKIEGLQNLVNLRELYLSH 261

Query: 578 NGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGS 399
           NGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E     
Sbjct: 262 NGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGA- 320

Query: 398 LQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS 291
            + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct: 321 -RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA 355



 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 56/167 (33%), Positives = 104/167 (62%), Gaps = 1/167 (0%)
 Frame = -2

Query: 860 KELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-NL 684
           +++ +++ +I KIE  E   +++ L L  N ++ +ENL  L +L+EL L  N+I+ I NL
Sbjct: 79  EDVDLNHYRIGKIEGFEVLKKVKSLCLRQNLIKCIENLDELQSLRELDLYDNQIKKIENL 138

Query: 683 CGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKL 504
             L  ++ + I  N L +++G+++   L++L+L +N I K+E +STL  L++L++ +N++
Sbjct: 139 EALTELEVLDISFNLLRNIEGIDKLTQLKKLFLVNNKINKIENISTLQQLQMLELGSNRI 198

Query: 503 TAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
            AI NI  LT LE L+L  N I+ ++++      +L  LT L ++ N
Sbjct: 199 RAIENIDTLTNLESLFLGKNKITKLQNL-----DALSNLTVLSMQSN 240



 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 45/162 (27%), Positives = 85/162 (52%), Gaps = 1/162 (0%)
 Frame = -2

Query: 824 IEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQ 648
           +E I    + + ++L   ++  +E  + L  ++ L L +N I+ I NL  L+ ++++ + 
Sbjct: 69  METISLDRDAEDVDLNHYRIGKIEGFEVLKKVKSLCLRQNLIKCIENLDELQSLRELDLY 128

Query: 647 SNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKL 468
            N++  ++ LE    LE L +S N +  +EG+  L  L+ L +  NK+  I NI+ L +L
Sbjct: 129 DNQIKKIENLEALTELEVLDISFNLLRNIEGIDKLTQLKKLFLVNNKINKIENISTLQQL 188

Query: 467 EDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPN 342
           + L L  N I ++E+I      +L  L +L+L +N      N
Sbjct: 189 QMLELGSNRIRAIENI-----DTLTNLESLFLGKNKITKLQN 225



 Score = 28.1 bits (61), Expect(2) = 2e-47
 Identities = 21/50 (42%), Positives = 25/50 (50%)
 Frame = -3

Query: 1087 LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL 938
            L  +    LRQNLI    +E L     +  L EL L DNQ+KKI  L  L
Sbjct: 97   LKKVKSLCLRQNLIK--CIENLDE---LQSLRELDLYDNQIKKIENLEAL 141



>gb:CR382136_1669089 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 369

 Score =  163 bits (412), Expect(2) = 5e-40
 Identities = 92/201 (45%), Positives = 131/201 (65%), Gaps = 2/201 (0%)
 Frame = -2

Query: 959 NSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILEL 780
           +S +S    L   D+SFN+I +   L  ++  L+ LY   N+I  I+ +E    L+ LEL
Sbjct: 139 SSQISKLTNLTNLDLSFNKIKNIKNLESLTK-LEHLYFVQNKIKDIKNLETLQNLKNLEL 197

Query: 779 GSNKLRVM-ENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECV 606
           G NK+ V+ E L  L NLQ+LWLG+N+I  + N+  L  ++ +SIQSNR+T ++GLE  V
Sbjct: 198 GGNKIEVISETLDKLVNLQQLWLGKNKIEKLENMSNLTNLRVLSIQSNRITKIEGLENLV 257

Query: 605 ALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVE 426
            LEELYLSHNGI K+E L    NL+VLDV++N+LT + N+ +LTKL D W + N ISS E
Sbjct: 258 NLEELYLSHNGITKIENLDKNANLQVLDVTSNRLTTLDNLNHLTKLTDFWCSYNKISSFE 317

Query: 425 DIAEAVAGSLQKLTTLYLERN 363
           +I + + G L +L T+Y E N
Sbjct: 318 EIGKEL-GKLPELDTVYFEGN 337



 Score = 25.4 bits (54), Expect(2) = 5e-40
 Identities = 17/50 (34%), Positives = 23/50 (46%)
 Frame = -3

Query: 1105 DPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKI 956
            D  +S  + L    LRQNLIT      +    T   L+EL   DN++  I
Sbjct: 92   DLNLSRFNKLESLCLRQNLITSMVEVKVLPGET---LQELDFYDNRINHI 138



>gb:CR382128_1660928 Yarrowia lipolytica chromosome B of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 352

 Score =  164 bits (415), Expect = 4e-39
 Identities = 88/214 (41%), Positives = 142/214 (66%), Gaps = 4/214 (1%)
 Frame = -2

Query: 920 DVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQT 741
           D SFN+I     +SK++  +   Y+  N+I +I  +++  +L  LELG+N++RV+ENL  
Sbjct: 136 DFSFNKIRHIKNVSKLTKVIN-FYLCQNKIQEIRGLDNMPDLVNLELGANRIRVIENLDH 194

Query: 740 LTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEK 564
           L NL++LWLG+N+IR ++ L GL+ ++ +SIQSNR+T ++GLE+   LEELY+SHNGI K
Sbjct: 195 LKNLRQLWLGKNKIRKLSGLSGLESLETLSIQSNRITKIEGLEKLKNLEELYISHNGITK 254

Query: 563 MEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLT 384
           +EGL     LR LD++ N +T +  +++L  LE+ W +D  +S+ ++I E   G L  L 
Sbjct: 255 IEGLEHNTKLRTLDITGNPITTLEGVSHLKDLEEFWASDCKLSNYKEI-ETELGQLPNLE 313

Query: 383 TLYLERNPC--ANSPNYISTLRQ-IFPNIQQVDS 291
           T+Y ERNP    N   Y + +R  + P+++Q+D+
Sbjct: 314 TVYFERNPLHRENPATYRNKVRLCLGPSLRQIDA 347



>gb:CR382124_1656456 Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 362

 Score =  155 bits (392), Expect(2) = 7e-39
 Identities = 93/230 (40%), Positives = 141/230 (61%), Gaps = 7/230 (3%)
 Frame = -2

Query: 959 NSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILEL 780
           +  V++F  L   D+SFN+I +   + K+ + L+ LY   N+I+KIE +    +L+ LEL
Sbjct: 130 SKSVNLFSNLKTLDLSFNKIRTIKNVDKLVN-LENLYFVQNKISKIENLGTLTKLKNLEL 188

Query: 779 GSNKLRVM--ENLQTLTNLQELWLGRNRI-RAINLCGLKCIKKISIQSNRLTSMKGLEEC 609
           G N+++ +  ++L+ L NL+E+WLG+N I + INL  LK ++ +SIQSN+L   +GLEE 
Sbjct: 189 GGNRIKEIGPDDLKGLANLEEIWLGKNSIPKLINLQHLKNLRILSIQSNKLKKFEGLEEL 248

Query: 608 VALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV 429
             LEELY+SHN I K+EGL   + L  LDV+ N+LT I N+ +LT L DLW +DN I   
Sbjct: 249 ENLEELYVSHNFISKIEGLENNLKLTTLDVTGNRLTKIENLKHLTHLTDLWASDNQIDQP 308

Query: 428 EDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQIFPN----IQQVDS 291
            +      G L +  T+YLE NP   + N     R+I  N    +Q++D+
Sbjct: 309 FESLGEELGKLPEFETIYLEGNP-IQTKNPTQYRRKIMLNLGESLQKIDA 357



 Score = 53.9 bits (128), Expect = 7e-06
 Identities = 37/113 (32%), Positives = 61/113 (53%), Gaps = 3/113 (2%)
 Frame = -2

Query: 692 INLCGLKCIKKISIQSNRLTSMKGLE--ECVALEELYLSHNGIEKM-EGLSTLVNLRVLD 522
           +NL   K +KK+ ++ N + S+  LE      +EE+    N I+ + + ++   NL+ LD
Sbjct: 84  LNLLRFKNLKKLYLRQNLIESIAELEVLPLENMEEIDFYDNRIKHISKSVNLFSNLKTLD 143

Query: 521 VSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
           +S NK+  I N+  L  LE+L+   N IS +E++     G+L KL  L L  N
Sbjct: 144 LSFNKIRTIKNVDKLVNLENLYFVQNKISKIENL-----GTLTKLKNLELGGN 191



 Score = 29.3 bits (64), Expect(2) = 7e-39
 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = -3

Query: 1117 LSALDPRISHLSNLNKFSLRQNLITD-AALEPLSSWHTISQLEELVLRDNQLKKI 956
            L+  D  +    NL K  LRQNLI   A LE L     +  +EE+   DN++K I
Sbjct: 79   LALEDLNLLRFKNLKKLYLRQNLIESIAELEVL----PLENMEEIDFYDNRIKHI 129



>gb:BC075482_2558585 Xenopus tropicalis protein phosphatase 1,
           regulatory subunit 7, mRNA (cDNA clone MGC:89316
           IMAGE:6986950), complete cds.
          Length = 346

 Score =  161 bits (408), Expect = 2e-38
 Identities = 88/217 (40%), Positives = 137/217 (63%), Gaps = 1/217 (0%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRV 759
           + L + D+SFN +    GL  +S  L+ LY+ NN+I++IE      +L++LELGSN+LRV
Sbjct: 128 RDLQILDLSFNLLRRIEGLESLSH-LQRLYLVNNKISRIENFGTLTQLRLLELGSNRLRV 186

Query: 758 MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS 582
           +ENL +L  L  L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLS
Sbjct: 187 IENLDSLRELDSLFLGKNKITKLQNLETLTNLTVLSVQSNRLTKIEGLQNLVNLRELYLS 246

Query: 581 HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG 402
            NGI+ +EGL     L  LD+++N++  I NI +L++L++ W+NDN + +  D+ E    
Sbjct: 247 DNGIQVIEGLENNNKLTTLDLASNRIKRIENIKHLSELQEFWMNDNLVENWSDLEE--LS 304

Query: 401 SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS 291
               L T+YLERNP      Y   +    P+++Q+D+
Sbjct: 305 GAPGLQTVYLERNPLQKDAQYRRKIMLALPSVRQIDA 341



 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 57/189 (30%), Positives = 108/189 (57%), Gaps = 3/189 (1%)
 Frame = -2

Query: 920 DVSFNEITSPSGLSKVS--STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENL 747
           +V   E  +P  +  ++     +++ +++ +I KI+  E   +++ L L  N ++++ENL
Sbjct: 43  EVPLGEADAPVDIETINLDPEAEDVDLNHFKIGKIQGFEVLKKVKTLCLRQNLIKLIENL 102

Query: 746 QTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGI 570
           + L  L EL L  N+IR I NL  L+ ++ + +  N L  ++GLE    L+ LYL +N I
Sbjct: 103 EQLVTLTELDLYDNQIRKIGNLETLRDLQILDLSFNLLRRIEGLESLSHLQRLYLVNNKI 162

Query: 569 EKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQK 390
            ++E   TL  LR+L++ +N+L  I N+ +L +L+ L+L  N I+ ++++      +L  
Sbjct: 163 SRIENFGTLTQLRLLELGSNRLRVIENLDSLRELDSLFLGKNKITKLQNLE-----TLTN 217

Query: 389 LTTLYLERN 363
           LT L ++ N
Sbjct: 218 LTVLSVQSN 226



>gb:AE014297_1140020 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003717_1222013 Drosophila melanogaster
           chromosome 3R, section 55 of 118 of the complete
           sequence.>gb:AY070854_1294939 Drosophila melanogaster
           GM06266 full length cDNA.>gb:AY118751_1300473 Drosophila
           melanogaster GH07711 full insert cDNA.
          Length = 326

 Score =  159 bits (403), Expect = 9e-38
 Identities = 88/217 (40%), Positives = 135/217 (62%), Gaps = 1/217 (0%)
 Frame = -2

Query: 932 LLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVME 753
           L V D+SFN +T    L K+   L+++Y  +N+I +IE ++    L +LELG NKL+ +E
Sbjct: 107 LEVLDISFNRLTKIENLDKLVK-LEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIE 165

Query: 752 NLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
           N++ L NL++L+LG+N+I  I NL  L  ++ +S+Q+NR+  ++ LE+   L ELY+S N
Sbjct: 166 NIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVKIENLEKLANLRELYVSEN 225

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
           G+E +E LS    L  LD++ N+L  I+N+  L  LE+LWLN N +   +DI        
Sbjct: 226 GVETIENLSENTKLETLDLAKNRLKGIANLEKLELLEELWLNHNGVDDWKDIELLKVN-- 283

Query: 395 QKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSEL 285
           + L T+YLE NP A    Y S LR I P +Q++D+ L
Sbjct: 284 KALQTIYLEYNPLAKDVRYRSKLRDILPQLQKIDATL 320



 Score = 90.9 bits (224), Expect = 5e-17
 Identities = 64/208 (30%), Positives = 109/208 (52%), Gaps = 3/208 (1%)
 Frame = -2

Query: 905 EITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQ 726
           ++ S   +  +     EL +++ +I K+E  E    ++ L L  N ++ +ENL +L  L 
Sbjct: 27  DVASIEDIITIDPDCYELDLNHRRIEKLENFEPLTRIERLFLRWNLIKKIENLSSLKTLI 86

Query: 725 ELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLS 549
           EL L  N+I  I NL  L  ++ + I  NRLT ++ L++ V LE++Y   N I ++E L 
Sbjct: 87  ELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLD 146

Query: 548 TLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLE 369
            L NL +L++  NKL  I NI  L  L  L+L  N I+ +E++      +L  L  L L+
Sbjct: 147 MLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENL-----DTLVNLEILSLQ 201

Query: 368 RNPCANSPNY--ISTLRQIFPNIQQVDS 291
            N      N   ++ LR+++ +   V++
Sbjct: 202 ANRIVKIENLEKLANLRELYVSENGVET 229



>gb:AF214664_1251334 Drosophila melanogaster putative mitotic
           protein phosphatase 1 regulator (sds22) mRNA, complete
           cds.
          Length = 326

 Score =  159 bits (401), Expect = 2e-37
 Identities = 88/217 (40%), Positives = 135/217 (62%), Gaps = 1/217 (0%)
 Frame = -2

Query: 932 LLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVME 753
           L V D+SFN +T    L K+   L+++Y  +N+I +IE ++    L +LELG NKL+ +E
Sbjct: 107 LEVLDISFNRLTKIENLDKLVK-LEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIE 165

Query: 752 NLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
           N++ L NL++L+LG+N+I  I NL  L  ++ +S+Q+NR+  ++ LE+   L ELY+S N
Sbjct: 166 NIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVKIETLEKLANLRELYVSEN 225

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
           G+E +E LS    L  LD++ N+L  I+N+  L  LE+LWLN N +   +DI        
Sbjct: 226 GVETIENLSENTKLETLDLAKNRLKGIANLEKLELLEELWLNHNGVDDWKDIELLKVN-- 283

Query: 395 QKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSEL 285
           + L T+YLE NP A    Y S LR I P +Q++D+ L
Sbjct: 284 KALQTIYLEYNPLAKDVRYRSKLRDILPQLQKIDATL 320



 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 60/182 (32%), Positives = 97/182 (53%), Gaps = 1/182 (0%)
 Frame = -2

Query: 905 EITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQ 726
           ++ S   +  +     EL +++ +I K+E  E    ++ L L  N ++ +ENL +L  L 
Sbjct: 27  DVASIEDIITIDPDCYELDLNHRRIEKLENFEPLTRIERLFLRWNLIKKIENLSSLKTLI 86

Query: 725 ELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLS 549
           EL L  N+I  I NL  L  ++ + I  NRLT ++ L++ V LE++Y   N I ++E L 
Sbjct: 87  ELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLD 146

Query: 548 TLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLE 369
            L NL +L++  NKL  I NI  L  L  L+L  N I+ +E++      +L  L  L L+
Sbjct: 147 MLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENL-----DTLVNLEILSLQ 201

Query: 368 RN 363
            N
Sbjct: 202 AN 203



 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 56/176 (31%), Positives = 83/176 (47%), Gaps = 3/176 (1%)
 Frame = -2

Query: 833 IAKIEEIEHFH-ELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKI 657
           +A IE+I     +   L+L   ++  +EN + LT ++ L+L  N I+ I           
Sbjct: 28  VASIEDIITIDPDCYELDLNHRRIEKLENFEPLTRIERLFLRWNLIKKIE---------- 77

Query: 656 SIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANL 477
                 L+S+K       L EL L  N I K+E L  L +L VLD+S N+LT I N+  L
Sbjct: 78  -----NLSSLK------TLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKL 126

Query: 476 TKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPN--YISTLRQIF 315
            KLE ++   N I+ +E++       L  LT L L  N      N   +  LRQ+F
Sbjct: 127 VKLEKVYFVSNRITQIENL-----DMLTNLTMLELGDNKLKKIENIEMLVNLRQLF 177



>gb:AE014185_937896 Plasmodium falciparum 3D7 chromosome 10 complete
            sequence.>gb:AE014834_1228630 Plasmodium falciparum 3D7
            chromosome 10 section 6 of 7 of the complete sequence.
          Length = 2070

 Score =  157 bits (396), Expect = 6e-37
 Identities = 93/242 (38%), Positives = 154/242 (63%), Gaps = 22/242 (9%)
 Frame = -2

Query: 950  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEI-------------- 813
            +S+   L V D+SFN+I     L  + + L+ELY+S+N+I+K+E++              
Sbjct: 1821 ISMLINLKVLDLSFNKIKIIENLETLVN-LEELYLSSNKISKVEKLKKKKKIKTYRMVDI 1879

Query: 812  ---EHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSN 642
               ++  +L++LELG NK+R++EN++ LTNL+ELWLG+N+I  INL  L  +KK+S+Q N
Sbjct: 1880 ENLQNCKKLRLLELGYNKIRMIENIEHLTNLEELWLGKNKIEQINLPYLPKLKKLSVQHN 1939

Query: 641  RLTSM--KGLEECVALEELYLSHNGIEK-MEGLSTLVNLRVLDVSANKLTAISNIANLTK 471
            RLT +  K ++  + +EELY+S+N I   ++    L +L+V D+S N++  IS  + L  
Sbjct: 1940 RLTDICEKSIKNILCVEELYISYNKINHIIDTFKDLKHLKVFDLSYNEINNISICSYLKS 1999

Query: 470  LEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANS--PNYISTLRQIFPNIQQV 297
            LE+LWLN+NNI ++E I +    +++ L TLYLE+N   ++   NY  T+  I P ++Q+
Sbjct: 2000 LEELWLNNNNIDNLEMIKK--LSTIENLKTLYLEKNKIQDNLKENYRKTIIHILPQLKQL 2057

Query: 296  DS 291
            D+
Sbjct: 2058 DA 2059



 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 57/167 (34%), Positives = 91/167 (54%)
 Frame = -2

Query: 863  LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAINL 684
            L+ L +  N I KIE I     L++L+L  NK++++ENL+TL NL+EL+L  N+I  +  
Sbjct: 1805 LEHLELYENMIKKIENISMLINLKVLDLSFNKIKIIENLETLVNLEELYLSSNKISKVE- 1863

Query: 683  CGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKL 504
               K  KK  I++ R+  ++ L+ C  L  L L +N I  +E +  L NL  L +  NK+
Sbjct: 1864 ---KLKKKKKIKTYRMVDIENLQNCKKLRLLELGYNKIRMIENIEHLTNLEELWLGKNKI 1920

Query: 503  TAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
              I N+  L KL+ L +  N ++   DI E    ++  +  LY+  N
Sbjct: 1921 EQI-NLPYLPKLKKLSVQHNRLT---DICEKSIKNILCVEELYISYN 1963



 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 62/189 (32%), Positives = 95/189 (50%), Gaps = 18/189 (9%)
 Frame = -2

Query: 941  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR 762
            FKK      S+N +   +  ++  + +   Y   ++I KIE IE   +L+ L+L SN + 
Sbjct: 1738 FKKKKKKMASYNVLGELTTFNEDETIITHQY---SRIKKIENIEKCKKLKTLKLISNCIE 1794

Query: 761  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL 585
             +ENL+    L+ L L  N I+ I N+  L  +K + +  N++  ++ LE  V LEELYL
Sbjct: 1795 KLENLENNVQLEHLELYENMIKKIENISMLINLKVLDLSFNKIKIIENLETLVNLEELYL 1854

Query: 584  SHNGIEK-----------------MEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLW 456
            S N I K                 +E L     LR+L++  NK+  I NI +LT LE+LW
Sbjct: 1855 SSNKISKVEKLKKKKKIKTYRMVDIENLQNCKKLRLLELGYNKIRMIENIEHLTNLEELW 1914

Query: 455  LNDNNISSV 429
            L  N I  +
Sbjct: 1915 LGKNKIEQI 1923



 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 41/97 (42%), Positives = 62/97 (63%), Gaps = 1/97 (1%)
 Frame = -2

Query: 707  NRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLR 531
            +RI+ I N+   K +K + + SN +  ++ LE  V LE L L  N I+K+E +S L+NL+
Sbjct: 1769 SRIKKIENIEKCKKLKTLKLISNCIEKLENLENNVQLEHLELYENMIKKIENISMLINLK 1828

Query: 530  VLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
            VLD+S NK+  I N+  L  LE+L+L+ N IS VE +
Sbjct: 1829 VLDLSFNKIKIIENLETLVNLEELYLSSNKISKVEKL 1865



>sp|P36047|SD22_YEAST Protein phosphatases PP1 regulatory subunit
           SDS22.>pir|S38030|S38030 suppressor protein SDS22 -
           yeast (Saccharomyces cerevisiae)>gb:AY558314_1614541
           Saccharomyces cerevisiae clone FLH111304.01X YKL193C
           gene, complete cds.>gb:SCSDS22_1709461 S.cerevisiae
           SDS22 gene.>gb:SCYKL193C_1713173 S.cerevisiae chromosome
           XI reading frame ORF YKL193c.
          Length = 338

 Score =  154 bits (390), Expect(2) = 1e-36
 Identities = 96/230 (41%), Positives = 144/230 (62%), Gaps = 7/230 (3%)
 Frame = -2

Query: 959 NSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILEL 780
           +S V+   KL   D+SFN+I     L  ++  L+ LY   N I+KIE +     L+ LEL
Sbjct: 106 SSNVNKLTKLTSLDLSFNKIKHIKNLENLTD-LENLYFVQNSISKIENLSTLKSLKNLEL 164

Query: 779 GSNKLRVME--NLQTLTNLQELWLGRNRI-RAINLCGLKCIKKISIQSNRLTSMKGLEEC 609
           G NK+  +E  + + L+NL+E+WLG+N I R INL  LK +K +SIQSN+L  ++ LEE 
Sbjct: 165 GGNKVHSIEPDSFEGLSNLEEIWLGKNSIPRLINLHPLKNLKILSIQSNKLKKIENLEEL 224

Query: 608 VALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNI-SS 432
             LEELYLSHN I K+EGL   + L  LDV++NK+T++ N+ +L+ L D+W + N I  S
Sbjct: 225 TNLEELYLSHNFITKIEGLEKNLKLTTLDVTSNKITSLENLNHLSNLTDIWASFNKIDQS 284

Query: 431 VEDIAEAVAGSLQKLTTLYLERNP--CANSPNYISTL-RQIFPNIQQVDS 291
            E + E ++ +L +L T+YLE NP    N  +Y   L   + P++Q++D+
Sbjct: 285 FESLGENLS-ALSRLETIYLEGNPIQLENKTSYRRKLTMNLPPSLQKIDA 333



 Score = 22.3 bits (46), Expect(2) = 1e-36
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 2/52 (3%)
 Frame = -3

Query: 1105 DPRISHLSNLNKFSLRQNLITDAALEPLSSWHTI--SQLEELVLRDNQLKKI 956
            D  +    NL +  LRQNLI     E +S    +   ++ +L   DN++K I
Sbjct: 59   DLNLYRFKNLKQLCLRQNLI-----ESISEVEVLPHDKIVDLDFYDNKIKHI 105



>gb:AE017344_1756316 Cryptococcus neoformans var. neoformans JEC21
           chromosome 4, complete sequence.
          Length = 374

 Score =  154 bits (390), Expect = 3e-36
 Identities = 87/216 (40%), Positives = 135/216 (62%), Gaps = 6/216 (2%)
 Frame = -2

Query: 920 DVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIE--EIEHFHE-LQILELGSNKLRVMEN 750
           D+SFN I     L  +   +  LY+  N+I+++E  E++   + ++ LELG N++RV+EN
Sbjct: 156 DLSFNNIRHAPSLPSLQH-VNTLYLVQNKISRLEKGELDWCQDTMKSLELGGNRIRVIEN 214

Query: 749 LQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNG 573
           L  L +LQELWLG+N+IR + NL     ++ +S+QSNR+T ++ LE  V LEELYLSHNG
Sbjct: 215 LDKLIHLQELWLGKNKIRVLENLSTFSSLRILSLQSNRITKLENLEGLVNLEELYLSHNG 274

Query: 572 IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQ 393
           ++K+EGL   + L  LDV  N +  I N+++L+ LE+ W ++N I S+  + E+    L 
Sbjct: 275 LQKIEGLHHNIKLTTLDVGNNFIKEIENLSHLSNLEEFWASNNQIGSLHAL-ESELRPLT 333

Query: 392 KLTTLYLERNPCANSP--NYISTLRQIFPNIQQVDS 291
            L T+YLE NPC      NY   +    P ++Q+D+
Sbjct: 334 NLCTIYLEGNPCQKEDMGNYRRKIMLALPQVKQIDA 369



>sp|P22194|SD22_SCHPO Protein phosphatases PP1 regulatory subunit
           sds22.>pir|S43988|S43988 protein phosphatases pp1
           regulatory subunit sds22 - fission yeast
           (Schizosaccharomyces pombe)>gb:SPAC4A8_1717918 S.pombe
           chromosome I cosmid c4A8.
          Length = 332

 Score =  154 bits (388), Expect(2) = 3e-36
 Identities = 88/223 (39%), Positives = 137/223 (61%), Gaps = 5/223 (2%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRV 759
           K L   D+SFN I +   ++ +   L+ L+   N+I +IE +E    L  LELG NK+RV
Sbjct: 104 KNLTYLDLSFNNIKTIRNINHLKG-LENLFFVQNRIRRIENLEGLDRLTNLELGGNKIRV 162

Query: 758 MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA--LEELY 588
           +ENL TL NL++LW+G+N+I    N   L+ +  +SIQSNR+T  + L  C++  L ELY
Sbjct: 163 IENLDTLVNLEKLWVGKNKITKFENFEKLQKLSLLSIQSNRITQFENLA-CLSHCLRELY 221

Query: 587 LSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAV 408
           +SHNG+    G+  L NL +LDVS N +  +S +A L  L +LW ++N +SS ++I + +
Sbjct: 222 VSHNGLTSFSGIEVLENLEILDVSNNMIKHLSYLAGLKNLVELWASNNELSSFQEIEDEL 281

Query: 407 AGSLQKLTTLYLERNPC--ANSPNYISTLRQIFPNIQQVDSEL 285
           +G L+KL T+Y E NP    N   Y + +R   P ++Q+D+ +
Sbjct: 282 SG-LKKLETVYFEGNPLQKTNPAVYRNKVRLCLPQLRQIDATI 323



 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 53/167 (31%), Positives = 84/167 (50%), Gaps = 2/167 (1%)
 Frame = -2

Query: 857 ELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENL-QTLTNLQELWLGRNRI-RAINL 684
           EL  S  Q      +E F  LQ L L  N+++ +E++ +TLT   EL L  N I R  NL
Sbjct: 44  ELIQSRIQSMASLGLERFKNLQSLCLRQNQIKKIESVPETLT---ELDLYDNLIVRIENL 100

Query: 683 CGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKL 504
             +K +  + +  N + +++ +     LE L+   N I ++E L  L  L  L++  NK+
Sbjct: 101 DNVKNLTYLDLSFNNIKTIRNINHLKGLENLFFVQNRIRRIENLEGLDRLTNLELGGNKI 160

Query: 503 TAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
             I N+  L  LE LW+  N I+  E+  +     LQKL+ L ++ N
Sbjct: 161 RVIENLDTLVNLEKLWVGKNKITKFENFEK-----LQKLSLLSIQSN 202



 Score = 35.0 bits (79), Expect = 3.4
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = -2

Query: 956 SGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIE 810
           SG+ + + L + DVS N I   S L+ + + L EL+ SNN+++  +EIE
Sbjct: 231 SGIEVLENLEILDVSNNMIKHLSYLAGLKN-LVELWASNNELSSFQEIE 278



 Score = 21.9 bits (45), Expect(2) = 3e-36
 Identities = 9/14 (64%), Positives = 11/14 (78%)
 Frame = -3

Query: 997 LEELVLRDNQLKKI 956
           L+ L LR NQ+KKI
Sbjct: 64  LQSLCLRQNQIKKI 77



>gb:YSPSDS22_1731221 S.pombe sds22+ gene, complete cds.
          Length = 280

 Score =  154 bits (388), Expect(2) = 3e-36
 Identities = 88/223 (39%), Positives = 137/223 (61%), Gaps = 5/223 (2%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRV 759
           K L   D+SFN I +   ++ +   L+ L+   N+I +IE +E    L  LELG NK+RV
Sbjct: 52  KNLTYLDLSFNNIKTIRNINHLKG-LENLFFVQNRIRRIENLEGLDRLTNLELGGNKIRV 110

Query: 758 MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA--LEELY 588
           +ENL TL NL++LW+G+N+I    N   L+ +  +SIQSNR+T  + L  C++  L ELY
Sbjct: 111 IENLDTLVNLEKLWVGKNKITKFENFEKLQKLSLLSIQSNRITQFENLA-CLSHCLRELY 169

Query: 587 LSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAV 408
           +SHNG+    G+  L NL +LDVS N +  +S +A L  L +LW ++N +SS ++I + +
Sbjct: 170 VSHNGLTSFSGIEVLENLEILDVSNNMIKHLSYLAGLKNLVELWASNNELSSFQEIEDEL 229

Query: 407 AGSLQKLTTLYLERNPC--ANSPNYISTLRQIFPNIQQVDSEL 285
           +G L+KL T+Y E NP    N   Y + +R   P ++Q+D+ +
Sbjct: 230 SG-LKKLETVYFEGNPLQKTNPAVYRNKVRLCLPQLRQIDATI 271



 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 49/153 (32%), Positives = 80/153 (52%), Gaps = 2/153 (1%)
 Frame = -2

Query: 815 IEHFHELQILELGSNKLRVMENL-QTLTNLQELWLGRNRI-RAINLCGLKCIKKISIQSN 642
           +E F  LQ L L  N+++ +E++ +TLT   EL L  N I R  NL  +K +  + +  N
Sbjct: 6   LERFKNLQSLCLRQNQIKKIESVPETLT---ELDLYDNLIVRIENLDNVKNLTYLDLSFN 62

Query: 641 RLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLED 462
            + +++ +     LE L+   N I ++E L  L  L  L++  NK+  I N+  L  LE 
Sbjct: 63  NIKTIRNINHLKGLENLFFVQNRIRRIENLEGLDRLTNLELGGNKIRVIENLDTLVNLEK 122

Query: 461 LWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
           LW+  N I+  E+  +     LQKL+ L ++ N
Sbjct: 123 LWVGKNKITKFENFEK-----LQKLSLLSIQSN 150



 Score = 35.0 bits (79), Expect = 3.4
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = -2

Query: 956 SGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIE 810
           SG+ + + L + DVS N I   S L+ + + L EL+ SNN+++  +EIE
Sbjct: 179 SGIEVLENLEILDVSNNMIKHLSYLAGLKN-LVELWASNNELSSFQEIE 226



 Score = 21.9 bits (45), Expect(2) = 3e-36
 Identities = 9/14 (64%), Positives = 11/14 (78%)
 Frame = -3

Query: 997 LEELVLRDNQLKKI 956
           L+ L LR NQ+KKI
Sbjct: 12  LQSLCLRQNQIKKI 25



>gb:CR380950_1649807 Candida glabrata strain CBS138 chromosome D
           complete sequence.
          Length = 339

 Score =  154 bits (389), Expect = 4e-36
 Identities = 95/227 (41%), Positives = 143/227 (62%), Gaps = 7/227 (3%)
 Frame = -2

Query: 950 VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN 771
           ++ FK L   D+SFN+I +   + K+ + L+ LY   N+I  IE +    +L+ LELG N
Sbjct: 110 INKFKNLKNLDLSFNKIKNIKNIDKLEN-LENLYFVQNKIEVIENLSTLKKLKNLELGGN 168

Query: 770 KLRVM--ENLQTLTNLQELWLGRNRI-RAINLCGLKCIKKISIQSNRLTSMKGLEECVAL 600
           ++  +  ++L+ L  L+E+WLG+N I R INL  LK +K +SIQSNR+  ++ LE+   L
Sbjct: 169 RIHEIGEDSLKGLDKLEEIWLGKNHIPRLINLHWLKNLKILSIQSNRIKKIENLEQLENL 228

Query: 599 EELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNI-SSVED 423
           EELYLSHN IEK+EGL   + L  LD+++NK+T I N+ +LTKL DLWL+ N I  S E 
Sbjct: 229 EELYLSHNFIEKIEGLDKNLKLTTLDITSNKITKIENVKHLTKLTDLWLSFNKIDQSFES 288

Query: 422 IAEAVAGSLQKLTTLYLERNPCA--NSPNYISTLR-QIFPNIQQVDS 291
           I + +   L +  T+YLE NP    N  +Y   L   + P++Q++D+
Sbjct: 289 IGDELR-DLPEFDTIYLEGNPVQLNNKTSYRRKLMLNLGPSLQKIDA 334



>gb:AE016818_1748252 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 349

 Score =  149 bits (377), Expect = 1e-34
 Identities = 95/217 (43%), Positives = 137/217 (63%), Gaps = 7/217 (3%)
 Frame = -2

Query: 920 DVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM--ENL 747
           D+SFN+I +   + K++  L+ +Y   N+IA IE +     L+ LELG N++  +  E+L
Sbjct: 130 DLSFNKIKNIKNIDKLTK-LERVYFVQNKIAVIENLNTLGNLKSLELGGNRIAEIGPESL 188

Query: 746 QTLTNLQELWLGRNRI-RAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGI 570
           Q L  L+E+WLG+N I R  NL  LK +K +SIQSN+L +++GL+E   LEELYLSHN I
Sbjct: 189 QGLGGLEEIWLGKNSISRLANLQYLKNLKILSIQSNKLRNIEGLDELENLEELYLSHNFI 248

Query: 569 EKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNI-SSVEDIAEAVAGSLQ 393
           E +EGL     L  LDV+AN+LT I N++ LT L DLW + N I  S E +AE +   L+
Sbjct: 249 EHIEGLEKNTKLTTLDVTANRLTRIENVSKLTALTDLWASFNKIDQSFESLAEELK-DLK 307

Query: 392 KLTTLYLERNP--CANSPNYISTL-RQIFPNIQQVDS 291
            L T+YLE NP    N+  Y   L   + P++Q++D+
Sbjct: 308 ALETIYLEGNPIQTKNATTYRRKLVLNLGPSLQKIDA 344



 Score = 52.0 bits (123), Expect = 3e-05
 Identities = 33/97 (34%), Positives = 59/97 (60%), Gaps = 3/97 (3%)
 Frame = -2

Query: 701 IRAINLCGLKCIKKISIQSNRLTSMKGLEECVA--LEELYLSHNGIEKME-GLSTLVNLR 531
           + A++L   K ++++ ++ N + S+  +E   A  +EEL L  N I+ +   ++ LVNL+
Sbjct: 68  LEALDLHRFKKLERLYLRQNLIESISEVEVLPAETVEELDLYDNRIKHISRNVNKLVNLK 127

Query: 530 VLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
            LD+S NK+  I NI  LTKLE ++   N I+ +E++
Sbjct: 128 SLDLSFNKIKNIKNIDKLTKLERVYFVQNKIAVIENL 164



 Score = 34.7 bits (78), Expect = 4.5
 Identities = 22/78 (28%), Positives = 39/78 (50%)
 Frame = -3

Query: 1123 NRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLA 944
            N+++ ++  ++ L NL    L  N I +   E L     +  LEE+ L  N + ++  L 
Sbjct: 156  NKIAVIE-NLNTLGNLKSLELGGNRIAEIGPESLQG---LGGLEEIWLGKNSISRLANLQ 211

Query: 943  YLRNFWYLMFRSTKLHHL 890
            YL+N   L  +S KL ++
Sbjct: 212  YLKNLKILSIQSNKLRNI 229



>sp|P45969|YNZ9_CAEEL Hypothetical protein T09A5.9 in chromosome
           III.>pir|T24722|T24722 hypothetical protein T09A5.9 -
           Caenorhabditis elegans>gb:CET09A5_1367498 Caenorhabditis
           elegans cosmid T09A5, complete sequence.
          Length = 326

 Score =  142 bits (358), Expect = 2e-32
 Identities = 77/204 (37%), Positives = 128/204 (62%), Gaps = 3/204 (1%)
 Frame = -2

Query: 962 ENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILE 783
           E S +     L+  D+S+N I   +GL K++  L+ LY+ +N+I KIE +E   +L++LE
Sbjct: 95  EISHLESLVNLVSLDLSYNRIRQINGLDKLTK-LETLYLVSNKIEKIENLEALTQLKLLE 153

Query: 782 LGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQS---NRLTSMKGLEE 612
           LG N+++ +EN+  L NL EL++G+N+IR +   G++ ++K+S+ S   NR+  ++ +E+
Sbjct: 154 LGDNRIKKIENIGHLVNLDELFIGKNKIRQLE--GVETLQKLSVLSLPGNRIVKIENVEQ 211

Query: 611 CVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISS 432
              L+ELYLS  G++ + G+  L NL +LDV+ N++   S +  L  L D W NDN + S
Sbjct: 212 LNNLKELYLSDQGLQDIHGVEPLTNLLLLDVANNEIKTFSGVERLESLNDFWANDNKVES 271

Query: 431 VEDIAEAVAGSLQKLTTLYLERNP 360
             +I +     L+ L T+YLERNP
Sbjct: 272 FSEIEQ--LSKLKGLQTVYLERNP 293



 Score = 63.5 bits (153), Expect = 9e-09
 Identities = 43/144 (29%), Positives = 74/144 (51%), Gaps = 2/144 (1%)
 Frame = -2

Query: 788 LELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN--LCGLKCIKKISIQSNRLTSMKGLE 615
           ++L   +   + +L     ++EL +  N + +I+  +  L  +  + +  N+LT +  LE
Sbjct: 41  IDLTHTRADHIPDLTGFPKIEELRMRNNLLVSISPTISSLVTLTSLDLYENQLTEISHLE 100

Query: 614 ECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNIS 435
             V L  L LS+N I ++ GL  L  L  L + +NK+  I N+  LT+L+ L L DN I 
Sbjct: 101 SLVNLVSLDLSYNRIRQINGLDKLTKLETLYLVSNKIEKIENLEALTQLKLLELGDNRIK 160

Query: 434 SVEDIAEAVAGSLQKLTTLYLERN 363
            +E+I     G L  L  L++ +N
Sbjct: 161 KIENI-----GHLVNLDELFIGKN 179



 Score = 33.5 bits (75), Expect = 10.0
 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 1/71 (1%)
 Frame = -3

Query: 1099 RISHLSNLNKFSLRQNL-ITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWY 923
            RI  ++ L+K +  + L +    +E + +   ++QL+ L L DN++KKI  + +L N   
Sbjct: 114  RIRQINGLDKLTKLETLYLVSNKIEKIENLEALTQLKLLELGDNRIKKIENIGHLVNLDE 173

Query: 922  LMFRSTKLHHL 890
            L     K+  L
Sbjct: 174  LFIGKNKIRQL 184



>gb:LMFL8138_1388420 Leishmania major Friedlin chromosome 5 cosmid
           L8138.
          Length = 396

 Score =  142 bits (357), Expect = 2e-32
 Identities = 89/228 (39%), Positives = 134/228 (58%), Gaps = 11/228 (4%)
 Frame = -2

Query: 941 FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR 762
           F  L   D+S+N++   +GL  + STLKELY+  N+I  IE ++ F  L++LELG N++R
Sbjct: 151 FYSLTKLDLSYNQLRKITGLDSLGSTLKELYLVENKIKVIEGLDSFVHLELLELGGNRIR 210

Query: 761 -VMENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSMKG---LEEC-VA 603
            +   L  L +LQ LWLG+N+I +I  +L  L+ ++K+S+Q+NRLTS+      E C   
Sbjct: 211 EIGSGLSNLRSLQSLWLGKNKIHSIGDSLHNLRELRKLSLQANRLTSITAEAFKEGCNPY 270

Query: 602 LEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLT----AISNIANLTKLEDLWLNDNNIS 435
           L ELYLS NGI  +E L  L +L +LD S N ++    A+ N  N+ +LE+ WL D +IS
Sbjct: 271 LAELYLSENGISTIENL-PLHSLHLLDFSFNPISTINEAVINPTNMPELEEFWLTDGSIS 329

Query: 434 SVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS 291
              ++ +   G    L T+Y+ERNP      Y   +    P + Q+DS
Sbjct: 330 DWGEV-KKFCGFANTLRTIYVERNPIEQDKRYRDKVYMNLPFVTQIDS 376



>gb:AF239995_1253966 Leishmania major strain Friedlin chromosome 5
           cosmid L8530, complete sequence.
          Length = 337

 Score =  142 bits (357), Expect = 2e-32
 Identities = 89/228 (39%), Positives = 134/228 (58%), Gaps = 11/228 (4%)
 Frame = -2

Query: 941 FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR 762
           F  L   D+S+N++   +GL  + STLKELY+  N+I  IE ++ F  L++LELG N++R
Sbjct: 92  FYSLTKLDLSYNQLRKITGLDSLGSTLKELYLVENKIKVIEGLDSFVHLELLELGGNRIR 151

Query: 761 -VMENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSMKG---LEEC-VA 603
            +   L  L +LQ LWLG+N+I +I  +L  L+ ++K+S+Q+NRLTS+      E C   
Sbjct: 152 EIGSGLSNLRSLQSLWLGKNKIHSIGDSLHNLRELRKLSLQANRLTSITAEAFKEGCNPY 211

Query: 602 LEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLT----AISNIANLTKLEDLWLNDNNIS 435
           L ELYLS NGI  +E L  L +L +LD S N ++    A+ N  N+ +LE+ WL D +IS
Sbjct: 212 LAELYLSENGISTIENL-PLHSLHLLDFSFNPISTINEAVINPTNMPELEEFWLTDGSIS 270

Query: 434 SVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS 291
              ++ +   G    L T+Y+ERNP      Y   +    P + Q+DS
Sbjct: 271 DWGEV-KKFCGFANTLRTIYVERNPIEQDKRYRDKVYMNLPFVTQIDS 317



>gb:BT009897_2151285 Synthetic construct Homo sapiens protein
           phosphatase 1, regulatory subunit 7 mRNA, partial cds.
          Length = 281

 Score =  128 bits (322), Expect(2) = 2e-30
 Identities = 66/133 (49%), Positives = 99/133 (74%), Gaps = 1/133 (0%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R +
Sbjct: 143 ELEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAI 201

Query: 755 ENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSH 579
           EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLSH
Sbjct: 202 ENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSH 261

Query: 578 NGIEKMEGLSTLV 540
           NGIE +EGL   V
Sbjct: 262 NGIEVIEGLENNV 274



 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 51/194 (26%), Positives = 97/194 (50%), Gaps = 14/194 (7%)
 Frame = -2

Query: 881 SKVSSTLKELYVSNNQIAKIEEIEHFHELQI-------------LELGSNKLRVMENLQT 741
           S + + L E  + + +    E+ E  HEL +             ++L   ++  +E  + 
Sbjct: 37  SGIVADLSEQSLKDGEERGEEDPEEEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEV 96

Query: 740 LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEK 564
           L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S N +  
Sbjct: 97  LKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRN 156

Query: 563 MEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLT 384
           +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      +L  L 
Sbjct: 157 IEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----DTLTNLE 211

Query: 383 TLYLERNPCANSPN 342
           +L+L +N      N
Sbjct: 212 SLFLGKNKITKLQN 225



 Score = 28.1 bits (61), Expect(2) = 2e-30
 Identities = 19/50 (38%), Positives = 25/50 (50%)
 Frame = -3

Query: 1087 LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL 938
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct: 97   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL 141



>gb:BC012397_1973595 Homo sapiens protein phosphatase 1, regulatory
           subunit 7, mRNA (cDNA clone MGC:9803 IMAGE:3858906),
           complete cds.>gb:BC013001_1973895 Homo sapiens protein
           phosphatase 1, regulatory subunit 7, mRNA (cDNA clone
           MGC:3671 IMAGE:3528281), complete
           cds.>gb:BT007296_1990734 Homo sapiens protein
           phosphatase 1, regulatory subunit 7 mRNA, complete
           cds.>gb:HSPPPR5_2019685 Homo sapiens protein
           phosphatase-1 regulatory subunit 7 (PPP1R7) gene, exons
           8 and 9 and alternatively spliced products.
          Length = 280

 Score =  128 bits (322), Expect(2) = 2e-30
 Identities = 66/133 (49%), Positives = 99/133 (74%), Gaps = 1/133 (0%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R +
Sbjct: 143 ELEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAI 201

Query: 755 ENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSH 579
           EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLSH
Sbjct: 202 ENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSH 261

Query: 578 NGIEKMEGLSTLV 540
           NGIE +EGL   V
Sbjct: 262 NGIEVIEGLENNV 274



 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 51/194 (26%), Positives = 97/194 (50%), Gaps = 14/194 (7%)
 Frame = -2

Query: 881 SKVSSTLKELYVSNNQIAKIEEIEHFHELQI-------------LELGSNKLRVMENLQT 741
           S + + L E  + + +    E+ E  HEL +             ++L   ++  +E  + 
Sbjct: 37  SGIVADLSEQSLKDGEERGEEDPEEEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEV 96

Query: 740 LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEK 564
           L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S N +  
Sbjct: 97  LKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRN 156

Query: 563 MEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLT 384
           +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      +L  L 
Sbjct: 157 IEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----DTLTNLE 211

Query: 383 TLYLERNPCANSPN 342
           +L+L +N      N
Sbjct: 212 SLFLGKNKITKLQN 225



 Score = 28.1 bits (61), Expect(2) = 2e-30
 Identities = 19/50 (38%), Positives = 25/50 (50%)
 Frame = -3

Query: 1087 LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL 938
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct: 97   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL 141



>gb:HSPPPR5_2019686 Homo sapiens protein phosphatase-1 regulatory
           subunit 7 (PPP1R7) gene, exons 8 and 9 and alternatively
           spliced products.
          Length = 237

 Score =  128 bits (322), Expect(2) = 2e-30
 Identities = 66/133 (49%), Positives = 99/133 (74%), Gaps = 1/133 (0%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R +
Sbjct: 100 ELEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAI 158

Query: 755 ENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSH 579
           EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLSH
Sbjct: 159 ENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSH 218

Query: 578 NGIEKMEGLSTLV 540
           NGIE +EGL   V
Sbjct: 219 NGIEVIEGLENNV 231



 Score =  112 bits (279), Expect = 2e-23
 Identities = 67/187 (35%), Positives = 107/187 (57%), Gaps = 1/187 (0%)
 Frame = -2

Query: 953 GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS 774
           G  + KK+    +  N I     L ++ S L+EL + +NQI KIE +E   EL+IL++  
Sbjct: 50  GFEVLKKVKTLCLRQNLIKCIENLEELQS-LRELDLYDNQIKKIENLEALTELEILDISF 108

Query: 773 NKLRVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALE 597
           N LR +E +  LT L++L+L  N+I  I NL  L  ++ + + SNR+ +++ ++    LE
Sbjct: 109 NLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENIDTLTNLE 168

Query: 596 ELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA 417
            L+L  N I K++ L  L NL VL + +N+LT I  + NL  L +L+L+ N I  +E + 
Sbjct: 169 SLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLE 228

Query: 416 EAVAGSL 396
             V  SL
Sbjct: 229 NNVQDSL 235



 Score = 91.3 bits (225), Expect = 4e-17
 Identities = 56/167 (33%), Positives = 104/167 (62%), Gaps = 1/167 (0%)
 Frame = -2

Query: 860 KELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-NL 684
           +++ +++ +I KIE  E   +++ L L  N ++ +ENL+ L +L+EL L  N+I+ I NL
Sbjct: 36  EDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENL 95

Query: 683 CGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKL 504
             L  ++ + I  N L +++G+++   L++L+L +N I K+E LS L  L++L++ +N++
Sbjct: 96  EALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRI 155

Query: 503 TAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
            AI NI  LT LE L+L  N I+ ++++      +L  LT L ++ N
Sbjct: 156 RAIENIDTLTNLESLFLGKNKITKLQNL-----DALTNLTVLSMQSN 197



 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 45/162 (27%), Positives = 87/162 (53%), Gaps = 1/162 (0%)
 Frame = -2

Query: 824 IEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQ 648
           +E I    + + ++L   ++  +E  + L  ++ L L +N I+ I NL  L+ ++++ + 
Sbjct: 26  METINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLY 85

Query: 647 SNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKL 468
            N++  ++ LE    LE L +S N +  +EG+  L  L+ L +  NK++ I N++NL +L
Sbjct: 86  DNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQL 145

Query: 467 EDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPN 342
           + L L  N I ++E+I      +L  L +L+L +N      N
Sbjct: 146 QMLELGSNRIRAIENI-----DTLTNLESLFLGKNKITKLQN 182



 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 49/154 (31%), Positives = 79/154 (51%), Gaps = 1/154 (0%)
 Frame = -2

Query: 821 EEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQS 645
           E +E  HEL +          ME +    + +++ L   RI  I     LK +K + ++ 
Sbjct: 14  EMMEEEHELPV---------DMETINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQ 64

Query: 644 NRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLE 465
           N +  ++ LEE  +L EL L  N I+K+E L  L  L +LD+S N L  I  +  LT+L+
Sbjct: 65  NLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLK 124

Query: 464 DLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
            L+L +N IS +E+++     +L +L  L L  N
Sbjct: 125 KLFLVNNKISKIENLS-----NLHQLQMLELGSN 153



 Score = 28.1 bits (61), Expect(2) = 2e-30
 Identities = 19/50 (38%), Positives = 25/50 (50%)
 Frame = -3

Query: 1087 LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL 938
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct: 54   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL 98



>gb:U21322_1402014 Caenorhabditis elegans cosmid K10D2, complete
           sequence.
          Length = 957

 Score =  130 bits (327), Expect = 6e-29
 Identities = 76/226 (33%), Positives = 134/226 (59%), Gaps = 2/226 (0%)
 Frame = -2

Query: 965 EENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQIL 786
           E+   +     L+  DVS+N IT   GLS++ + L+EL++ +N+I  IE +E    ++ L
Sbjct: 45  EKLENLETLVNLVFLDVSYNRITKIEGLSELIN-LEELHLVHNKIITIEGLETNTAMKYL 103

Query: 785 ELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEEC 609
           E G N+++ MENL  L NL+ L+LG N+IR I  L G+  +K++S+  N L  ++GL+  
Sbjct: 104 EFGDNRIQKMENLSHLVNLERLFLGANQIRKIEGLDGMAQLKELSLPGNALQIIEGLDTL 163

Query: 608 VALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV 429
             L+ + L+ NGI K++GLS L NL+ LD++ N +  + N+     +  L +  N ++  
Sbjct: 164 SGLKSISLAQNGIRKIDGLSGLTNLKSLDLNDNIIEKLENVEQFKGISSLMIRKNKLNCW 223

Query: 428 EDIAEAVAGSLQKLTTLYLERNPCANSP-NYISTLRQIFPNIQQVD 294
           +D+ +     L+ LT L +E NP  +S   Y + +++I P+++ +D
Sbjct: 224 QDVRQ--LKKLENLTVLTMEMNPLYSSDYTYRNRVKEILPDVKLLD 267



 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 47/152 (30%), Positives = 76/152 (50%)
 Frame = -2

Query: 875 VSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIR 696
           VS+   +L +  N + KI+  +    L  L L  N++  +ENL+TL NL  L        
Sbjct: 8   VSNKGNDLSLRWNLLKKIDHFQCLTSLTRLNLNDNQIEKLENLETLVNLVFL-------- 59

Query: 695 AINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVS 516
                         +  NR+T ++GL E + LEEL+L HN I  +EGL T   ++ L+  
Sbjct: 60  -------------DVSYNRITKIEGLSELINLEELHLVHNKIITIEGLETNTAMKYLEFG 106

Query: 515 ANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
            N++  + N+++L  LE L+L  N I  +E +
Sbjct: 107 DNRIQKMENLSHLVNLERLFLGANQIRKIEGL 138



 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 29/90 (32%), Positives = 51/90 (56%)
 Frame = -2

Query: 677 LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA 498
           L  + ++++  N++  ++ LE  V L  L +S+N I K+EGLS L+NL  L +  NK+  
Sbjct: 31  LTSLTRLNLNDNQIEKLENLETLVNLVFLDVSYNRITKIEGLSELINLEELHLVHNKIIT 90

Query: 497 ISNIANLTKLEDLWLNDNNISSVEDIAEAV 408
           I  +   T ++ L   DN I  +E+++  V
Sbjct: 91  IEGLETNTAMKYLEFGDNRIQKMENLSHLV 120



>pir|E88451|E88451 protein K10D2.1 [imported] - Caenorhabditis
           elegans>gb:U21322_1402013 Caenorhabditis elegans cosmid
           K10D2, complete sequence.
          Length = 1223

 Score =  130 bits (327), Expect = 6e-29
 Identities = 76/226 (33%), Positives = 134/226 (59%), Gaps = 2/226 (0%)
 Frame = -2

Query: 965 EENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQIL 786
           E+   +     L+  DVS+N IT   GLS++ + L+EL++ +N+I  IE +E    ++ L
Sbjct: 45  EKLENLETLVNLVFLDVSYNRITKIEGLSELIN-LEELHLVHNKIITIEGLETNTAMKYL 103

Query: 785 ELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEEC 609
           E G N+++ MENL  L NL+ L+LG N+IR I  L G+  +K++S+  N L  ++GL+  
Sbjct: 104 EFGDNRIQKMENLSHLVNLERLFLGANQIRKIEGLDGMAQLKELSLPGNALQIIEGLDTL 163

Query: 608 VALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV 429
             L+ + L+ NGI K++GLS L NL+ LD++ N +  + N+     +  L +  N ++  
Sbjct: 164 SGLKSISLAQNGIRKIDGLSGLTNLKSLDLNDNIIEKLENVEQFKGISSLMIRKNKLNCW 223

Query: 428 EDIAEAVAGSLQKLTTLYLERNPCANSP-NYISTLRQIFPNIQQVD 294
           +D+ +     L+ LT L +E NP  +S   Y + +++I P+++ +D
Sbjct: 224 QDVRQ--LKKLENLTVLTMEMNPLYSSDYTYRNRVKEILPDVKLLD 267



 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 47/152 (30%), Positives = 76/152 (50%)
 Frame = -2

Query: 875 VSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIR 696
           VS+   +L +  N + KI+  +    L  L L  N++  +ENL+TL NL  L        
Sbjct: 8   VSNKGNDLSLRWNLLKKIDHFQCLTSLTRLNLNDNQIEKLENLETLVNLVFL-------- 59

Query: 695 AINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVS 516
                         +  NR+T ++GL E + LEEL+L HN I  +EGL T   ++ L+  
Sbjct: 60  -------------DVSYNRITKIEGLSELINLEELHLVHNKIITIEGLETNTAMKYLEFG 106

Query: 515 ANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
            N++  + N+++L  LE L+L  N I  +E +
Sbjct: 107 DNRIQKMENLSHLVNLERLFLGANQIRKIEGL 138



 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 29/90 (32%), Positives = 51/90 (56%)
 Frame = -2

Query: 677 LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA 498
           L  + ++++  N++  ++ LE  V L  L +S+N I K+EGLS L+NL  L +  NK+  
Sbjct: 31  LTSLTRLNLNDNQIEKLENLETLVNLVFLDVSYNRITKIEGLSELINLEELHLVHNKIIT 90

Query: 497 ISNIANLTKLEDLWLNDNNISSVEDIAEAV 408
           I  +   T ++ L   DN I  +E+++  V
Sbjct: 91  IEGLETNTAMKYLEFGDNRIQKMENLSHLV 120



>pir|T15422|T15422 hypothetical protein C06A8.6 - Caenorhabditis
           elegans>gb:U39849_1403107 Caenorhabditis elegans cosmid
           C06A8, complete sequence.
          Length = 349

 Score =  118 bits (296), Expect = 2e-25
 Identities = 72/210 (34%), Positives = 117/210 (55%), Gaps = 1/210 (0%)
 Frame = -2

Query: 920 DVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQT 741
           D+SFN IT    L K++  LK L+  +N+I KIE ++   EL+ LELG N++  +ENL  
Sbjct: 104 DLSFNRITKIENLEKLTK-LKTLFFVHNKITKIEGLDTLTELEYLELGDNRIAKIENLDN 162

Query: 740 LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEK 564
              L  L+LG N+IR I N+  LK +  +S+ +N +T +  +     L+E+YL+ NGI+ 
Sbjct: 163 NLKLDRLFLGANQIRLIENVDHLKKLTVLSLPANAITVVDNISGLHNLKEIYLAQNGIKY 222

Query: 563 MEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLT 384
           + G+   + L +LD + N+L  + NI  L  L D W   N + +   + E V   L +L 
Sbjct: 223 VCGIDEHLPLEILDFNQNRLEKVENIHQLKTLTDFWARGNKLDNWSIMDELV--ELPQLN 280

Query: 383 TLYLERNPCANSPNYISTLRQIFPNIQQVD 294
           ++YL+ NP A+   Y   +  +   I ++D
Sbjct: 281 SVYLDFNPIASVDTYRGKVIHLLQQITRLD 310



 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 63/207 (30%), Positives = 100/207 (48%), Gaps = 4/207 (1%)
 Frame = -2

Query: 971 SAEENSGVSIFKKLLVFDVSFNEITSPSGLSKVSST---LKELYVSNNQIAKIEEIEHFH 801
           S     GV  F+K++V       +  P+    V  T   +KE+       + +  +EHF 
Sbjct: 5   SVTSEDGVKEFEKIVVEPEDIEYVEIPADAKNVDLTRHRIKEI----GDYSWLTHVEHF- 59

Query: 800 ELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMK 624
                    N ++ +ENL  LT L  L    N+I  + NL  L  ++ + +  NR+T ++
Sbjct: 60  -----SFRWNLIKKIENLDCLTTLTHLEFYDNQITKVENLDSLVNLESLDLSFNRITKIE 114

Query: 623 GLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDN 444
            LE+   L+ L+  HN I K+EGL TL  L  L++  N++  I N+ N  KL+ L+L  N
Sbjct: 115 NLEKLTKLKTLFFVHNKITKIEGLDTLTELEYLELGDNRIAKIENLDNNLKLDRLFLGAN 174

Query: 443 NISSVEDIAEAVAGSLQKLTTLYLERN 363
            I  +E++       L+KLT L L  N
Sbjct: 175 QIRLIENV-----DHLKKLTVLSLPAN 196



>gb:DD1039PPR2_1376825 Dictyostelium discoideum PprA (pprA) gene,
           partial cds.
          Length = 154

 Score =  118 bits (295), Expect = 3e-25
 Identities = 64/153 (41%), Positives = 96/153 (62%), Gaps = 3/153 (1%)
 Frame = -2

Query: 734 NLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSM--KGLEECVALEELYLSHNGIEK 564
           N++ LWLGRN+I  I  +  L  ++ +S+QSNRLT +  KGL     LEELYLSHNGI  
Sbjct: 1   NIETLWLGRNKITEIKGINHLSHLRILSLQSNRLTEIGVKGLVGLNCLEELYLSHNGITD 60

Query: 563 MEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLT 384
           ++GL +L  LR LD+SANK+  +  +  L  L+++W NDN + S+++I + V  S++   
Sbjct: 61  IDGLQSLKQLRTLDISANKIKTLVGLNELPDLDEIWCNDNLVDSMDNIEQQVTKSIK--- 117

Query: 383 TLYLERNPCANSPNYISTLRQIFPNIQQVDSEL 285
            LY ERNP A    Y      +FP ++Q+D+ +
Sbjct: 118 CLYFERNPVATHVQYRRMFINMFPQLKQLDATM 150



 Score = 47.4 bits (111), Expect = 7e-04
 Identities = 24/93 (25%), Positives = 50/93 (53%), Gaps = 1/93 (1%)
 Frame = -2

Query: 962 ENSGVSIFKKLLVFDVSFNEITSPSGLSKVS-STLKELYVSNNQIAKIEEIEHFHELQIL 786
           E  G++    L +  +  N +T       V  + L+ELY+S+N I  I+ ++   +L+ L
Sbjct: 14  EIKGINHLSHLRILSLQSNRLTEIGVKGLVGLNCLEELYLSHNGITDIDGLQSLKQLRTL 73

Query: 785 ELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN 687
           ++ +NK++ +  L  L +L E+W   N + +++
Sbjct: 74  DISANKIKTLVGLNELPDLDEIWCNDNLVDSMD 106



>gb:AE017178_397993 Porphyromonas gingivalis W83 section 7 of 8 of
           the complete genome.>gb:AE015924_1033604 Porphyromonas
           gingivalis W83 complete genome.
          Length = 1266

 Score =  112 bits (281), Expect = 1e-23
 Identities = 71/198 (35%), Positives = 112/198 (56%), Gaps = 1/198 (0%)
 Frame = -2

Query: 953 GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS 774
           G+     L    +S N+I+   GL +++S L ELY+ +NQI+K+E +E    L  LEL  
Sbjct: 138 GLDSLTSLTKLSLSDNQISKLEGLERLTS-LAELYLLDNQISKLEGLERLTSLATLELSG 196

Query: 773 NKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALE 597
           N++R +E L+ LT+L  L L  N+IR +  L  L  + K+ ++SN+++ ++GLE   +L 
Sbjct: 197 NQIRKLEGLERLTSLATLELSGNQIRKLEGLERLTSLTKLRLRSNQISKLEGLERLTSLA 256

Query: 596 ELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA 417
            L LS N I K+EGL  L +L  L++S N+++ +  +  L+ L  L L  N IS +E + 
Sbjct: 257 TLELSGNQIRKLEGLERLTSLATLELSGNQISKLEGLERLSSLTKLRLRSNQISKLEGLE 316

Query: 416 EAVAGSLQKLTTLYLERN 363
                 L  LT L L  N
Sbjct: 317 R-----LTSLTKLSLSDN 329



 Score =  104 bits (259), Expect = 5e-21
 Identities = 66/183 (36%), Positives = 105/183 (57%), Gaps = 1/183 (0%)
 Frame = -2

Query: 908 NEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNL 729
           N+I+   GL +++S L  L +S NQI K+E +E    L  LEL  N++  +E L+ L++L
Sbjct: 241 NQISKLEGLERLTS-LATLELSGNQIRKLEGLERLTSLATLELSGNQISKLEGLERLSSL 299

Query: 728 QELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGL 552
            +L L  N+I  +  L  L  + K+S+  N+++ ++GLE   +L ELYL  N I K+EGL
Sbjct: 300 TKLRLRSNQISKLEGLERLTSLTKLSLSDNQISKLEGLERLTSLAELYLLDNQIRKLEGL 359

Query: 551 STLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYL 372
             L +L  L + +N+++ +  + +LT L  L L+DN IS +E +       L  L  LYL
Sbjct: 360 ERLTSLTKLRLRSNQISKLEGLDSLTSLTKLSLSDNQISKLEGLER-----LTSLAELYL 414

Query: 371 ERN 363
             N
Sbjct: 415 LDN 417



 Score =  103 bits (256), Expect = 1e-20
 Identities = 68/207 (32%), Positives = 112/207 (54%), Gaps = 1/207 (0%)
 Frame = -2

Query: 953 GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS 774
           G+     L    +  N+I+   GL +++S L +L +S+NQI+K+E +E    L  L L  
Sbjct: 292 GLERLSSLTKLRLRSNQISKLEGLERLTS-LTKLSLSDNQISKLEGLERLTSLAELYLLD 350

Query: 773 NKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALE 597
           N++R +E L+ LT+L +L L  N+I  +  L  L  + K+S+  N+++ ++GLE   +L 
Sbjct: 351 NQIRKLEGLERLTSLTKLRLRSNQISKLEGLDSLTSLTKLSLSDNQISKLEGLERLTSLA 410

Query: 596 ELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA 417
           ELYL  N I K+EGL  L +L  L +  N+++ +  +  L  L  L ++ N+I S++DI 
Sbjct: 411 ELYLLDNQIRKLEGLDGLASLTRLSLRRNQISKLEGLDRLKVLRKLDVSGNDIQSIDDIK 470

Query: 416 EAVAGSLQKLTTLYLERNPCANSPNYI 336
                  Q L  L +  NP   S   I
Sbjct: 471 LLAPILEQTLEKLRIHDNPFVASSGLI 497



 Score = 90.9 bits (224), Expect = 5e-17
 Identities = 61/197 (30%), Positives = 102/197 (51%), Gaps = 10/197 (5%)
 Frame = -2

Query: 923 FDVSFNEITSPSGLS---------KVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN 771
           +++   +++S  G+S           S  + EL +   QI  +  +  F  L+ L+L  N
Sbjct: 50  YNIEIPDLSSQEGISWSVNRYFKQDSSGAVVELCLRECQIESMTWLIDFPALKKLDLSYN 109

Query: 770 KLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEE 594
           ++  +E L+ LT+L +L L  N+IR +  L  L  + K+S+  N+++ ++GLE   +L E
Sbjct: 110 QISKLEGLERLTSLTKLRLRSNQIRKLEGLDSLTSLTKLSLSDNQISKLEGLERLTSLAE 169

Query: 593 LYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAE 414
           LYL  N I K+EGL  L +L  L++S N++  +  +  LT L  L L+ N I  +E +  
Sbjct: 170 LYLLDNQISKLEGLERLTSLATLELSGNQIRKLEGLERLTSLATLELSGNQIRKLEGLER 229

Query: 413 AVAGSLQKLTTLYLERN 363
                L  LT L L  N
Sbjct: 230 -----LTSLTKLRLRSN 241



>gb:AK009870_1155408 Mus musculus adult male tongue cDNA, RIKEN
           full-length enriched library, clone:2310047D16
           product:protein phosphatase 1, regulatory (inhibitor)
           subunit 7, full insert sequence.
          Length = 284

 Score =  101 bits (252), Expect(2) = 1e-22
 Identities = 52/111 (46%), Positives = 81/111 (72%), Gaps = 1/111 (0%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           +L V D+SFN + +  G+ K++  LK+L++ NN+I KIE I + H+LQ+LELGSN++R +
Sbjct: 144 ELEVLDISFNMLRNIEGIDKLTQ-LKKLFLVNNKINKIENISNLHQLQMLELGSNRIRAI 202

Query: 755 ENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECV 606
           EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRL  ++GL+  V
Sbjct: 203 ENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSVQSNRLAKIEGLQSLV 253



 Score = 94.0 bits (232), Expect = 6e-18
 Identities = 55/160 (34%), Positives = 93/160 (58%), Gaps = 1/160 (0%)
 Frame = -2

Query: 953 GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS 774
           G+ + KK+    +  N I     L ++ S L+EL + +NQI KIE +E   EL++L++  
Sbjct: 94  GLEVLKKVKSLCLRQNLIKCIENLEELQS-LRELDLYDNQIKKIENLEALTELEVLDISF 152

Query: 773 NKLRVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALE 597
           N LR +E +  LT L++L+L  N+I  I N+  L  ++ + + SNR+ +++ ++    LE
Sbjct: 153 NMLRNIEGIDKLTQLKKLFLVNNKINKIENISNLHQLQMLELGSNRIRAIENIDTLTNLE 212

Query: 596 ELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANL 477
            L+L  N I K++ L  L NL VL V +N+L  I  + +L
Sbjct: 213 SLFLGKNKITKLQNLDALTNLTVLSVQSNRLAKIEGLQSL 252



 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 56/170 (32%), Positives = 106/170 (62%), Gaps = 1/170 (0%)
 Frame = -2

Query: 860 KELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-NL 684
           +++ +++ +I KIE +E   +++ L L  N ++ +ENL+ L +L+EL L  N+I+ I NL
Sbjct: 80  EDVDLTHYRIGKIEGLEVLKKVKSLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENL 139

Query: 683 CGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKL 504
             L  ++ + I  N L +++G+++   L++L+L +N I K+E +S L  L++L++ +N++
Sbjct: 140 EALTELEVLDISFNMLRNIEGIDKLTQLKKLFLVNNKINKIENISNLHQLQMLELGSNRI 199

Query: 503 TAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCA 354
            AI NI  LT LE L+L  N I+ ++++      +L  LT L ++ N  A
Sbjct: 200 RAIENIDTLTNLESLFLGKNKITKLQNL-----DALTNLTVLSVQSNRLA 244



 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 47/162 (29%), Positives = 87/162 (53%), Gaps = 1/162 (0%)
 Frame = -2

Query: 824 IEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQ 648
           +E I    + + ++L   ++  +E L+ L  ++ L L +N I+ I NL  L+ ++++ + 
Sbjct: 70  METINLDRDAEDVDLTHYRIGKIEGLEVLKKVKSLCLRQNLIKCIENLEELQSLRELDLY 129

Query: 647 SNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKL 468
            N++  ++ LE    LE L +S N +  +EG+  L  L+ L +  NK+  I NI+NL +L
Sbjct: 130 DNQIKKIENLEALTELEVLDISFNMLRNIEGIDKLTQLKKLFLVNNKINKIENISNLHQL 189

Query: 467 EDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPN 342
           + L L  N I ++E+I      +L  L +L+L +N      N
Sbjct: 190 QMLELGSNRIRAIENI-----DTLTNLESLFLGKNKITKLQN 226



 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 52/154 (33%), Positives = 80/154 (51%), Gaps = 1/154 (0%)
 Frame = -2

Query: 821 EEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQS 645
           E+ E  HEL +          ME +    + +++ L   RI  I  L  LK +K + ++ 
Sbjct: 58  EDPEEEHELAV---------DMETINLDRDAEDVDLTHYRIGKIEGLEVLKKVKSLCLRQ 108

Query: 644 NRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLE 465
           N +  ++ LEE  +L EL L  N I+K+E L  L  L VLD+S N L  I  I  LT+L+
Sbjct: 109 NLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEVLDISFNMLRNIEGIDKLTQLK 168

Query: 464 DLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
            L+L +N I+ +E+I+     +L +L  L L  N
Sbjct: 169 KLFLVNNKINKIENIS-----NLHQLQMLELGSN 197



 Score = 28.5 bits (62), Expect(2) = 1e-22
 Identities = 19/50 (38%), Positives = 25/50 (50%)
 Frame = -3

Query: 1087 LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL 938
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct: 98   LKKVKSLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL 142



>pir|AE1515|AE1515 internalin like protein (LPXTG motif) [imported]
           - Listeria innocua (strain Clip11262)>gb:AL596165_538007
           Listeria innocua Clip11262 complete genome, segment
           3/12.
          Length = 596

 Score = 94.4 bits (233), Expect = 5e-18
 Identities = 67/218 (30%), Positives = 106/218 (48%), Gaps = 1/218 (0%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL    +  N+IT  + L  + + L  L +S NQI  I  I     LQ L +  N++  +
Sbjct: 189 KLDYLIIENNQITDLTPLKNMKN-LNNLVISGNQINDITTIAELTSLQNLSISDNQIVDI 247

Query: 755 ENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSH 579
             L  L NL  L + +N I   + L  L  +K I+I+ N++  + GL     L  L+L  
Sbjct: 248 SPLANLNNLNSLAIHKNNIVDTSPLANLTQLKFINIRDNQIDDITGLTNLTNLTNLHLGG 307

Query: 578 NGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGS 399
           N I  +  L+ L NL +LD++ N+++ +  +ANLT L +LWLN NNI  +  + +     
Sbjct: 308 NEISDLTPLANLTNLNLLDLTNNQISEVIPLANLTNLSNLWLNGNNIIDISPLKD----- 362

Query: 398 LQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSEL 285
           L+ L  L L       +P    T   +  NI+ +D  L
Sbjct: 363 LKGLKNLSLSDQRIQKNPELFKTNFTLTNNIKDLDGGL 400



 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 53/184 (28%), Positives = 92/184 (50%), Gaps = 1/184 (0%)
 Frame = -2

Query: 965 EENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQIL 786
           E   G+     +  F+ +  +I   S LS  S+ L+ L +S N I     I +  +L  L
Sbjct: 91  ESLEGIQYLPNVTTFNFNGEKIQDISFLSN-STKLENLDLSGNPIKDFSPIANLTKLHTL 149

Query: 785 ELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEEC 609
            L + ++  +  +  LT L+ L+L  NRI  I+ L  L  +  + I++N++T +  L+  
Sbjct: 150 NLMNCEISDISFITNLTELKSLYLSNNRITNISPLANLTKLDYLIIENNQITDLTPLKNM 209

Query: 608 VALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV 429
             L  L +S N I  +  ++ L +L+ L +S N++  IS +ANL  L  L ++ NNI   
Sbjct: 210 KNLNNLVISGNQINDITTIAELTSLQNLSISDNQIVDISPLANLNNLNSLAIHKNNIVDT 269

Query: 428 EDIA 417
             +A
Sbjct: 270 SPLA 273



 Score = 43.1 bits (100), Expect = 0.013
 Identities = 33/109 (30%), Positives = 50/109 (45%)
 Frame = -2

Query: 677 LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA 498
           L  I  +   S  + S++G++    +     +   I+ +  LS    L  LD+S N +  
Sbjct: 77  LNNITIVGATSTGIESLEGIQYLPNVTTFNFNGEKIQDISFLSNSTKLENLDLSGNPIKD 136

Query: 497 ISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCAN 351
            S IANLTKL  L L +  IS +  I      +L +L +LYL  N   N
Sbjct: 137 FSPIANLTKLHTLNLMNCEISDISFIT-----NLTELKSLYLSNNRITN 180



 Score = 33.9 bits (76), Expect = 7.6
 Identities = 23/78 (29%), Positives = 44/78 (56%)
 Frame = -3

Query: 1123 NRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLA 944
            N++  + P +++L+NLN  ++ +N I D +  PL++   ++QL+ + +RDNQ+  I  L 
Sbjct: 242  NQIVDISP-LANLNNLNSLAIHKNNIVDTS--PLAN---LTQLKFINIRDNQIDDITGLT 295

Query: 943  YLRNFWYLMFRSTKLHHL 890
             L N   L     ++  L
Sbjct: 296  NLTNLTNLHLGGNEISDL 313



>gb:AE015937_319684 Clostridium tetani E88, section 2 of 10 of the
           complete genome.>gb:AE015927_962473 Clostridium tetani
           E88, complete genome.
          Length = 695

 Score = 94.0 bits (232), Expect = 6e-18
 Identities = 62/182 (34%), Positives = 107/182 (58%), Gaps = 1/182 (0%)
 Frame = -2

Query: 956 SGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELG 777
           SG+  F+ L   D+S NEI     LS +   LKEL +  N+I  ++ ++    L+ L L 
Sbjct: 97  SGLEFFENLQSLDLSNNEIKDLGSLSGLKY-LKELTLYKNKITDVKALDGLKNLEKLNLR 155

Query: 776 SNKLRVMENLQTLTNLQELWLGRNRI-RAINLCGLKCIKKISIQSNRLTSMKGLEECVAL 600
            NK++ +E L+ L  L+EL LG+N + +   L  LK ++ ++++SN + + + LEE   +
Sbjct: 156 DNKVKNIEGLKGLEKLRELDLGKNSVFQPKPLKDLKNLRILNLESNGIGNAEDLEELKQV 215

Query: 599 EELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
           E L LS+N ++ +E L TL N+  L +  N +T I  + ++T L+ L +N++   S+ED+
Sbjct: 216 EHLILSNNTVDDVEPLLTLTNVNKLYLDDNPVTHIGKLKDMTNLKRLNINND---SIEDL 272

Query: 419 AE 414
           AE
Sbjct: 273 AE 274



 Score = 91.7 bits (226), Expect = 3e-17
 Identities = 50/183 (27%), Positives = 105/183 (57%), Gaps = 1/183 (0%)
 Frame = -2

Query: 908 NEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNL 729
           N++ S +G+  + + L+ L ++ N ++ +  I     L+ L +  N +  +  +  L NL
Sbjct: 435 NKLVSLAGIENLVN-LESLDINKNNVSNLASIRDLTNLKSLNINENNVTDLSVVTNLKNL 493

Query: 728 QELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGL 552
           + + L +N + ++  L  L  ++ ++ + N LTS  GL+  + L+EL+L  N I  +  L
Sbjct: 494 ERISLNKNGVTSLGALAALPELEWVTAKENGLTSTVGLQNALKLKELFLDSNQISDLSSL 553

Query: 551 STLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYL 372
           + L +L  L +  N ++ +S++++LT++++L+L+ NNI S+  +A     S++ LT LY+
Sbjct: 554 ANLTSLETLSLRTNNISDVSSLSDLTRMKNLYLHKNNIGSIAPLA-----SMENLTRLYV 608

Query: 371 ERN 363
            +N
Sbjct: 609 GKN 611



 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 46/175 (26%), Positives = 95/175 (54%), Gaps = 1/175 (0%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRV 759
           +++   D+    +T+ +G+  +   L+ L    N I+ +E ++    L+ L L   K+  
Sbjct: 337 QRVTQLDLWDKNVTNLAGIENLID-LRVLNAGKNNISNLEPLKSMDNLENLYLTKTKVVS 395

Query: 758 MENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS 582
           +E L+ LTNL+ L +    +  +  +  L  ++++++  N+L S+ G+E  V LE L ++
Sbjct: 396 LEPLRGLTNLKALVINETNVSDLTPIKNLINLERLTLGDNKLVSLAGIENLVNLESLDIN 455

Query: 581 HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA 417
            N +  +  +  L NL+ L+++ N +T +S + NL  LE + LN N ++S+  +A
Sbjct: 456 KNNVSNLASIRDLTNLKSLNINENNVTDLSVVTNLKNLERISLNKNGVTSLGALA 510



 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 47/143 (32%), Positives = 76/143 (53%), Gaps = 1/143 (0%)
 Frame = -2

Query: 788 LELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEE 612
           L L S  ++ +  L+   NLQ L L  N I+ + +L GLK +K++++  N++T +K L+ 
Sbjct: 86  LNLKSKNIKDISGLEFFENLQSLDLSNNEIKDLGSLSGLKYLKELTLYKNKITDVKALDG 145

Query: 611 CVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISS 432
              LE+L L  N ++ +EGL  L  LR LD+  N +     + +L  L  L L  N I +
Sbjct: 146 LKNLEKLNLRDNKVKNIEGLKGLEKLRELDLGKNSVFQPKPLKDLKNLRILNLESNGIGN 205

Query: 431 VEDIAEAVAGSLQKLTTLYLERN 363
            ED+ E     L+++  L L  N
Sbjct: 206 AEDLEE-----LKQVEHLILSNN 223



 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 47/187 (25%), Positives = 98/187 (52%), Gaps = 1/187 (0%)
 Frame = -2

Query: 920  DVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQT 741
            +++ N +T  S ++ + + L+ + ++ N +  +  +    EL+ +    N L     LQ 
Sbjct: 475  NINENNVTDLSVVTNLKN-LERISLNKNGVTSLGALAALPELEWVTAKENGLTSTVGLQN 533

Query: 740  LTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEK 564
               L+EL+L  N+I  ++ L  L  ++ +S+++N ++ +  L +   ++ LYL  N I  
Sbjct: 534  ALKLKELFLDSNQISDLSSLANLTSLETLSLRTNNISDVSSLSDLTRMKNLYLHKNNIGS 593

Query: 563  MEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLT 384
            +  L+++ NL  L V  N ++ IS +AN+  L+ L + +N +S++  ++      LQ L 
Sbjct: 594  IAPLASMENLTRLYVGKNNISDISAVANMKNLKTLSIGENMVSNIGPVS-----GLQSLE 648

Query: 383  TLYLERN 363
            TL +  N
Sbjct: 649  TLDVADN 655



 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 48/203 (23%), Positives = 93/203 (45%), Gaps = 2/203 (0%)
 Frame = -2

Query: 965 EENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLK--ELYVSNNQIAKIEEIEHFHELQ 792
           + N  V    K L F +  ++I  P G  K +   +  +L + +  +  +  IE+  +L+
Sbjct: 304 DPNKEVKFADKNLEFAIR-DKIEKPKGAIKKADLQRVTQLDLWDKNVTNLAGIENLIDLR 362

Query: 791 ILELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEE 612
           +L  G N +  +E L+++ NL+ L+L + ++                      S++ L  
Sbjct: 363 VLNAGKNNISNLEPLKSMDNLENLYLTKTKV---------------------VSLEPLRG 401

Query: 611 CVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISS 432
              L+ L ++   +  +  +  L+NL  L +  NKL +++ I NL  LE L +N NN+S+
Sbjct: 402 LTNLKALVINETNVSDLTPIKNLINLERLTLGDNKLVSLAGIENLVNLESLDINKNNVSN 461

Query: 431 VEDIAEAVAGSLQKLTTLYLERN 363
           +  I +     L  L +L +  N
Sbjct: 462 LASIRD-----LTNLKSLNINEN 479



 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 44/158 (27%), Positives = 76/158 (48%)
 Frame = -2

Query: 908 NEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNL 729
           N +TS  GL      LKEL++ +NQI+ +  + +   L+ L L +N +  + +L  LT +
Sbjct: 523 NGLTSTVGLQNALK-LKELFLDSNQISDLSSLANLTSLETLSLRTNNISDVSSLSDLTRM 581

Query: 728 QELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLS 549
           + L+L +N I +I                 L SM+ L        LY+  N I  +  ++
Sbjct: 582 KNLYLHKNNIGSIA---------------PLASMENLTR------LYVGKNNISDISAVA 620

Query: 548 TLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNIS 435
            + NL+ L +  N ++ I  ++ L  LE L + DN I+
Sbjct: 621 NMKNLKTLSIGENMVSNIGPVSGLQSLETLDVADNFIT 658



 Score = 53.9 bits (128), Expect = 7e-06
 Identities = 34/104 (32%), Positives = 56/104 (53%)
 Frame = -2

Query: 674 KCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAI 495
           K + K++++S  +  + GLE    L+ L LS+N I+ +  LS L  L+ L +  NK+T +
Sbjct: 81  KMVTKLNLKSKNIKDISGLEFFENLQSLDLSNNEIKDLGSLSGLKYLKELTLYKNKITDV 140

Query: 494 SNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
             +  L  LE L L DN + ++E +       L+KL  L L +N
Sbjct: 141 KALDGLKNLEKLNLRDNKVKNIEGLK-----GLEKLRELDLGKN 179



>gb:AE014134_1127435 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003578_1216196 Drosophila melanogaster
           chromosome 2L, section 13 of 83 of the complete
           sequence.
          Length = 804

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 54/180 (30%), Positives = 107/180 (59%), Gaps = 1/180 (0%)
 Frame = -2

Query: 854 LYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRI-RAINLCG 678
           L +S  ++ K+ + +  H ++ L L  N+L+ ++N+ +   ++ L L RN++ R   +C 
Sbjct: 13  LNLSKQKLKKVPKQDDAHSIRQLILDENELQKIDNIDSYLKIETLSLARNQLLRMYGVCR 72

Query: 677 LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA 498
           L C++++++  N + S++GL+EC+ L  L L  N I+ +E L+T VNL  L+++ N + +
Sbjct: 73  LHCLRELNLSFNGILSIEGLKECIHLRVLNLEGNNIKTIEHLNTNVNLECLNLADNSIGS 132

Query: 497 ISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQI 318
           IS+++ L  L++L+L+ N ++ +    + +  SL+ LT   L +N   N  N I TL  +
Sbjct: 133 ISDMSYLRNLKELYLHGNRLTHLRQCDKCLPTSLETLT---LAKN-SINDLNEICTLSHL 188



>gb:AE014134_1127434 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003578_1216195 Drosophila melanogaster
           chromosome 2L, section 13 of 83 of the complete
           sequence.
          Length = 829

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 54/180 (30%), Positives = 107/180 (59%), Gaps = 1/180 (0%)
 Frame = -2

Query: 854 LYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRI-RAINLCG 678
           L +S  ++ K+ + +  H ++ L L  N+L+ ++N+ +   ++ L L RN++ R   +C 
Sbjct: 13  LNLSKQKLKKVPKQDDAHSIRQLILDENELQKIDNIDSYLKIETLSLARNQLLRMYGVCR 72

Query: 677 LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA 498
           L C++++++  N + S++GL+EC+ L  L L  N I+ +E L+T VNL  L+++ N + +
Sbjct: 73  LHCLRELNLSFNGILSIEGLKECIHLRVLNLEGNNIKTIEHLNTNVNLECLNLADNSIGS 132

Query: 497 ISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQI 318
           IS+++ L  L++L+L+ N ++ +    + +  SL+ LT   L +N   N  N I TL  +
Sbjct: 133 ISDMSYLRNLKELYLHGNRLTHLRQCDKCLPTSLETLT---LAKN-SINDLNEICTLSHL 188



>pir|C97303|C97303 hypothetical protein CAC3280 [imported] -
            Clostridium acetobutylicum>gb:AE007824_230575 Clostridium
            acetobutylicum ATCC 824 section 312 of 356 of the
            complete genome.>gb:AE001437_1093530 Clostridium
            acetobutylicum ATCC 824, complete genome.
          Length = 849

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 64/197 (32%), Positives = 103/197 (52%), Gaps = 1/197 (0%)
 Frame = -2

Query: 950  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN 771
            +S+  KL   ++S N+I   S LS +++ L +L +S NQI+ I  + +   L IL L SN
Sbjct: 616  LSVVTKLQNLNLSSNKIADISALSNLTN-LNQLDLSTNQISNISSLNNLIGLNILNLNSN 674

Query: 770  KLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEE 594
            K+  + +L  L  LQ L L  N I+ I+ L     +  + + +N++T +  L    +L+ 
Sbjct: 675  KINDISSLTNLKQLQTLSLNSNTIQDIDVLKNFTVLNVLGLSNNKITDISTLANLNSLKN 734

Query: 593  LYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAE 414
            + LS+N I  +  L  L N + L +  N++  IS +  L  L  L+LN+N I+ +     
Sbjct: 735  ISLSNNQITNISCLCNLTNAQYLHLENNQINDISALNKLKNLAYLYLNNNQITDI----- 789

Query: 413  AVAGSLQKLTTLYLERN 363
               G L KL TLYL  N
Sbjct: 790  TALGFLDKLNTLYLSYN 806



 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 55/186 (29%), Positives = 103/186 (55%), Gaps = 4/186 (2%)
 Frame = -2

Query: 971  SAEENSGVSIFKKLL---VFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFH 801
            S  + S +S    L+   + +++ N+I   S L+ +   L+ L +++N I  I+ +++F 
Sbjct: 650  STNQISNISSLNNLIGLNILNLNSNKINDISSLTNLKQ-LQTLSLNSNTIQDIDVLKNFT 708

Query: 800  ELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMK 624
             L +L L +NK+  +  L  L +L+ + L  N+I  I+ LC L   + + +++N++  + 
Sbjct: 709  VLNVLGLSNNKITDISTLANLNSLKNISLSNNQITNISCLCNLTNAQYLHLENNQINDIS 768

Query: 623  GLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDN 444
             L +   L  LYL++N I  +  L  L  L  L +S NK+T + ++ NLT L+ L L +N
Sbjct: 769  ALNKLKNLAYLYLNNNQITDITALGFLDKLNTLYLSYNKITKVDSLKNLTNLKILILAEN 828

Query: 443  NISSVE 426
            NI+S +
Sbjct: 829  NITSTD 834



 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 61/221 (27%), Positives = 106/221 (47%), Gaps = 9/221 (4%)
 Frame = -2

Query: 929  LVFDVSFNEITSPSGLSKVSSTLKE--------LYVSNNQIAKIEEIEHFHELQILELGS 774
            +VF     E    + ++K + TL E        L  +N  I  +  IE+   L  L L S
Sbjct: 482  VVFSDKNLEAAVRNSINKQTGTLYESDVQNISSLNANNANITDLTGIENLKSLDTLYLNS 541

Query: 773  NKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALE 597
            N +  +  L++L NLQ L+LG N+I     L  L  ++++ +  N L +  G++    L 
Sbjct: 542  NSISNLTPLRSLINLQNLYLGNNKITDTTALSSLSSLQRLDLYGNALNTFDGIKNLSNLT 601

Query: 596  ELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA 417
            EL LS+  +  +  LS +  L+ L++S+NK+  IS ++NLT L  L L+ N IS++  + 
Sbjct: 602  ELDLSNTNLSSLAFLSVVTKLQNLNLSSNKIADISALSNLTNLNQLDLSTNQISNISSLN 661

Query: 416  EAVAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVD 294
              +  ++  L +  +       +   + TL      IQ +D
Sbjct: 662  NLIGLNILNLNSNKINDISSLTNLKQLQTLSLNSNTIQDID 702



 Score = 47.8 bits (112), Expect = 5e-04
 Identities = 29/79 (36%), Positives = 45/79 (56%)
 Frame = -2

Query: 908 NEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNL 729
           N+I   S L+K+ + L  LY++NNQI  I  +    +L  L L  NK+  +++L+ LTNL
Sbjct: 762 NQINDISALNKLKN-LAYLYLNNNQITDITALGFLDKLNTLYLSYNKITKVDSLKNLTNL 820

Query: 728 QELWLGRNRIRAINLCGLK 672
           + L L  N I + +   LK
Sbjct: 821 KILILAENNITSTDQTSLK 839



>gb:LIV271621_140733 Listeria ivanovii partial putative ysnb gene,
           i-inlB2 gene and tRNA-Arg gene.
          Length = 897

 Score = 91.7 bits (226), Expect = 3e-17
 Identities = 57/181 (31%), Positives = 105/181 (58%), Gaps = 1/181 (0%)
 Frame = -2

Query: 902 ITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQE 723
           I S  GL  +S+ L+ +Y+S+NQI  I  + + ++L+ + L  N+++ + +L  L  L++
Sbjct: 86  IKSIQGLQHLSN-LQTIYLSDNQIQDISYLTNLNKLEEIYLSGNQIKDIGHLANLNKLEK 144

Query: 722 LWLGRNRIRAINL-CGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLST 546
           ++L  N++  INL  GL  +K + + +N++  +  LE+   LE +YL  N +  +  ++ 
Sbjct: 145 IFLQGNQLTDINLPAGLSNLKTLVLSNNQIKDICNLEKSKKLENVYLQGNQLTDI-SIAG 203

Query: 545 LVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLER 366
           L NL +LD+S N++  I+ +ANL KL +L+L  N ++ +     +V   L  L TL L  
Sbjct: 204 LSNLNILDLSNNQIKGINQLANLNKLNELYLEGNQLTDI-----SVLAGLSNLKTLDLNN 258

Query: 365 N 363
           N
Sbjct: 259 N 259



 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 56/227 (24%), Positives = 117/227 (51%), Gaps = 2/227 (0%)
 Frame = -2

Query: 965 EENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQIL 786
           ++ S ++   KL    +S N+I     L+ ++  L+++++  NQ+  I        L+ L
Sbjct: 109 QDISYLTNLNKLEEIYLSGNQIKDIGHLANLNK-LEKIFLQGNQLTDINLPAGLSNLKTL 167

Query: 785 ELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECV 606
            L +N+++ + NL+    L+ ++L  N++  I++ GL  +  + + +N++  +  L    
Sbjct: 168 VLSNNQIKDICNLEKSKKLENVYLQGNQLTDISIAGLSNLNILDLSNNQIKGINQLANLN 227

Query: 605 ALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVE 426
            L ELYL  N +  +  L+ L NL+ LD++ N++  I  ++ L  LE+L +N+N + ++ 
Sbjct: 228 KLNELYLEGNQLTDISVLAGLSNLKTLDLNNNRIKDIRTLSTLVNLENLLMNNNQLININ 287

Query: 425 DIAEAVAGSLQKLTTLYLERNPCA--NSPNYISTLRQIFPNIQQVDS 291
            ++     SL KL  L    N     +S   ++ L ++  +  QVD+
Sbjct: 288 HLS-----SLLKLKLLSFNGNRVTDISSVAKLTNLTELDCSENQVDN 329



 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 56/218 (25%), Positives = 98/218 (44%), Gaps = 45/218 (20%)
 Frame = -2

Query: 932 LLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVME 753
           L + D+S N+I   + L+ ++  L ELY+  NQ+  I  +     L+ L+L +N+++ + 
Sbjct: 207 LNILDLSNNQIKGINQLANLNK-LNELYLEGNQLTDISVLAGLSNLKTLDLNNNRIKDIR 265

Query: 752 NLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
            L TL NL+ L +  N++  IN L  L  +K +S   NR+T +  + +   L EL  S N
Sbjct: 266 TLSTLVNLENLLMNNNQLININHLSSLLKLKLLSFNGNRVTDISSVAKLTNLTELDCSEN 325

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLT-------------------------- 474
            ++ +  L+ L NL  L +  NK+  +S +A LT                          
Sbjct: 326 QVDNINSLAKLTNLTGLTLEGNKVKDLSPLAQLTNLTGLNFRQNQINDISILEKLPNLDS 385

Query: 473 ------------------KLEDLWLNDNNISSVEDIAE 414
                             KL  L  NDN +++++ +A+
Sbjct: 386 LAFDKNKVSDVSILAKLPKLTYLIFNDNQVTNIDSLAK 423



 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 57/197 (28%), Positives = 97/197 (49%), Gaps = 1/197 (0%)
 Frame = -2

Query: 950 VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN 771
           +S   KL +   + N +T  S ++K+++ L EL  S NQ+  I  +     L  L L  N
Sbjct: 289 LSSLLKLKLLSFNGNRVTDISSVAKLTN-LTELDCSENQVDNINSLAKLTNLTGLTLEGN 347

Query: 770 KLRVMENLQTLTNLQELWLGRNRIRAINLCG-LKCIKKISIQSNRLTSMKGLEECVALEE 594
           K++ +  L  LTNL  L   +N+I  I++   L  +  ++   N+++ +  L +   L  
Sbjct: 348 KVKDLSPLAQLTNLTGLNFRQNQINDISILEKLPNLDSLAFDKNKVSDVSILAKLPKLTY 407

Query: 593 LYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAE 414
           L  + N +  ++ L+ L +L  +D S NK++ I  + NLTKL  L  N N I  ++ +  
Sbjct: 408 LIFNDNQVTNIDSLAKLPHLVGVDFSGNKVSNIKALTNLTKLRFLNANGNCIQDIQALR- 466

Query: 413 AVAGSLQKLTTLYLERN 363
                L +L  L L RN
Sbjct: 467 ----GLTQLEELKLARN 479



 Score = 57.4 bits (137), Expect = 6e-07
 Identities = 35/126 (27%), Positives = 67/126 (53%), Gaps = 2/126 (1%)
 Frame = -2

Query: 668 IKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISN 489
           + K S++ N +T +   +E   +E +      I+ ++GL  L NL+ + +S N++  IS 
Sbjct: 54  VMKWSLRKNSVTDVVSQQELDQVESINAMRKNIKSIQGLQHLSNLQTIYLSDNQIQDISY 113

Query: 488 IANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCA--NSPNYISTLRQIF 315
           + NL KLE+++L+ N I  +  +A     +L KL  ++L+ N     N P  +S L+ + 
Sbjct: 114 LTNLNKLEEIYLSGNQIKDIGHLA-----NLNKLEKIFLQGNQLTDINLPAGLSNLKTLV 168

Query: 314 PNIQQV 297
            +  Q+
Sbjct: 169 LSNNQI 174



 Score = 52.8 bits (125), Expect = 2e-05
 Identities = 40/159 (25%), Positives = 79/159 (49%)
 Frame = -2

Query: 839 NQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKK 660
           N +  +   +   +++ +      ++ ++ LQ L+NLQ ++L  N+I+ I+         
Sbjct: 62  NSVTDVVSQQELDQVESINAMRKNIKSIQGLQHLSNLQTIYLSDNQIQDISY-------- 113

Query: 659 ISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIAN 480
                  LT++        LEE+YLS N I+ +  L+ L  L  + +  N+LT I+  A 
Sbjct: 114 -------LTNLN------KLEEIYLSGNQIKDIGHLANLNKLEKIFLQGNQLTDINLPAG 160

Query: 479 LTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
           L+ L+ L L++N I  + ++ ++     +KL  +YL+ N
Sbjct: 161 LSNLKTLVLSNNQIKDICNLEKS-----KKLENVYLQGN 194



 Score = 33.5 bits (75), Expect = 10.0
 Identities = 22/66 (33%), Positives = 32/66 (48%)
 Frame = -3

Query: 1096 ISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYLM 917
            + HLSNL    L  N I D     +S    +++LEE+ L  NQ+K I  LA L     + 
Sbjct: 92   LQHLSNLQTIYLSDNQIQD-----ISYLTNLNKLEEIYLSGNQIKDIGHLANLNKLEKIF 146

Query: 916  FRSTKL 899
             +  +L
Sbjct: 147  LQGNQL 152



>gb:AF497168_516458 Listeria monocytogenes strain FSLw1110
           internalin A precursor (inlA) gene, complete cds.
          Length = 741

 Score = 91.3 bits (225), Expect = 4e-17
 Identities = 66/195 (33%), Positives = 103/195 (52%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL+   ++ N+IT  S L+ +++ L  L + NNQI  I+ +++   L  LEL SN +  +
Sbjct: 65  KLVDIVMNNNQITDISPLANLTN-LTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDI 123

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
             L  LTNLQ+L  G        L  L  ++++ I SN+++ +  L +   LE L  ++N
Sbjct: 124 SALSGLTNLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNN 183

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L  L NL  L ++ N+L  I  +A+LT L DL L +N IS++     A    L
Sbjct: 184 QISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNL-----APLSGL 238

Query: 395 QKLTTLYLERNPCAN 351
            KLT L L  N  +N
Sbjct: 239 TKLTELKLGANQISN 253



 Score = 70.5 bits (171), Expect = 7e-11
 Identities = 50/202 (24%), Positives = 100/202 (49%), Gaps = 17/202 (8%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L +L ++NNQI+ +  +    +L  L+LG+N++  +  L  LT L  L L  N++  I
Sbjct: 217 TNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDI 276

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + +  LK +  +++  N ++ +  +     L+ L+  +N +  +  L+ L N+  L    
Sbjct: 277 SPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGH 336

Query: 512 NKLTAISNIANLTKLEDLWLND-----------NNISSVEDIAEAVAGSLQKLTTL---- 378
           N+++ ++ +ANLT++  L LND            N+ S+ +  + V G+L    T+    
Sbjct: 337 NQISDLTPLANLTRITQLGLNDQAWTNPPVNYKTNV-SIPNTVKNVTGALIAPATISDGG 395

Query: 377 -YLERNPCANSPNYISTLRQIF 315
            Y E +   N P+Y + +   F
Sbjct: 396 SYAEPDITWNLPSYTNEVSYTF 417



 Score = 67.0 bits (162), Expect = 8e-10
 Identities = 53/181 (29%), Positives = 91/181 (50%), Gaps = 1/181 (0%)
 Frame = -2

Query: 902 ITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQE 723
           I S  GL  +++ L ++    NQ+  I  ++   +L  + + +N++  +  L  LTNL  
Sbjct: 32  IKSIDGLEYLNN-LTQINFGFNQLTDITPLKDLTKLVDIVMNNNQITDISPLANLTNLTG 90

Query: 722 LWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLST 546
           L L  N+I  I+ L  L  + ++ + SN ++ +  L     L++L    N +  ++ L+ 
Sbjct: 91  LTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTNLQQLSFG-NQVTDLKPLAN 149

Query: 545 LVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLER 366
           L  L  LD+S+NK++ IS +A LT LE L   +N IS +  +     G L  L  L L  
Sbjct: 150 LTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPL-----GILTNLDELSLNG 204

Query: 365 N 363
           N
Sbjct: 205 N 205



 Score = 43.9 bits (102), Expect = 0.007
 Identities = 26/71 (36%), Positives = 42/71 (59%)
 Frame = -2

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
           GI+ ++GL  L NL  ++   N+LT I+ + +LTKL D+ +N+N I+ +  +A     +L
Sbjct: 31  GIKSIDGLEYLNNLTQINFGFNQLTDITPLKDLTKLVDIVMNNNQITDISPLA-----NL 85

Query: 395 QKLTTLYLERN 363
             LT L L  N
Sbjct: 86  TNLTGLTLFNN 96



>gb:LISINLAB_140565 Listeria monocytogenes internalin (inlA, inlB)
           genes, complete cds.
          Length = 630

 Score = 90.5 bits (223), Expect = 7e-17
 Identities = 63/198 (31%), Positives = 108/198 (54%), Gaps = 3/198 (1%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           +++ ++  +N+ I  ++ I++   +  L L  NKL  ++ L  L NL  L+L  N+I+ +
Sbjct: 76  NSIDQIIANNSDIKSVQGIQYLPNVTKLFLNGNKLTDIKPLTNLKNLGWLFLDENKIKDL 135

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + L  LK +K +S++ N ++ + GL     LE LYL +N I  +  LS L  L  L +  
Sbjct: 136 SSLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNNKITDITVLSRLTKLDTLSLED 195

Query: 512 NKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSP-NYI 336
           N+++ I  +A LTKL++L+L+ N+IS +  +A      L+ L  L L    C N P N+ 
Sbjct: 196 NQISDIVPLAGLTKLQNLYLSKNHISDLRALA-----GLKNLDVLELFSQECLNKPINHQ 250

Query: 335 STLRQIFPN-IQQVDSEL 285
           S L  + PN ++  D  L
Sbjct: 251 SNL--VVPNTVKNTDGSL 266



>pir|C39930|C39930 hypothetical protein (internalin region) -
           Listeria monocytogenes
          Length = 630

 Score = 90.5 bits (223), Expect = 7e-17
 Identities = 63/198 (31%), Positives = 108/198 (54%), Gaps = 3/198 (1%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           +++ ++  +N+ I  ++ I++   +  L L  NKL  ++ L  L NL  L+L  N+I+ +
Sbjct: 76  NSIDQIIANNSDIKSVQGIQYLPNVTKLFLNGNKLTDIKPLTNLKNLGWLFLDENKIKDL 135

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + L  LK +K +S++ N ++ + GL     LE LYL +N I  +  LS L  L  L +  
Sbjct: 136 SSLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNNKITDITVLSRLTKLDTLSLED 195

Query: 512 NKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSP-NYI 336
           N+++ I  +A LTKL++L+L+ N+IS +  +A      L+ L  L L    C N P N+ 
Sbjct: 196 NQISDIVPLAGLTKLQNLYLSKNHISDLRALA-----GLKNLDVLELFSQECLNKPINHQ 250

Query: 335 STLRQIFPN-IQQVDSEL 285
           S L  + PN ++  D  L
Sbjct: 251 SNL--VVPNTVKNTDGSL 266



>sp|P25147|INLB_LISMO Internalin B precursor.>pir|AC1129|AC1129
           Internalin B [imported] - Listeria monocytogenes (strain
           EGD-e)>gb:LMO012346_141553 Listeria monocytogenes
           internalin operon; orfA, inlA, and inlB
           genes.>gb:AL591975_534926 Listeria monocytogenes strain
           EGD, complete genome, segment 3/12.
          Length = 630

 Score = 90.1 bits (222), Expect = 9e-17
 Identities = 62/198 (31%), Positives = 108/198 (54%), Gaps = 3/198 (1%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           +++ ++  +N+ I  ++ I++   +  L L  NKL  ++ L  L NL  L+L  N+++ +
Sbjct: 76  NSIDQIIANNSDIKSVQGIQYLPNVTKLFLNGNKLTDIKPLANLKNLGWLFLDENKVKDL 135

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + L  LK +K +S++ N ++ + GL     LE LYL +N I  +  LS L  L  L +  
Sbjct: 136 SSLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNNKITDITVLSRLTKLDTLSLED 195

Query: 512 NKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSP-NYI 336
           N+++ I  +A LTKL++L+L+ N+IS +  +A      L+ L  L L    C N P N+ 
Sbjct: 196 NQISDIVPLAGLTKLQNLYLSKNHISDLRALA-----GLKNLDVLELFSQECLNKPINHQ 250

Query: 335 STLRQIFPN-IQQVDSEL 285
           S L  + PN ++  D  L
Sbjct: 251 SNL--VVPNTVKNTDGSL 266



 Score = 47.0 bits (110), Expect = 9e-04
 Identities = 27/100 (27%), Positives = 56/100 (56%)
 Frame = -2

Query: 662 KISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIA 483
           K +++   +T      E  +++++  +++ I+ ++G+  L N+  L ++ NKLT I  +A
Sbjct: 58  KDNLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVTKLFLNGNKLTDIKPLA 117

Query: 482 NLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
           NL  L  L+L++N +  +  + +     L+KL +L LE N
Sbjct: 118 NLKNLGWLFLDENKVKDLSSLKD-----LKKLKSLSLEHN 152



>gb:AF497165_516455 Listeria monocytogenes strain FSLJ1158
           internalin A precursor (inlA) gene, complete cds.
          Length = 746

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 64/195 (32%), Positives = 102/195 (52%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL+   ++ N+I   + L+ +S+ L  L + NNQI  I+ +++   L  LEL SN +  +
Sbjct: 65  KLVDILMNNNQIADITPLANLSN-LTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDI 123

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
             L  LT+LQ+L  G        L  L  ++++ I SN+++ +  L +   LE L  ++N
Sbjct: 124 SALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNN 183

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L  L NL  L ++ N+L  I  +A+LT L DL L +N IS++     A    L
Sbjct: 184 QISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNL-----APLSGL 238

Query: 395 QKLTTLYLERNPCAN 351
            KLT L L  N  +N
Sbjct: 239 TKLTELKLGANQISN 253



 Score = 79.3 bits (194), Expect(2) = 2e-16
 Identities = 68/237 (28%), Positives = 115/237 (48%), Gaps = 23/237 (9%)
 Frame = -2

Query: 920 DVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQT 741
           D+S N+++  S L+K+++ L+ L  +NNQI+ I  +     L  L L  N+L+ +  L +
Sbjct: 157 DISSNKVSDISVLAKLTN-LESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLAS 215

Query: 740 LTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEK 564
           LTNL +L L  N+I  +  L GL  + ++ + +N+++++  L    AL  L L+ N +E 
Sbjct: 216 LTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLED 275

Query: 563 MEGLSTLVNLRVL--------DVSA--------------NKLTAISNIANLTKLEDLWLN 450
           +  +S L NL  L        D+S               NK++ +S++ANLT +  L   
Sbjct: 276 ISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAG 335

Query: 449 DNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA 279
            N IS +  +A     +L ++T L L      N P    T   I   ++ V   L A
Sbjct: 336 HNQISDLTPLA-----NLTRITQLGLNDQAWTNPPVNYKTNVSIPNTVKNVTGALIA 387



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 27/71 (38%), Positives = 43/71 (60%)
 Frame = -2

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
           GI+ ++GL  L NL  ++ S N+LT I+ + +LTKL D+ +N+N I+ +  +A     +L
Sbjct: 31  GIKSIDGLEYLNNLTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLA-----NL 85

Query: 395 QKLTTLYLERN 363
             LT L L  N
Sbjct: 86  SNLTGLTLFNN 96



 Score = 30.4 bits (67), Expect(2) = 2e-16
 Identities = 22/70 (31%), Positives = 38/70 (54%)
 Frame = -3

Query: 1123 NRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLA 944
            N+++ + P +++LSNL   +L  N ITD  ++PL +   ++ L  L L  N +  I  L+
Sbjct: 74   NQIADITP-LANLSNLTGLTLFNNQITD--IDPLKN---LTNLNRLELSSNTISDISALS 127

Query: 943  YLRNFWYLMF 914
             L +   L F
Sbjct: 128  GLTSLQQLSF 137



>gb:AF497167_516457 Listeria monocytogenes strain FSLX1002
           internalin A precursor (inlA) gene, complete cds.
          Length = 744

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 65/195 (33%), Positives = 102/195 (52%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL+   ++ N+I   + L+ +S+ L  L + NNQI  I+ +++   L  LEL SN +  +
Sbjct: 65  KLVDILMNNNQIADITPLANLSN-LTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDI 123

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
             L  LTNLQ+L  G        L  L  ++++ I SN+++ +  L +   LE L  ++N
Sbjct: 124 SALSGLTNLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNN 183

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L  L NL  L ++ N+L  I  +A+LT L DL L +N IS++     A    L
Sbjct: 184 QISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNL-----APLSGL 238

Query: 395 QKLTTLYLERNPCAN 351
            KLT L L  N  +N
Sbjct: 239 TKLTELKLGANQISN 253



 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 50/202 (24%), Positives = 101/202 (50%), Gaps = 17/202 (8%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L +L ++NNQI+ +  +    +L  L+LG+N++  +  L  LT L  L L  N++  I
Sbjct: 217 TNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDI 276

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + +  LK +  +++  N ++ +  +     L+ L+  +N +  +  L++L N+  L    
Sbjct: 277 SPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLASLTNINWLSAGH 336

Query: 512 NKLTAISNIANLTKLEDLWLNDN-----------NISSVEDIAEAVAGSLQKLTTL---- 378
           N+++ ++ +ANLT++  L LND            N+ S+ +  + V G+L    T+    
Sbjct: 337 NQISDLTPLANLTRITQLGLNDQAWTNAPVNYKANV-SIPNTVKNVTGALIAPATISDGG 395

Query: 377 -YLERNPCANSPNYISTLRQIF 315
            Y E +   N P+Y + +   F
Sbjct: 396 SYAEPDITWNLPSYTNEVSYTF 417



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 27/71 (38%), Positives = 43/71 (60%)
 Frame = -2

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
           GI+ ++GL  L NL  ++ S N+LT I+ + +LTKL D+ +N+N I+ +  +A     +L
Sbjct: 31  GIKSIDGLEYLNNLTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLA-----NL 85

Query: 395 QKLTTLYLERN 363
             LT L L  N
Sbjct: 86  SNLTGLTLFNN 96



>gb:AF497154_516444 Listeria monocytogenes strain FSLJ2068
           internalin A precursor (inlA) gene, complete cds.
          Length = 741

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 65/195 (33%), Positives = 102/195 (52%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL+   ++ N+I   + L+ +S+ L  L + NNQI  I+ +++   L  LEL SN +  +
Sbjct: 65  KLVDILMNNNQIADITPLANLSN-LTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDI 123

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
             L  LTNLQ+L  G        L  L  ++++ I SN+++ +  L +   LE L  ++N
Sbjct: 124 SALSGLTNLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNN 183

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L  L NL  L ++ N+L  I  +A+LT L DL L +N IS++     A    L
Sbjct: 184 QISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNL-----APLSGL 238

Query: 395 QKLTTLYLERNPCAN 351
            KLT L L  N  +N
Sbjct: 239 TKLTELKLGANQISN 253



 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 49/201 (24%), Positives = 99/201 (49%), Gaps = 16/201 (7%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L +L ++NNQI+ +  +    +L  L+LG+N++  +  L  LT L  L L  N++  I
Sbjct: 217 TNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDI 276

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + +  LK +  +++  N ++ +  +     L+ L+  +N +  +  L+ L N+  L    
Sbjct: 277 SPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGH 336

Query: 512 NKLTAISNIANLTKLEDLWLNDNNIS----------SVEDIAEAVAGSLQKLTTL----- 378
           N+++ ++ +ANLT++  L LND   +          S+ +  + V G+L    T+     
Sbjct: 337 NQISDLTPLANLTRITQLGLNDQEWTNPPVKYKVNVSIPNTVKNVTGALIAPATISDGGS 396

Query: 377 YLERNPCANSPNYISTLRQIF 315
           Y E +   N P+Y + +   F
Sbjct: 397 YAEPDITWNLPSYTNEVSYTF 417



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 27/71 (38%), Positives = 43/71 (60%)
 Frame = -2

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
           GI+ ++GL  L NL  ++ S N+LT I+ + +LTKL D+ +N+N I+ +  +A     +L
Sbjct: 31  GIKSIDGLEYLNNLTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLA-----NL 85

Query: 395 QKLTTLYLERN 363
             LT L L  N
Sbjct: 86  SNLTGLTLFNN 96



>gb:AE017323_442811 Listeria monocytogenes str. 4b F2365, section 2
           of 10 of the complete genome.>gb:AE017262_1075167
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 589

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 53/164 (32%), Positives = 94/164 (57%), Gaps = 1/164 (0%)
 Frame = -2

Query: 956 SGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELG 777
           S +S  K L   D++  ++T  + LS +++ LK L + NNQ+  +  +   H+L+ L + 
Sbjct: 131 SALSNLKNLQALDINDAQVTDITPLSGLTN-LKGLGLYNNQLENLSGVNSLHQLRSLNVS 189

Query: 776 SNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVAL 600
           +NKL  ++ LQ L+NL  L+   N+I  +  L  L  +  + + +N++     L     +
Sbjct: 190 NNKLTNLDELQALSNLSVLYANENQINNLQGLSNLNNLFLLDLSANQIVDTTPLAGLTKV 249

Query: 599 EELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKL 468
           + LY+S+N I  + GLS+L+NL  LD+S NK++ I  + +LTKL
Sbjct: 250 QTLYVSNNQISDVTGLSSLINLDWLDISQNKISNIRPLNSLTKL 293



 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 60/204 (29%), Positives = 113/204 (55%), Gaps = 3/204 (1%)
 Frame = -2

Query: 953 GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS 774
           G++    L    ++ N+++  S L  +++ L  L +S N I+ I  + +   LQ L++  
Sbjct: 88  GMNYLTNLGTLILTGNQVSDISPLKGLTN-LTMLQLSGNPISDISALSNLKNLQALDIND 146

Query: 773 NKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCI---KKISIQSNRLTSMKGLEECVA 603
            ++  +  L  LTNL+ L L  N++   NL G+  +   + +++ +N+LT++  L+    
Sbjct: 147 AQVTDITPLSGLTNLKGLGLYNNQLE--NLSGVNSLHQLRSLNVSNNKLTNLDELQALSN 204

Query: 602 LEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVED 423
           L  LY + N I  ++GLS L NL +LD+SAN++   + +A LTK++ L++++N IS V  
Sbjct: 205 LSVLYANENQINNLQGLSNLNNLFLLDLSANQIVDTTPLAGLTKVQTLYVSNNQISDVTG 264

Query: 422 IAEAVAGSLQKLTTLYLERNPCAN 351
           ++     SL  L  L + +N  +N
Sbjct: 265 LS-----SLINLDWLDISQNKISN 283



>pir|AE1479|AE1479 probable cell surface protein (LPXTG motif)
           [imported] - Listeria innocua (strain
           Clip11262)>gb:AL596164_537719 Listeria innocua Clip11262
           complete genome, segment 2/12.
          Length = 656

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 57/166 (34%), Positives = 96/166 (57%), Gaps = 3/166 (1%)
 Frame = -2

Query: 956 SGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELG 777
           S +S  K L   D++  +IT  + LS +++ LK L + NNQ+  +  + +  +L+ L + 
Sbjct: 131 SALSNLKNLQALDINDAQITDITPLSGLTN-LKGLGLYNNQLENLSGVNNLQQLRSLNVS 189

Query: 776 SNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKI---SIQSNRLTSMKGLEECV 606
           +NKL  ++ LQ L+NL  L+   N+I   NL GL  +K +    + +N++     L    
Sbjct: 190 NNKLTNLDELQALSNLGVLYANGNQIN--NLQGLSTLKNLFLLDLSTNQIVDTTPLAGLT 247

Query: 605 ALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKL 468
            ++ LYLS+N I  + GLS+L+NL  LD+S NK++ I  + +LTKL
Sbjct: 248 NVQTLYLSNNQISDVTGLSSLINLDWLDISQNKISNIRPLNSLTKL 293



 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 62/204 (30%), Positives = 113/204 (55%), Gaps = 3/204 (1%)
 Frame = -2

Query: 953 GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS 774
           G++    L    +S N+++  S L  +++ L  L +S N I+ I  + +   LQ L++  
Sbjct: 88  GMNYLTNLGTLILSSNQVSDISPLKGLTN-LTMLQLSGNPISDISALSNLKNLQALDIND 146

Query: 773 NKLRVMENLQTLTNLQELWLGRNRIRAINLCG---LKCIKKISIQSNRLTSMKGLEECVA 603
            ++  +  L  LTNL+ L L  N++   NL G   L+ ++ +++ +N+LT++  L+    
Sbjct: 147 AQITDITPLSGLTNLKGLGLYNNQLE--NLSGVNNLQQLRSLNVSNNKLTNLDELQALSN 204

Query: 602 LEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVED 423
           L  LY + N I  ++GLSTL NL +LD+S N++   + +A LT ++ L+L++N IS V  
Sbjct: 205 LGVLYANGNQINNLQGLSTLKNLFLLDLSTNQIVDTTPLAGLTNVQTLYLSNNQISDVTG 264

Query: 422 IAEAVAGSLQKLTTLYLERNPCAN 351
           ++     SL  L  L + +N  +N
Sbjct: 265 LS-----SLINLDWLDISQNKISN 283



>gb:AP004365_1840825 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0458E05.
          Length = 463

 Score = 88.6 bits (218), Expect = 3e-16
 Identities = 71/227 (31%), Positives = 121/227 (53%), Gaps = 4/227 (1%)
 Frame = -2

Query: 956 SGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELG 777
           S +S F  L   D+ +N + +  GLS  ++ LK L V  N++  ++ +E   +LQ+L  G
Sbjct: 34  SCLSSFVNLERLDLGYNCLLTLEGLSNCAN-LKWLSVIENKLVSLKGVEGLSKLQVLNAG 92

Query: 776 SNKLRVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRL-TSMKGLEECVA 603
            NKL+ M+ +++LT+L  L L  N I +I  L  L  +  + +  N + T    L +  A
Sbjct: 93  KNKLKTMDEVKSLTSLGALILNDNNISSICKLDQLHQLNTLVLSKNPIFTIGDALMKAKA 152

Query: 602 LEELYLSHNGIEKM-EGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSV 429
           +++L LSH  IEK+   L+  V L+ L ++ NK+T I S++A   K+ +L L +N I   
Sbjct: 153 MKKLSLSHCQIEKIGSSLTACVELKELRLAHNKITTIPSDLAKNVKILNLDLGNNLIERR 212

Query: 428 EDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSE 288
            D+   V   L  L  L L+ NP A        ++++ PN++  +S+
Sbjct: 213 SDL--EVLSELHYLRNLNLQGNPIAEKDGLAKKVKKLVPNLRIFNSK 257



>gb:AY228472_599550 Listeria monocytogenes strain F6214 internalin A
           (inlA) gene, partial cds.
          Length = 739

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 65/195 (33%), Positives = 102/195 (52%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL+   ++ N+I   + L+ +S+ L  L + NNQI  I+ +++   L  LEL SN +  +
Sbjct: 64  KLVDILMNNNQIADITPLANLSN-LTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDI 122

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
             L  LT+LQ+L  G        L  L  ++++ I SN+L+ +  L +   LE L  ++N
Sbjct: 123 SALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKLSDISVLAKLTNLESLIATNN 182

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L  L NL  L ++ N+L  I  +A+LT L DL L +N IS++     A    L
Sbjct: 183 QISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNL-----APLSGL 237

Query: 395 QKLTTLYLERNPCAN 351
            KLT L L  N  +N
Sbjct: 238 TKLTELKLGANQISN 252



 Score = 77.4 bits (189), Expect(2) = 6e-16
 Identities = 65/218 (29%), Positives = 110/218 (50%), Gaps = 24/218 (11%)
 Frame = -2

Query: 920 DVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQT 741
           D+S N+++  S L+K+++ L+ L  +NNQI+ I  +     L  L L  N+L+ +  L +
Sbjct: 156 DISSNKLSDISVLAKLTN-LESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLAS 214

Query: 740 LTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEK 564
           LTNL +L L  N+I  +  L GL  + ++ + +N+++++  L    AL  L L+ N +E 
Sbjct: 215 LTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLED 274

Query: 563 MEGLSTLVNLRVL--------DVSA--------------NKLTAISNIANLTKLEDLWLN 450
           +  +S L NL  L        D+S               NK++ +S++ANLT +  L   
Sbjct: 275 ISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAG 334

Query: 449 DNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSP-NY 339
            N IS +  +A     +L ++T L L      N P NY
Sbjct: 335 HNQISDLTPLA-----NLTRITQLGLNDQAWTNPPVNY 367



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 27/71 (38%), Positives = 43/71 (60%)
 Frame = -2

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
           GI+ ++GL  L NL  ++ S N+LT I+ + +LTKL D+ +N+N I+ +  +A     +L
Sbjct: 30  GIKSIDGLEYLNNLTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLA-----NL 84

Query: 395 QKLTTLYLERN 363
             LT L L  N
Sbjct: 85  SNLTGLTLFNN 95



 Score = 30.4 bits (67), Expect(2) = 6e-16
 Identities = 22/70 (31%), Positives = 38/70 (54%)
 Frame = -3

Query: 1123 NRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLA 944
            N+++ + P +++LSNL   +L  N ITD  ++PL +   ++ L  L L  N +  I  L+
Sbjct: 73   NQIADITP-LANLSNLTGLTLFNNQITD--IDPLKN---LTNLNRLELSSNTISDISALS 126

Query: 943  YLRNFWYLMF 914
             L +   L F
Sbjct: 127  GLTSLQQLSF 136



>gb:AF497166_516456 Listeria monocytogenes strain FSLW1111
           internalin A precursor (inlA) gene, complete cds.
          Length = 743

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 65/195 (33%), Positives = 102/195 (52%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL+   ++ N+I   + L+ +S+ L  L + NNQI  I+ +++   L  LEL SN +  +
Sbjct: 65  KLVDILMNNNQIADITPLANLSN-LTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDI 123

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
             L  LT+LQ+L  G        L  L  ++++ I SN+L+ +  L +   LE L  ++N
Sbjct: 124 SALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKLSDISVLAKLTNLESLIATNN 183

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L  L NL  L ++ N+L  I  +A+LT L DL L +N IS++     A    L
Sbjct: 184 QISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNL-----APLSGL 238

Query: 395 QKLTTLYLERNPCAN 351
            KLT L L  N  +N
Sbjct: 239 TKLTELKLGANQISN 253



 Score = 77.4 bits (189), Expect(2) = 6e-16
 Identities = 65/218 (29%), Positives = 110/218 (50%), Gaps = 24/218 (11%)
 Frame = -2

Query: 920 DVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQT 741
           D+S N+++  S L+K+++ L+ L  +NNQI+ I  +     L  L L  N+L+ +  L +
Sbjct: 157 DISSNKLSDISVLAKLTN-LESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLAS 215

Query: 740 LTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEK 564
           LTNL +L L  N+I  +  L GL  + ++ + +N+++++  L    AL  L L+ N +E 
Sbjct: 216 LTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLED 275

Query: 563 MEGLSTLVNLRVL--------DVSA--------------NKLTAISNIANLTKLEDLWLN 450
           +  +S L NL  L        D+S               NK++ +S++ANLT +  L   
Sbjct: 276 ISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAG 335

Query: 449 DNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSP-NY 339
            N IS +  +A     +L ++T L L      N P NY
Sbjct: 336 HNQISDLTPLA-----NLTRITQLGLNDQAWTNPPVNY 368



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 27/71 (38%), Positives = 43/71 (60%)
 Frame = -2

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
           GI+ ++GL  L NL  ++ S N+LT I+ + +LTKL D+ +N+N I+ +  +A     +L
Sbjct: 31  GIKSIDGLEYLNNLTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLA-----NL 85

Query: 395 QKLTTLYLERN 363
             LT L L  N
Sbjct: 86  SNLTGLTLFNN 96



 Score = 30.4 bits (67), Expect(2) = 6e-16
 Identities = 22/70 (31%), Positives = 38/70 (54%)
 Frame = -3

Query: 1123 NRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLA 944
            N+++ + P +++LSNL   +L  N ITD  ++PL +   ++ L  L L  N +  I  L+
Sbjct: 74   NQIADITP-LANLSNLTGLTLFNNQITD--IDPLKN---LTNLNRLELSSNTISDISALS 127

Query: 943  YLRNFWYLMF 914
             L +   L F
Sbjct: 128  GLTSLQQLSF 137



>gb:AE015937_319683 Clostridium tetani E88, section 2 of 10 of the
           complete genome.>gb:AE015927_962472 Clostridium tetani
           E88, complete genome.
          Length = 706

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 54/198 (27%), Positives = 111/198 (56%), Gaps = 1/198 (0%)
 Frame = -2

Query: 953 GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS 774
           G+   KKL +   + +E+     L+     L+ L +  N+I ++E+++   +L++L+L  
Sbjct: 411 GLENLKKLQITATNLSELHPLKNLTN----LERLELGENKIFEVEDLQGLIKLEVLDLSD 466

Query: 773 NKLRVMENLQTLTNLQELWLGRNRIRAINL-CGLKCIKKISIQSNRLTSMKGLEECVALE 597
           N ++ + +L+ LT+++EL L +N++  I++   +K ++++ I  N +T++K L++   L 
Sbjct: 467 NYIKDISSLKNLTDIKELKLNKNKVSDISIVANMKNLQRLYINDNNITTLKYLKDAKDLV 526

Query: 596 ELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA 417
            L  ++N I   EGL  L++++ + V  NK++ +  + NL +LE L    N IS ++ I 
Sbjct: 527 WLTANNNKITSFEGLENLLDIKEIHVDNNKISKLDPLKNLKELETLSARTNVISDLKPIE 586

Query: 416 EAVAGSLQKLTTLYLERN 363
                +L  +  LYL  N
Sbjct: 587 -----NLDYIKNLYLYEN 599



 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 57/184 (30%), Positives = 101/184 (54%), Gaps = 3/184 (1%)
 Frame = -2

Query: 905 EITSPSGLSKVSST--LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTN 732
           +I  P G  +++    +KEL +    I  I  +E+   L+ + LG N +R +  L+ L +
Sbjct: 333 KIEKPLGELRLADVEYIKELNLFAKNIKDISGMEYLRGLRWVNLGKNNIRDISPLKDLED 392

Query: 731 LQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEG 555
           L+ L+L + ++  I  L GL+ +KK+ I +  L+ +  L+    LE L L  N I ++E 
Sbjct: 393 LEGLYLYKTKVSDITPLQGLENLKKLQITATNLSELHPLKNLTNLERLELGENKIFEVED 452

Query: 554 LSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLY 375
           L  L+ L VLD+S N +  IS++ NLT +++L LN N +S +     ++  +++ L  LY
Sbjct: 453 LQGLIKLEVLDLSDNYIKDISSLKNLTDIKELKLNKNKVSDI-----SIVANMKNLQRLY 507

Query: 374 LERN 363
           +  N
Sbjct: 508 INDN 511



 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 58/184 (31%), Positives = 100/184 (54%), Gaps = 3/184 (1%)
 Frame = -2

Query: 905 EITSPSGLSKVS--STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTN 732
           +I  P G  + S  S + EL + N  I  IE I++   LQ ++  +NK+  +  +   T+
Sbjct: 77  KINKPVGPIEKSDLSNISELDIRNKAIKSIEGIQYLTGLQTIDAANNKIHDLSPISDCTS 136

Query: 731 LQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEG 555
           L ++    N+I  I+ L  L  ++K+ ++ N +  +  LE+   L+EL LS N I+ ++ 
Sbjct: 137 LSKINFSYNKIEDISTLKNLTILEKVYLKDNEIKRIDALEDLKELKELDLSSNEIKNLKS 196

Query: 554 LSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLY 375
           L+ L NL+ L ++ N L  I ++ +L KLE L L+ NNIS +  I       ++ LT LY
Sbjct: 197 LTYLNNLKTLTMADNGLKNIDDLGSLEKLESLTLSKNNISDISAIK-----VIRNLTKLY 251

Query: 374 LERN 363
           ++ N
Sbjct: 252 IDDN 255



 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 44/178 (24%), Positives = 97/178 (54%), Gaps = 1/178 (0%)
 Frame = -2

Query: 956 SGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELG 777
           S +S    L   + S+N+I   S L  ++  L+++Y+ +N+I +I+ +E   EL+ L+L 
Sbjct: 129 SPISDCTSLSKINFSYNKIEDISTLKNLT-ILEKVYLKDNEIKRIDALEDLKELKELDLS 187

Query: 776 SNKLRVMENLQTLTNLQELWLGRNRIRAINLCG-LKCIKKISIQSNRLTSMKGLEECVAL 600
           SN+++ +++L  L NL+ L +  N ++ I+  G L+ ++ +++  N ++ +  ++    L
Sbjct: 188 SNEIKNLKSLTYLNNLKTLTMADNGLKNIDDLGSLEKLESLTLSKNNISDISAIKVIRNL 247

Query: 599 EELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVE 426
            +LY+  N +E +  L  +  L  +++  NK         +  +E+L  N +N+  V+
Sbjct: 248 TKLYIDDNQVEDVYPLVGMDYLERINLDKNK---------IKNIEELEANKDNLKWVK 296



 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 51/192 (26%), Positives = 92/192 (47%)
 Frame = -2

Query: 938  KKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRV 759
            K L+    + N+ITS  GL  +   +KE++V NN+I+K++ +++  EL+ L   +N   V
Sbjct: 523  KDLVWLTANNNKITSFEGLENLLD-IKEIHVDNNKISKLDPLKNLKELETLSARTN---V 578

Query: 758  MENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSH 579
            + +L+ + NL                    IK + +  N+++ +  L+    +  LYL  
Sbjct: 579  ISDLKPIENLDY------------------IKNLYLYENKISDISPLKNMTGMLRLYLDK 620

Query: 578  NGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGS 399
            N I+ +  +S + ++  L +  N    I NIA +  LEDL   D   + ++DI   V  +
Sbjct: 621  NNIKDISVVSNMKDVTTLSLGDNN---IINIAPVAGLEDLATLDIGDNDIKDI--TVLYN 675

Query: 398  LQKLTTLYLERN 363
            L  L  L +  N
Sbjct: 676  LPSLEKLVVTNN 687



 Score = 51.6 bits (122), Expect = 4e-05
 Identities = 53/249 (21%), Positives = 100/249 (40%), Gaps = 59/249 (23%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRV 759
           +KL    +S N I+  S + KV   L +LY+ +NQ+  +  +     L+ + L  NK++ 
Sbjct: 223 EKLESLTLSKNNISDISAI-KVIRNLTKLYIDDNQVEDVYPLVGMDYLERINLDKNKIKN 281

Query: 758 MENLQ------------------------------TLTNLQELWLGR-------NRIRAI 690
           +E L+                               + N ++  L R         +  +
Sbjct: 282 IEELEANKDNLKWVKYRGKEITDIGTLKYIVEQANVVVNFKDKNLEREVRKKIEKPLGEL 341

Query: 689 NLCGLKCIKKISIQSNRLTSMKGLE----------------------ECVALEELYLSHN 576
            L  ++ IK++++ +  +  + G+E                      +   LE LYL   
Sbjct: 342 RLADVEYIKELNLFAKNIKDISGMEYLRGLRWVNLGKNNIRDISPLKDLEDLEGLYLYKT 401

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            +  +  L  L NL+ L ++A  L+ +  + NLT LE L L +N I  VED+   +   +
Sbjct: 402 KVSDITPLQGLENLKKLQITATNLSELHPLKNLTNLERLELGENKIFEVEDLQGLIKLEV 461

Query: 395 QKLTTLYLE 369
             L+  Y++
Sbjct: 462 LDLSDNYIK 470



>gb:AE012908_286995 Chlorobium tepidum TLS section 129 of 194 of the
           complete genome.>gb:AE006470_934163 Chlorobium tepidum
           TLS complete genome.
          Length = 1102

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 65/193 (33%), Positives = 105/193 (54%), Gaps = 1/193 (0%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRV 759
           K L    +S N+IT  S L+ ++S L  L++  NQI  I  +   + L +L L  NK+  
Sbjct: 63  KSLSELSLSSNQITDISPLASLNS-LSMLWLDRNQITDIAPLASLNSLSMLWLFGNKISD 121

Query: 758 MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS 582
           +  L++L +L EL L  N+I  I  L  LK + ++S+  N ++ +  LE   +L EL LS
Sbjct: 122 IAPLESLKSLTELQLSSNQITDIAPLASLKSLTELSLSGNNISDIAPLESLKSLTELSLS 181

Query: 581 HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG 402
            N I  +  L++L +L  L +S+N+++ I+ + +L  L +L L+ N IS +     A   
Sbjct: 182 SNQITDIAPLASLKSLTELSLSSNQISDIAPLESLKSLTELQLSRNQISDI-----APLE 236

Query: 401 SLQKLTTLYLERN 363
           SL+ LT L L  N
Sbjct: 237 SLKSLTELQLSSN 249



 Score = 79.3 bits (194), Expect = 2e-13
 Identities = 63/228 (27%), Positives = 111/228 (48%), Gaps = 11/228 (4%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRV 759
           K L    +S N+I+  + L  + S L EL +S+NQI  I  +     L  L+L  N++  
Sbjct: 217 KSLTELQLSRNQISDIAPLESLKS-LTELQLSSNQITDIAPLASLKSLTELQLSRNQISD 275

Query: 758 MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS 582
           +  L++L +L +LWL  N+I  I  L  L  + ++ + SN++T +  L    +L  L+LS
Sbjct: 276 IAPLESLNSLSKLWLNGNQITDIAPLASLNSLTELELSSNQITDIAPLASLKSLSTLWLS 335

Query: 581 HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI-----A 417
            N I  +  L++L +L  L +S+N+++ IS +A+L  L    +  N I  + +       
Sbjct: 336 SNQISDIAPLASLESLSELSLSSNQISDISPLASLNSLTGFDVRRNPIKRLPETITGFDM 395

Query: 416 EAVAGSLQKLTTLYLERNPCANSPNYI-----STLRQIFPNIQQVDSE 288
           E +         +    NP  + P  I       +RQ F +I++  S+
Sbjct: 396 EILWNDFSSSGFITFFDNPLESPPPEIVKQGKEAVRQYFQSIEEARSK 443



>gb:AY228471_599549 Listeria monocytogenes strain 10403S internalin
           A (inlA) gene, partial cds.
          Length = 743

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 64/195 (32%), Positives = 102/195 (52%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL+   ++ N+I   + L+ +++ L  L + NNQI  I+ +++   L  LEL SN +  +
Sbjct: 64  KLVDILMNNNQIADITPLANLTN-LTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDI 122

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
             L  LTNLQ+L  G        L  L  ++++ I SN+++ +  L +   LE L  ++N
Sbjct: 123 SALSGLTNLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNN 182

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L  L NL  L ++ N+L  I  +A+LT L DL L +N IS++     A    L
Sbjct: 183 QISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNL-----APLSGL 237

Query: 395 QKLTTLYLERNPCAN 351
            KLT L L  N  +N
Sbjct: 238 TKLTELKLGANQISN 252



 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 55/181 (30%), Positives = 93/181 (51%), Gaps = 1/181 (0%)
 Frame = -2

Query: 902 ITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQE 723
           I S  GL  +++ L ++  SNNQ+  I  ++   +L  + + +N++  +  L  LTNL  
Sbjct: 31  IKSIDGLEYLNN-LTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLANLTNLTG 89

Query: 722 LWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLST 546
           L L  N+I  I+ L  L  + ++ + SN ++ +  L     L++L    N +  ++ L+ 
Sbjct: 90  LTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTNLQQLSFG-NQVTDLKPLAN 148

Query: 545 LVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLER 366
           L  L  LD+S+NK++ IS +A LT LE L   +N IS +  +     G L  L  L L  
Sbjct: 149 LTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPL-----GILTNLDELSLNG 203

Query: 365 N 363
           N
Sbjct: 204 N 204



 Score = 70.5 bits (171), Expect = 7e-11
 Identities = 50/202 (24%), Positives = 100/202 (49%), Gaps = 17/202 (8%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L +L ++NNQI+ +  +    +L  L+LG+N++  +  L  LT L  L L  N++  I
Sbjct: 216 TNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDI 275

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + +  LK +  +++  N ++ +  +     L+ L+  +N +  +  L+ L N+  L    
Sbjct: 276 SPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGH 335

Query: 512 NKLTAISNIANLTKLEDLWLNDN-----------NISSVEDIAEAVAGSLQKLTTL---- 378
           N+++ ++ +ANLT++  L LND            N+ S+ +  + V G+L    T+    
Sbjct: 336 NQISDLTPLANLTRITQLGLNDQAWTNAPVNYKANV-SIPNTVKNVTGALIAPATISDGG 394

Query: 377 -YLERNPCANSPNYISTLRQIF 315
            Y E +   N P+Y + +   F
Sbjct: 395 SYAEPDITWNLPSYTNEVSYTF 416



 Score = 45.4 bits (106), Expect = 0.003
 Identities = 27/71 (38%), Positives = 43/71 (60%)
 Frame = -2

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
           GI+ ++GL  L NL  ++ S N+LT I+ + +LTKL D+ +N+N I+ +  +A     +L
Sbjct: 30  GIKSIDGLEYLNNLTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLA-----NL 84

Query: 395 QKLTTLYLERN 363
             LT L L  N
Sbjct: 85  TNLTGLTLFNN 95



>gb:AJ784775_532441 Listeria monocytogenes partial inlA gene for
           internalin A, strain Scott A.
          Length = 792

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 65/195 (33%), Positives = 101/195 (51%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL+   ++ N+I   + L+  SS L  L + NNQI  I+ +++   L  LEL SN +  +
Sbjct: 113 KLVDILMNNNQIADITPLAN-SSNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDI 171

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
             L  LT+LQ+L  G        L  L  ++++ I SN+++ +  L +   LE L  ++N
Sbjct: 172 SALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNN 231

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L  L NL  L ++ N+L  I  +A+LT L DL L +N IS++     A    L
Sbjct: 232 QISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNL-----APLSGL 286

Query: 395 QKLTTLYLERNPCAN 351
            KLT L L  N  +N
Sbjct: 287 TKLTELKLGANQISN 301



 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 49/201 (24%), Positives = 99/201 (49%), Gaps = 16/201 (7%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L +L ++NNQI+ +  +    +L  L+LG+N++  +  L  LT L  L L  N++  I
Sbjct: 265 TNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDI 324

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + +  LK +  +++  N ++ +  +     L+ L+  +N +  +  L+ L N+  L    
Sbjct: 325 SPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGH 384

Query: 512 NKLTAISNIANLTKLEDLWLNDNNIS----------SVEDIAEAVAGSLQKLTTL----- 378
           N+++ ++ +ANLT++  L LND   +          S+ +  + V G+L    T+     
Sbjct: 385 NQISDLTPLANLTRITQLGLNDQEWTNPPVNYKVNVSIPNTVKNVTGALIAPATISDGGS 444

Query: 377 YLERNPCANSPNYISTLRQIF 315
           Y E +   N P+Y + +   F
Sbjct: 445 YAEPDITWNLPSYTNEVSYTF 465



 Score = 44.3 bits (103), Expect = 0.006
 Identities = 21/55 (38%), Positives = 37/55 (67%)
 Frame = -2

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEA 411
           GI+ ++GL  L NL  ++ S N+LT I+ + +LTKL D+ +N+N I+ +  +A +
Sbjct: 79  GIKSIDGLEYLNNLTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLANS 133



>gb:AF497163_516453 Listeria monocytogenes strain FSLj2064
           internalin A precursor (inlA) gene, complete cds.
          Length = 744

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 64/195 (32%), Positives = 102/195 (52%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL+   ++ N+I   + L+ +++ L  L + NNQI  I+ +++   L  LEL SN +  +
Sbjct: 65  KLVDILMNNNQIADITPLANLTN-LTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDI 123

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
             L  LTNLQ+L  G        L  L  ++++ I SN+++ +  L +   LE L  ++N
Sbjct: 124 SALSGLTNLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNN 183

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L  L NL  L ++ N+L  I  +A+LT L DL L +N IS++     A    L
Sbjct: 184 QISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNL-----APLSGL 238

Query: 395 QKLTTLYLERNPCAN 351
            KLT L L  N  +N
Sbjct: 239 TKLTELKLGANQISN 253



 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 49/201 (24%), Positives = 99/201 (49%), Gaps = 16/201 (7%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L +L ++NNQI+ +  +    +L  L+LG+N++  +  L  LT L  L L  N++  I
Sbjct: 217 TNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDI 276

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + +  LK +  +++  N ++ +  +     L+ L+  +N +  +  L+ L N+  L    
Sbjct: 277 SPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGH 336

Query: 512 NKLTAISNIANLTKLEDLWLNDNNIS----------SVEDIAEAVAGSLQKLTTL----- 378
           N+++ ++ +ANLT++  L LND   +          S+ +  + V G+L    T+     
Sbjct: 337 NQISDLTPLANLTRITQLGLNDQEWTNPPVNYKVNVSIPNTVKNVTGALIAPATISDGGS 396

Query: 377 YLERNPCANSPNYISTLRQIF 315
           Y E +   N P+Y + +   F
Sbjct: 397 YAEPDITWNLPSYTNEVSYTF 417



 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 55/181 (30%), Positives = 93/181 (51%), Gaps = 1/181 (0%)
 Frame = -2

Query: 902 ITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQE 723
           I S  GL  +++ L ++  SNNQ+  I  ++   +L  + + +N++  +  L  LTNL  
Sbjct: 32  IKSIDGLEYLNN-LTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLANLTNLTG 90

Query: 722 LWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLST 546
           L L  N+I  I+ L  L  + ++ + SN ++ +  L     L++L    N +  ++ L+ 
Sbjct: 91  LTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTNLQQLSFG-NQVTDLKPLAN 149

Query: 545 LVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLER 366
           L  L  LD+S+NK++ IS +A LT LE L   +N IS +  +     G L  L  L L  
Sbjct: 150 LTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPL-----GILTNLDELSLNG 204

Query: 365 N 363
           N
Sbjct: 205 N 205



 Score = 45.4 bits (106), Expect = 0.003
 Identities = 27/71 (38%), Positives = 43/71 (60%)
 Frame = -2

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
           GI+ ++GL  L NL  ++ S N+LT I+ + +LTKL D+ +N+N I+ +  +A     +L
Sbjct: 31  GIKSIDGLEYLNNLTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLA-----NL 85

Query: 395 QKLTTLYLERN 363
             LT L L  N
Sbjct: 86  TNLTGLTLFNN 96



>gb:AF497156_516446 Listeria monocytogenes strain FSLj1038
           internalin A precursor (inlA) gene, complete
           cds.>gb:AF497161_516451 Listeria monocytogenes strain
           FSLj2039 internalin A precursor (inlA) gene, complete
           cds.>gb:AF497162_516452 Listeria monocytogenes strain
           FSLj2045 internalin A precursor (inlA) gene, complete
           cds.
          Length = 744

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 64/195 (32%), Positives = 102/195 (52%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL+   ++ N+I   + L+ +++ L  L + NNQI  I+ +++   L  LEL SN +  +
Sbjct: 65  KLVDILMNNNQIADITPLANLTN-LTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDI 123

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
             L  LTNLQ+L  G        L  L  ++++ I SN+++ +  L +   LE L  ++N
Sbjct: 124 SALSGLTNLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNN 183

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L  L NL  L ++ N+L  I  +A+LT L DL L +N IS++     A    L
Sbjct: 184 QISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNL-----APLSGL 238

Query: 395 QKLTTLYLERNPCAN 351
            KLT L L  N  +N
Sbjct: 239 TKLTELKLGANQISN 253



 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 49/201 (24%), Positives = 99/201 (49%), Gaps = 16/201 (7%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L +L ++NNQI+ +  +    +L  L+LG+N++  +  L  LT L  L L  N++  I
Sbjct: 217 TNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDI 276

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + +  LK +  +++  N ++ +  +     L+ L+  +N +  +  L+ L N+  L    
Sbjct: 277 SPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGH 336

Query: 512 NKLTAISNIANLTKLEDLWLNDNNIS----------SVEDIAEAVAGSLQKLTTL----- 378
           N+++ ++ +ANLT++  L LND   +          S+ +  + V G+L    T+     
Sbjct: 337 NQISDLTPLANLTRITQLGLNDQEWTNPPVNYKVNVSIPNTVKNVTGALIAPATISDGGS 396

Query: 377 YLERNPCANSPNYISTLRQIF 315
           Y E +   N P+Y + +   F
Sbjct: 397 YAEPDITWNLPSYTNEVSYTF 417



 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 55/181 (30%), Positives = 93/181 (51%), Gaps = 1/181 (0%)
 Frame = -2

Query: 902 ITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQE 723
           I S  GL  +++ L ++  SNNQ+  I  ++   +L  + + +N++  +  L  LTNL  
Sbjct: 32  IKSIDGLEYLNN-LTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLANLTNLTG 90

Query: 722 LWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLST 546
           L L  N+I  I+ L  L  + ++ + SN ++ +  L     L++L    N +  ++ L+ 
Sbjct: 91  LTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTNLQQLSFG-NQVTDLKPLAN 149

Query: 545 LVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLER 366
           L  L  LD+S+NK++ IS +A LT LE L   +N IS +  +     G L  L  L L  
Sbjct: 150 LTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPL-----GILTNLDELSLNG 204

Query: 365 N 363
           N
Sbjct: 205 N 205



 Score = 45.4 bits (106), Expect = 0.003
 Identities = 27/71 (38%), Positives = 43/71 (60%)
 Frame = -2

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
           GI+ ++GL  L NL  ++ S N+LT I+ + +LTKL D+ +N+N I+ +  +A     +L
Sbjct: 31  GIKSIDGLEYLNNLTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLA-----NL 85

Query: 395 QKLTTLYLERN 363
             LT L L  N
Sbjct: 86  TNLTGLTLFNN 96



>gb:LMU25448_141648 Listeria monocytogenes F5782 internalin (inlA)
           gene, partial cds.
          Length = 344

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 65/195 (33%), Positives = 103/195 (52%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL+   ++ N+I   + L+ +S+ L  L + NNQI  I+ +++   L  LEL SN +  +
Sbjct: 47  KLVDILMNNNQIADITPLANLSN-LTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDI 105

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
             L  LT+LQ+L LG        L  L  ++++ I SN+++ +  L +   LE L  ++N
Sbjct: 106 SALSGLTSLQQLSLGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNN 165

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L  L NL  L ++ N+L  I  +A+LT L DL L +N IS++     A    L
Sbjct: 166 QISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNL-----APLPGL 220

Query: 395 QKLTTLYLERNPCAN 351
            KLT L L  N  +N
Sbjct: 221 TKLTELKLGANQISN 235



 Score = 73.6 bits (179), Expect(2) = 3e-14
 Identities = 61/206 (29%), Positives = 106/206 (51%), Gaps = 23/206 (11%)
 Frame = -2

Query: 920 DVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQT 741
           D+S N+++  S L+K+++ L+ L  +NNQI+ I  +     L  L L  N+L+ +  L +
Sbjct: 139 DISSNKVSDISVLAKLTN-LESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLAS 197

Query: 740 LTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEK 564
           LTNL +L L  N+I  +  L GL  + ++ + +N+++++  L    AL  L L+ N +E 
Sbjct: 198 LTNLTDLDLANNQISNLAPLPGLTKLTELKLGANQISNIXPLAGLTALTNLELNENQLED 257

Query: 563 MEGLSTLVNLRVL--------DVSA--------------NKLTAISNIANLTKLEDLWLN 450
           +  +S L NL  L        D+S               NK++ +S++ANLT +  L   
Sbjct: 258 ISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAG 317

Query: 449 DNNISSVEDIAEAVAGSLQKLTTLYL 372
            N IS +  +A     +L ++T L L
Sbjct: 318 HNQISDLTPLA-----NLTRITQLGL 338



 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 38/142 (26%), Positives = 78/142 (54%), Gaps = 1/142 (0%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L +L ++NNQI+ +  +    +L  L+LG+N++  +  L  LT L  L L  N++  I
Sbjct: 199 TNLTDLDLANNQISNLAPLPGLTKLTELKLGANQISNIXPLAGLTALTNLELNENQLEDI 258

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + +  LK +  +++  N ++ +  +     L+ L+  +N +  +  L+ L N+  L    
Sbjct: 259 SPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGH 318

Query: 512 NKLTAISNIANLTKLEDLWLND 447
           N+++ ++ +ANLT++  L LND
Sbjct: 319 NQISDLTPLANLTRITQLGLND 340



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 27/71 (38%), Positives = 43/71 (60%)
 Frame = -2

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
           GI+ ++GL  L NL  ++ S N+LT I+ + +LTKL D+ +N+N I+ +  +A     +L
Sbjct: 13  GIKSIDGLEYLNNLTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLA-----NL 67

Query: 395 QKLTTLYLERN 363
             LT L L  N
Sbjct: 68  SNLTGLTLFNN 78



 Score = 28.5 bits (62), Expect(2) = 3e-14
 Identities = 21/68 (30%), Positives = 37/68 (54%)
 Frame = -3

Query: 1123 NRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLA 944
            N+++ + P +++LSNL   +L  N ITD  ++PL +   ++ L  L L  N +  I  L+
Sbjct: 56   NQIADITP-LANLSNLTGLTLFNNQITD--IDPLKN---LTNLNRLELSSNTISDISALS 109

Query: 943  YLRNFWYL 920
             L +   L
Sbjct: 110  GLTSLQQL 117



>gb:LISINLAB_140564 Listeria monocytogenes internalin (inlA, inlB)
           genes, complete cds.>gb:AF497164_516454 Listeria
           monocytogenes strain FSLC1117 internalin A precursor
           (inlA) gene, complete cds.
          Length = 744

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 64/195 (32%), Positives = 102/195 (52%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL+   ++ N+I   + L+ +++ L  L + NNQI  I+ +++   L  LEL SN +  +
Sbjct: 65  KLVDILMNNNQIADITPLANLTN-LTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDI 123

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
             L  LTNLQ+L  G        L  L  ++++ I SN+++ +  L +   LE L  ++N
Sbjct: 124 SALSGLTNLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNN 183

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L  L NL  L ++ N+L  I  +A+LT L DL L +N IS++     A    L
Sbjct: 184 QISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNL-----APLSGL 238

Query: 395 QKLTTLYLERNPCAN 351
            KLT L L  N  +N
Sbjct: 239 TKLTELKLGANQISN 253



 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 55/181 (30%), Positives = 93/181 (51%), Gaps = 1/181 (0%)
 Frame = -2

Query: 902 ITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQE 723
           I S  GL  +++ L ++  SNNQ+  I  ++   +L  + + +N++  +  L  LTNL  
Sbjct: 32  IKSIDGLEYLNN-LTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLANLTNLTG 90

Query: 722 LWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLST 546
           L L  N+I  I+ L  L  + ++ + SN ++ +  L     L++L    N +  ++ L+ 
Sbjct: 91  LTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTNLQQLSFG-NQVTDLKPLAN 149

Query: 545 LVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLER 366
           L  L  LD+S+NK++ IS +A LT LE L   +N IS +  +     G L  L  L L  
Sbjct: 150 LTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPL-----GILTNLDELSLNG 204

Query: 365 N 363
           N
Sbjct: 205 N 205



 Score = 70.5 bits (171), Expect = 7e-11
 Identities = 50/202 (24%), Positives = 100/202 (49%), Gaps = 17/202 (8%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L +L ++NNQI+ +  +    +L  L+LG+N++  +  L  LT L  L L  N++  I
Sbjct: 217 TNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDI 276

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + +  LK +  +++  N ++ +  +     L+ L+  +N +  +  L+ L N+  L    
Sbjct: 277 SPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGH 336

Query: 512 NKLTAISNIANLTKLEDLWLNDN-----------NISSVEDIAEAVAGSLQKLTTL---- 378
           N+++ ++ +ANLT++  L LND            N+ S+ +  + V G+L    T+    
Sbjct: 337 NQISDLTPLANLTRITQLGLNDQAWTNAPVNYKANV-SIPNTVKNVTGALIAPATISDGG 395

Query: 377 -YLERNPCANSPNYISTLRQIF 315
            Y E +   N P+Y + +   F
Sbjct: 396 SYAEPDITWNLPSYTNEVSYTF 417



 Score = 45.4 bits (106), Expect = 0.003
 Identities = 27/71 (38%), Positives = 43/71 (60%)
 Frame = -2

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
           GI+ ++GL  L NL  ++ S N+LT I+ + +LTKL D+ +N+N I+ +  +A     +L
Sbjct: 31  GIKSIDGLEYLNNLTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLA-----NL 85

Query: 395 QKLTTLYLERN 363
             LT L L  N
Sbjct: 86  TNLTGLTLFNN 96



>pir|S37387|S37387 internalin A precursor - Listeria monocytogenes
          Length = 800

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 64/195 (32%), Positives = 102/195 (52%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL+   ++ N+I   + L+ +++ L  L + NNQI  I+ +++   L  LEL SN +  +
Sbjct: 121 KLVDILMNNNQIADITPLANLTN-LTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDI 179

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
             L  LTNLQ+L  G        L  L  ++++ I SN+++ +  L +   LE L  ++N
Sbjct: 180 SALSGLTNLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNN 239

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L  L NL  L ++ N+L  I  +A+LT L DL L +N IS++     A    L
Sbjct: 240 QISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNL-----APLSGL 294

Query: 395 QKLTTLYLERNPCAN 351
            KLT L L  N  +N
Sbjct: 295 TKLTELKLGANQISN 309



 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 55/181 (30%), Positives = 93/181 (51%), Gaps = 1/181 (0%)
 Frame = -2

Query: 902 ITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQE 723
           I S  GL  +++ L ++  SNNQ+  I  ++   +L  + + +N++  +  L  LTNL  
Sbjct: 88  IKSIDGLEYLNN-LTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLANLTNLTG 146

Query: 722 LWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLST 546
           L L  N+I  I+ L  L  + ++ + SN ++ +  L     L++L    N +  ++ L+ 
Sbjct: 147 LTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTNLQQLSFG-NQVTDLKPLAN 205

Query: 545 LVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLER 366
           L  L  LD+S+NK++ IS +A LT LE L   +N IS +  +     G L  L  L L  
Sbjct: 206 LTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPL-----GILTNLDELSLNG 260

Query: 365 N 363
           N
Sbjct: 261 N 261



 Score = 70.5 bits (171), Expect = 7e-11
 Identities = 50/202 (24%), Positives = 100/202 (49%), Gaps = 17/202 (8%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L +L ++NNQI+ +  +    +L  L+LG+N++  +  L  LT L  L L  N++  I
Sbjct: 273 TNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDI 332

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + +  LK +  +++  N ++ +  +     L+ L+  +N +  +  L+ L N+  L    
Sbjct: 333 SPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGH 392

Query: 512 NKLTAISNIANLTKLEDLWLNDN-----------NISSVEDIAEAVAGSLQKLTTL---- 378
           N+++ ++ +ANLT++  L LND            N+ S+ +  + V G+L    T+    
Sbjct: 393 NQISDLTPLANLTRITQLGLNDQAWTNAPVNYKANV-SIPNTVKNVTGALIAPATISDGG 451

Query: 377 -YLERNPCANSPNYISTLRQIF 315
            Y E +   N P+Y + +   F
Sbjct: 452 SYAEPDITWNLPSYTNEVSYTF 473



 Score = 45.4 bits (106), Expect = 0.003
 Identities = 27/71 (38%), Positives = 43/71 (60%)
 Frame = -2

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
           GI+ ++GL  L NL  ++ S N+LT I+ + +LTKL D+ +N+N I+ +  +A     +L
Sbjct: 87  GIKSIDGLEYLNNLTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLA-----NL 141

Query: 395 QKLTTLYLERN 363
             LT L L  N
Sbjct: 142 TNLTGLTLFNN 152



>gb:BC037982_1982268 Homo sapiens hypothetical protein FLJ20156,
           mRNA (cDNA clone MGC:46072 IMAGE:5246149), complete cds.
          Length = 685

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 58/191 (30%), Positives = 106/191 (55%), Gaps = 1/191 (0%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-N 687
           L+ L   +N I +I+ I +  +L  L+L  N++  +  L TL  L+ L LG+NRI+ I N
Sbjct: 114 LRLLNFQHNFITRIQNISNLQKLISLDLYDNQIEEISGLSTLRCLRVLLLGKNRIKKISN 173

Query: 686 LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANK 507
           L  LK +  + +  N++T ++ +     L  L L+ N +  ++ L+ L +L  L++  N+
Sbjct: 174 LENLKSLDVLDLHGNQITKIENINHLCELRVLNLARNFLSHVDNLNGLDSLTELNLRHNQ 233

Query: 506 LTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTL 327
           +T + ++ NL  L+ L+L+ NNISS + ++  +A S   L+ +  + NP A    Y  T+
Sbjct: 234 ITFVRDVDNLPCLQHLFLSFNNISSFDSVS-CLADS-SSLSDITFDGNPIAQESWYKHTV 291

Query: 326 RQIFPNIQQVD 294
            Q    ++Q+D
Sbjct: 292 LQNMMQLRQLD 302



 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 52/196 (26%), Positives = 98/196 (50%), Gaps = 1/196 (0%)
 Frame = -2

Query: 950 VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN 771
           +S  +KL+  D+  N+I   SGLS +   L+ L +  N+I KI  +E+   L +L+L  N
Sbjct: 130 ISNLQKLISLDLYDNQIEEISGLSTLRC-LRVLLLGKNRIKKISNLENLKSLDVLDLHGN 188

Query: 770 KLRVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEE 594
           ++  +EN+  L  L+ L L RN +  + NL GL  + +++++ N++T ++ ++    L+ 
Sbjct: 189 QITKIENINHLCELRVLNLARNFLSHVDNLNGLDSLTELNLRHNQITFVRDVDNLPCLQH 248

Query: 593 LYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAE 414
           L+LS N I   + +S L                   A+ + L D+  + N I+       
Sbjct: 249 LFLSFNNISSFDSVSCL-------------------ADSSSLSDITFDGNPIAQESWYKH 289

Query: 413 AVAGSLQKLTTLYLER 366
            V  ++ +L  L ++R
Sbjct: 290 TVLQNMMQLRQLDMKR 305



 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 51/158 (32%), Positives = 78/158 (49%), Gaps = 9/158 (5%)
 Frame = -2

Query: 965 EENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQIL 786
           EE SG+S  + L V  +  N I   S L  + S L  L +  NQI KIE I H  EL++L
Sbjct: 147 EEISGLSTLRCLRVLLLGKNRIKKISNLENLKS-LDVLDLHGNQITKIENINHLCELRVL 205

Query: 785 ELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKG---L 618
            L  N L  ++NL  L +L EL L  N+I  + ++  L C++ + +  N ++S      L
Sbjct: 206 NLARNFLSHVDNLNGLDSLTELNLRHNQITFVRDVDNLPCLQHLFLSFNNISSFDSVSCL 265

Query: 617 EECVALEELYLSHNGIE-----KMEGLSTLVNLRVLDV 519
            +  +L ++    N I      K   L  ++ LR LD+
Sbjct: 266 ADSSSLSDITFDGNPIAQESWYKHTVLQNMMQLRQLDM 303



>gb:CR859837_1183939 Pongo pygmaeus mRNA; cDNA DKFZp469H1034 (from
           clone DKFZp469H1034).
          Length = 622

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 58/191 (30%), Positives = 106/191 (55%), Gaps = 1/191 (0%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-N 687
           L+ L   +N I +I+ I +  +L  L+L  N++  +  L TL  L+ L LG+NRI+ I N
Sbjct: 114 LRLLNFQHNFITRIQNISNLQKLISLDLYDNQIEEISGLSTLRCLRVLLLGKNRIKKISN 173

Query: 686 LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANK 507
           L  LK +  + +  N++T ++ +     L  L L+ N +  ++ L+ L +L  L++  N+
Sbjct: 174 LENLKSLDVLDLHGNQITKIENINHLCELRVLNLARNFLSHVDNLNGLDSLTELNLRHNQ 233

Query: 506 LTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTL 327
           +T + ++ NL  L+ L+L+ NNISS + ++  +A S   L+ +  + NP A    Y  T+
Sbjct: 234 ITFVRDVDNLPCLQHLFLSFNNISSFDSVS-CLADS-SSLSDITFDGNPIAQESWYKHTV 291

Query: 326 RQIFPNIQQVD 294
            Q    ++Q+D
Sbjct: 292 LQNMMQLRQLD 302



 Score = 73.9 bits (180), Expect = 7e-12
 Identities = 52/196 (26%), Positives = 98/196 (50%), Gaps = 1/196 (0%)
 Frame = -2

Query: 950 VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN 771
           +S  +KL+  D+  N+I   SGLS +   L+ L +  N+I KI  +E+   L +L+L  N
Sbjct: 130 ISNLQKLISLDLYDNQIEEISGLSTLRC-LRVLLLGKNRIKKISNLENLKSLDVLDLHGN 188

Query: 770 KLRVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEE 594
           ++  +EN+  L  L+ L L RN +  + NL GL  + +++++ N++T ++ ++    L+ 
Sbjct: 189 QITKIENINHLCELRVLNLARNFLSHVDNLNGLDSLTELNLRHNQITFVRDVDNLPCLQH 248

Query: 593 LYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAE 414
           L+LS N I   + +S L                   A+ + L D+  + N I+       
Sbjct: 249 LFLSFNNISSFDSVSCL-------------------ADSSSLSDITFDGNPIAQESWYKH 289

Query: 413 AVAGSLQKLTTLYLER 366
            V  ++ +L  L ++R
Sbjct: 290 TVLQNMMQLRQLDMKR 305



 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 51/158 (32%), Positives = 78/158 (49%), Gaps = 9/158 (5%)
 Frame = -2

Query: 965 EENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQIL 786
           EE SG+S  + L V  +  N I   S L  + S L  L +  NQI KIE I H  EL++L
Sbjct: 147 EEISGLSTLRCLRVLLLGKNRIKKISNLENLKS-LDVLDLHGNQITKIENINHLCELRVL 205

Query: 785 ELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKG---L 618
            L  N L  ++NL  L +L EL L  N+I  + ++  L C++ + +  N ++S      L
Sbjct: 206 NLARNFLSHVDNLNGLDSLTELNLRHNQITFVRDVDNLPCLQHLFLSFNNISSFDSVSCL 265

Query: 617 EECVALEELYLSHNGIE-----KMEGLSTLVNLRVLDV 519
            +  +L ++    N I      K   L  ++ LR LD+
Sbjct: 266 ADSSSLSDITFDGNPIAQESWYKHTVLQNMMQLRQLDM 303



>gb:AJ784776_532442 Listeria monocytogenes partial inlA gene for
           truncated internalin A, strain C3.
          Length = 483

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 64/195 (32%), Positives = 102/195 (52%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL+   ++ N+I   + L+ +S+ L  L + NNQI  I+ +++   L  LEL SN +  +
Sbjct: 113 KLVDILMNNNQIADITPLANLSN-LTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDI 171

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
             L  LT+LQ+L  G        L  L  ++++ I SN+++ +  L +   LE L  ++N
Sbjct: 172 SALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNN 231

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L  L NL  L ++ N+L  I  +A+LT L DL L +N IS++     A    L
Sbjct: 232 QISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNL-----APLSGL 286

Query: 395 QKLTTLYLERNPCAN 351
            KLT L L  N  +N
Sbjct: 287 TKLTELKLGANQISN 301



 Score = 70.5 bits (171), Expect = 7e-11
 Identities = 50/202 (24%), Positives = 100/202 (49%), Gaps = 17/202 (8%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L +L ++NNQI+ +  +    +L  L+LG+N++  +  L  LT L  L L  N++  I
Sbjct: 265 TNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDI 324

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + +  LK +  +++  N ++ +  +     L+ L+  +N +  +  L+ L N+  L    
Sbjct: 325 SPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGH 384

Query: 512 NKLTAISNIANLTKLEDLWLNDN-----------NISSVEDIAEAVAGSLQKLTTL---- 378
           N+++ ++ +ANLT++  L LND            N+ S+ +  + V G+L    T+    
Sbjct: 385 NQISDLTPLANLTRITQLGLNDQAWTNAPVNYKANV-SIPNTVKNVTGALIAPATISDGG 443

Query: 377 -YLERNPCANSPNYISTLRQIF 315
            Y E +   N P+Y + +   F
Sbjct: 444 SYAEPDITWNLPSYTNEVSYTF 465



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 27/71 (38%), Positives = 43/71 (60%)
 Frame = -2

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
           GI+ ++GL  L NL  ++ S N+LT I+ + +LTKL D+ +N+N I+ +  +A     +L
Sbjct: 79  GIKSIDGLEYLNNLTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLA-----NL 133

Query: 395 QKLTTLYLERN 363
             LT L L  N
Sbjct: 134 SNLTGLTLFNN 144



>gb:AF497158_516448 Listeria monocytogenes strain FSLj1051
           internalin A precursor (inlA) gene, complete cds.
          Length = 744

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 64/195 (32%), Positives = 102/195 (52%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL+   ++ N+I   + L+ +S+ L  L + NNQI  I+ +++   L  LEL SN +  +
Sbjct: 65  KLVDILMNNNQIADITPLANLSN-LTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDI 123

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
             L  LT+LQ+L  G        L  L  ++++ I SN+++ +  L +   LE L  ++N
Sbjct: 124 SALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNN 183

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L  L NL  L ++ N+L  I  +A+LT L DL L +N IS++     A    L
Sbjct: 184 QISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNL-----APLSGL 238

Query: 395 QKLTTLYLERNPCAN 351
            KLT L L  N  +N
Sbjct: 239 TKLTELKLGANQISN 253



 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 49/201 (24%), Positives = 99/201 (49%), Gaps = 16/201 (7%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L +L ++NNQI+ +  +    +L  L+LG+N++  +  L  LT L  L L  N++  I
Sbjct: 217 TNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDI 276

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + +  LK +  +++  N ++ +  +     L+ L+  +N +  +  L+ L N+  L    
Sbjct: 277 SPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGH 336

Query: 512 NKLTAISNIANLTKLEDLWLNDNNIS----------SVEDIAEAVAGSLQKLTTL----- 378
           N+++ ++ +ANLT++  L LND   +          S+ +  + V G+L    T+     
Sbjct: 337 NQISDLTPLANLTRITQLGLNDQEWTNPPVNYKVNVSIPNTVKNVTGALIAPATISDGGS 396

Query: 377 YLERNPCANSPNYISTLRQIF 315
           Y E +   N P+Y + +   F
Sbjct: 397 YAEPDITWNLPSYTNEVSYTF 417



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 27/71 (38%), Positives = 43/71 (60%)
 Frame = -2

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
           GI+ ++GL  L NL  ++ S N+LT I+ + +LTKL D+ +N+N I+ +  +A     +L
Sbjct: 31  GIKSIDGLEYLNNLTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLA-----NL 85

Query: 395 QKLTTLYLERN 363
             LT L L  N
Sbjct: 86  SNLTGLTLFNN 96



>gb:AE017323_442906 Listeria monocytogenes str. 4b F2365, section 2
           of 10 of the complete genome.>gb:AE017262_1075262
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 800

 Score = 87.0 bits (214), Expect = 8e-16
 Identities = 64/195 (32%), Positives = 102/195 (52%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL+   ++ N+I   + L+ +S+ L  L + NNQI  I+ +++   L  LEL SN +  +
Sbjct: 121 KLVDILMNNNQIADITPLANLSN-LTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDI 179

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
             L  LT+LQ+L  G        L  L  ++++ I SN+++ +  L +   LE L  ++N
Sbjct: 180 SALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNN 239

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L  L NL  L ++ N+L  I  +A+LT L DL L +N IS++     A    L
Sbjct: 240 QISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNL-----APLSGL 294

Query: 395 QKLTTLYLERNPCAN 351
            KLT L L  N  +N
Sbjct: 295 TKLTELKLGANQISN 309



 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 49/201 (24%), Positives = 99/201 (49%), Gaps = 16/201 (7%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L +L ++NNQI+ +  +    +L  L+LG+N++  +  L  LT L  L L  N++  I
Sbjct: 273 TNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDI 332

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + +  LK +  +++  N ++ +  +     L+ L+  +N +  +  L+ L N+  L    
Sbjct: 333 SPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGH 392

Query: 512 NKLTAISNIANLTKLEDLWLNDNNIS----------SVEDIAEAVAGSLQKLTTL----- 378
           N+++ ++ +ANLT++  L LND   +          S+ +  + V G+L    T+     
Sbjct: 393 NQISDLTPLANLTRITQLGLNDQEWTNPPVNYKVNVSIPNTVKNVTGALIAPATISDGGS 452

Query: 377 YLERNPCANSPNYISTLRQIF 315
           Y E +   N P+Y + +   F
Sbjct: 453 YAEPDITWNLPSYTNEVSYTF 473



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 27/71 (38%), Positives = 43/71 (60%)
 Frame = -2

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
           GI+ ++GL  L NL  ++ S N+LT I+ + +LTKL D+ +N+N I+ +  +A     +L
Sbjct: 87  GIKSIDGLEYLNNLTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLA-----NL 141

Query: 395 QKLTTLYLERN 363
             LT L L  N
Sbjct: 142 SNLTGLTLFNN 152



>gb:AK000163_1907731 Homo sapiens cDNA FLJ20156 fis, clone COL08823.
          Length = 685

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 58/191 (30%), Positives = 103/191 (53%), Gaps = 1/191 (0%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-N 687
           L+ L   +N I +I+ I +  +L  L+L  N++  +  L TL  L+ L LG+NRI+ I N
Sbjct: 114 LRLLNFQHNFITRIQNISNLQKLISLDLYDNQIEEISGLSTLRCLRVLLLGKNRIKKISN 173

Query: 686 LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANK 507
           L  LK +  + +  N++T ++ +     L  L L+ N +  ++ L+ L +L  L++  N+
Sbjct: 174 LENLKSLDVLDLHGNQITKIENINHLCELRVLNLARNFLSHVDNLNGLDSLTELNLRHNQ 233

Query: 506 LTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTL 327
           +T + ++ NL  L+ L+L+ NNISS + ++     S    TT   + NP A    Y  T+
Sbjct: 234 ITFVRDVDNLPCLQHLFLSFNNISSFDSVSCLADSSSLSDTT--FDGNPIAQESWYKHTV 291

Query: 326 RQIFPNIQQVD 294
            Q    ++Q+D
Sbjct: 292 LQNMMQLRQLD 302



 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 51/158 (32%), Positives = 77/158 (48%), Gaps = 9/158 (5%)
 Frame = -2

Query: 965 EENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQIL 786
           EE SG+S  + L V  +  N I   S L  + S L  L +  NQI KIE I H  EL++L
Sbjct: 147 EEISGLSTLRCLRVLLLGKNRIKKISNLENLKS-LDVLDLHGNQITKIENINHLCELRVL 205

Query: 785 ELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKG---L 618
            L  N L  ++NL  L +L EL L  N+I  + ++  L C++ + +  N ++S      L
Sbjct: 206 NLARNFLSHVDNLNGLDSLTELNLRHNQITFVRDVDNLPCLQHLFLSFNNISSFDSVSCL 265

Query: 617 EECVALEELYLSHNGIE-----KMEGLSTLVNLRVLDV 519
            +  +L +     N I      K   L  ++ LR LD+
Sbjct: 266 ADSSSLSDTTFDGNPIAQESWYKHTVLQNMMQLRQLDM 303



>gb:AE017290_433054 Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130, chromosome I, section 4 of 14 of the
           complete sequence.>gb:AE016823_1066065 Leptospira
           interrogans serovar Copenhageni str. Fiocruz L1-130,
           chromosome I, complete sequence.
          Length = 377

 Score = 86.7 bits (213), Expect = 1e-15
 Identities = 69/222 (31%), Positives = 122/222 (54%), Gaps = 7/222 (3%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKLR 762
           K L    + +N++T      +    L+ LY+ +N++  + +EIE    LQ+L+LGSN+L 
Sbjct: 69  KNLQRLYLHYNQLTVLPQEIEQLKNLQLLYLRSNRLTTLPKEIEQLKNLQVLDLGSNQLT 128

Query: 761 VM-ENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSMKG-LEECVALEE 594
           V+ + ++ L NLQ L+L  NR+  +  ++  L+ +K + + +N+LT++   +E+   L+ 
Sbjct: 129 VLPQEIEQLKNLQLLYLHSNRLTTLSKDIEQLQNLKSLDLSNNQLTTLPNEIEQLKNLKS 188

Query: 593 LYLSHNGIEKM-EGLSTLVNLRVLDVSANKLTAISN-IANLTKLEDLWLNDNNISSVEDI 420
           LYLS N      + +  L NL+VL ++ N++T + N IA L KL+ L+L+DN + ++   
Sbjct: 189 LYLSENQFATFPKEIGQLQNLKVLFLNNNQITILPNEIAKLKKLQYLYLSDNQLITLPKE 248

Query: 419 AEAVAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVD 294
            E     L+ L TL L  N     P  +  L     N+Q +D
Sbjct: 249 IE----QLKNLQTLDLSYNQLTILPKEVGQLE----NLQTLD 282



 Score = 80.1 bits (196), Expect = 9e-14
 Identities = 73/219 (33%), Positives = 117/219 (53%), Gaps = 8/219 (3%)
 Frame = -2

Query: 926 VFDVSFNEI-TSPSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKLRVM- 756
           V D+S  E+ T P  + K+ + L+ LY+  NQ+  + +EIE    LQ+L L SN+L  + 
Sbjct: 50  VLDLSRQELKTLPIEIGKLKN-LQRLYLHYNQLTVLPQEIEQLKNLQLLYLRSNRLTTLP 108

Query: 755 ENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALEELYL 585
           + ++ L NLQ L LG N++  +   +  LK ++ + + SNRLT++ K +E+   L+ L L
Sbjct: 109 KEIEQLKNLQVLDLGSNQLTVLPQEIEQLKNLQLLYLHSNRLTTLSKDIEQLQNLKSLDL 168

Query: 584 SHNGIEKMEG-LSTLVNLRVLDVSANKL-TAISNIANLTKLEDLWLNDNNISSVEDIAEA 411
           S+N +  +   +  L NL+ L +S N+  T    I  L  L+ L+LN+N I+    I   
Sbjct: 169 SNNQLTTLPNEIEQLKNLKSLYLSENQFATFPKEIGQLQNLKVLFLNNNQIT----ILPN 224

Query: 410 VAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVD 294
               L+KL  LYL  N     P  I  L+    N+Q +D
Sbjct: 225 EIAKLKKLQYLYLSDNQLITLPKEIEQLK----NLQTLD 259



>gb:BC016574_2092381 Mus musculus RIKEN cDNA D430025H09 gene, mRNA
           (cDNA clone MGC:27966 IMAGE:3594577), complete cds.
          Length = 686

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 56/191 (29%), Positives = 103/191 (53%), Gaps = 1/191 (0%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-N 687
           L+ L   +N I +I+ I +   L  L+L  N++  +  L TL +L+ L LG+NRI+ I N
Sbjct: 114 LRLLNFQHNFITRIQNISNLQRLIFLDLYDNQIEEISGLSTLKSLRVLLLGKNRIKKISN 173

Query: 686 LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANK 507
           L  LK +  + +  N++T ++ +     L  L L+ N +  ++ L+ L +L  L++  N+
Sbjct: 174 LENLKNLDVLDLHGNQITKIENVNHLCDLRVLNLARNLLSHVDNLNGLDSLTELNLRHNQ 233

Query: 506 LTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTL 327
           +T + ++ NL  L+ L+L+ NNI+S E +  +       L+ +  + NP A    Y  T+
Sbjct: 234 ITFVRDVDNLPCLQRLFLSFNNITSFESV--SCLAESTSLSDITFDGNPIAQESWYKHTV 291

Query: 326 RQIFPNIQQVD 294
            Q    ++Q+D
Sbjct: 292 LQNMMQLRQLD 302



 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 54/196 (27%), Positives = 99/196 (50%), Gaps = 1/196 (0%)
 Frame = -2

Query: 950 VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN 771
           +S  ++L+  D+  N+I   SGLS + S L+ L +  N+I KI  +E+   L +L+L  N
Sbjct: 130 ISNLQRLIFLDLYDNQIEEISGLSTLKS-LRVLLLGKNRIKKISNLENLKNLDVLDLHGN 188

Query: 770 KLRVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEE 594
           ++  +EN+  L +L+ L L RN +  + NL GL  + +++++ N++T ++ ++    L+ 
Sbjct: 189 QITKIENVNHLCDLRVLNLARNLLSHVDNLNGLDSLTELNLRHNQITFVRDVDNLPCLQR 248

Query: 593 LYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAE 414
           L+LS N I   E +S L                   A  T L D+  + N I+       
Sbjct: 249 LFLSFNNITSFESVSCL-------------------AESTSLSDITFDGNPIAQESWYKH 289

Query: 413 AVAGSLQKLTTLYLER 366
            V  ++ +L  L ++R
Sbjct: 290 TVLQNMMQLRQLDMKR 305



 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 51/158 (32%), Positives = 80/158 (50%), Gaps = 9/158 (5%)
 Frame = -2

Query: 965 EENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQIL 786
           EE SG+S  K L V  +  N I   S L  + + L  L +  NQI KIE + H  +L++L
Sbjct: 147 EEISGLSTLKSLRVLLLGKNRIKKISNLENLKN-LDVLDLHGNQITKIENVNHLCDLRVL 205

Query: 785 ELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKG---L 618
            L  N L  ++NL  L +L EL L  N+I  + ++  L C++++ +  N +TS +    L
Sbjct: 206 NLARNLLSHVDNLNGLDSLTELNLRHNQITFVRDVDNLPCLQRLFLSFNNITSFESVSCL 265

Query: 617 EECVALEELYLSHNGIE-----KMEGLSTLVNLRVLDV 519
            E  +L ++    N I      K   L  ++ LR LD+
Sbjct: 266 AESTSLSDITFDGNPIAQESWYKHTVLQNMMQLRQLDM 303



 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 38/113 (33%), Positives = 62/113 (54%)
 Frame = -2

Query: 680 GLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLT 501
           G + ++ ++ Q N +T ++ +     L  L L  N IE++ GLSTL +LRVL +  N++ 
Sbjct: 110 GEEHLRLLNFQHNFITRIQNISNLQRLIFLDLYDNQIEEISGLSTLKSLRVLLLGKNRIK 169

Query: 500 AISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPN 342
            ISN+ NL  L+ L L+ N I+ +E++       L  L  L L RN  ++  N
Sbjct: 170 KISNLENLKNLDVLDLHGNQITKIENV-----NHLCDLRVLNLARNLLSHVDN 217



>gb:AK049268_1168694 Mus musculus ES cells cDNA, RIKEN full-length
           enriched library, clone:C330018D03 product:hypothetical
           protein, full insert sequence.
          Length = 752

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 56/191 (29%), Positives = 103/191 (53%), Gaps = 1/191 (0%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-N 687
           L+ L   +N I +I+ I +   L  L+L  N++  +  L TL +L+ L LG+NRI+ I N
Sbjct: 180 LRLLNFQHNFITRIQNISNLQRLIFLDLYDNQIEEISGLSTLKSLRVLLLGKNRIKKISN 239

Query: 686 LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANK 507
           L  LK +  + +  N++T ++ +     L  L L+ N +  ++ L+ L +L  L++  N+
Sbjct: 240 LENLKNLDVLDLHGNQITKIENVNHLCDLRVLNLARNLLSHVDNLNGLDSLTELNLRHNQ 299

Query: 506 LTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTL 327
           +T + ++ NL  L+ L+L+ NNI+S E +  +       L+ +  + NP A    Y  T+
Sbjct: 300 ITFVRDVDNLPCLQRLFLSFNNITSFESV--SCLAESTSLSDITFDGNPIAQESWYKHTV 357

Query: 326 RQIFPNIQQVD 294
            Q    ++Q+D
Sbjct: 358 LQNMMQLRQLD 368



 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 54/196 (27%), Positives = 99/196 (50%), Gaps = 1/196 (0%)
 Frame = -2

Query: 950 VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN 771
           +S  ++L+  D+  N+I   SGLS + S L+ L +  N+I KI  +E+   L +L+L  N
Sbjct: 196 ISNLQRLIFLDLYDNQIEEISGLSTLKS-LRVLLLGKNRIKKISNLENLKNLDVLDLHGN 254

Query: 770 KLRVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEE 594
           ++  +EN+  L +L+ L L RN +  + NL GL  + +++++ N++T ++ ++    L+ 
Sbjct: 255 QITKIENVNHLCDLRVLNLARNLLSHVDNLNGLDSLTELNLRHNQITFVRDVDNLPCLQR 314

Query: 593 LYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAE 414
           L+LS N I   E +S L                   A  T L D+  + N I+       
Sbjct: 315 LFLSFNNITSFESVSCL-------------------AESTSLSDITFDGNPIAQESWYKH 355

Query: 413 AVAGSLQKLTTLYLER 366
            V  ++ +L  L ++R
Sbjct: 356 TVLQNMMQLRQLDMKR 371



 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 51/158 (32%), Positives = 80/158 (50%), Gaps = 9/158 (5%)
 Frame = -2

Query: 965 EENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQIL 786
           EE SG+S  K L V  +  N I   S L  + + L  L +  NQI KIE + H  +L++L
Sbjct: 213 EEISGLSTLKSLRVLLLGKNRIKKISNLENLKN-LDVLDLHGNQITKIENVNHLCDLRVL 271

Query: 785 ELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKG---L 618
            L  N L  ++NL  L +L EL L  N+I  + ++  L C++++ +  N +TS +    L
Sbjct: 272 NLARNLLSHVDNLNGLDSLTELNLRHNQITFVRDVDNLPCLQRLFLSFNNITSFESVSCL 331

Query: 617 EECVALEELYLSHNGIE-----KMEGLSTLVNLRVLDV 519
            E  +L ++    N I      K   L  ++ LR LD+
Sbjct: 332 AESTSLSDITFDGNPIAQESWYKHTVLQNMMQLRQLDM 369



 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 38/113 (33%), Positives = 62/113 (54%)
 Frame = -2

Query: 680 GLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLT 501
           G + ++ ++ Q N +T ++ +     L  L L  N IE++ GLSTL +LRVL +  N++ 
Sbjct: 176 GEEHLRLLNFQHNFITRIQNISNLQRLIFLDLYDNQIEEISGLSTLKSLRVLLLGKNRIK 235

Query: 500 AISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPN 342
            ISN+ NL  L+ L L+ N I+ +E++       L  L  L L RN  ++  N
Sbjct: 236 KISNLENLKNLDVLDLHGNQITKIENV-----NHLCDLRVLNLARNLLSHVDN 283



>gb:LMU25454_141654 Listeria monocytogenes F6789 internalin (inlA)
           gene, partial cds.
          Length = 344

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 64/195 (32%), Positives = 102/195 (52%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL+   ++ N+I   + L+ +++ L  L + NNQI  I+ +++   L  LEL SN +  +
Sbjct: 47  KLVDILMNNNQIADITPLANLTN-LTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDI 105

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
             L  LTNLQ+L LG        L  L  ++++ I SN+++ +  L +   LE L  ++N
Sbjct: 106 SALSGLTNLQQLSLGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNN 165

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L  L N   L ++ N+L  I  +A+LT L DL L +N IS++     A    L
Sbjct: 166 QISDITPLGILTNWDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNL-----APLRGL 220

Query: 395 QKLTTLYLERNPCAN 351
            KLT L L  N  +N
Sbjct: 221 TKLTELKLGANQISN 235



 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 60/206 (29%), Positives = 105/206 (50%), Gaps = 23/206 (11%)
 Frame = -2

Query: 920 DVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQT 741
           D+S N+++  S L+K+++ L+ L  +NNQI+ I  +        L L  N+L+ +  L +
Sbjct: 139 DISSNKVSDISVLAKLTN-LESLIATNNQISDITPLGILTNWDELSLNGNQLKDIGTLAS 197

Query: 740 LTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEK 564
           LTNL +L L  N+I  +  L GL  + ++ + +N+++++  L    AL  L L+ N +E 
Sbjct: 198 LTNLTDLDLANNQISNLAPLRGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLED 257

Query: 563 MEGLSTLVNLRVL--------DVSA--------------NKLTAISNIANLTKLEDLWLN 450
           +  +S L NL  L        D+S               NK++ +S++ANLT +  L   
Sbjct: 258 ISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAG 317

Query: 449 DNNISSVEDIAEAVAGSLQKLTTLYL 372
            N IS +  +A     +L ++T L L
Sbjct: 318 HNQISDLTPLA-----NLTRITQLGL 338



 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 50/159 (31%), Positives = 87/159 (54%), Gaps = 1/159 (0%)
 Frame = -2

Query: 902 ITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQE 723
           I S  GL  +++ L ++  SNNQ+  I  ++   +L  + + +N++  +  L  LTNL  
Sbjct: 14  IKSIDGLEYLNN-LTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLANLTNLTG 72

Query: 722 LWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLST 546
           L L  N+I  I+ L  L  + ++ + SN ++ +  L     L++L L  N +  ++ L+ 
Sbjct: 73  LTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTNLQQLSLG-NQVTDLKPLAN 131

Query: 545 LVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV 429
           L  L  LD+S+NK++ IS +A LT LE L   +N IS +
Sbjct: 132 LTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDI 170



 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 38/142 (26%), Positives = 78/142 (54%), Gaps = 1/142 (0%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L +L ++NNQI+ +  +    +L  L+LG+N++  +  L  LT L  L L  N++  I
Sbjct: 199 TNLTDLDLANNQISNLAPLRGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDI 258

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + +  LK +  +++  N ++ +  +     L+ L+  +N +  +  L+ L N+  L    
Sbjct: 259 SPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGH 318

Query: 512 NKLTAISNIANLTKLEDLWLND 447
           N+++ ++ +ANLT++  L LND
Sbjct: 319 NQISDLTPLANLTRITQLGLND 340



 Score = 45.4 bits (106), Expect = 0.003
 Identities = 27/71 (38%), Positives = 43/71 (60%)
 Frame = -2

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
           GI+ ++GL  L NL  ++ S N+LT I+ + +LTKL D+ +N+N I+ +  +A     +L
Sbjct: 13  GIKSIDGLEYLNNLTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLA-----NL 67

Query: 395 QKLTTLYLERN 363
             LT L L  N
Sbjct: 68  TNLTGLTLFNN 78



>gb:LMU25451_141651 Listeria monocytogenes F4233 internalin (inlA)
           gene, partial cds.
          Length = 344

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 64/195 (32%), Positives = 102/195 (52%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL+   ++ N+I   + L+ +++ L  L + NNQI  I+ +++   L  LEL SN +  +
Sbjct: 47  KLVDILMNNNQIADITPLANLTN-LTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDI 105

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
             L  LTNLQ+L LG        L  L  ++++ I SN+++ +  L +   LE L  ++N
Sbjct: 106 SALSGLTNLQQLSLGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNN 165

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L  L N   L ++ N+L  I  +A+LT L DL L +N IS++     A    L
Sbjct: 166 QISDITPLGILTNWDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNL-----APLPGL 220

Query: 395 QKLTTLYLERNPCAN 351
            KLT L L  N  +N
Sbjct: 221 TKLTELKLGANQISN 235



 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 60/206 (29%), Positives = 105/206 (50%), Gaps = 23/206 (11%)
 Frame = -2

Query: 920 DVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQT 741
           D+S N+++  S L+K+++ L+ L  +NNQI+ I  +        L L  N+L+ +  L +
Sbjct: 139 DISSNKVSDISVLAKLTN-LESLIATNNQISDITPLGILTNWDELSLNGNQLKDIGTLAS 197

Query: 740 LTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEK 564
           LTNL +L L  N+I  +  L GL  + ++ + +N+++++  L    AL  L L+ N +E 
Sbjct: 198 LTNLTDLDLANNQISNLAPLPGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLED 257

Query: 563 MEGLSTLVNLRVL--------DVSA--------------NKLTAISNIANLTKLEDLWLN 450
           +  +S L NL  L        D+S               NK++ +S++ANLT +  L   
Sbjct: 258 ISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAG 317

Query: 449 DNNISSVEDIAEAVAGSLQKLTTLYL 372
            N IS +  +A     +L ++T L L
Sbjct: 318 HNQISDLTPLA-----NLTRITQLGL 338



 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 50/159 (31%), Positives = 87/159 (54%), Gaps = 1/159 (0%)
 Frame = -2

Query: 902 ITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQE 723
           I S  GL  +++ L ++  SNNQ+  I  ++   +L  + + +N++  +  L  LTNL  
Sbjct: 14  IKSIDGLEYLNN-LTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLANLTNLTG 72

Query: 722 LWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLST 546
           L L  N+I  I+ L  L  + ++ + SN ++ +  L     L++L L  N +  ++ L+ 
Sbjct: 73  LTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTNLQQLSLG-NQVTDLKPLAN 131

Query: 545 LVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV 429
           L  L  LD+S+NK++ IS +A LT LE L   +N IS +
Sbjct: 132 LTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDI 170



 Score = 45.4 bits (106), Expect = 0.003
 Identities = 27/71 (38%), Positives = 43/71 (60%)
 Frame = -2

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
           GI+ ++GL  L NL  ++ S N+LT I+ + +LTKL D+ +N+N I+ +  +A     +L
Sbjct: 13  GIKSIDGLEYLNNLTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLA-----NL 67

Query: 395 QKLTTLYLERN 363
             LT L L  N
Sbjct: 68  TNLTGLTLFNN 78



>gb:AJ784777_532443 Listeria monocytogenes partial inlA gene for
           internalin A, strain PP1.
          Length = 773

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 63/195 (32%), Positives = 102/195 (52%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL+   ++ N+I   + L+ +++ L  L + NNQI  I+ +++   L  LEL SN +  +
Sbjct: 94  KLVDILMNNNQIADITPLANLTN-LTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDI 152

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
             L  LTNLQ+L  G        L  L  ++++ I SN+++ +  L +   LE L  ++N
Sbjct: 153 SALSGLTNLQQLSFGNQVTDLKPLANLTSLERLDISSNKVSDISVLAKLTNLESLIATNN 212

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L  L NL  L ++ N+L  I  +A+LT L DL L ++ IS++     A    L
Sbjct: 213 QISDITPLGILANLDELSLNGNQLKDIGTLASLTNLTDLDLANDQISNL-----APLSGL 267

Query: 395 QKLTTLYLERNPCAN 351
            KLT L L  N  +N
Sbjct: 268 TKLTELKLGANQISN 282



 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 55/181 (30%), Positives = 94/181 (51%), Gaps = 1/181 (0%)
 Frame = -2

Query: 902 ITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQE 723
           I S  GL  +++ L ++  SNNQ+  I  ++   +L  + + +N++  +  L  LTNL  
Sbjct: 61  IKSIDGLEYLNN-LTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLANLTNLTG 119

Query: 722 LWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLST 546
           L L  N+I  I+ L  L  + ++ + SN ++ +  L     L++L    N +  ++ L+ 
Sbjct: 120 LTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTNLQQLSFG-NQVTDLKPLAN 178

Query: 545 LVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLER 366
           L +L  LD+S+NK++ IS +A LT LE L   +N IS +  +     G L  L  L L  
Sbjct: 179 LTSLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPL-----GILANLDELSLNG 233

Query: 365 N 363
           N
Sbjct: 234 N 234



 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 49/202 (24%), Positives = 100/202 (49%), Gaps = 17/202 (8%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L +L ++N+QI+ +  +    +L  L+LG+N++  +  L  LT L  L L  N++  I
Sbjct: 246 TNLTDLDLANDQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDI 305

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + +  LK +  +++  N ++ +  +     L+ L+  +N +  +  L+ L N+  L    
Sbjct: 306 SPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGH 365

Query: 512 NKLTAISNIANLTKLEDLWLNDN-----------NISSVEDIAEAVAGSLQKLTTL---- 378
           N+++ ++ +ANLT++  L LND            N+ S+ +  + V G+L    T+    
Sbjct: 366 NQISDLTPLANLTRITQLGLNDQAWTNPPVNYKVNV-SIPNTVKNVTGALIAPATISDGG 424

Query: 377 -YLERNPCANSPNYISTLRQIF 315
            Y E +   N P+Y + +   F
Sbjct: 425 SYAELDITWNLPSYTNEVSYTF 446



 Score = 45.4 bits (106), Expect = 0.003
 Identities = 27/71 (38%), Positives = 43/71 (60%)
 Frame = -2

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
           GI+ ++GL  L NL  ++ S N+LT I+ + +LTKL D+ +N+N I+ +  +A     +L
Sbjct: 60  GIKSIDGLEYLNNLTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLA-----NL 114

Query: 395 QKLTTLYLERN 363
             LT L L  N
Sbjct: 115 TNLTGLTLFNN 125



>gb:AF497155_516445 Listeria monocytogenes strain FSLJ1022
           internalin A precursor (inlA) gene, complete
           cds.>gb:AF497157_516447 Listeria monocytogenes strain
           FSLj1047 internalin A precursor (inlA) gene, complete
           cds.
          Length = 744

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 63/195 (32%), Positives = 102/195 (52%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL+   ++ N+I   + L+ +++ L  L + NNQI  I+ +++   L  LEL SN +  +
Sbjct: 65  KLVDILMNNNQIADITPLANLTN-LTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDI 123

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
             L  LT+LQ+L  G        L  L  ++++ I SN+++ +  L +   LE L  ++N
Sbjct: 124 SALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNN 183

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L  L NL  L ++ N+L  I  +A+LT L DL L +N IS++     A    L
Sbjct: 184 QISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNL-----APLSGL 238

Query: 395 QKLTTLYLERNPCAN 351
            KLT L L  N  +N
Sbjct: 239 TKLTELKLGANQISN 253



 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 51/170 (30%), Positives = 89/170 (52%), Gaps = 1/170 (0%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L ++  SNNQ+  I  +++  +L  + + +N++  +  L  LTNL  L L  N+I  I
Sbjct: 42  NNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDI 101

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + L  L  + ++ + SN ++ +  L    +L++L    N +  ++ L+ L  L  LD+S+
Sbjct: 102 DPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFG-NQVTDLKPLANLTTLERLDISS 160

Query: 512 NKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
           NK++ IS +A LT LE L   +N IS +  +     G L  L  L L  N
Sbjct: 161 NKVSDISVLAKLTNLESLIATNNQISDITPL-----GILTNLDELSLNGN 205



 Score = 70.5 bits (171), Expect = 7e-11
 Identities = 50/202 (24%), Positives = 100/202 (49%), Gaps = 17/202 (8%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L +L ++NNQI+ +  +    +L  L+LG+N++  +  L  LT L  L L  N++  I
Sbjct: 217 TNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDI 276

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + +  LK +  +++  N ++ +  +     L+ L+  +N +  +  L+ L N+  L    
Sbjct: 277 SPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGH 336

Query: 512 NKLTAISNIANLTKLEDLWLNDN-----------NISSVEDIAEAVAGSLQKLTTL---- 378
           N+++ ++ +ANLT++  L LND            N+ S+ +  + V G+L    T+    
Sbjct: 337 NQISDLTPLANLTRITQLGLNDQAWTNAPVNYKANV-SIPNTVKNVTGALIAPATISDGG 395

Query: 377 -YLERNPCANSPNYISTLRQIF 315
            Y E +   N P+Y + +   F
Sbjct: 396 SYTEPDITWNLPSYTNEVSYTF 417



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 27/71 (38%), Positives = 43/71 (60%)
 Frame = -2

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
           GI+ ++G+  L NL  ++ S N+LT I+ + NLTKL D+ +N+N I+ +  +A     +L
Sbjct: 31  GIKSIDGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLA-----NL 85

Query: 395 QKLTTLYLERN 363
             LT L L  N
Sbjct: 86  TNLTGLTLFNN 96



>gb:AE011492_273555 Leptospira interrogans serovar lai str. 56601
           chromosome I, section 301 of 397 of the complete
           sequence.>gb:AE010300_1006954 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete sequence.
          Length = 377

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 68/222 (30%), Positives = 121/222 (54%), Gaps = 7/222 (3%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKLR 762
           K L    + +N++T      +    L+ LY+ +N++  +  EIE    LQ+L+LGSN+L 
Sbjct: 69  KNLQRLYLHYNQLTVLPQEIEQLKNLQLLYLRSNRLTTLPNEIEQLKNLQVLDLGSNQLT 128

Query: 761 VM-ENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSMKG-LEECVALEE 594
           ++ + ++ L NLQ L+L  NR+  +  ++  L+ +K + + +N+LT++   +E+   L+ 
Sbjct: 129 ILPQEIEQLKNLQLLYLHSNRLTTLSKDIEQLQNLKSLDLSNNQLTTLPNEIEQLKNLKS 188

Query: 593 LYLSHNGIEKM-EGLSTLVNLRVLDVSANKLTAISN-IANLTKLEDLWLNDNNISSVEDI 420
           LYLS N      + +  L NL+VL ++ N++T + N IA L KL+ L+L+DN + ++   
Sbjct: 189 LYLSENQFATFPKEIGQLQNLKVLFLNNNQITILPNEIAKLKKLQYLYLSDNQLITLPKE 248

Query: 419 AEAVAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVD 294
            E     L+ L TL L  N     P  +  L     N+Q +D
Sbjct: 249 IE----QLKNLQTLDLSYNQLTILPKEVGQLE----NLQTLD 282



 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 74/219 (33%), Positives = 117/219 (53%), Gaps = 8/219 (3%)
 Frame = -2

Query: 926 VFDVSFNEI-TSPSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKLRVME 753
           V D+S  E+ T P  + K+ + L+ LY+  NQ+  + +EIE    LQ+L L SN+L  + 
Sbjct: 50  VLDLSRQELKTLPIEIGKLKN-LQRLYLHYNQLTVLPQEIEQLKNLQLLYLRSNRLTTLP 108

Query: 752 N-LQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALEELYL 585
           N ++ L NLQ L LG N++  +   +  LK ++ + + SNRLT++ K +E+   L+ L L
Sbjct: 109 NEIEQLKNLQVLDLGSNQLTILPQEIEQLKNLQLLYLHSNRLTTLSKDIEQLQNLKSLDL 168

Query: 584 SHNGIEKMEG-LSTLVNLRVLDVSANKL-TAISNIANLTKLEDLWLNDNNISSVEDIAEA 411
           S+N +  +   +  L NL+ L +S N+  T    I  L  L+ L+LN+N I+    I   
Sbjct: 169 SNNQLTTLPNEIEQLKNLKSLYLSENQFATFPKEIGQLQNLKVLFLNNNQIT----ILPN 224

Query: 410 VAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVD 294
               L+KL  LYL  N     P  I  L+    N+Q +D
Sbjct: 225 EIAKLKKLQYLYLSDNQLITLPKEIEQLK----NLQTLD 259



>gb:LMU25445_141645 Listeria monocytogenes F2365 internalin (inlA)
           gene, partial cds.
          Length = 346

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 63/195 (32%), Positives = 101/195 (51%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL+   ++ N+I   + L+ +S+ L  L + NNQI  I+ +++   L  LEL SN +  +
Sbjct: 49  KLVDILMNNNQIADITPLANLSN-LTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDI 107

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
             L  LT+LQ+L  G        L  L  ++++ I  N+++ +  L +   LE L  ++N
Sbjct: 108 SALSGLTSLQQLSFGNQVTDLXPLANLTTLERLDISXNKVSDISVLAKLTNLESLIATNN 167

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L  L NL  L ++ N+L  I  +A+LT L DL L +N IS++     A    L
Sbjct: 168 QISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNL-----APLXGL 222

Query: 395 QKLTTLYLERNPCAN 351
            KLT L L  N  +N
Sbjct: 223 TKLTELKLGANQISN 237



 Score = 74.7 bits (182), Expect(2) = 4e-15
 Identities = 61/206 (29%), Positives = 106/206 (51%), Gaps = 23/206 (11%)
 Frame = -2

Query: 920 DVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQT 741
           D+S N+++  S L+K+++ L+ L  +NNQI+ I  +     L  L L  N+L+ +  L +
Sbjct: 141 DISXNKVSDISVLAKLTN-LESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLAS 199

Query: 740 LTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEK 564
           LTNL +L L  N+I  +  L GL  + ++ + +N+++++  L    AL  L L+ N +E 
Sbjct: 200 LTNLTDLDLANNQISNLAPLXGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLED 259

Query: 563 MEGLSTLVNLRVL--------DVSA--------------NKLTAISNIANLTKLEDLWLN 450
           +  +S L NL  L        D+S               NK++ +S++ANLT +  L   
Sbjct: 260 ISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAG 319

Query: 449 DNNISSVEDIAEAVAGSLQKLTTLYL 372
            N IS +  +A     +L ++T L L
Sbjct: 320 HNQISDLTPLA-----NLTRITQLGL 340



 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 38/142 (26%), Positives = 78/142 (54%), Gaps = 1/142 (0%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L +L ++NNQI+ +  +    +L  L+LG+N++  +  L  LT L  L L  N++  I
Sbjct: 201 TNLTDLDLANNQISNLAPLXGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDI 260

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + +  LK +  +++  N ++ +  +     L+ L+  +N +  +  L+ L N+  L    
Sbjct: 261 SPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGH 320

Query: 512 NKLTAISNIANLTKLEDLWLND 447
           N+++ ++ +ANLT++  L LND
Sbjct: 321 NQISDLTPLANLTRITQLGLND 342



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 27/71 (38%), Positives = 43/71 (60%)
 Frame = -2

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
           GI+ ++GL  L NL  ++ S N+LT I+ + +LTKL D+ +N+N I+ +  +A     +L
Sbjct: 15  GIKSIDGLEYLNNLTQINFSNNQLTDITPLKDLTKLVDILMNNNQIADITPLA-----NL 69

Query: 395 QKLTTLYLERN 363
             LT L L  N
Sbjct: 70  SNLTGLTLFNN 80



 Score = 30.4 bits (67), Expect(2) = 4e-15
 Identities = 22/70 (31%), Positives = 38/70 (54%)
 Frame = -3

Query: 1123 NRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLA 944
            N+++ + P +++LSNL   +L  N ITD  ++PL +   ++ L  L L  N +  I  L+
Sbjct: 58   NQIADITP-LANLSNLTGLTLFNNQITD--IDPLKN---LTNLNRLELSSNTISDISALS 111

Query: 943  YLRNFWYLMF 914
             L +   L F
Sbjct: 112  GLTSLQQLSF 121



>sp|P25146|INLA_LISMO Internalin A precursor.>pir|AB1129|AB1129
           Internalin A [imported] - Listeria monocytogenes (strain
           EGD-e)>gb:LMO012346_141552 Listeria monocytogenes
           internalin operon; orfA, inlA, and inlB
           genes.>gb:AL591975_534925 Listeria monocytogenes strain
           EGD, complete genome, segment 3/12.
          Length = 800

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 63/195 (32%), Positives = 102/195 (52%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL+   ++ N+I   + L+ +++ L  L + NNQI  I+ +++   L  LEL SN +  +
Sbjct: 121 KLVDILMNNNQIADITPLANLTN-LTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDI 179

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
             L  LT+LQ+L  G        L  L  ++++ I SN+++ +  L +   LE L  ++N
Sbjct: 180 SALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNN 239

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L  L NL  L ++ N+L  I  +A+LT L DL L +N IS++     A    L
Sbjct: 240 QISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNL-----APLSGL 294

Query: 395 QKLTTLYLERNPCAN 351
            KLT L L  N  +N
Sbjct: 295 TKLTELKLGANQISN 309



 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 51/170 (30%), Positives = 89/170 (52%), Gaps = 1/170 (0%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L ++  SNNQ+  I  +++  +L  + + +N++  +  L  LTNL  L L  N+I  I
Sbjct: 98  NNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDI 157

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + L  L  + ++ + SN ++ +  L    +L++L    N +  ++ L+ L  L  LD+S+
Sbjct: 158 DPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFG-NQVTDLKPLANLTTLERLDISS 216

Query: 512 NKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
           NK++ IS +A LT LE L   +N IS +  +     G L  L  L L  N
Sbjct: 217 NKVSDISVLAKLTNLESLIATNNQISDITPL-----GILTNLDELSLNGN 261



 Score = 70.5 bits (171), Expect = 7e-11
 Identities = 50/202 (24%), Positives = 100/202 (49%), Gaps = 17/202 (8%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L +L ++NNQI+ +  +    +L  L+LG+N++  +  L  LT L  L L  N++  I
Sbjct: 273 TNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDI 332

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + +  LK +  +++  N ++ +  +     L+ L+  +N +  +  L+ L N+  L    
Sbjct: 333 SPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGH 392

Query: 512 NKLTAISNIANLTKLEDLWLNDN-----------NISSVEDIAEAVAGSLQKLTTL---- 378
           N+++ ++ +ANLT++  L LND            N+ S+ +  + V G+L    T+    
Sbjct: 393 NQISDLTPLANLTRITQLGLNDQAWTNAPVNYKANV-SIPNTVKNVTGALIAPATISDGG 451

Query: 377 -YLERNPCANSPNYISTLRQIF 315
            Y E +   N P+Y + +   F
Sbjct: 452 SYTEPDITWNLPSYTNEVSYTF 473



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 27/71 (38%), Positives = 43/71 (60%)
 Frame = -2

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
           GI+ ++G+  L NL  ++ S N+LT I+ + NLTKL D+ +N+N I+ +  +A     +L
Sbjct: 87  GIKSIDGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLA-----NL 141

Query: 395 QKLTTLYLERN 363
             LT L L  N
Sbjct: 142 TNLTGLTLFNN 152



>gb:CP000001_851841 Bacillus cereus ZK, complete genome.
          Length = 772

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 60/206 (29%), Positives = 106/206 (51%)
 Frame = -2

Query: 920 DVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQT 741
           D+S N+IT+ + L ++ + +K LY+S NQI  +  +    +L  L L +NK+  +  L  
Sbjct: 298 DLSNNKITNVAPLIEMKN-VKSLYLSGNQIEDVTVLAKMEQLDYLNLANNKITNVAPLSA 356

Query: 740 LTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKM 561
           L N+  L L  N+I  I       +K + +  N++  + G+E+   LEEL++  N I+ +
Sbjct: 357 LKNVTYLTLAGNQIEDIKPLYSLPLKDLVLTRNKVKDLSGIEQMKQLEELWIGKNEIKDI 416

Query: 560 EGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTT 381
             LS +  L+ L +  N+LT I+ +++L  L+ L L  N IS +       A +L+KL  
Sbjct: 417 TPLSKMTQLKELHLPNNELTDITPLSSLVNLQKLDLEANYISDL-----TPASNLKKLVF 471

Query: 380 LYLERNPCANSPNYISTLRQIFPNIQ 303
           L    N   +    I   ++ + N+Q
Sbjct: 472 LSFVANEIRDVRPVIELSKKAYINVQ 497



 Score = 54.3 bits (129), Expect = 5e-06
 Identities = 35/149 (23%), Positives = 75/149 (50%), Gaps = 1/149 (0%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN- 687
           +K L+++ N+I     +++   L+ L + + K++       L  L  L L  N    +  
Sbjct: 228 VKNLFLNTNEILDYSALKYMPNLKSLTVANAKIKDPSFFANLKQLNHLALRGNEFSDVTP 287

Query: 686 LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANK 507
           L  +  +  + + +N++T++  L E   ++ LYLS N IE +  L+ +  L  L+++ NK
Sbjct: 288 LVKMDHLDSLDLSNNKITNVAPLIEMKNVKSLYLSGNQIEDVTVLAKMEQLDYLNLANNK 347

Query: 506 LTAISNIANLTKLEDLWLNDNNISSVEDI 420
           +T ++ ++ L  +  L L  N I  ++ +
Sbjct: 348 ITNVAPLSALKNVTYLTLAGNQIEDIKPL 376



 Score = 36.2 bits (82), Expect = 1.5
 Identities = 27/89 (30%), Positives = 41/89 (46%)
 Frame = -2

Query: 617 EECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNI 438
           EE + ++ L+L+ N I     L  + NL+ L V+  K+   S  ANL +L  L L  N  
Sbjct: 223 EELLQVKNLFLNTNEILDYSALKYMPNLKSLTVANAKIKDPSFFANLKQLNHLALRGNEF 282

Query: 437 SSVEDIAEAVAGSLQKLTTLYLERNPCAN 351
           S V  + +     +  L +L L  N   N
Sbjct: 283 SDVTPLVK-----MDHLDSLDLSNNKITN 306



>gb:AY436594_617571 Listeria monocytogenes isolate F6900 internalin
           A (inlA) gene, partial cds.
          Length = 685

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 62/195 (31%), Positives = 102/195 (52%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL+   ++ N+I   + L+ +++ L  L + NNQI  ++ +++   L  LEL SN +  +
Sbjct: 65  KLVDILMNNNQIADITPLANLTN-LTGLTLFNNQITDLDPLKNLTNLNRLELSSNTISDI 123

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
             L  LT+LQ+L  G        L  L  ++++ I SN+++ +  L +   LE L  ++N
Sbjct: 124 SALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNN 183

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L  L NL  L ++ N+L  I  +A+LT L DL L +N IS++     A    L
Sbjct: 184 QISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNL-----APLSGL 238

Query: 395 QKLTTLYLERNPCAN 351
            KLT L L  N  +N
Sbjct: 239 TKLTELKLGANQISN 253



 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 50/170 (29%), Positives = 89/170 (52%), Gaps = 1/170 (0%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L ++  SNNQ+  I  +++  +L  + + +N++  +  L  LTNL  L L  N+I  +
Sbjct: 42  NNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDL 101

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + L  L  + ++ + SN ++ +  L    +L++L    N +  ++ L+ L  L  LD+S+
Sbjct: 102 DPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFG-NQVTDLKPLANLTTLERLDISS 160

Query: 512 NKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
           NK++ IS +A LT LE L   +N IS +  +     G L  L  L L  N
Sbjct: 161 NKVSDISVLAKLTNLESLIATNNQISDITPL-----GILTNLDELSLNGN 205



 Score = 70.5 bits (171), Expect = 7e-11
 Identities = 50/202 (24%), Positives = 100/202 (49%), Gaps = 17/202 (8%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L +L ++NNQI+ +  +    +L  L+LG+N++  +  L  LT L  L L  N++  I
Sbjct: 217 TNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDI 276

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + +  LK +  +++  N ++ +  +     L+ L+  +N +  +  L+ L N+  L    
Sbjct: 277 SPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGH 336

Query: 512 NKLTAISNIANLTKLEDLWLNDN-----------NISSVEDIAEAVAGSLQKLTTL---- 378
           N+++ ++ +ANLT++  L LND            N+ S+ +  + V G+L    T+    
Sbjct: 337 NQISDLTPLANLTRITQLGLNDQAWTNAPVNYKANV-SIPNTVKNVTGALIAPATISDGG 395

Query: 377 -YLERNPCANSPNYISTLRQIF 315
            Y E +   N P+Y + +   F
Sbjct: 396 SYTEPDITWNLPSYTNEVSYTF 417



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 27/71 (38%), Positives = 43/71 (60%)
 Frame = -2

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
           GI+ ++G+  L NL  ++ S N+LT I+ + NLTKL D+ +N+N I+ +  +A     +L
Sbjct: 31  GIKSIDGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLA-----NL 85

Query: 395 QKLTTLYLERN 363
             LT L L  N
Sbjct: 86  TNLTGLTLFNN 96



>gb:AY436593_617570 Listeria monocytogenes isolate J0161 internalin
           A (inlA) gene, partial cds.
          Length = 728

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 62/195 (31%), Positives = 102/195 (52%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL+   ++ N+I   + L+ +++ L  L + NNQI  ++ +++   L  LEL SN +  +
Sbjct: 65  KLVDILMNNNQIADITPLANLTN-LTGLTLFNNQITDLDPLKNLTNLNRLELSSNTISDI 123

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
             L  LT+LQ+L  G        L  L  ++++ I SN+++ +  L +   LE L  ++N
Sbjct: 124 SALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNN 183

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L  L NL  L ++ N+L  I  +A+LT L DL L +N IS++     A    L
Sbjct: 184 QISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNL-----APLSGL 238

Query: 395 QKLTTLYLERNPCAN 351
            KLT L L  N  +N
Sbjct: 239 TKLTELKLGANQISN 253



 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 50/170 (29%), Positives = 89/170 (52%), Gaps = 1/170 (0%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L ++  SNNQ+  I  +++  +L  + + +N++  +  L  LTNL  L L  N+I  +
Sbjct: 42  NNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDL 101

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + L  L  + ++ + SN ++ +  L    +L++L    N +  ++ L+ L  L  LD+S+
Sbjct: 102 DPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFG-NQVTDLKPLANLTTLERLDISS 160

Query: 512 NKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
           NK++ IS +A LT LE L   +N IS +  +     G L  L  L L  N
Sbjct: 161 NKVSDISVLAKLTNLESLIATNNQISDITPL-----GILTNLDELSLNGN 205



 Score = 70.5 bits (171), Expect = 7e-11
 Identities = 50/202 (24%), Positives = 100/202 (49%), Gaps = 17/202 (8%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L +L ++NNQI+ +  +    +L  L+LG+N++  +  L  LT L  L L  N++  I
Sbjct: 217 TNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDI 276

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + +  LK +  +++  N ++ +  +     L+ L+  +N +  +  L+ L N+  L    
Sbjct: 277 SPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGH 336

Query: 512 NKLTAISNIANLTKLEDLWLNDN-----------NISSVEDIAEAVAGSLQKLTTL---- 378
           N+++ ++ +ANLT++  L LND            N+ S+ +  + V G+L    T+    
Sbjct: 337 NQISDLTPLANLTRITQLGLNDQAWTNAPVNYKANV-SIPNTVKNVTGALIAPATISDGG 395

Query: 377 -YLERNPCANSPNYISTLRQIF 315
            Y E +   N P+Y + +   F
Sbjct: 396 SYTEPDITWNLPSYTNEVSYTF 417



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 27/71 (38%), Positives = 43/71 (60%)
 Frame = -2

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
           GI+ ++G+  L NL  ++ S N+LT I+ + NLTKL D+ +N+N I+ +  +A     +L
Sbjct: 31  GIKSIDGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLA-----NL 85

Query: 395 QKLTTLYLERN 363
             LT L L  N
Sbjct: 86  TNLTGLTLFNN 96



>gb:AF497160_516450 Listeria monocytogenes strain FSLj2017
           internalin A precursor (inlA) gene, complete cds.
          Length = 744

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 62/195 (31%), Positives = 102/195 (52%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL+   ++ N+I   + L+ +++ L  L + NNQI  ++ +++   L  LEL SN +  +
Sbjct: 65  KLVDILMNNNQIADITPLANLTN-LTGLTLFNNQITDLDPLKNLTNLNRLELSSNTISDI 123

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
             L  LT+LQ+L  G        L  L  ++++ I SN+++ +  L +   LE L  ++N
Sbjct: 124 SALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNN 183

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L  L NL  L ++ N+L  I  +A+LT L DL L +N IS++     A    L
Sbjct: 184 QISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNL-----APLSGL 238

Query: 395 QKLTTLYLERNPCAN 351
            KLT L L  N  +N
Sbjct: 239 TKLTELKLGANQISN 253



 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 50/170 (29%), Positives = 89/170 (52%), Gaps = 1/170 (0%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L ++  SNNQ+  I  +++  +L  + + +N++  +  L  LTNL  L L  N+I  +
Sbjct: 42  NNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDL 101

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + L  L  + ++ + SN ++ +  L    +L++L    N +  ++ L+ L  L  LD+S+
Sbjct: 102 DPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFG-NQVTDLKPLANLTTLERLDISS 160

Query: 512 NKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
           NK++ IS +A LT LE L   +N IS +  +     G L  L  L L  N
Sbjct: 161 NKVSDISVLAKLTNLESLIATNNQISDITPL-----GILTNLDELSLNGN 205



 Score = 70.5 bits (171), Expect = 7e-11
 Identities = 50/202 (24%), Positives = 100/202 (49%), Gaps = 17/202 (8%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L +L ++NNQI+ +  +    +L  L+LG+N++  +  L  LT L  L L  N++  I
Sbjct: 217 TNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDI 276

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + +  LK +  +++  N ++ +  +     L+ L+  +N +  +  L+ L N+  L    
Sbjct: 277 SPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGH 336

Query: 512 NKLTAISNIANLTKLEDLWLNDN-----------NISSVEDIAEAVAGSLQKLTTL---- 378
           N+++ ++ +ANLT++  L LND            N+ S+ +  + V G+L    T+    
Sbjct: 337 NQISDLTPLANLTRITQLGLNDQAWTNAPVNYKANV-SIPNTVKNVTGALIAPATISDGG 395

Query: 377 -YLERNPCANSPNYISTLRQIF 315
            Y E +   N P+Y + +   F
Sbjct: 396 SYAEPDITWNLPSYTNEVSYTF 417



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 27/71 (38%), Positives = 43/71 (60%)
 Frame = -2

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
           GI+ ++G+  L NL  ++ S N+LT I+ + NLTKL D+ +N+N I+ +  +A     +L
Sbjct: 31  GIKSIDGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLA-----NL 85

Query: 395 QKLTTLYLERN 363
             LT L L  N
Sbjct: 86  TNLTGLTLFNN 96



>gb:AF497159_516449 Listeria monocytogenes strain FSLj2003
           internalin A precursor (inlA) gene, complete cds.
          Length = 741

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 62/195 (31%), Positives = 102/195 (52%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL+   ++ N+I   + L+ +++ L  L + NNQI  ++ +++   L  LEL SN +  +
Sbjct: 65  KLVDILMNNNQIADITPLANLTN-LTGLTLFNNQITDLDPLKNLTNLNRLELSSNTISDI 123

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
             L  LT+LQ+L  G        L  L  ++++ I SN+++ +  L +   LE L  ++N
Sbjct: 124 SALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNN 183

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L  L NL  L ++ N+L  I  +A+LT L DL L +N IS++     A    L
Sbjct: 184 QISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNL-----APLSGL 238

Query: 395 QKLTTLYLERNPCAN 351
            KLT L L  N  +N
Sbjct: 239 TKLTELKLGANQISN 253



 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 50/170 (29%), Positives = 89/170 (52%), Gaps = 1/170 (0%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L ++  SNNQ+  I  +++  +L  + + +N++  +  L  LTNL  L L  N+I  +
Sbjct: 42  NNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDL 101

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + L  L  + ++ + SN ++ +  L    +L++L    N +  ++ L+ L  L  LD+S+
Sbjct: 102 DPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFG-NQVTDLKPLANLTTLERLDISS 160

Query: 512 NKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
           NK++ IS +A LT LE L   +N IS +  +     G L  L  L L  N
Sbjct: 161 NKVSDISVLAKLTNLESLIATNNQISDITPL-----GILTNLDELSLNGN 205



 Score = 70.5 bits (171), Expect = 7e-11
 Identities = 50/202 (24%), Positives = 100/202 (49%), Gaps = 17/202 (8%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L +L ++NNQI+ +  +    +L  L+LG+N++  +  L  LT L  L L  N++  I
Sbjct: 217 TNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDI 276

Query: 689 N-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + +  LK +  +++  N ++ +  +     L+ L+  +N +  +  L+ L N+  L    
Sbjct: 277 SPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGH 336

Query: 512 NKLTAISNIANLTKLEDLWLNDN-----------NISSVEDIAEAVAGSLQKLTTL---- 378
           N+++ ++ +ANLT++  L LND            N+ S+ +  + V G+L    T+    
Sbjct: 337 NQISDLTPLANLTRITQLGLNDQAWTNAPVNYKANV-SIPNTVKNVTGALIAPATISDGG 395

Query: 377 -YLERNPCANSPNYISTLRQIF 315
            Y E +   N P+Y + +   F
Sbjct: 396 SYTEPDITWNLPSYTNEVSYTF 417



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 27/71 (38%), Positives = 43/71 (60%)
 Frame = -2

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
           GI+ ++G+  L NL  ++ S N+LT I+ + NLTKL D+ +N+N I+ +  +A     +L
Sbjct: 31  GIKSIDGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLA-----NL 85

Query: 395 QKLTTLYLERN 363
             LT L L  N
Sbjct: 86  TNLTGLTLFNN 96



>gb:AF250284_2221604 Amsacta moorei entomopoxvirus, complete genome.
          Length = 350

 Score = 83.6 bits (205), Expect = 8e-15
 Identities = 58/208 (27%), Positives = 104/208 (50%), Gaps = 7/208 (3%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL+  + S + I S +G+  + + L+ELY  N +I  ++EIE+   L+ L   + K+  +
Sbjct: 117 KLIKLNCSSSRINSLNGIKNIIN-LRELYCYNTKINSLKEIENTTNLRKLYCHNTKINSL 175

Query: 755 ENLQTLTNLQELWLGRNRIRA-------INLCGLKCIKKISIQSNRLTSMKGLEECVALE 597
           + ++ L NL+EL+     I +       INL  L C       +  + S+ G+E  + L 
Sbjct: 176 KEIKNLINLRELYCFNTNIDSLIGIENFINLRELYCF------NTNIDSLIGIENLINLR 229

Query: 596 ELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA 417
           EL   +  I  + G++ L+NL+ LD +  K+ ++  I NL  L +L+  D  I ++ +I 
Sbjct: 230 ELCCFNTNIYSLSGINNLINLKKLDCNNTKINSLKEIKNLINLRELYCFDTKIDTLLEIK 289

Query: 416 EAVAGSLQKLTTLYLERNPCANSPNYIS 333
             +  +L+KL   Y   N      N I+
Sbjct: 290 NLI--NLEKLNCSYTNINSLTGIENLIN 315



 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 49/188 (26%), Positives = 90/188 (47%), Gaps = 4/188 (2%)
 Frame = -2

Query: 971 SAEENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQ 792
           S +E    +  +KL   +   N +     L      L+ELY  N  I  +  IE+F  L+
Sbjct: 152 SLKEIENTTNLRKLYCHNTKINSLKEIKNLIN----LRELYCFNTNIDSLIGIENFINLR 207

Query: 791 ILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLE 615
            L   +  +  +  ++ L NL+EL      I +++ +  L  +KK+   + ++ S+K ++
Sbjct: 208 ELYCFNTNIDSLIGIENLINLRELCCFNTNIYSLSGINNLINLKKLDCNNTKINSLKEIK 267

Query: 614 ECVALEELYLSHNGIEKMEGLSTLVNLRVLDVS---ANKLTAISNIANLTKLEDLWLNDN 444
             + L ELY     I+ +  +  L+NL  L+ S    N LT I N+ NL KL   + N N
Sbjct: 268 NLINLRELYCFDTKIDTLLEIKNLINLEKLNCSYTNINSLTGIENLINLKKLNCSYTNIN 327

Query: 443 NISSVEDI 420
           ++  ++++
Sbjct: 328 SLYEIKNL 335



 Score = 48.1 bits (113), Expect = 4e-04
 Identities = 28/114 (24%), Positives = 58/114 (50%), Gaps = 1/114 (0%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-N 687
           L+EL   N  I  +  I +   L+ L+  + K+  ++ ++ L NL+EL+    +I  +  
Sbjct: 228 LRELCCFNTNIYSLSGINNLINLKKLDCNNTKINSLKEIKNLINLRELYCFDTKIDTLLE 287

Query: 686 LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVL 525
           +  L  ++K++     + S+ G+E  + L++L  S+  I  +  +  L+NL  L
Sbjct: 288 IKNLINLEKLNCSYTNINSLTGIENLINLKKLNCSYTNINSLYEIKNLINLEEL 341



 Score = 39.3 bits (90), Expect = 0.18
 Identities = 28/106 (26%), Positives = 57/106 (53%), Gaps = 1/106 (0%)
 Frame = -2

Query: 902 ITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQE 723
           I S SG++ + + LK+L  +N +I  ++EI++   L+ L     K+  +  ++ L NL++
Sbjct: 238 IYSLSGINNLIN-LKKLDCNNTKINSLKEIKNLINLRELYCFDTKIDTLLEIKNLINLEK 296

Query: 722 LWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELY 588
           L      I ++  +  L  +KK++     + S+  ++  + LEELY
Sbjct: 297 LNCSYTNINSLTGIENLINLKKLNCSYTNINSLYEIKNLINLEELY 342



>gb:AE017269_422672 Bacillus cereus ATCC 10987, section 6 of 18 of
           the complete genome.>gb:AE017194_1061091 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 755

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 59/206 (28%), Positives = 104/206 (50%)
 Frame = -2

Query: 920 DVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQT 741
           D+S N+IT+ + L ++ + +K LY+S NQI  +  +    +L  L L +NK+  +  L  
Sbjct: 287 DLSNNKITNVAPLIEMKN-VKSLYLSGNQIEDVTALAKMEQLDYLNLANNKITNVTPLSA 345

Query: 740 LTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKM 561
           L N+  L L  N+I  I       +K + +  N++  + G+E+   LEEL++  N I+ +
Sbjct: 346 LKNVTYLTLAGNQIEDIKPLYSLPLKDLVLTRNKVKDLSGIEQMKQLEELWIGKNEIKDV 405

Query: 560 EGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTT 381
             LS +  L+ L +  N+L  I+ +++L  L+ L L  N IS +       A +L+KL  
Sbjct: 406 TPLSKMTQLKQLHLPNNELKDITPLSSLVNLQKLDLEANYISDL-----TPASNLKKLVF 460

Query: 380 LYLERNPCANSPNYISTLRQIFPNIQ 303
           L    N   +    I   +  + N+Q
Sbjct: 461 LSFVANEIRDVRPVIELSKTAYINVQ 486



 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 34/149 (22%), Positives = 78/149 (52%), Gaps = 1/149 (0%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN- 687
           +K+L+++ N+I     +++   L+ L + + K++      +L  L+ L L  N    +  
Sbjct: 217 VKDLFLNTNEILDYSALKYMPNLKSLTVANAKIKDPSFFTSLKQLKHLALRGNEFSDVTP 276

Query: 686 LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANK 507
           +  +  +  + + +N++T++  L E   ++ LYLS N IE +  L+ +  L  L+++ NK
Sbjct: 277 IVKMDNLDSLDLSNNKITNVAPLIEMKNVKSLYLSGNQIEDVTALAKMEQLDYLNLANNK 336

Query: 506 LTAISNIANLTKLEDLWLNDNNISSVEDI 420
           +T ++ ++ L  +  L L  N I  ++ +
Sbjct: 337 ITNVTPLSALKNVTYLTLAGNQIEDIKPL 365



>gb:AE017002_376270 Bacillus cereus ATCC 14579 section 5 of 18 of
           the complete genome.>gb:AE016877_1016520 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 760

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 55/206 (26%), Positives = 107/206 (51%)
 Frame = -2

Query: 920 DVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQT 741
           D+S N+IT+ + L+++ + +K L++S NQI  +  +    +L  L L +NK+  +  L  
Sbjct: 292 DLSNNKITNVAPLTEMKN-VKSLFLSGNQIEDVTALAKMEQLDYLNLANNKITNVAPLSN 350

Query: 740 LTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKM 561
           L N+  L L  N+I  I       +K + +  N++  + G+++   L+EL++  N I  +
Sbjct: 351 LKNVTYLTLAGNQIEDIKPLYTLPLKDLVLTRNKVKDLSGIDQLNQLQELWIGKNEITDV 410

Query: 560 EGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTT 381
             LS +  L++L++  N+L  I+ +++L  L+ L L  N IS +  ++     +L+KL  
Sbjct: 411 TPLSKMTQLKILNLPNNELKDITPLSSLVNLQKLDLEANYISDLSPVS-----NLKKLVF 465

Query: 380 LYLERNPCANSPNYISTLRQIFPNIQ 303
           L    N   +    I   +  + N+Q
Sbjct: 466 LSFVANEIRDVRPVIELSKTAYINVQ 491



 Score = 63.5 bits (153), Expect = 9e-09
 Identities = 63/235 (26%), Positives = 110/235 (46%), Gaps = 28/235 (11%)
 Frame = -2

Query: 908 NEITSPSGLSKVSSTLKELYVSN----------------------NQIAKIEEIEHFHEL 795
           NEI   S L K    LK L V+N                      N+ A +  +     L
Sbjct: 230 NEILDYSAL-KYMPNLKSLTVANAKIKDPSFFANLKQLNHLALRGNEFADVTPLVKMDNL 288

Query: 794 QILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGL 618
           + L+L +NK+  +  L  + N++ L+L  N+I  +  L  ++ +  +++ +N++T++  L
Sbjct: 289 ESLDLSNNKITNVAPLTEMKNVKSLFLSGNQIEDVTALAKMEQLDYLNLANNKITNVAPL 348

Query: 617 EECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNI 438
                +  L L+ N IE ++ L TL  L+ L ++ NK+  +S I  L +L++LW+  N I
Sbjct: 349 SNLKNVTYLTLAGNQIEDIKPLYTL-PLKDLVLTRNKVKDLSGIDQLNQLQELWIGKNEI 407

Query: 437 SSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQIFP-----NIQQVDSE 288
           + V          L K+T L +      N PN  + L+ I P     N+Q++D E
Sbjct: 408 TDVT--------PLSKMTQLKI-----LNLPN--NELKDITPLSSLVNLQKLDLE 447



 Score = 35.0 bits (79), Expect = 3.4
 Identities = 25/89 (28%), Positives = 42/89 (47%)
 Frame = -2

Query: 617 EECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNI 438
           E+ + +++L+L+ N I     L  + NL+ L V+  K+   S  ANL +L  L L  N  
Sbjct: 217 EDLLQVKDLFLNTNEILDYSALKYMPNLKSLTVANAKIKDPSFFANLKQLNHLALRGNEF 276

Query: 437 SSVEDIAEAVAGSLQKLTTLYLERNPCAN 351
           + V  + +     +  L +L L  N   N
Sbjct: 277 ADVTPLVK-----MDNLESLDLSNNKITN 300



>gb:LMU77367_141681 Listeria monocytogenes internalin (inlF) gene,
           complete cds.
          Length = 821

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 60/203 (29%), Positives = 104/203 (51%), Gaps = 2/203 (0%)
 Frame = -2

Query: 953 GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS 774
           G+     L   +++ N+IT  S LS ++  L E+Y+ +N+I+ I  +++   +  L L  
Sbjct: 94  GLEYLTNLKFLNLNGNQITDLSPLSNLTK-LTEIYIGDNKISDISPLQNLTNVTDLYLVD 152

Query: 773 NKLRVMENLQTLTNLQELWLGRN-RIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVAL 600
           N +  +  L  LT +  L LG N  I  +N +  +  +  + +  + L  +  L +  +L
Sbjct: 153 NDISDLRPLANLTQMYSLRLGGNSNISDLNPVRNMTRLNNLEVTGSILKDLTPLADVTSL 212

Query: 599 EELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
             L LS N IE +  L+ L  L  +   +NK+T I+ + NLT+L+ L L  N I+ +  +
Sbjct: 213 TRLTLSDNQIEDLSPLAGLTKLDNIAAYSNKITDITPVTNLTRLQYLDLGSNEITDLSPV 272

Query: 419 AEAVAGSLQKLTTLYLERNPCAN 351
           A     +LQKLT+L+L  N   N
Sbjct: 273 A-----NLQKLTSLHLANNQITN 290



 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 58/232 (25%), Positives = 112/232 (48%), Gaps = 11/232 (4%)
 Frame = -2

Query: 950 VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN 771
           V+   +L + D    +++  +GL+K    L  +   +N+I  I  + +   LQ L+LGSN
Sbjct: 209 VTSLTRLTLSDNQIEDLSPLAGLTK----LDNIAAYSNKITDITPVTNLTRLQYLDLGSN 264

Query: 770 KLRVMENLQTLTNLQELWLGRNRIRAINLC-GLKCIKKISIQSNRLTSMKGLEECVALEE 594
           ++  +  +  L  L  L L  N+I  I++   L  +  + +Q+N+++ +  L+    +  
Sbjct: 265 EITDLSPVANLQKLTSLHLANNQITNISMLEDLTNLTSLGLQNNKISDISVLKNLTHVTY 324

Query: 593 LYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLE----------DLWLNDN 444
           L L +N I  ++ +  L NL  L ++ N +T IS +ANLTK++          +L  N +
Sbjct: 325 LQLGYNQIVDVKIIGGLTNLTSLQLTQNHITDISPLANLTKIQYSDFSNQMITNLERNFS 384

Query: 443 NISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSE 288
              SV +   ++ G+L    T  +  N   ++PN   +L    P ++   S+
Sbjct: 385 KTLSVPNNITSIDGTLIAPET--ISNNGTYDAPNLKWSLPNYLPEVKYTFSQ 434



 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 47/168 (27%), Positives = 78/168 (46%), Gaps = 1/168 (0%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN- 687
           L  L V+ + +  +  +     L  L L  N++  +  L  LT L  +    N+I  I  
Sbjct: 190 LNNLEVTGSILKDLTPLADVTSLTRLTLSDNQIEDLSPLAGLTKLDNIAAYSNKITDITP 249

Query: 686 LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANK 507
           +  L  ++ + + SN +T +  +     L  L+L++N I  +  L  L NL  L +  NK
Sbjct: 250 VTNLTRLQYLDLGSNEITDLSPVANLQKLTSLHLANNQITNISMLEDLTNLTSLGLQNNK 309

Query: 506 LTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
           ++ IS + NLT +  L L  N I  V+     + G L  LT+L L +N
Sbjct: 310 ISDISVLKNLTHVTYLQLGYNQIVDVK-----IIGGLTNLTSLQLTQN 352



 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 31/100 (31%), Positives = 58/100 (58%)
 Frame = -2

Query: 662 KISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIA 483
           +  +Q + +T +   EE  ++ +L +    I  +EGL  L NL+ L+++ N++T +S ++
Sbjct: 59  RAELQKSSVTDVVTKEELESISQLSVYAKKIASIEGLEYLTNLKFLNLNGNQITDLSPLS 118

Query: 482 NLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
           NLTKL ++++ DN IS +  +      +L  +T LYL  N
Sbjct: 119 NLTKLTEIYIGDNKISDISPLQ-----NLTNVTDLYLVDN 153



 Score = 57.8 bits (138), Expect = 5e-07
 Identities = 31/87 (35%), Positives = 53/87 (60%)
 Frame = -2

Query: 677 LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA 498
           L+ I ++S+ + ++ S++GLE    L+ L L+ N I  +  LS L  L  + +  NK++ 
Sbjct: 76  LESISQLSVYAKKIASIEGLEYLTNLKFLNLNGNQITDLSPLSNLTKLTEIYIGDNKISD 135

Query: 497 ISNIANLTKLEDLWLNDNNISSVEDIA 417
           IS + NLT + DL+L DN+IS +  +A
Sbjct: 136 ISPLQNLTNVTDLYLVDNDISDLRPLA 162



>gb:LMO012386_141562 Listeria monocytogenes inlG gene, partial.
          Length = 825

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 60/203 (29%), Positives = 104/203 (51%), Gaps = 2/203 (0%)
 Frame = -2

Query: 953 GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS 774
           G+     L   +++ N+IT  S LS ++  L E+Y+ +N+I+ I  +++   +  L L  
Sbjct: 94  GLEYLTNLKFLNLNGNQITDLSPLSNLTK-LTEIYIGDNKISDISPLQNLTNVTDLYLVD 152

Query: 773 NKLRVMENLQTLTNLQELWLGRN-RIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVAL 600
           N +  +  L  LT +  L LG N  I  +N +  +  +  + +  + L  +  L +  +L
Sbjct: 153 NDISDLRPLANLTQMYSLRLGGNSNISDLNPVRNMTRLNNLEVTGSILKDLTPLADVTSL 212

Query: 599 EELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
             L LS N IE +  L+ L  L  +   +NK+T I+ + NLT+L+ L L  N I+ +  +
Sbjct: 213 TRLTLSDNQIEDLSPLAGLTKLGNIAAYSNKITDITPVTNLTRLQYLDLGSNEITDLSPV 272

Query: 419 AEAVAGSLQKLTTLYLERNPCAN 351
           A     +LQKLT+L+L  N   N
Sbjct: 273 A-----NLQKLTSLHLANNQITN 290



 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 57/232 (24%), Positives = 113/232 (48%), Gaps = 11/232 (4%)
 Frame = -2

Query: 950 VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN 771
           V+   +L + D    +++  +GL+K+ +    +   +N+I  I  + +   LQ L+LGSN
Sbjct: 209 VTSLTRLTLSDNQIEDLSPLAGLTKLGN----IAAYSNKITDITPVTNLTRLQYLDLGSN 264

Query: 770 KLRVMENLQTLTNLQELWLGRNRIRAINLC-GLKCIKKISIQSNRLTSMKGLEECVALEE 594
           ++  +  +  L  L  L L  N+I  I++   L  +  + +Q+N+++ +  L+    +  
Sbjct: 265 EITDLSPVANLQKLTSLHLANNQITNISMLEDLTNLTSLGLQNNKISDISVLKNLTHVTY 324

Query: 593 LYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLE----------DLWLNDN 444
           L L +N I  ++ +  L NL  L ++ N +T IS +ANLTK++          +L  N +
Sbjct: 325 LQLGYNQIVDVKIIGGLTNLTSLQLTQNHITDISPLANLTKIQYSDFSNQMITNLERNFS 384

Query: 443 NISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSE 288
              SV +   ++ G+L    T  +  N   ++PN   +L    P ++   S+
Sbjct: 385 KTLSVPNNITSIDGTLIAPET--ISNNGTYDAPNLKWSLPNYLPEVKYTFSQ 434



 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 47/168 (27%), Positives = 78/168 (46%), Gaps = 1/168 (0%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN- 687
           L  L V+ + +  +  +     L  L L  N++  +  L  LT L  +    N+I  I  
Sbjct: 190 LNNLEVTGSILKDLTPLADVTSLTRLTLSDNQIEDLSPLAGLTKLGNIAAYSNKITDITP 249

Query: 686 LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANK 507
           +  L  ++ + + SN +T +  +     L  L+L++N I  +  L  L NL  L +  NK
Sbjct: 250 VTNLTRLQYLDLGSNEITDLSPVANLQKLTSLHLANNQITNISMLEDLTNLTSLGLQNNK 309

Query: 506 LTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
           ++ IS + NLT +  L L  N I  V+     + G L  LT+L L +N
Sbjct: 310 ISDISVLKNLTHVTYLQLGYNQIVDVK-----IIGGLTNLTSLQLTQN 352



 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 31/100 (31%), Positives = 58/100 (58%)
 Frame = -2

Query: 662 KISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIA 483
           +  +Q + +T +   EE  ++ +L +    I  +EGL  L NL+ L+++ N++T +S ++
Sbjct: 59  RAELQKSSVTDVVTKEELESISQLSVYAKKIASIEGLEYLTNLKFLNLNGNQITDLSPLS 118

Query: 482 NLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
           NLTKL ++++ DN IS +  +      +L  +T LYL  N
Sbjct: 119 NLTKLTEIYIGDNKISDISPLQ-----NLTNVTDLYLVDN 153



 Score = 57.8 bits (138), Expect = 5e-07
 Identities = 31/87 (35%), Positives = 53/87 (60%)
 Frame = -2

Query: 677 LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA 498
           L+ I ++S+ + ++ S++GLE    L+ L L+ N I  +  LS L  L  + +  NK++ 
Sbjct: 76  LESISQLSVYAKKIASIEGLEYLTNLKFLNLNGNQITDLSPLSNLTKLTEIYIGDNKISD 135

Query: 497 ISNIANLTKLEDLWLNDNNISSVEDIA 417
           IS + NLT + DL+L DN+IS +  +A
Sbjct: 136 ISPLQNLTNVTDLYLVDNDISDLRPLA 162



>pir|AB1126|AB1126 internalin, peptidoglycan bound protein (LPxTG
           motif) homolog lmo0409 [imported] - Listeria
           monocytogenes (strain EGD-e)>gb:AL591975_534901 Listeria
           monocytogenes strain EGD, complete genome, segment 3/12.
          Length = 821

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 60/203 (29%), Positives = 104/203 (51%), Gaps = 2/203 (0%)
 Frame = -2

Query: 953 GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS 774
           G+     L   +++ N+IT  S LS ++  L E+Y+ +N+I+ I  +++   +  L L  
Sbjct: 94  GLEYLTNLKFLNLNGNQITDLSPLSNLTK-LTEIYIGDNKISDISPLQNLTNVTDLYLVD 152

Query: 773 NKLRVMENLQTLTNLQELWLGRN-RIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVAL 600
           N +  +  L  LT +  L LG N  I  +N +  +  +  + +  + L  +  L +  +L
Sbjct: 153 NDISDLRPLANLTQMYSLRLGGNSNISDLNPVRNMTRLNNLEVTGSILKDLTPLADVTSL 212

Query: 599 EELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
             L LS N IE +  L+ L  L  +   +NK+T I+ + NLT+L+ L L  N I+ +  +
Sbjct: 213 TRLTLSDNQIEDLSPLAGLTKLDNIAAYSNKITDITPVTNLTRLQYLDLGSNEITDLSPV 272

Query: 419 AEAVAGSLQKLTTLYLERNPCAN 351
           A     +LQKLT+L+L  N   N
Sbjct: 273 A-----NLQKLTSLHLANNQITN 290



 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 58/232 (25%), Positives = 112/232 (48%), Gaps = 11/232 (4%)
 Frame = -2

Query: 950 VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN 771
           V+   +L + D    +++  +GL+K    L  +   +N+I  I  + +   LQ L+LGSN
Sbjct: 209 VTSLTRLTLSDNQIEDLSPLAGLTK----LDNIAAYSNKITDITPVTNLTRLQYLDLGSN 264

Query: 770 KLRVMENLQTLTNLQELWLGRNRIRAINLC-GLKCIKKISIQSNRLTSMKGLEECVALEE 594
           ++  +  +  L  L  L L  N+I  I++   L  +  + +Q+N+++ +  L+    +  
Sbjct: 265 EITDLSPVANLQKLTSLHLANNQITNISMLEDLTNLTSLGLQNNKISDISVLKNLTHVTY 324

Query: 593 LYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLE----------DLWLNDN 444
           L L +N I  ++ +  L NL  L ++ N +T IS +ANLTK++          +L  N +
Sbjct: 325 LQLGYNQIVDVKIIGGLTNLTSLQLTQNHITDISPLANLTKIQYSDFSNQMITNLERNFS 384

Query: 443 NISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSE 288
              SV +   ++ G+L    T  +  N   ++PN   +L    P ++   S+
Sbjct: 385 KTLSVPNNITSIDGTLIAPET--ISNNGTYDAPNLKWSLPNYLPEVKYTFSQ 434



 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 47/168 (27%), Positives = 78/168 (46%), Gaps = 1/168 (0%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN- 687
           L  L V+ + +  +  +     L  L L  N++  +  L  LT L  +    N+I  I  
Sbjct: 190 LNNLEVTGSILKDLTPLADVTSLTRLTLSDNQIEDLSPLAGLTKLDNIAAYSNKITDITP 249

Query: 686 LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANK 507
           +  L  ++ + + SN +T +  +     L  L+L++N I  +  L  L NL  L +  NK
Sbjct: 250 VTNLTRLQYLDLGSNEITDLSPVANLQKLTSLHLANNQITNISMLEDLTNLTSLGLQNNK 309

Query: 506 LTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
           ++ IS + NLT +  L L  N I  V+     + G L  LT+L L +N
Sbjct: 310 ISDISVLKNLTHVTYLQLGYNQIVDVK-----IIGGLTNLTSLQLTQN 352



 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 31/100 (31%), Positives = 58/100 (58%)
 Frame = -2

Query: 662 KISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIA 483
           +  +Q + +T +   EE  ++ +L +    I  +EGL  L NL+ L+++ N++T +S ++
Sbjct: 59  RAELQKSSVTDVVTKEELESISQLSVYAKKIASIEGLEYLTNLKFLNLNGNQITDLSPLS 118

Query: 482 NLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
           NLTKL ++++ DN IS +  +      +L  +T LYL  N
Sbjct: 119 NLTKLTEIYIGDNKISDISPLQ-----NLTNVTDLYLVDN 153



 Score = 57.8 bits (138), Expect = 5e-07
 Identities = 31/87 (35%), Positives = 53/87 (60%)
 Frame = -2

Query: 677 LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA 498
           L+ I ++S+ + ++ S++GLE    L+ L L+ N I  +  LS L  L  + +  NK++ 
Sbjct: 76  LESISQLSVYAKKIASIEGLEYLTNLKFLNLNGNQITDLSPLSNLTKLTEIYIGDNKISD 135

Query: 497 ISNIANLTKLEDLWLNDNNISSVEDIA 417
           IS + NLT + DL+L DN+IS +  +A
Sbjct: 136 ISPLQNLTNVTDLYLVDNDISDLRPLA 162



>gb:AE017323_442719 Listeria monocytogenes str. 4b F2365, section 2
           of 10 of the complete genome.>gb:AE017262_1075075
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 548

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 63/210 (30%), Positives = 107/210 (50%), Gaps = 16/210 (7%)
 Frame = -2

Query: 908 NEITSPSGLSKVSSTLKE--------LYVSNNQIAKIEEIEHFHELQILELGSNKLRVME 753
           N + + +G S V+  + +        L   N  +  IE I++ + L  LEL  N++  + 
Sbjct: 55  NAVKTATGKSNVTDAVTQADLDGIATLSAFNTGVTTIEGIQYLNNLIGLELKDNQITDLT 114

Query: 752 NLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
            L+ LT + EL L  N ++ ++ + GL+ IK + + S ++T +  L     L+ LYL  N
Sbjct: 115 PLKNLTKITELELSGNPLKNVSAIAGLQSIKTLDLTSTQITDVTPLAGLSNLQVLYLDLN 174

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L+ L NL+ L +  N++  ++ +ANL+KL  L  +DN IS +  +A     SL
Sbjct: 175 QITNISPLAGLTNLQYLSIGNNQVNDLTPLANLSKLTTLRADDNKISDISPLA-----SL 229

Query: 395 QKLTTLYLERN------PCANSPN-YISTL 327
             L  ++L+ N      P AN  N +I TL
Sbjct: 230 PNLIEVHLKDNQISDVSPLANLSNLFIVTL 259



>gb:AK057348_1911992 Homo sapiens cDNA FLJ32786 fis, clone
           TESTI2002256, weakly similar to GUANYLATE KINASE (EC
           2.7.4.8).
          Length = 825

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 66/199 (33%), Positives = 98/199 (49%), Gaps = 3/199 (1%)
 Frame = -2

Query: 965 EENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQIL 786
           E+ S VS    LL  + S N +T+     K    LK+   S+NQI++I ++  +H L  L
Sbjct: 162 EDLSCVSCMPYLLELNASQNNLTTFFNF-KPPKNLKKADFSHNQISEICDLSAYHALTKL 220

Query: 785 ELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECV 606
            L  N++  +  L+   NL  L L  N+I  IN      IK + + +N++  + GLE+  
Sbjct: 221 ILDGNEIEEISGLEMCNNLIHLSLANNKITTINGLNKLPIKILCLSNNQIEMITGLEDLK 280

Query: 605 ALEELYLSHNGIEKMEGLSTLVNLRVLDVSANK---LTAISNIANLTKLEDLWLNDNNIS 435
           AL+ L LSHN I  ++GL     L V+++  NK   L  I  I NL  L  L L +N I 
Sbjct: 281 ALQNLDLSHNQISSLQGLENHDLLEVINLEDNKIAELREIEYIKNLPILRVLNLLENPIQ 340

Query: 434 SVEDIAEAVAGSLQKLTTL 378
              +    V   L +LT L
Sbjct: 341 EKSEYWFFVIFMLLRLTEL 359



>gb:AE017290_433051 Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130, chromosome I, section 4 of 14 of the
           complete sequence.>gb:AE016823_1066062 Leptospira
           interrogans serovar Copenhageni str. Fiocruz L1-130,
           chromosome I, complete sequence.
          Length = 378

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 66/215 (30%), Positives = 120/215 (55%), Gaps = 8/215 (3%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKIE-EIEHFHELQILELGSNKL 765
           K L    +++N++T+ P  + ++ S L +LY+SNNQ+  +  EI     LQ L L +N+L
Sbjct: 93  KNLQELFLNYNQLTTFPKEIEQLKS-LHKLYLSNNQLTILPVEIGQLQNLQELNLWNNQL 151

Query: 764 R-VMENLQTLTNLQELWLGRNRIRAIN--LCGLKCIKKISIQSNRLTSM-KGLEECVALE 597
           + + + ++ L NLQ+L+L  N++ A++  +  L+ +K + + +N+LT+  K + +   L+
Sbjct: 152 KTISKEIEQLKNLQKLYLDNNQLTALSKEIGKLQNLKSLFLSNNQLTTFPKEIGKLQNLQ 211

Query: 596 ELYLSHNGIEKM-EGLSTLVNLRVLDVSANKLTAISN-IANLTKLEDLWLNDNNISSVED 423
           ELYLS+N +    + +  L  L+ L +  N+LT I N I  L KL++L L+ N ++++  
Sbjct: 212 ELYLSNNQLTTFPKEIGKLQKLQWLGLGDNQLTTIPNEIGKLQKLQELNLDVNQLTTI-- 269

Query: 422 IAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQI 318
                 G LQ L  L+L  N     P     L+ +
Sbjct: 270 --PKEIGQLQNLQVLFLSYNQFKTIPVEFGQLKNL 302



 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 63/209 (30%), Positives = 109/209 (52%), Gaps = 7/209 (3%)
 Frame = -2

Query: 908 NEITSPSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKLRVM-ENLQTLT 735
           N++T+ S        LK L++SNNQ+    +EI     LQ L L +N+L    + +  L 
Sbjct: 172 NQLTALSKEIGKLQNLKSLFLSNNQLTTFPKEIGKLQNLQELYLSNNQLTTFPKEIGKLQ 231

Query: 734 NLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALEELYLSHNGIEK 564
            LQ L LG N++  I   +  L+ ++++++  N+LT++ K + +   L+ L+LS+N  + 
Sbjct: 232 KLQWLGLGDNQLTTIPNEIGKLQKLQELNLDVNQLTTIPKEIGQLQNLQVLFLSYNQFKT 291

Query: 563 ME-GLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQK 390
           +      L NL++L + AN+LTA+   I  L  L+ L L+ N ++++        G LQ 
Sbjct: 292 IPVEFGQLKNLKMLSLDANQLTALPKEIGKLKNLKMLNLDANQLTTI----PKEIGQLQN 347

Query: 389 LTTLYLERNPCANSPNYISTLRQIFPNIQ 303
           L TLYL  N  +        +R++ P  Q
Sbjct: 348 LQTLYLRNNQFSIEEK--ERIRKLLPKCQ 374



>gb:AE015937_319705 Clostridium tetani E88, section 2 of 10 of the
           complete genome.>gb:AE015927_962494 Clostridium tetani
           E88, complete genome.
          Length = 871

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 57/195 (29%), Positives = 99/195 (50%), Gaps = 24/195 (12%)
 Frame = -2

Query: 926 VFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENL 747
           + D+S   I+   G+ ++   LKEL +SNN+I  +E +E    L+ L L  NK+  +E L
Sbjct: 398 ILDLSGFNISKIDGI-QLFEGLKELNLSNNKIKNLEPLEDMFYLESLNLSENKVEDLEPL 456

Query: 746 QTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN-- 576
           + L +L  L L  N +R ++ L  L+ +K +++  N ++ ++  ++   L  L LSHN  
Sbjct: 457 EELRSLNYLNLNNNNVRYVDSLKKLEYLKYLNLGKNDISYIEDFKDLTYLYYLDLSHNNN 516

Query: 575 ---------------------GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDL 459
                                GI  +  L  L  L  LD++ N ++ + ++  L  L+ L
Sbjct: 517 IGGLSDLSDLKNLTTLKLSNTGISSLGFLEDLKRLTELDLAKNSISNLDSLKKLDNLKTL 576

Query: 458 WLNDNNISSVEDIAE 414
           +LNDNNIS +ED+ +
Sbjct: 577 YLNDNNISYIEDLKD 591



 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 59/214 (27%), Positives = 106/214 (49%), Gaps = 24/214 (11%)
 Frame = -2

Query: 953  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS 774
            G+ +F+ L   ++S N+I +   L  +   L+ L +S N++  +E +E    L  L L +
Sbjct: 411  GIQLFEGLKELNLSNNKIKNLEPLEDMFY-LESLNLSENKVEDLEPLEELRSLNYLNLNN 469

Query: 773  NKLRVMENLQTLTNLQELWLGRNRIRAI------------------------NLCGLKCI 666
            N +R +++L+ L  L+ L LG+N I  I                        +L  LK +
Sbjct: 470  NNVRYVDSLKKLEYLKYLNLGKNDISYIEDFKDLTYLYYLDLSHNNNIGGLSDLSDLKNL 529

Query: 665  KKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNI 486
              + + +  ++S+  LE+   L EL L+ N I  ++ L  L NL+ L ++ N ++ I ++
Sbjct: 530  TTLKLSNTGISSLGFLEDLKRLTELDLAKNSISNLDSLKKLDNLKTLYLNDNNISYIEDL 589

Query: 485  ANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLT 384
             +L  LE+L +  NNI  VE   +    +L+KLT
Sbjct: 590  KDLKDLEELNVWGNNIKDVEKFKK--FKTLRKLT 621



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 38/162 (23%), Positives = 78/162 (48%)
 Frame = -2

Query: 848 VSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKC 669
           +S N +  I  +++  + +I     N  R +     +TN  E  + ++++R + +     
Sbjct: 347 ISENYVNNI--VDYIEDEEIKFKDGNMERAVREKLGITNENER-IYKSKVRDVKI----- 398

Query: 668 IKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISN 489
              + +    ++ + G++    L+EL LS+N I+ +E L  +  L  L++S NK+  +  
Sbjct: 399 ---LDLSGFNISKIDGIQLFEGLKELNLSNNKIKNLEPLEDMFYLESLNLSENKVEDLEP 455

Query: 488 IANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
           +  L  L  L LN+NN+  V+ + +     L+ L  L L +N
Sbjct: 456 LEELRSLNYLNLNNNNVRYVDSLKK-----LEYLKYLNLGKN 492



>gb:AK014976_1158219 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4921528H16
           product:hypothetical RNI-like structure containing
           protein, full insert sequence.
          Length = 820

 Score = 80.9 bits (198), Expect = 5e-14
 Identities = 65/199 (32%), Positives = 102/199 (51%), Gaps = 3/199 (1%)
 Frame = -2

Query: 965 EENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQIL 786
           E+ S VS    LL  + S N++T+     K    LK++  S+N I+++ ++  +H L  L
Sbjct: 162 EDLSCVSCMPYLLELNASQNKLTTFFNF-KPPQNLKKVDFSSNLISEMYDLSAYHTLTQL 220

Query: 785 ELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECV 606
            L +N++  +  L+   +L  L L  N+I  I   G   IK +S+ +N + ++ GLEE  
Sbjct: 221 ILDNNEIEEITGLENCISLTHLSLAGNKITTIKGLGTLPIKVLSLSNNMIETITGLEELK 280

Query: 605 ALEELYLSHNGIEKMEGLSTLVNLRVLDVSANK---LTAISNIANLTKLEDLWLNDNNIS 435
           AL+ L LSHN I  ++GL     L V+++  NK   L+ I  I NL  L  L L  N I 
Sbjct: 281 ALQNLDLSHNQISSLQGLENHDLLEVINLEDNKIKELSEIEYIENLPILRVLNLLRNPIQ 340

Query: 434 SVEDIAEAVAGSLQKLTTL 378
           +  +    V   L +LT L
Sbjct: 341 TKPEYWFFVIYMLLRLTEL 359



 Score = 37.4 bits (85), Expect = 0.69
 Identities = 21/94 (22%), Positives = 45/94 (47%)
 Frame = -2

Query: 686 LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANK 507
           LCG   ++K+++  NR+  +  +     L EL  S N +          NL+ +D S+N 
Sbjct: 145 LCGYVHLQKLNLSGNRIEDLSCVSCMPYLLELNASQNKLTTFFNFKPPQNLKKVDFSSNL 204

Query: 506 LTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA 405
           ++ + +++    L  L L++N I  +  +   ++
Sbjct: 205 ISEMYDLSAYHTLTQLILDNNEIEEITGLENCIS 238



>gb:AE017355_462531 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.
          Length = 765

 Score = 80.5 bits (197), Expect = 7e-14
 Identities = 58/206 (28%), Positives = 103/206 (50%)
 Frame = -2

Query: 920 DVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQT 741
           D+S N+IT+ + L ++ + +K LY+S NQI  +  +    +L  L L +NK+  +  L  
Sbjct: 297 DLSNNKITNVAPLIEMKN-VKSLYLSGNQIEDVTALAKMEQLDYLNLANNKITNVAPLSA 355

Query: 740 LTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKM 561
           L N+  L L  N+I  I       +  + +  N++  + G+E+   LEEL++  N I+ +
Sbjct: 356 LKNVTYLTLAGNQIEDIKPLYSLPLTDLVLTRNKVKDLSGIEQMKQLEELWIGKNEIKDV 415

Query: 560 EGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTT 381
             LS +  L+ L +  N+L  I+ +++L  L+ L L  N IS +       A +L+KL  
Sbjct: 416 TPLSKMTQLKQLHLPNNELKDITPLSSLVNLQKLDLEANYISDL-----TPASNLKKLVF 470

Query: 380 LYLERNPCANSPNYISTLRQIFPNIQ 303
           L    N   +    I   +  + N+Q
Sbjct: 471 LSFVANEIRDVRPVIELSKTAYINVQ 496



 Score = 57.0 bits (136), Expect = 8e-07
 Identities = 41/168 (24%), Positives = 81/168 (48%), Gaps = 1/168 (0%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN- 687
           +K L+++ N+I     +++   L+ L + + K++       L  L  L L  N    +  
Sbjct: 227 VKNLFLNTNEILDYSALKYMPNLKSLTVANAKIKDPSFFANLKQLNHLALRGNEFSDVTP 286

Query: 686 LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANK 507
           L  +  +  + + +N++T++  L E   ++ LYLS N IE +  L+ +  L  L+++ NK
Sbjct: 287 LVKMDHLDSLDLSNNKITNVAPLIEMKNVKSLYLSGNQIEDVTALAKMEQLDYLNLANNK 346

Query: 506 LTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
           +T ++ ++ L  +  L L  N I  ++ +          LT L L RN
Sbjct: 347 ITNVAPLSALKNVTYLTLAGNQIEDIKPLYSL------PLTDLVLTRN 388



 Score = 36.2 bits (82), Expect = 1.5
 Identities = 27/89 (30%), Positives = 41/89 (46%)
 Frame = -2

Query: 617 EECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNI 438
           EE + ++ L+L+ N I     L  + NL+ L V+  K+   S  ANL +L  L L  N  
Sbjct: 222 EELLQVKNLFLNTNEILDYSALKYMPNLKSLTVANAKIKDPSFFANLKQLNHLALRGNEF 281

Query: 437 SSVEDIAEAVAGSLQKLTTLYLERNPCAN 351
           S V  + +     +  L +L L  N   N
Sbjct: 282 SDVTPLVK-----MDHLDSLDLSNNKITN 305



>gb:AE017028_381536 Bacillus anthracis str. Ames section 5 of 18 of
           the complete genome.>gb:AE017225_406642 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_451385 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE016879_1011241 Bacillus
           anthracis str. Ames complete genome.
          Length = 542

 Score = 80.5 bits (197), Expect = 7e-14
 Identities = 58/206 (28%), Positives = 103/206 (50%)
 Frame = -2

Query: 920 DVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQT 741
           D+S N+IT+ + L ++ + +K LY+S NQI  +  +    +L  L L +NK+  +  L  
Sbjct: 68  DLSNNKITNVAPLIEMKN-VKSLYLSGNQIEDVTALAKMEQLDYLNLANNKITNVAPLSA 126

Query: 740 LTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKM 561
           L N+  L L  N+I  I       +  + +  N++  + G+E+   LEEL++  N I+ +
Sbjct: 127 LKNVTYLTLAGNQIEDIKPLYSLPLTDLVLTRNKVKDLSGIEQMKQLEELWIGKNEIKDV 186

Query: 560 EGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTT 381
             LS +  L+ L +  N+L  I+ +++L  L+ L L  N IS +       A +L+KL  
Sbjct: 187 TPLSKMTQLKQLHLPNNELKDITPLSSLVNLQKLDLEANYISDL-----TPASNLKKLVF 241

Query: 380 LYLERNPCANSPNYISTLRQIFPNIQ 303
           L    N   +    I   +  + N+Q
Sbjct: 242 LSFVANEIRDVRPVIELSKTAYINVQ 267



 Score = 53.9 bits (128), Expect = 7e-06
 Identities = 39/165 (23%), Positives = 79/165 (47%), Gaps = 1/165 (0%)
 Frame = -2

Query: 854 LYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCG 678
           ++++ N+I     +++   L+ L + + K++       L  L  L L  N    +  L  
Sbjct: 1   MFLNTNEILDYSALKYMPNLKSLTVANAKIKDPSFFANLKQLNHLALRGNEFSDVTPLVK 60

Query: 677 LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA 498
           +  +  + + +N++T++  L E   ++ LYLS N IE +  L+ +  L  L+++ NK+T 
Sbjct: 61  MDHLDSLDLSNNKITNVAPLIEMKNVKSLYLSGNQIEDVTALAKMEQLDYLNLANNKITN 120

Query: 497 ISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
           ++ ++ L  +  L L  N I  ++ +          LT L L RN
Sbjct: 121 VAPLSALKNVTYLTLAGNQIEDIKPLYSL------PLTDLVLTRN 159



>gb:LIAJ4808_140496 Listeria ivanovii i-inlB, i-inlJ, i-inlI,
           i-inlH, i-inlG genes.
          Length = 1078

 Score = 69.3 bits (168), Expect(2) = 8e-14
 Identities = 53/182 (29%), Positives = 89/182 (48%), Gaps = 1/182 (0%)
 Frame = -2

Query: 956 SGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELG 777
           S ++   KL V D+S N+I     LS +   LK L + +NQ+  I  +E    L+ L   
Sbjct: 134 SALANLSKLNVLDLSNNQIKDIDALSNLVK-LKSLNLDDNQLTDISRLESLTALKELFFT 192

Query: 776 SNKLRVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVAL 600
            N++  +  L  LTNL EL   +N++  I  L  L  +  +  + N +  +  L + V L
Sbjct: 193 GNQITDIRVLSKLTNLTELVFNKNQVTNIAALSKLTNLTALGFRENNVKDIAPLVKLVKL 252

Query: 599 EELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
             L  S N ++ +  L TL  L  L    N++  IS +A L  L  L  +DN +++++ +
Sbjct: 253 TTLAFSQNQVKDISVLETLDILVYLAFDGNQVKDISVLAKLNHLAYLVFDDNQVTNIDAL 312

Query: 419 AE 414
           A+
Sbjct: 313 AK 314



 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 59/209 (28%), Positives = 99/209 (47%), Gaps = 9/209 (4%)
 Frame = -2

Query: 908 NEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNL 729
           N+IT    LSK+++ L EL  + NQ+  I  +     L  L    N ++ +  L  L  L
Sbjct: 194 NQITDIRVLSKLTN-LTELVFNKNQVTNIAALSKLTNLTALGFRENNVKDIAPLVKLVKL 252

Query: 728 QELWLGRNRIRAINLCG-LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGL 552
             L   +N+++ I++   L  +  ++   N++  +  L +   L  L    N +  ++ L
Sbjct: 253 TTLAFSQNQVKDISVLETLDILVYLAFDGNQVKDISVLAKLNHLAYLVFDDNQVTNIDAL 312

Query: 551 STLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYL 372
           + L NL  +  + N++  +S +ANLTKLE L    N I  V+ ++     SL KL  L L
Sbjct: 313 AKLPNLIGVMFNDNRVRNMSPLANLTKLEKLHAEGNYIQDVKALS-----SLTKLKELKL 367

Query: 371 ERN------PCA--NSPNYISTLRQIFPN 309
           +RN      P A  N+ + +    QIF N
Sbjct: 368 DRNCIVDISPLAGLNNLDELELSNQIFTN 396



 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 36/115 (31%), Positives = 65/115 (56%), Gaps = 1/115 (0%)
 Frame = -2

Query: 746 QTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGI 570
           Q L+++ EL+   + I++I  +  L  ++KI  Q N++  +  L   + LEE+ L+ N I
Sbjct: 71  QELSSIDELYADESWIKSIKGVQYLSNLRKIFFQKNQIKDISDLASLIKLEEVRLNGNQI 130

Query: 569 EKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA 405
             +  L+ L  L VLD+S N++  I  ++NL KL+ L L+DN ++ +  +    A
Sbjct: 131 SDISALANLSKLNVLDLSNNQIKDIDALSNLVKLKSLNLDDNQLTDISRLESLTA 185



 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 31/98 (31%), Positives = 55/98 (56%)
 Frame = -2

Query: 656 SIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANL 477
           ++    +T +   +E  +++ELY   + I+ ++G+  L NLR +    N++  IS++A+L
Sbjct: 58  TLSKKNITDVVSQQELSSIDELYADESWIKSIKGVQYLSNLRKIFFQKNQIKDISDLASL 117

Query: 476 TKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
            KLE++ LN N IS +  +A     +L KL  L L  N
Sbjct: 118 IKLEEVRLNGNQISDISALA-----NLSKLNVLDLSNN 150



 Score = 31.2 bits (69), Expect(2) = 8e-14
 Identities = 19/53 (35%), Positives = 29/53 (54%)
 Frame = -3

Query: 1096 ISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL 938
            + +LSNL K   ++N I D     +S   ++ +LEE+ L  NQ+  I  LA L
Sbjct: 92   VQYLSNLRKIFFQKNQIKD-----ISDLASLIKLEEVRLNGNQISDISALANL 139



>gb:LMU77368_141682 Listeria monocytogenes internalin (inlC2), inlD,
           and inlE genes, complete cds.
          Length = 548

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 62/210 (29%), Positives = 107/210 (50%), Gaps = 16/210 (7%)
 Frame = -2

Query: 908 NEITSPSGLSKVSSTLKE--------LYVSNNQIAKIEEIEHFHELQILELGSNKLRVME 753
           N I   +G S V+ T+ +        L      +  IE +++ + L  LEL  N++  + 
Sbjct: 55  NAIKIAAGKSNVTDTVTQADLDGITTLSAFGTGVTTIEGVQYLNNLIGLELKDNQITDLT 114

Query: 752 NLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
            L+ LT + EL L  N ++ ++ + GL+ IK + + S ++T +  L     L+ LYL  N
Sbjct: 115 PLKNLTKITELELSGNPLKNVSAIAGLQSIKTLDLTSTQITDVTPLAGLSNLQVLYLDLN 174

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L+ L NL+ L +   +++ ++ +ANL+KL  L  +DN IS +  +A     SL
Sbjct: 175 QITNISPLAGLTNLQYLSIGNAQVSDLTPLANLSKLTTLKADDNKISDISPLA-----SL 229

Query: 395 QKLTTLYLERN------PCANSPN-YISTL 327
             L  ++L+ N      P AN+ N +I TL
Sbjct: 230 PNLIEVHLKNNQISDVSPLANTSNLFIVTL 259



>gb:LMO012385_141559 Listeria monocytogenes inlF, inlD and inlE
           genes and gene encoding exhypothetical protein.
          Length = 548

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 62/210 (29%), Positives = 107/210 (50%), Gaps = 16/210 (7%)
 Frame = -2

Query: 908 NEITSPSGLSKVSSTLKE--------LYVSNNQIAKIEEIEHFHELQILELGSNKLRVME 753
           N I   +G S V+ T+ +        L      +  IE +++ + L  LEL  N++  + 
Sbjct: 55  NAIKIAAGKSNVTDTVTQADLDGITTLSAFGTGVTTIEGVQYLNNLIGLELKDNQITDLT 114

Query: 752 NLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
            L+ LT + EL L  N ++ ++ + GL+ IK + + S ++T +  L     L+ LYL  N
Sbjct: 115 PLKNLTKITELELSGNPLKNVSAIAGLQSIKTLDLTSTQITDVTPLAGLSNLQVLYLDLN 174

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L+ L NL+ L +   +++ ++ +ANL+KL  L  +DN IS +  +A     SL
Sbjct: 175 QITNISPLAGLTNLQYLSIGNAQVSDLTPLANLSKLTTLKADDNKISDISPLA-----SL 229

Query: 395 QKLTTLYLERN------PCANSPN-YISTL 327
             L  ++L+ N      P AN+ N +I TL
Sbjct: 230 PNLIEVHLKNNQISDVSPLANTSNLFIVTL 259



>pir|AH1107|AH1107 internalin H [imported] - Listeria monocytogenes
           (strain EGD-e)>gb:LMO34616_141607 Listeria monocytogenes
           ascB, inlG, inlH, inlE, dapE genes.>gb:AL591974_534755
           Listeria monocytogenes strain EGD, complete genome,
           segment 2/12.
          Length = 548

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 62/210 (29%), Positives = 107/210 (50%), Gaps = 16/210 (7%)
 Frame = -2

Query: 908 NEITSPSGLSKVSSTLKE--------LYVSNNQIAKIEEIEHFHELQILELGSNKLRVME 753
           N I   +G S V+ T+ +        L      +  IE +++ + L  LEL  N++  + 
Sbjct: 55  NAIKIAAGKSNVTDTVTQADLDGITTLSAFGTGVTTIEGVQYLNNLIGLELKDNQITDLT 114

Query: 752 NLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
            L+ LT + EL L  N ++ ++ + GL+ IK + + S ++T +  L     L+ LYL  N
Sbjct: 115 PLKNLTKITELELSGNPLKNVSAIAGLQSIKTLDLTSTQITDVTPLAGLSNLQVLYLDLN 174

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
            I  +  L+ L NL+ L +   +++ ++ +ANL+KL  L  +DN IS +  +A     SL
Sbjct: 175 QITNISPLAGLTNLQYLSIGNAQVSDLTPLANLSKLTTLKADDNKISDISPLA-----SL 229

Query: 395 QKLTTLYLERN------PCANSPN-YISTL 327
             L  ++L+ N      P AN+ N +I TL
Sbjct: 230 PNLIEVHLKNNQISDVSPLANTSNLFIVTL 259



>gb:AE017266_421841 Bacillus cereus ATCC 10987, section 3 of 18 of the
            complete genome.>gb:AE017194_1060260 Bacillus cereus ATCC
            10987, complete genome.
          Length = 1088

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 55/195 (28%), Positives = 106/195 (54%), Gaps = 3/195 (1%)
 Frame = -2

Query: 938  KKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRV 759
            K L + D     IT  SGL  +++ ++EL + N ++  ++ I +   L+ ++L SN+L  
Sbjct: 564  KSLKIVDGKNQGITDISGLEYMTN-IEELVLDNIELKNVDFISNLRSLKAVKLTSNQLEN 622

Query: 758  MENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLT--SMKGLEECVALEELY 588
            +E L  L  L+++ +  N ++ I  L  L  +K +++ +N+L   S++ +++   LE L 
Sbjct: 623  IEPLSKLDKLEKIDISDNNVKNIRPLFTLNAMKNLNVSNNKLNDASLQEIQQLKNLEVLK 682

Query: 587  LSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAV 408
            L+HN I  +E +S +  L  L++  NK+  I+ ++ L  L+ L L+DN I  +     ++
Sbjct: 683  LNHNEISNVEAISEISMLNELELVGNKVVDITPLSKLKNLQWLDLSDNKIQDI-----SI 737

Query: 407  AGSLQKLTTLYLERN 363
              S+  L +L L  N
Sbjct: 738  FASMLDLISLKLPGN 752



 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 48/160 (30%), Positives = 78/160 (48%)
 Frame = -2

Query: 950 VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN 771
           +S  KK+ V D+  NEIT    L  + S  K LY+SNN+I+ + +IE   +L++L +G+N
Sbjct: 301 LSQLKKVKVLDLIGNEITDIKPLFSMDSVTK-LYLSNNKISDLTDIEKLDDLRLLWIGNN 359

Query: 770 KLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEEL 591
            +  +  +  L NL EL +    IR                   LT +  +++   L+ L
Sbjct: 360 YIDNLTEIGKLKNLVELEVANAEIR------------------DLTPLAKMQQ---LQSL 398

Query: 590 YLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTK 471
            L  N I  +  +S L NL  L++ AN++  I  +  L K
Sbjct: 399 DLEQNYISDISPISKLNNLYALNLIANEIRDIRPVKELGK 438



 Score = 51.6 bits (122), Expect = 4e-05
 Identities = 30/114 (26%), Positives = 63/114 (55%), Gaps = 2/114 (1%)
 Frame = -2

Query: 755 ENLQTLTNLQELWLGR--NRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS 582
           +NLQ   N   L      + I   +L  +K +K +  ++  +T + GLE    +EEL L 
Sbjct: 535 KNLQKFINKNGLGRANLESSITKEDLLQIKSLKIVDGKNQGITDISGLEYMTNIEELVLD 594

Query: 581 HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
           +  ++ ++ +S L +L+ + +++N+L  I  ++ L KLE + ++DNN+ ++  +
Sbjct: 595 NIELKNVDFISNLRSLKAVKLTSNQLENIEPLSKLDKLEKIDISDNNVKNIRPL 648



 Score = 50.8 bits (120), Expect = 6e-05
 Identities = 39/167 (23%), Positives = 89/167 (53%), Gaps = 2/167 (1%)
 Frame = -2

Query: 872 SSTLKELYVSNNQ-IAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIR 696
           ++ +KEL V   + I  +E +++   L+  EL  + ++ +  + +L  L+ + L  N I 
Sbjct: 215 AAQIKELKVYLGKGIESLEGLQYMENLEAFELHESNVKDISPISSLKKLKTMKLYLNPIE 274

Query: 695 AIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDV 519
            I  +  L+ ++ ++++ N+++ +  L +   ++ L L  N I  ++ L ++ ++  L +
Sbjct: 275 NIAPISQLEKLQFLTLRDNKISDLTPLSQLKKVKVLDLIGNEITDIKPLFSMDSVTKLYL 334

Query: 518 SANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTL 378
           S NK++ +++I  L  L  LW+ +N I ++ +I     G L+ L  L
Sbjct: 335 SNNKISDLTDIEKLDDLRLLWIGNNYIDNLTEI-----GKLKNLVEL 376



>pir|E97302|E97302 hypothetical protein CAC3274 [imported] -
            Clostridium acetobutylicum>gb:AE007823_230569 Clostridium
            acetobutylicum ATCC 824 section 311 of 356 of the
            complete genome.>gb:AE001437_1093524 Clostridium
            acetobutylicum ATCC 824, complete genome.
          Length = 874

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 55/183 (30%), Positives = 95/183 (51%), Gaps = 1/183 (0%)
 Frame = -2

Query: 896  SPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELW 717
            SP G     + L+  Y + + +  + ++++   L  + L  N +  +E L++ TNL +L 
Sbjct: 614  SPLGSLTNLTLLQASYCNFSDLTPLAKMKN---LSRVSLNYNNITSIEPLKSSTNLVDLV 670

Query: 716  LGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLV 540
            L  N+I  I  +  L  ++ IS+  N++ ++  L +   L+ L L H GI  +  LS L 
Sbjct: 671  LSGNKISDITPVANLTNLESISLSYNQVNNISSLAKLTKLKSLMLDHTGISDISSLSGLT 730

Query: 539  NLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNP 360
            NL  L V  N +  I+++ NLT L +L ++ N IS+V+ I     G+L  LT L +  N 
Sbjct: 731  NLNYLGVQDNNIEDITSLKNLTNLANLKISQNKISNVDAI-----GNLTNLTLLDMNNNQ 785

Query: 359  CAN 351
             +N
Sbjct: 786  ISN 788



 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 55/204 (26%), Positives = 97/204 (47%), Gaps = 1/204 (0%)
 Frame = -2

Query: 971  SAEENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQ 792
            S ++ S +     L +   S+   +  + L+K+ + L  + ++ N I  IE ++    L 
Sbjct: 609  SIKDFSPLGSLTNLTLLQASYCNFSDLTPLAKMKN-LSRVSLNYNNITSIEPLKSSTNLV 667

Query: 791  ILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLE 615
             L L  NK+  +  +  LTNL+ + L  N++  I+ L  L  +K + +    ++ +  L 
Sbjct: 668  DLVLSGNKISDITPVANLTNLESISLSYNQVNNISSLAKLTKLKSLMLDHTGISDISSLS 727

Query: 614  ECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNIS 435
                L  L +  N IE +  L  L NL  L +S NK++ +  I NLT L  L +N+N IS
Sbjct: 728  GLTNLNYLGVQDNNIEDITSLKNLTNLANLKISQNKISNVDAIGNLTNLTLLDMNNNQIS 787

Query: 434  SVEDIAEAVAGSLQKLTTLYLERN 363
            ++  I  +      KL +L +  N
Sbjct: 788  NINAIKNST-----KLISLSMHHN 806



 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 40/161 (24%), Positives = 76/161 (47%)
 Frame = -2

Query: 902 ITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQE 723
           I S  G+ ++S+ LK+L+++   +  +  I     L+IL L  +    +  +  LTNL +
Sbjct: 521 INSLDGIEQLSN-LKQLWLNYGNVTDLTPISKLSNLKILSLNGDTDIDISPIGNLTNLNQ 579

Query: 722 LWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTL 543
           L +G ++I  IN+             N+L ++  L        +   +  I+    L +L
Sbjct: 580 LDIGESKISNINVL------------NKLNNLNYL--------ILDKNTSIKDFSPLGSL 619

Query: 542 VNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
            NL +L  S    + ++ +A +  L  + LN NNI+S+E +
Sbjct: 620 TNLTLLQASYCNFSDLTPLAKMKNLSRVSLNYNNITSIEPL 660



 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 28/97 (28%), Positives = 53/97 (54%)
 Frame = -2

Query: 653 IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLT 474
           I+   + S+ G+E+   L++L+L++  +  +  +S L NL++L ++ +    IS I NLT
Sbjct: 516 IKDTVINSLDGIEQLSNLKQLWLNYGNVTDLTPISKLSNLKILSLNGDTDIDISPIGNLT 575

Query: 473 KLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
            L  L + ++ IS++      V   L  L  L L++N
Sbjct: 576 NLNQLDIGESKISNIN-----VLNKLNNLNYLILDKN 607



 Score = 40.0 bits (92), Expect = 0.11
 Identities = 27/92 (29%), Positives = 49/92 (53%)
 Frame = -2

Query: 965  EENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQIL 786
            E+ + +     L    +S N+I++   +  +++ L  L ++NNQI+ I  I++  +L  L
Sbjct: 743  EDITSLKNLTNLANLKISQNKISNVDAIGNLTN-LTLLDMNNNQISNINAIKNSTKLISL 801

Query: 785  ELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
             +  NK+  +  L  LTNL+ L LG N I  +
Sbjct: 802  SMHHNKVSDISALSKLTNLESLNLGNNPINDV 833



>pir|B97303|B97303 hypothetical protein CAC3279 [imported] -
            Clostridium acetobutylicum>gb:AE007824_230574 Clostridium
            acetobutylicum ATCC 824 section 312 of 356 of the
            complete genome.>gb:AE001437_1093529 Clostridium
            acetobutylicum ATCC 824, complete genome.
          Length = 808

 Score = 77.0 bits (188), Expect = 8e-13
 Identities = 62/207 (29%), Positives = 100/207 (48%), Gaps = 25/207 (12%)
 Frame = -2

Query: 863  LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN- 687
            LK LY+ NN I+ I  ++    L+ L+L  N +  + +L  L+NL EL L  N I+  N 
Sbjct: 534  LKSLYLPNNNISDISYLKALDNLRTLQLDKNPITDISSLSNLSNLSELDL--NDIKTSNF 591

Query: 686  --LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
              L GL  ++ +S+  N +  +  +   + L+ LYL++N I  +  LS L NL  L +S 
Sbjct: 592  SALKGLTTLQHLSLLDNNINDISFVSNLLKLQYLYLNNNKITDISYLSNLANLDNLSLSN 651

Query: 512  N----------------------KLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGS 399
            N                      KLT +S + +L+ L+ L LNDN+I+ +  ++     +
Sbjct: 652  NTLSSLSPLSKLNNLTSLYLINNKLTDVSALNSLSNLQYLSLNDNSINDISPLS-----N 706

Query: 398  LQKLTTLYLERNPCANSPNYISTLRQI 318
            L  L  L L  N   N+   I TL ++
Sbjct: 707  LNNLRFLNLSGNSSLNNIASIKTLSKL 733



 Score = 60.8 bits (146), Expect = 6e-08
 Identities = 52/188 (27%), Positives = 98/188 (52%), Gaps = 5/188 (2%)
 Frame = -2

Query: 956  SGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELG 777
            S VS   KL    ++ N+IT  S LS +++ L  L +SNN ++ +  +   + L  L L 
Sbjct: 614  SFVSNLLKLQYLYLNNNKITDISYLSNLAN-LDNLSLSNNTLSSLSPLSKLNNLTSLYLI 672

Query: 776  SNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSN-RLTSMKGLEECVA 603
            +NKL  +  L +L+NLQ L L  N I  I+ L  L  ++ +++  N  L ++  ++    
Sbjct: 673  NNKLTDVSALNSLSNLQYLSLNDNSINDISPLSNLNNLRFLNLSGNSSLNNIASIKTLSK 732

Query: 602  LEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWL-NDN--NISS 432
            L  + L +  +  +  L ++  L  + ++   +T ++ + +L+ L DL++ ND+  N SS
Sbjct: 733  LTLVNLDYTKVTDLSPLKSISTLTTISLNYTNITTLTPLESLSSLTDLYIVNDSSLNQSS 792

Query: 431  VEDIAEAV 408
            V +   A+
Sbjct: 793  VSEFKAAL 800



 Score = 57.4 bits (137), Expect = 6e-07
 Identities = 39/134 (29%), Positives = 67/134 (50%), Gaps = 17/134 (12%)
 Frame = -2

Query: 668 IKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISN 489
           I  ++ ++  +  + G+E  V L+ LYL +N I  +  L  L NLR L +  N +T IS+
Sbjct: 512 ITTLNAETKNINYLDGIENLVNLKSLYLPNNNISDISYLKALDNLRTLQLDKNPITDISS 571

Query: 488 IANLTKLEDLWLND---NNISSVEDIAE--------------AVAGSLQKLTTLYLERNP 360
           ++NL+ L +L LND   +N S+++ +                +   +L KL  LYL  N 
Sbjct: 572 LSNLSNLSELDLNDIKTSNFSALKGLTTLQHLSLLDNNINDISFVSNLLKLQYLYLNNNK 631

Query: 359 CANSPNYISTLRQI 318
             +  +Y+S L  +
Sbjct: 632 ITDI-SYLSNLANL 644



>gb:CNS07EGI_1374434 chromosome IX of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 218

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 54/169 (31%), Positives = 90/169 (53%)
 Frame = -2

Query: 872 SSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRA 693
           + +++ L +S+N+I  I  +E+   L++L+L  N +  +       NL+EL+L  N I  
Sbjct: 40  AESVEYLDLSDNRIRTISSLENVPNLKVLDLSYNLITDISIPPM--NLEELYLISNDIAT 97

Query: 692 INLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           I+   L  IKK+ +  N +  ++ LE+C  LEELYL  N I  +EGL  + +L++LD+  
Sbjct: 98  IHGLNLPRIKKLDMAVNDICKIENLEKCTTLEELYLGSNQIGAVEGLEEMRSLKILDLQN 157

Query: 512 NKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLER 366
           NKL  +      + +E L L +N    V +  E     L+ L  L LE+
Sbjct: 158 NKLELVDCSMIPSSVEVLLLGENRSLEVVENIEL----LKNLKILGLEK 202



 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 44/167 (26%), Positives = 78/167 (46%), Gaps = 21/167 (12%)
 Frame = -2

Query: 764 RVMENLQTLT-NLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEEC------- 609
           R +E + T+  +++ + L RN I  + L   + ++ + +  NR+ ++  LE         
Sbjct: 10  RQLEKIPTIPEHVRTVDLRRNNISRMTLNKAESVEYLDLSDNRIRTISSLENVPNLKVLD 69

Query: 608 -------------VALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKL 468
                        + LEELYL  N I  + GL+ L  ++ LD++ N +  I N+   T L
Sbjct: 70  LSYNLITDISIPPMNLEELYLISNDIATIHGLN-LPRIKKLDMAVNDICKIENLEKCTTL 128

Query: 467 EDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTL 327
           E+L+L  N I +VE + E  +  +  L    LE   C+  P+ +  L
Sbjct: 129 EELYLGSNQIGAVEGLEEMRSLKILDLQNNKLELVDCSMIPSSVEVL 175



>gb:AE017323_442787 Listeria monocytogenes str. 4b F2365, section 2 of
            10 of the complete genome.>gb:AE017262_1075143 Listeria
            monocytogenes str. 4b F2365, complete genome.
          Length = 1775

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 64/214 (29%), Positives = 107/214 (50%), Gaps = 16/214 (7%)
 Frame = -2

Query: 935  KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
            KL   DV  N IT+ S +  + S L+  Y  NN I  I  +++  EL  ++L  N++  +
Sbjct: 564  KLQNLDVHSNRITNTSVIHDLPS-LETFYAQNNLITNIGTMDNLPELTYVDLSFNRIPSL 622

Query: 755  ENLQTLTNLQELWLGRNR--IRAIN-LCGLKCIKKISIQSNRLT------SMKGLEECVA 603
              +  L  L+ L +  N   +R++  + G+  ++ + +Q+N L       ++  L +   
Sbjct: 623  APIGDLPKLEILKVTDNYSYLRSLGTMDGVSKLRNLELQNNYLNYTGTEGNLSALSDLTN 682

Query: 602  LEELYLSHNG-IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVE 426
            L EL L  NG I  + GLSTL  L  L++ +NK+  IS ++NLT L++L L +N I  + 
Sbjct: 683  LTELNLRDNGYISDISGLSTLSRLIYLNLDSNKIKDISALSNLTTLQELTLENNQIEDIS 742

Query: 425  DIAEAVAGSLQKLTTLYLERN------PCANSPN 342
             +++     L  L  L L +N      P AN  N
Sbjct: 743  ALSD-----LDNLNKLALSKNKIIDISPAANMVN 771



 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 52/191 (27%), Positives = 93/191 (48%), Gaps = 1/191 (0%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN- 687
           L++L +  NQ+  I EI     L  L++  N L  +  L+ L  L+ L +  NR+  ++ 
Sbjct: 433 LEKLDLKENQLTSISEINDLPRLSYLDVSVNYLTTIGELKKLPLLEWLNVSSNRLSDVST 492

Query: 686 LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANK 507
           L     +  I++ +N + ++  + E  +L+E Y  +N +  +  +  + NLR +D S N 
Sbjct: 493 LTNFPSLNYINVSNNVIRTVGKMTELPSLKEFYAQNNNVSDISMIHDMPNLRKVDASNNL 552

Query: 506 LTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTL 327
           +T I    NL KL++L ++ N I++      +V   L  L T Y + N   N    I T+
Sbjct: 553 ITNIGTFDNLPKLQNLDVHSNRITNT-----SVIHDLPSLETFYAQNNLITN----IGTM 603

Query: 326 RQIFPNIQQVD 294
             + P +  VD
Sbjct: 604 DNL-PELTYVD 613



 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 46/194 (23%), Positives = 93/194 (47%), Gaps = 23/194 (11%)
 Frame = -2

Query: 956  SGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELG 777
            S ++   +L   DVS N +T+   L K+   L+ L VS+N+++ +  + +F  L  + + 
Sbjct: 447  SEINDLPRLSYLDVSVNYLTTIGELKKLP-LLEWLNVSSNRLSDVSTLTNFPSLNYINVS 505

Query: 776  SNKLRVMENLQTLTNLQELWLGRNRIRAINLC-----------------------GLKCI 666
            +N +R +  +  L +L+E +   N +  I++                         L  +
Sbjct: 506  NNVIRTVGKMTELPSLKEFYAQNNNVSDISMIHDMPNLRKVDASNNLITNIGTFDNLPKL 565

Query: 665  KKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNI 486
            + + + SNR+T+   + +  +LE  Y  +N I  +  +  L  L  +D+S N++ +++ I
Sbjct: 566  QNLDVHSNRITNTSVIHDLPSLETFYAQNNLITNIGTMDNLPELTYVDLSFNRIPSLAPI 625

Query: 485  ANLTKLEDLWLNDN 444
             +L KLE L + DN
Sbjct: 626  GDLPKLEILKVTDN 639



 Score = 40.0 bits (92), Expect = 0.11
 Identities = 25/79 (31%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = -2

Query: 638 LTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANK-LTAISNIANLTKLED 462
           +++++GL+    L  L LS N I  +  +  LVNL  L++S+N+ L  +S +  L  L++
Sbjct: 169 ISNIEGLQYLENLTSLNLSENNISDLAPIKDLVNLVSLNLSSNRTLVNLSGVEGLVNLQE 228

Query: 461 LWLNDNNISSVEDIAEAVA 405
           L ++ N   ++EDI++  A
Sbjct: 229 LNVSAN--KALEDISQVAA 245



>gb:AB051551_1868063 Homo sapiens mRNA for KIAA1764 protein, partial
           cds.
          Length = 1029

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 62/223 (27%), Positives = 100/223 (44%), Gaps = 4/223 (1%)
 Frame = -2

Query: 950 VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN 771
           V + K + +  + F  I+  S    + STL  + +  N I+KIE I+H   LQ L+L SN
Sbjct: 17  VMLLKSIFIVYIFFYSISELS----LDSTLHAVNLHCNNISKIEAIDHIWNLQHLDLSSN 72

Query: 770 KLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEEL 591
           ++  +E L TLT L  L                     ++  N +T ++GLEE + L  L
Sbjct: 73  QISRIEGLNTLTKLYTL---------------------NLSCNLITKVEGLEELINLTRL 111

Query: 590 YLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEA 411
            +S+N I+ + GL  L  ++                   KL  + L+ N I S+  + + 
Sbjct: 112 NVSYNHIDDLSGLIPLHGIK------------------HKLRYIDLHSNRIDSIHHLLQC 153

Query: 410 VAGSLQKLTTLYLER----NPCANSPNYISTLRQIFPNIQQVD 294
           + G L  LT L LE+    NP    P Y + + Q  P ++ +D
Sbjct: 154 MVG-LHFLTNLILEKDGDDNPVCRLPGYRAVILQTLPQLRILD 195



>gb:AB007651_1510259 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MWD9.>gb:AY056427_1563735 Arabidopsis thaliana
           AT5g22320/MWD9_11 mRNA, complete
           cds.>gb:AY090323_1574075 Arabidopsis thaliana
           AT5g22320/MWD9_11 mRNA, complete cds.
          Length = 452

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 45/140 (32%), Positives = 79/140 (56%), Gaps = 1/140 (0%)
 Frame = -2

Query: 734 NLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKME 558
           +++EL LG   +  ++ L   K ++K+ ++ N LT ++GL+ CV L+ L +  N ++ + 
Sbjct: 20  SVKELNLGHKALTDVSCLSKFKNLEKLDLRFNNLTDLQGLKSCVNLKWLSVVENKLQSLN 79

Query: 557 GLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTL 378
           G+  L  L VL+   NKL +++ I++L  L  L LNDN ISS+          L+ L +L
Sbjct: 80  GIEALTKLTVLNAGKNKLKSMNEISSLVNLRALILNDNEISSI-----CKLDLLKDLNSL 134

Query: 377 YLERNPCANSPNYISTLRQI 318
            L RNP +   + +S L+ +
Sbjct: 135 VLSRNPISEIGDSLSKLKNL 154



 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 44/161 (27%), Positives = 91/161 (56%), Gaps = 3/161 (1%)
 Frame = -2

Query: 902 ITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQE 723
           +T  S LSK  + L++L +  N +  ++ ++    L+ L +  NKL+ +  ++ LT L  
Sbjct: 31  LTDVSCLSKFKN-LEKLDLRFNNLTDLQGLKSCVNLKWLSVVENKLQSLNGIEALTKLTV 89

Query: 722 LWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKM-EGLS 549
           L  G+N+++++N +  L  ++ + +  N ++S+  L+    L  L LS N I ++ + LS
Sbjct: 90  LNAGKNKLKSMNEISSLVNLRALILNDNEISSICKLDLLKDLNSLVLSRNPISEIGDSLS 149

Query: 548 TLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSV 429
            L NL  + +S  ++ AI S++ + + L++L L +N I ++
Sbjct: 150 KLKNLSKISLSDCRIKAIGSSLKSCSDLKELRLANNEIKAL 190



>gb:BX294139_767129 Pirellula sp. strain 1 complete genome; segment
           7/24.
          Length = 400

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 46/162 (28%), Positives = 85/162 (52%), Gaps = 1/162 (0%)
 Frame = -2

Query: 833 IAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKI 657
           I  +E ++H   L +++L  NK+  +  +  L  LQ + L  N+I +++ +  L  ++ +
Sbjct: 180 IQSLEGLQHCKSLMLIDLADNKIEDLSPIADLKRLQSVTLANNKIASLDPVAELVAMQLL 239

Query: 656 SIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANL 477
            +  N LTS+  L +   L  LY++ N +  ++ L+ L  +  LD + N+LT++  +A L
Sbjct: 240 DVSGNELTSLDPLAKMSNLRTLYVADNKLTSLDPLAGLTKIWSLDAAGNELTSLDPVAKL 299

Query: 476 TKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCAN 351
             L  L ++DN I+S+  +      SL+ L  L    NP AN
Sbjct: 300 GWLTTLEISDNKITSLAPLT-----SLKDLDMLIAPGNPFAN 336



 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 43/142 (30%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -2

Query: 782 LGSNK-LRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEEC 609
           +G+ K ++ +E LQ   +L  + L  N+I  ++ +  LK ++ +++ +N++ S+  + E 
Sbjct: 174 VGTGKGIQSLEGLQHCKSLMLIDLADNKIEDLSPIADLKRLQSVTLANNKIASLDPVAEL 233

Query: 608 VALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV 429
           VA++ L +S N +  ++ L+ + NLR L V+ NKLT++  +A LTK+  L    N ++S+
Sbjct: 234 VAMQLLDVSGNELTSLDPLAKMSNLRTLYVADNKLTSLDPLAGLTKIWSLDAAGNELTSL 293

Query: 428 EDIAEAVAGSLQKLTTLYLERN 363
           + +A+     L  LTTL +  N
Sbjct: 294 DPVAK-----LGWLTTLEISDN 310



 Score = 47.8 bits (112), Expect = 5e-04
 Identities = 24/74 (32%), Positives = 46/74 (62%)
 Frame = -2

Query: 617 EECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNI 438
           E+   +  +  +  GI+ +EGL    +L ++D++ NK+  +S IA+L +L+ + L +N I
Sbjct: 165 EDVAKISRVVGTGKGIQSLEGLQHCKSLMLIDLADNKIEDLSPIADLKRLQSVTLANNKI 224

Query: 437 SSVEDIAEAVAGSL 396
           +S++ +AE VA  L
Sbjct: 225 ASLDPVAELVAMQL 238



 Score = 45.4 bits (106), Expect = 0.003
 Identities = 28/125 (22%), Positives = 63/125 (50%), Gaps = 22/125 (17%)
 Frame = -2

Query: 725 ELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVA------------------- 603
           E++  R+    I    +  I ++      + S++GL+ C +                   
Sbjct: 151 EVFAKRHNDEPITAEDVAKISRVVGTGKGIQSLEGLQHCKSLMLIDLADNKIEDLSPIAD 210

Query: 602 ---LEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISS 432
              L+ + L++N I  ++ ++ LV +++LDVS N+LT++  +A ++ L  L++ DN ++S
Sbjct: 211 LKRLQSVTLANNKIASLDPVAELVAMQLLDVSGNELTSLDPLAKMSNLRTLYVADNKLTS 270

Query: 431 VEDIA 417
           ++ +A
Sbjct: 271 LDPLA 275



 Score = 42.7 bits (99), Expect = 0.016
 Identities = 29/104 (27%), Positives = 57/104 (54%), Gaps = 1/104 (0%)
 Frame = -2

Query: 926 VFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENL 747
           + DVS NE+TS   L+K+S+ L+ LYV++N++  ++ +    ++  L+   N+L  ++ +
Sbjct: 238 LLDVSGNELTSLDPLAKMSN-LRTLYVADNKLTSLDPLAGLTKIWSLDAAGNELTSLDPV 296

Query: 746 QTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGL 618
             L  L  L +  N+I ++  L  LK +  +    N   ++K L
Sbjct: 297 AKLGWLTTLEISDNKITSLAPLTSLKDLDMLIAPGNPFANLKPL 340



>gb:AF121026_480750 Listeria monocytogenes strain 125 internalin B
           precursor (inlB) gene, partial cds.
          Length = 504

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 55/158 (34%), Positives = 86/158 (54%), Gaps = 3/158 (1%)
 Frame = -2

Query: 749 LQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNG 573
           L  L NL  L+L  N+I+ ++ L  LK +K +S++ N ++ + GL     LE LYL +N 
Sbjct: 3   LTNLKNLGWLFLDENKIKDLSSLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNNK 62

Query: 572 IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQ 393
           I  +  LS L  L  L +  N+++ I  +A LTKL++L+L+ N+IS +  +A      L+
Sbjct: 63  ITDITVLSRLTKLDTLSLEDNQISDIVPLAGLTKLQNLYLSKNHISDLRALA-----GLK 117

Query: 392 KLTTLYLERNPCANSP-NYISTLRQIFPN-IQQVDSEL 285
            L  L L    C N P N+ S L  + PN ++  D  L
Sbjct: 118 NLDVLELFSQECLNKPINHQSNL--VVPNTVKNTDGSL 153



 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 40/150 (26%), Positives = 77/150 (51%), Gaps = 3/150 (2%)
 Frame = -2

Query: 854 LYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCG 678
           L++  N+I  +  ++   +L+ L L  N +  +  L  L  L+ L+LG N+I  I  L  
Sbjct: 12  LFLDENKIKDLSSLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNNKITDITVLSR 71

Query: 677 LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKL-- 504
           L  +  +S++ N+++ +  L     L+ LYLS N I  +  L+ L NL VL++ + +   
Sbjct: 72  LTKLDTLSLEDNQISDIVPLAGLTKLQNLYLSKNHISDLRALAGLKNLDVLELFSQECLN 131

Query: 503 TAISNIANLTKLEDLWLNDNNISSVEDIAE 414
             I++ +NL     +   D ++ + E I++
Sbjct: 132 KPINHQSNLVVPNTVKNTDGSLVTPEIISD 161



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 33/105 (31%), Positives = 52/105 (49%), Gaps = 1/105 (0%)
 Frame = -2

Query: 956 SGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELG 777
           S +   KKL    +  N I+  +GL  +   L+ LY+ NN+I  I  +    +L  L L 
Sbjct: 23  SSLKDLKKLKSLSLEHNGISDINGLVHLPQ-LESLYLGNNKITDITVLSRLTKLDTLSLE 81

Query: 776 SNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQS 645
            N++  +  L  LT LQ L+L +N I  +  L GLK +  + + S
Sbjct: 82  DNQISDIVPLAGLTKLQNLYLSKNHISDLRALAGLKNLDVLELFS 126



>gb:AF121025_480749 Listeria monocytogenes strain 83 internalin B
           precursor (inlB) gene, partial cds.
          Length = 504

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 55/158 (34%), Positives = 86/158 (54%), Gaps = 3/158 (1%)
 Frame = -2

Query: 749 LQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNG 573
           L  L NL  L+L  N+I+ ++ L  LK +K +S++ N ++ + GL     LE LYL +N 
Sbjct: 3   LTNLKNLGWLFLDENKIKDLSSLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNNK 62

Query: 572 IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQ 393
           I  +  LS L  L  L +  N+++ I  +A LTKL++L+L+ N+IS +  +A      L+
Sbjct: 63  ITDITVLSRLTKLDTLSLEDNQISDIVPLAGLTKLQNLYLSKNHISDLRALA-----GLK 117

Query: 392 KLTTLYLERNPCANSP-NYISTLRQIFPN-IQQVDSEL 285
            L  L L    C N P N+ S L  + PN ++  D  L
Sbjct: 118 NLDVLELFSQECLNKPINHQSNL--VVPNTVKNTDGSL 153



 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 40/150 (26%), Positives = 77/150 (51%), Gaps = 3/150 (2%)
 Frame = -2

Query: 854 LYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCG 678
           L++  N+I  +  ++   +L+ L L  N +  +  L  L  L+ L+LG N+I  I  L  
Sbjct: 12  LFLDENKIKDLSSLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNNKITDITVLSR 71

Query: 677 LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKL-- 504
           L  +  +S++ N+++ +  L     L+ LYLS N I  +  L+ L NL VL++ + +   
Sbjct: 72  LTKLDTLSLEDNQISDIVPLAGLTKLQNLYLSKNHISDLRALAGLKNLDVLELFSQECLN 131

Query: 503 TAISNIANLTKLEDLWLNDNNISSVEDIAE 414
             I++ +NL     +   D ++ + E I++
Sbjct: 132 KPINHQSNLVVPNTVKNTDGSLVTPEIISD 161



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 33/105 (31%), Positives = 52/105 (49%), Gaps = 1/105 (0%)
 Frame = -2

Query: 956 SGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELG 777
           S +   KKL    +  N I+  +GL  +   L+ LY+ NN+I  I  +    +L  L L 
Sbjct: 23  SSLKDLKKLKSLSLEHNGISDINGLVHLPQ-LESLYLGNNKITDITVLSRLTKLDTLSLE 81

Query: 776 SNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQS 645
            N++  +  L  LT LQ L+L +N I  +  L GLK +  + + S
Sbjct: 82  DNQISDIVPLAGLTKLQNLYLSKNHISDLRALAGLKNLDVLELFS 126



>gb:AF121024_480748 Listeria monocytogenes strain 77 internalin B
           precursor (inlB) gene, partial cds.>gb:AF121027_480751
           Listeria monocytogenes strain 465 internalin B precursor
           (inlB) gene, partial cds.
          Length = 504

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 55/158 (34%), Positives = 86/158 (54%), Gaps = 3/158 (1%)
 Frame = -2

Query: 749 LQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNG 573
           L  L NL  L+L  N+I+ ++ L  LK +K +S++ N ++ + GL     LE LYL +N 
Sbjct: 3   LTNLKNLGWLFLDENKIKDLSSLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNNK 62

Query: 572 IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQ 393
           I  +  LS L  L  L +  N+++ I  +A LTKL++L+L+ N+IS +  +A      L+
Sbjct: 63  ITDITVLSRLTKLDTLSLEDNQISDIVPLAGLTKLQNLYLSKNHISDLRALA-----GLK 117

Query: 392 KLTTLYLERNPCANSP-NYISTLRQIFPN-IQQVDSEL 285
            L  L L    C N P N+ S L  + PN ++  D  L
Sbjct: 118 NLDVLELFSQECLNKPINHQSNL--VVPNTVKNTDGSL 153



 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 40/150 (26%), Positives = 77/150 (51%), Gaps = 3/150 (2%)
 Frame = -2

Query: 854 LYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCG 678
           L++  N+I  +  ++   +L+ L L  N +  +  L  L  L+ L+LG N+I  I  L  
Sbjct: 12  LFLDENKIKDLSSLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNNKITDITVLSR 71

Query: 677 LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKL-- 504
           L  +  +S++ N+++ +  L     L+ LYLS N I  +  L+ L NL VL++ + +   
Sbjct: 72  LTKLDTLSLEDNQISDIVPLAGLTKLQNLYLSKNHISDLRALAGLKNLDVLELFSQECLN 131

Query: 503 TAISNIANLTKLEDLWLNDNNISSVEDIAE 414
             I++ +NL     +   D ++ + E I++
Sbjct: 132 KPINHQSNLVVPNTVKNTDGSLVTPEIISD 161



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 33/105 (31%), Positives = 52/105 (49%), Gaps = 1/105 (0%)
 Frame = -2

Query: 956 SGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELG 777
           S +   KKL    +  N I+  +GL  +   L+ LY+ NN+I  I  +    +L  L L 
Sbjct: 23  SSLKDLKKLKSLSLEHNGISDINGLVHLPQ-LESLYLGNNKITDITVLSRLTKLDTLSLE 81

Query: 776 SNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQS 645
            N++  +  L  LT LQ L+L +N I  +  L GLK +  + + S
Sbjct: 82  DNQISDIVPLAGLTKLQNLYLSKNHISDLRALAGLKNLDVLELFS 126



>gb:LIY14181_140741 Listeria ivanovii i-inlF gene.
          Length = 315

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 44/138 (31%), Positives = 76/138 (55%), Gaps = 3/138 (2%)
 Frame = -2

Query: 863 LKELYVSNNQ---IAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRA 693
           L E+ + N     I  I+ +++F  L+ L L  N +R +  L+ LTNL  L L +NR+  
Sbjct: 73  LDEVQIFNGNGRTIISIDGLQYFTNLKELYLSRNHIRDLTPLKDLTNLAILCLDKNRLEN 132

Query: 692 INLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           +N      + ++S++ N LT +  L     LE L++S N ++ ++ L+ L NL+ LD++ 
Sbjct: 133 LNGIPSNKLVRLSLEDNELTQVDALANLTQLETLFISKNQLKNIDALANLTNLKTLDLNR 192

Query: 512 NKLTAISNIANLTKLEDL 459
           N+L  +S +A L  L  L
Sbjct: 193 NELEDLSPLARLENLTSL 210



>gb:LIIN1E_140505 Listeria ivanovii i-inlF and i-inlE genes and gene
           encoding hypothetical protein.
          Length = 314

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 44/138 (31%), Positives = 76/138 (55%), Gaps = 3/138 (2%)
 Frame = -2

Query: 863 LKELYVSNNQ---IAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRA 693
           L E+ + N     I  I+ +++F  L+ L L  N +R +  L+ LTNL  L L +NR+  
Sbjct: 73  LDEVQIFNGNGRTIISIDGLQYFTNLKELYLSRNHIRDLTPLKDLTNLAILCLDKNRLEN 132

Query: 692 INLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           +N      + ++S++ N LT +  L     LE L++S N ++ ++ L+ L NL+ LD++ 
Sbjct: 133 LNGIPSNKLVRLSLEDNELTQVDALANLTQLETLFISKNQLKNIDALANLTNLKTLDLNR 192

Query: 512 NKLTAISNIANLTKLEDL 459
           N+L  +S +A L  L  L
Sbjct: 193 NELEDLSPLARLENLTSL 210



>pir|AF1116|AF1116 internalin proteins, probable peptidoglycan bound
            protein  (LPXTG motif) homolog lmo0333 [imported] -
            Listeria monocytogenes (strain EGD-e)>gb:AL591975_534825
            Listeria monocytogenes strain EGD, complete genome,
            segment 3/12.
          Length = 1778

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 61/214 (28%), Positives = 108/214 (50%), Gaps = 16/214 (7%)
 Frame = -2

Query: 935  KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
            KL   DV  N ITS S +  + S L+      N I  I  +++  +L  + L  N++  +
Sbjct: 567  KLQSLDVHSNRITSTSVIHDLPS-LETFNAQTNLITNIGTMDNLPDLTYVNLSFNRIPSL 625

Query: 755  ENLQTLTNLQELWLGRNR--IRAIN-LCGLKCIKKISIQSNRLT------SMKGLEECVA 603
              +  L NL+ L +  N   +R++  + G+  ++ + +Q+N L       ++  L +   
Sbjct: 626  APIGDLPNLETLIVSDNNSYLRSLGTMDGVPKLRILDLQNNYLNYTGTEGNLSSLSDLTN 685

Query: 602  LEELYLSHNG-IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVE 426
            L EL L +N  I+ + GLSTL  L  L++ +NK+  IS ++NLT L++L L +N I ++ 
Sbjct: 686  LTELNLRNNVYIDDISGLSTLSRLIYLNLDSNKIEDISALSNLTNLQELTLENNKIENIS 745

Query: 425  DIAEAVAGSLQKLTTLYLERN------PCANSPN 342
             +++     L+ L  L + +N      P AN  N
Sbjct: 746  ALSD-----LENLNKLVVSKNKIIDISPVANMVN 774



 Score = 70.9 bits (172), Expect(2) = 2e-12
 Identities = 50/172 (29%), Positives = 84/172 (48%), Gaps = 1/172 (0%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN- 687
           L++L +  NQI  I EI     L  L++  N L  + +L+ L  L+ L +  NR+  ++ 
Sbjct: 436 LEKLDLKENQITSISEITDLPRLSYLDVSVNNLTTIGDLKKLPLLEWLNVSSNRLSDVST 495

Query: 686 LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANK 507
           L     +  I+I +N + ++  + E  +L+E Y  +N I  +  +  + NLR +D S N 
Sbjct: 496 LTNFPSLNYINISNNVIRTVGKMTELPSLKEFYAQNNSISDISMIHDMPNLRKVDASNNL 555

Query: 506 LTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCAN 351
           +T I    NL KL+ L ++ N I+S      +V   L  L T   + N   N
Sbjct: 556 ITNIGTFDNLPKLQSLDVHSNRITST-----SVIHDLPSLETFNAQTNLITN 602



 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 64/209 (30%), Positives = 103/209 (49%), Gaps = 12/209 (5%)
 Frame = -2

Query: 1067 LSSPEPHYRRRARASFVVAHHFPTRGTSAQG*SAEENSG-VSIFKKLLVFDVSFNEITSP 891
            L S + H  R    S  V H  P+  T     +   N G +     L   ++SFN I S 
Sbjct: 568  LQSLDVHSNRITSTS--VIHDLPSLETFNAQTNLITNIGTMDNLPDLTYVNLSFNRIPSL 625

Query: 890  SGLSKVSSTLKELYVSNNQ--IAKIEEIEHFHELQILELGSNKLRV------MENLQTLT 735
            + +  + + L+ L VS+N   +  +  ++   +L+IL+L +N L        + +L  LT
Sbjct: 626  APIGDLPN-LETLIVSDNNSYLRSLGTMDGVPKLRILDLQNNYLNYTGTEGNLSSLSDLT 684

Query: 734  NLQELWLGRNRIRAINLCGLKCIKKI---SIQSNRLTSMKGLEECVALEELYLSHNGIEK 564
            NL EL L RN +   ++ GL  + ++   ++ SN++  +  L     L+EL L +N IE 
Sbjct: 685  NLTELNL-RNNVYIDDISGLSTLSRLIYLNLDSNKIEDISALSNLTNLQELTLENNKIEN 743

Query: 563  MEGLSTLVNLRVLDVSANKLTAISNIANL 477
            +  LS L NL  L VS NK+  IS +AN+
Sbjct: 744  ISALSDLENLNKLVVSKNKIIDISPVANM 772



 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 61/223 (27%), Positives = 107/223 (47%), Gaps = 6/223 (2%)
 Frame = -2

Query: 956  SGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELG 777
            S ++ F  L   ++S N I +   ++++ S LKE Y  NN I+ I  I     L+ ++  
Sbjct: 494  STLTNFPSLNYINISNNVIRTVGKMTELPS-LKEFYAQNNSISDISMIHDMPNLRKVDAS 552

Query: 776  SNKLRVMENLQTLTNLQELWLGRNRIRAINLC-GLKCIKKISIQSNRLTSMKGLEECVAL 600
            +N +  +     L  LQ L +  NRI + ++   L  ++  + Q+N +T++  ++    L
Sbjct: 553  NNLITNIGTFDNLPKLQSLDVHSNRITSTSVIHDLPSLETFNAQTNLITNIGTMDNLPDL 612

Query: 599  EELYLSHNGIEKMEGLSTLVNLRVLDVSANK--LTAISNIANLTKLEDLWLNDN--NISS 432
              + LS N I  +  +  L NL  L VS N   L ++  +  + KL  L L +N  N + 
Sbjct: 613  TYVNLSFNRIPSLAPIGDLPNLETLIVSDNNSYLRSLGTMDGVPKLRILDLQNNYLNYTG 672

Query: 431  VEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTL-RQIFPNI 306
             E    +++  L  LT L L  N   +  + +STL R I+ N+
Sbjct: 673  TEGNLSSLS-DLTNLTELNLRNNVYIDDISGLSTLSRLIYLNL 714



 Score = 40.0 bits (92), Expect = 0.11
 Identities = 25/79 (31%), Positives = 48/79 (60%), Gaps = 1/79 (1%)
 Frame = -2

Query: 638 LTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANK-LTAISNIANLTKLED 462
           +++++GL+    L  L LS N I  +  L  LVNL  L++S+N+ L  +S + +L  L++
Sbjct: 172 ISNIEGLQYLENLTSLNLSENNISDLAPLKDLVNLVSLNLSSNRTLVNLSGVEDLVNLQE 231

Query: 461 LWLNDNNISSVEDIAEAVA 405
           L ++ N   ++EDI++  +
Sbjct: 232 LNVSAN--KALEDISQVAS 248



 Score = 24.6 bits (52), Expect(2) = 2e-12
 Identities = 12/45 (26%), Positives = 26/45 (57%), Gaps = 1/45 (2%)
 Frame = -3

Query: 1099 RISHLSNLNKFSLRQNLITDA-ALEPLSSWHTISQLEELVLRDNQ 968
            ++  +++L       N+  D+ A+E L + + + +L+ LVL DN+
Sbjct: 356  KLKEITSLKNLPNLVNITADSCAIEDLGTLNNLPKLQTLVLSDNE 400



>gb:AF121032_480756 Listeria monocytogenes strain 524 internalin B
           precursor (inlB) gene, partial cds.>gb:AF121033_480757
           Listeria monocytogenes strain 525 internalin B precursor
           (inlB) gene, partial cds.>gb:AF121034_480758 Listeria
           monocytogenes strain 1929 internalin B precursor (inlB)
           gene, partial cds.>gb:AF121035_480759 Listeria
           monocytogenes strain 2551 internalin B precursor (inlB)
           gene, partial cds.
          Length = 504

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 54/158 (34%), Positives = 86/158 (54%), Gaps = 3/158 (1%)
 Frame = -2

Query: 749 LQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNG 573
           L  L NL  L+L  N+++ ++ L  LK +K +S++ N ++ + GL     LE LYL +N 
Sbjct: 3   LANLKNLGWLFLDENKVKDLSSLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNNK 62

Query: 572 IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQ 393
           I  +  LS L  L  L +  N+++ I  +A LTKL++L+L+ N+IS +  +A      L+
Sbjct: 63  ITDITVLSRLTKLDTLSLEDNQISDIVPLAGLTKLQNLYLSKNHISDLRALA-----GLK 117

Query: 392 KLTTLYLERNPCANSP-NYISTLRQIFPN-IQQVDSEL 285
            L  L L    C N P N+ S L  + PN ++  D  L
Sbjct: 118 NLDVLELFSQECLNKPINHQSNL--VVPNTVKNTDGSL 153



 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 39/150 (26%), Positives = 77/150 (51%), Gaps = 3/150 (2%)
 Frame = -2

Query: 854 LYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCG 678
           L++  N++  +  ++   +L+ L L  N +  +  L  L  L+ L+LG N+I  I  L  
Sbjct: 12  LFLDENKVKDLSSLKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNNKITDITVLSR 71

Query: 677 LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKL-- 504
           L  +  +S++ N+++ +  L     L+ LYLS N I  +  L+ L NL VL++ + +   
Sbjct: 72  LTKLDTLSLEDNQISDIVPLAGLTKLQNLYLSKNHISDLRALAGLKNLDVLELFSQECLN 131

Query: 503 TAISNIANLTKLEDLWLNDNNISSVEDIAE 414
             I++ +NL     +   D ++ + E I++
Sbjct: 132 KPINHQSNLVVPNTVKNTDGSLVTPEIISD 161



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 33/105 (31%), Positives = 52/105 (49%), Gaps = 1/105 (0%)
 Frame = -2

Query: 956 SGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELG 777
           S +   KKL    +  N I+  +GL  +   L+ LY+ NN+I  I  +    +L  L L 
Sbjct: 23  SSLKDLKKLKSLSLEHNGISDINGLVHLPQ-LESLYLGNNKITDITVLSRLTKLDTLSLE 81

Query: 776 SNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQS 645
            N++  +  L  LT LQ L+L +N I  +  L GLK +  + + S
Sbjct: 82  DNQISDIVPLAGLTKLQNLYLSKNHISDLRALAGLKNLDVLELFS 126



>gb:LMU77368_141683 Listeria monocytogenes internalin (inlC2), inlD,
           and inlE genes, complete cds.
          Length = 567

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 51/183 (27%), Positives = 93/183 (50%), Gaps = 1/183 (0%)
 Frame = -2

Query: 908 NEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNL 729
           NEI +   L+    T      + + ++++E       ++ +   S+ +  +E +Q L NL
Sbjct: 43  NEIFTDENLANAIKTTLSKPSTASAVSQVE----LDSVRDVTAESSNIASLEGVQYLNNL 98

Query: 728 QELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGL 552
             L L  N+I  +N L GL  +  +   +N+L+ +  L     L +L L  N I+++ G+
Sbjct: 99  DTLVLNNNKITDLNPLAGLTKLSILEASNNQLSDISALSNVTNLHQLRLDGNQIKQLNGV 158

Query: 551 STLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYL 372
           S L+NL  +++S N++TAIS ++ L  L  L +++N IS +  I+      L KL  L  
Sbjct: 159 SNLINLETIELSNNQITAISPVSGLKNLVGLGIDNNKISDLSPIS-----GLSKLNHLTA 213

Query: 371 ERN 363
           + N
Sbjct: 214 DSN 216



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 45/203 (22%), Positives = 87/203 (42%), Gaps = 5/203 (2%)
 Frame = -2

Query: 908 NEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNL 729
           N+I   +G+S + + L+ + +SNNQI  I  +     L  L + +NK+  +  +  L+ L
Sbjct: 150 NQIKQLNGVSNLIN-LETIELSNNQITAISPVSGLKNLVGLGIDNNKISDLSPISGLSKL 208

Query: 728 QELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGL 552
             L    N+I  +  L  L  ++ + +  N+++ +  +     L  ++L+ N I  +  L
Sbjct: 209 NHLTADSNQISDLRPLSNLAAMEVMRLDGNQISDVTPIANLANLNYVFLAENQISDISSL 268

Query: 551 STLVNLRVLDVSANKLTAISNIANLTKLEDLWLND----NNISSVEDIAEAVAGSLQKLT 384
             L N      S N      +   +T    L+  +    NNI   +++   +A +     
Sbjct: 269 QPLFN------SPNFFGITLDNQKITSEPVLYQQELVVPNNIK--DEMGALIAPATISDN 320

Query: 383 TLYLERNPCANSPNYISTLRQIF 315
            +Y   N   N PNY + +   F
Sbjct: 321 GVYASPNINWNLPNYTNQVSYTF 343



>gb:AE011492_273559 Leptospira interrogans serovar lai str. 56601
           chromosome I, section 301 of 397 of the complete
           sequence.>gb:AE010300_1006958 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete sequence.
          Length = 329

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 59/214 (27%), Positives = 112/214 (52%), Gaps = 7/214 (3%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKLR 762
           + L +  + +N++T      +    L+ LY+ NNQI  + +EI     L++L L +N+L 
Sbjct: 90  QNLQLLGLYYNQLTILPKEIEQLKNLQALYLGNNQITILPKEIRQLQNLKVLFLSNNQLT 149

Query: 761 VM-ENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALEE 594
            + + ++ L NLQ L+LG NR+      +  LK ++ + +  N+LT + + +++   L+ 
Sbjct: 150 TLPKEIEQLKNLQTLYLGNNRLTTFPKEIEQLKNLQLLYLYDNQLTVLPQEIKQLKNLQL 209

Query: 593 LYLSHNGIEKM-EGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSVEDI 420
           L LS+N ++ + + +  L NL+ L++  N+LT +   I  L  L+ L+L  N ++++   
Sbjct: 210 LDLSYNQLKTLPKEIEQLKNLQELNLGYNQLTVLPKEIEQLKNLQTLYLGYNQLTTL--- 266

Query: 419 AEAVAGSLQKLTTLYLERNPCANSPNYISTLRQI 318
                G LQ L  L+L  N     P  I  L+ +
Sbjct: 267 -PKEIGQLQNLKVLFLNNNQLTTLPKEIGQLKNL 299



 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 55/175 (31%), Positives = 92/175 (52%), Gaps = 6/175 (3%)
 Frame = -2

Query: 800 ELQILELGSNKLRVM-ENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTS 630
           +++IL L   KL  + + +  L NLQEL LG N+I  +   +  L+ ++ + +  N+LT 
Sbjct: 45  DVRILNLSEQKLTTLPKEIGQLKNLQELNLGNNQITILPKEIGQLQNLQLLGLYYNQLTI 104

Query: 629 M-KGLEECVALEELYLSHNGIEKM-EGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDL 459
           + K +E+   L+ LYL +N I  + + +  L NL+VL +S N+LT +   I  L  L+ L
Sbjct: 105 LPKEIEQLKNLQALYLGNNQITILPKEIRQLQNLKVLFLSNNQLTTLPKEIEQLKNLQTL 164

Query: 458 WLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVD 294
           +L +N +++     E     L+ L  LYL  N     P  I  L+    N+Q +D
Sbjct: 165 YLGNNRLTTFPKEIE----QLKNLQLLYLYDNQLTVLPQEIKQLK----NLQLLD 211



>gb:BC053114_2550508 Danio rerio zgc:63856, mRNA (cDNA clone
           MGC:63856 IMAGE:6788957), complete cds.
          Length = 599

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 47/167 (28%), Positives = 87/167 (52%)
 Frame = -2

Query: 884 LSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRN 705
           L +  S    L ++ NQ+ K+E +EH  +LQ L +  N+L                    
Sbjct: 31  LFRPDSHTHTLILNQNQLMKLEHLEHNPDLQQLSVACNRL-------------------- 70

Query: 704 RIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVL 525
            +R +N+C L  ++ + +Q+N +  ++GL+E   LE L L+ N I+ ME L   V+L+ L
Sbjct: 71  -VRMMNVCRLTQLRVLDLQNNSIGCIEGLKELQQLERLNLAGNNIKVMEQLHHCVSLQHL 129

Query: 524 DVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLT 384
           D+S N ++ I +++ L+ L+ L L+ N I+++      +   L+ L+
Sbjct: 130 DLSDNNISQIGDVSRLSALQTLLLHGNIITTLRSAPAHLPAHLRVLS 176



 Score = 45.4 bits (106), Expect = 0.003
 Identities = 36/128 (28%), Positives = 63/128 (49%), Gaps = 3/128 (2%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-N 687
           L+ L + NN I  IE ++   +L+ L L  N ++VME L    +LQ L L  N I  I +
Sbjct: 82  LRVLDLQNNSIGCIEGLKELQQLERLNLAGNNIKVMEQLHHCVSLQHLDLSDNNISQIGD 141

Query: 686 LCGLKCIKKISIQSNRLTSMKGLEECVA--LEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           +  L  ++ + +  N +T+++     +   L  L L+ N I  +  +  L  +R L    
Sbjct: 142 VSRLSALQTLLLHGNIITTLRSAPAHLPAHLRVLSLAENEIRDLTEVCYLAPVRGL---- 197

Query: 512 NKLTAISN 489
            +L+ +SN
Sbjct: 198 QQLSLLSN 205



>gb:CP000001_851086 Bacillus cereus ZK, complete genome.
          Length = 1112

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 49/200 (24%), Positives = 104/200 (52%), Gaps = 1/200 (0%)
 Frame = -2

Query: 977 G*SAEENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHE 798
           G   E   G+   + L    +  +++ + + +S++   LK + +S N+I  +E + +  +
Sbjct: 213 GQGIESLKGLEYMENLERITIQGSDVRNIAPISQLKR-LKVVDLSFNKIENVEPLVNLEK 271

Query: 797 LQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKG 621
           L ILEL +N++  +  L  L  ++ + L  N+I  I  L  +  ++K+ + +N++T   G
Sbjct: 272 LDILELQNNRIADVTPLSQLKKVRTINLSGNKISDIKPLYNVSSLRKLYVSNNKITDFTG 331

Query: 620 LEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNN 441
           +E+   L  L +  NG+  +E +S +  +  L++  N +  I++++ LT L+ L L +N 
Sbjct: 332 IEQLNKLGTLGVGSNGLVNIEPISQMSGIVELNLEKNDIKDITSLSKLTGLQSLNLEENY 391

Query: 440 ISSVEDIAEAVAGSLQKLTT 381
           +S V  ++  +     KL T
Sbjct: 392 VSDVSSLSNLINLYELKLAT 411



 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 45/177 (25%), Positives = 96/177 (54%), Gaps = 3/177 (1%)
 Frame = -2

Query: 938  KKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRV 759
            K L + D     IT  SGL  +++ ++EL + N  +  ++ I     L+ ++L  N++  
Sbjct: 550  KALKITDGKKEGITDFSGLEFMTN-MEELILQNANMKNVKFISSLRNLKSVDLSYNQIED 608

Query: 758  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRL--TSMKGLEECVALEELY 588
            ++ L +L NL++L +  N I+ +  L  ++ +K + + +N+L   ++ G+ +   L+ L 
Sbjct: 609  IKPLHSLENLEKLNISNNGIKNVPELFKMQTLKTLDLSNNKLDNAALDGIYQLENLDALL 668

Query: 587  LSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA 417
            +++N I  ++ +  +  L  L++  NK+  IS +ANL  L+ L L +N I  +  ++
Sbjct: 669  VNNNEINNLDEIGKVSKLNKLEMMGNKVRDISPLANLKNLQWLNLANNKIQDISSLS 725



 Score = 51.6 bits (122), Expect = 4e-05
 Identities = 33/114 (28%), Positives = 62/114 (54%)
 Frame = -2

Query: 689 NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSAN 510
           +L  +K +K    +   +T   GLE    +EEL L +  ++ ++ +S+L NL+ +D+S N
Sbjct: 545 DLLTVKALKITDGKKEGITDFSGLEFMTNMEELILQNANMKNVKFISSLRNLKSVDLSYN 604

Query: 509 KLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANS 348
           ++  I  + +L  LE L +++N I +V ++ +     +Q L TL L  N   N+
Sbjct: 605 QIEDIKPLHSLENLEKLNISNNGIKNVPELFK-----MQTLKTLDLSNNKLDNA 653



 Score = 42.7 bits (99), Expect = 0.016
 Identities = 31/106 (29%), Positives = 58/106 (54%), Gaps = 3/106 (2%)
 Frame = -2

Query: 932 LLVFDVSFNEITSPS--GLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRV 759
           L   D+S N++ + +  G+ ++ + L  L V+NN+I  ++EI    +L  LE+  NK+R 
Sbjct: 640 LKTLDLSNNKLDNAALDGIYQLEN-LDALLVNNNEINNLDEIGKVSKLNKLEMMGNKVRD 698

Query: 758 MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMK 624
           +  L  L NLQ L L  N+I+ I +L  +  +  + +  N +  ++
Sbjct: 699 ISPLANLKNLQWLNLANNKIQDISSLSSILDLLSLKLAGNEIRDVR 744



>gb:AE017025_380815 Bacillus anthracis str. Ames section 2 of 18 of
           the complete genome.>gb:AE017225_405925 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_450664 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE016879_1010520 Bacillus
           anthracis str. Ames complete genome.
          Length = 1070

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 49/200 (24%), Positives = 104/200 (52%), Gaps = 1/200 (0%)
 Frame = -2

Query: 977 G*SAEENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHE 798
           G   E   G+   + L    +  +++ + + +S++   LK + +S N+I  +E + +  +
Sbjct: 213 GQGIESLKGLEYMENLERITIQGSDVRNIAPISQLKR-LKVVDLSFNKIENVEPLVNLEK 271

Query: 797 LQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKG 621
           L ILEL +N++  +  L  L  ++ + L  N+I  I  L  +  ++K+ + +N++T   G
Sbjct: 272 LDILELQNNRIADVTPLSQLKKVRTINLSGNKISDIKPLYNVSSLRKLYVSNNKITDFTG 331

Query: 620 LEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNN 441
           +E+   L  L +  NG+  +E +S +  +  L++  N +  I++++ LT L+ L L +N 
Sbjct: 332 IEQLNKLGTLGVGSNGLVNIEPISQMSGIVELNLEKNDIKDITSLSKLTGLQSLNLEENY 391

Query: 440 ISSVEDIAEAVAGSLQKLTT 381
           +S V  ++  +     KL T
Sbjct: 392 VSDVSSLSNLINLYELKLAT 411



 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 46/177 (25%), Positives = 98/177 (55%), Gaps = 3/177 (1%)
 Frame = -2

Query: 938  KKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRV 759
            K L + D     IT  SGL  +++ ++EL + N  +   E I     L+ ++L  N++  
Sbjct: 550  KALKITDGKKEGITDFSGLEFMTN-VEELTLQNVNMKNAEFISSLRNLKSVDLSYNQIED 608

Query: 758  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRL--TSMKGLEECVALEELY 588
            ++ L +L +L++L +  N I+ +  L  ++ +K + + +N+L   ++ G+ +   L+ L 
Sbjct: 609  IKPLHSLEDLEKLNVSDNGIKNVPELFKMQKLKTLDLSNNKLDNAALDGIHQLENLDALL 668

Query: 587  LSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA 417
            +++N I  ++ +S +  L  L++ +NK+  IS +A+L  L+ L L+DN I  +  ++
Sbjct: 669  VNNNEINNLDEISKVSKLNKLEMMSNKVRDISPLASLKNLQWLNLSDNKIQDISTLS 725



 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 36/114 (31%), Positives = 62/114 (54%)
 Frame = -2

Query: 689 NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSAN 510
           +L  +K +K    +   +T   GLE    +EEL L +  ++  E +S+L NL+ +D+S N
Sbjct: 545 DLLTVKALKITDGKKEGITDFSGLEFMTNVEELTLQNVNMKNAEFISSLRNLKSVDLSYN 604

Query: 509 KLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANS 348
           ++  I  + +L  LE L ++DN I +V ++ +     +QKL TL L  N   N+
Sbjct: 605 QIEDIKPLHSLEDLEKLNVSDNGIKNVPELFK-----MQKLKTLDLSNNKLDNA 653



 Score = 47.4 bits (111), Expect = 7e-04
 Identities = 33/108 (30%), Positives = 62/108 (57%), Gaps = 3/108 (2%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITSPS--GLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKL 765
           +KL   D+S N++ + +  G+ ++ + L  L V+NN+I  ++EI    +L  LE+ SNK+
Sbjct: 638 QKLKTLDLSNNKLDNAALDGIHQLEN-LDALLVNNNEINNLDEISKVSKLNKLEMMSNKV 696

Query: 764 RVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMK 624
           R +  L +L NLQ L L  N+I+ I+ L  +  +  + +  N +  ++
Sbjct: 697 RDISPLASLKNLQWLNLSDNKIQDISTLSSMLDLLSLKLAGNEIRDVR 744



>gb:BC070092_1988429 Homo sapiens KIAA1764 protein, mRNA (cDNA clone
           MGC:87502 IMAGE:5272572), complete cds.
          Length = 881

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 64/215 (29%), Positives = 99/215 (46%), Gaps = 6/215 (2%)
 Frame = -2

Query: 920 DVSFNE--ITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENL 747
           DV F +  + S S LS + STL  + +  N I+KIE I+H   LQ L+L SN++  +E L
Sbjct: 25  DVCFMDKGLQSISELS-LDSTLHAVNLHCNNISKIEAIDHIWNLQHLDLSSNQISRIEGL 83

Query: 746 QTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIE 567
            TLT L  L                     ++  N +T ++GLEE + L  L +S+N I+
Sbjct: 84  NTLTKLCTL---------------------NLSCNLITKVEGLEELINLTRLNVSYNHID 122

Query: 566 KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKL 387
            + GL  L  ++                   KL  + L+ N I S+  + + + G L  L
Sbjct: 123 DLSGLIPLHGIK------------------HKLRYIDLHSNRIDSIHHLLQCMVG-LHFL 163

Query: 386 TTLYLER----NPCANSPNYISTLRQIFPNIQQVD 294
           T L LE+    NP    P Y + + Q  P ++ +D
Sbjct: 164 TNLILEKDGDDNPVCRLPGYRAVILQTLPQLRILD 198



>gb:AE014296_1134802 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003482_1212101 Drosophila melanogaster
           chromosome 3L, section 16 of 83 of the complete
           sequence.
          Length = 1301

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 54/195 (27%), Positives = 98/195 (50%), Gaps = 5/195 (2%)
 Frame = -2

Query: 947 SIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHE-LQILELGSN 771
           SIF++L+  D+  N+I   + L  + S L  L +  N+I  I  +    + L++L+L  N
Sbjct: 467 SIFQQLVFLDLYDNQIERIANLDGLPS-LSVLLLGKNRITDIGGLSSLKDTLRVLDLHGN 525

Query: 770 KLRVM-ENLQTLTNLQELWLGRNRIRAIN---LCGLKCIKKISIQSNRLTSMKGLEECVA 603
           KL  +   +  L  L+ L L  N+IR IN     GL+C+++++++ N+L  + G +  VA
Sbjct: 526 KLTSLGSRINCLQQLKSLNLAGNQIRQINQQDFLGLRCLRELNLKRNKLRRINGFQHLVA 585

Query: 602 LEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVED 423
           LE L+L HN + +++ +                   ++IA  T+L ++ + +N +S   D
Sbjct: 586 LERLWLCHNDLHRVDDM-------------------ASIARATRLLEVTIENNPVSLAGD 626

Query: 422 IAEAVAGSLQKLTTL 378
               +   L  L TL
Sbjct: 627 CVSFLVSYLPLLQTL 641



>gb:BC047873_1984033 Homo sapiens hypothetical protein
           DKFZp586M1120, mRNA (cDNA clone MGC:57559
           IMAGE:5760028), complete cds.>gb:BC050665_1984467 Homo
           sapiens hypothetical protein DKFZp586M1120, mRNA (cDNA
           clone MGC:60187 IMAGE:5203312), complete cds.
          Length = 523

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 46/139 (33%), Positives = 76/139 (54%)
 Frame = -2

Query: 710 RNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLR 531
           RN +R  NL   + ++K+ + +N +  ++GLE    L  L LS N IE +EGL TLVNL 
Sbjct: 53  RNILRIDNLWQFENLRKLQLDNNIIEKIEGLENLAHLVWLDLSFNNIETIEGLDTLVNLE 112

Query: 530 VLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCAN 351
            L +  N+++ I ++  L KL+ L L +N I ++ +I        + L TL L RNP + 
Sbjct: 113 DLSLFNNRISKIDSLDALVKLQVLSLGNNRIDNMMNI--IYLRRFKCLRTLSLSRNPISE 170

Query: 350 SPNYISTLRQIFPNIQQVD 294
           + +Y   +    P++  +D
Sbjct: 171 AEDYKMFICAYLPDLMYLD 189



 Score = 60.5 bits (145), Expect = 8e-08
 Identities = 45/133 (33%), Positives = 69/133 (51%), Gaps = 4/133 (3%)
 Frame = -2

Query: 944 IFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKL 765
           +FK +L   + F  I     L +  + L++L + NN I KIE +E+   L  L+L  N +
Sbjct: 41  LFKDVLSLQLDFRNILRIDNLWQFEN-LRKLQLDNNIIEKIEGLENLAHLVWLDLSFNNI 99

Query: 764 RVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKG---LEECVALE 597
             +E L TL NL++L L  NRI  I +L  L  ++ +S+ +NR+ +M     L     L 
Sbjct: 100 ETIEGLDTLVNLEDLSLFNNRISKIDSLDALVKLQVLSLGNNRIDNMMNIIYLRRFKCLR 159

Query: 596 ELYLSHNGIEKME 558
            L LS N I + E
Sbjct: 160 TLSLSRNPISEAE 172



 Score = 53.9 bits (128), Expect = 7e-06
 Identities = 37/113 (32%), Positives = 55/113 (48%)
 Frame = -2

Query: 674 KCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAI 495
           K +  + +    +  +  L +   L +L L +N IEK+EGL  L +L  LD+S N +  I
Sbjct: 43  KDVLSLQLDFRNILRIDNLWQFENLRKLQLDNNIIEKIEGLENLAHLVWLDLSFNNIETI 102

Query: 494 SNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYI 336
             +  L  LEDL L +N IS ++ +      +L KL  L L  N   N  N I
Sbjct: 103 EGLDTLVNLEDLSLFNNRISKIDSL-----DALVKLQVLSLGNNRIDNMMNII 150



>gb:BC040276_1982774 Homo sapiens hypothetical protein
           DKFZp586M1120, mRNA (cDNA clone MGC:34123
           IMAGE:5172360), complete cds.
          Length = 457

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 46/139 (33%), Positives = 76/139 (54%)
 Frame = -2

Query: 710 RNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLR 531
           RN +R  NL   + ++K+ + +N +  ++GLE    L  L LS N IE +EGL TLVNL 
Sbjct: 53  RNILRIDNLWQFENLRKLQLDNNIIEKIEGLENLAHLVWLDLSFNNIETIEGLDTLVNLE 112

Query: 530 VLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCAN 351
            L +  N+++ I ++  L KL+ L L +N I ++ +I        + L TL L RNP + 
Sbjct: 113 DLSLFNNRISKIDSLDALVKLQVLSLGNNRIDNMMNI--IYLRRFKCLRTLSLSRNPISE 170

Query: 350 SPNYISTLRQIFPNIQQVD 294
           + +Y   +    P++  +D
Sbjct: 171 AEDYKMFICAYLPDLMYLD 189



 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 56/206 (27%), Positives = 96/206 (46%), Gaps = 14/206 (6%)
 Frame = -2

Query: 944 IFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKL 765
           +FK +L   + F  I     L +  + L++L + NN I KIE +E+   L  L+L  N +
Sbjct: 41  LFKDVLSLQLDFRNILRIDNLWQFEN-LRKLQLDNNIIEKIEGLENLAHLVWLDLSFNNI 99

Query: 764 RVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKG---LEECVALE 597
             +E L TL NL++L L  NRI  I +L  L  ++ +S+ +NR+ +M     L     L 
Sbjct: 100 ETIEGLDTLVNLEDLSLFNNRISKIDSLDALVKLQVLSLGNNRIDNMMNIIYLRRFKCLR 159

Query: 596 ELYLSHNGIEKMEGLSTLV----------NLRVLDVSANKLTAISNIANLTKLEDLWLND 447
            L LS N I + E     +          + R +D    KL    +  ++ +L+     +
Sbjct: 160 TLSLSRNPISEAEDYKMFICAYLPDLMYLDYRRIDDHTKKLAEAKHQYSIDELKH---QE 216

Query: 446 NNISSVEDIAEAVAGSLQKLTTLYLE 369
           N + +  +  +A    L+K  T ++E
Sbjct: 217 NLMQAQLEDEQAQREELEKHKTAFVE 242



 Score = 53.9 bits (128), Expect = 7e-06
 Identities = 37/113 (32%), Positives = 55/113 (48%)
 Frame = -2

Query: 674 KCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAI 495
           K +  + +    +  +  L +   L +L L +N IEK+EGL  L +L  LD+S N +  I
Sbjct: 43  KDVLSLQLDFRNILRIDNLWQFENLRKLQLDNNIIEKIEGLENLAHLVWLDLSFNNIETI 102

Query: 494 SNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYI 336
             +  L  LEDL L +N IS ++ +      +L KL  L L  N   N  N I
Sbjct: 103 EGLDTLVNLEDLSLFNNRISKIDSL-----DALVKLQVLSLGNNRIDNMMNII 150



>gb:BC030701_1979923 Homo sapiens KIAA1764 protein, mRNA (cDNA clone
           IMAGE:4837403), partial cds.
          Length = 960

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 63/215 (29%), Positives = 99/215 (46%), Gaps = 6/215 (2%)
 Frame = -2

Query: 920 DVSFNE--ITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENL 747
           DV F +  + S S LS + STL  + +  N I+KIE I+H   LQ L+L SN++  +E L
Sbjct: 52  DVCFMDKGLQSISELS-LDSTLHAVNLHCNNISKIEAIDHIWNLQHLDLSSNQISRIEGL 110

Query: 746 QTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIE 567
            TLT L  L                     ++  N +T ++GLEE + L  L +S+N ++
Sbjct: 111 NTLTKLCTL---------------------NLSCNLITKVEGLEELINLTRLNVSYNHVD 149

Query: 566 KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKL 387
            + GL  L  ++                   KL  + L+ N I S+  + + + G L  L
Sbjct: 150 DLSGLIPLHGIK------------------HKLRYIDLHSNRIDSIHHLLQCMVG-LHFL 190

Query: 386 TTLYLER----NPCANSPNYISTLRQIFPNIQQVD 294
           T L LE+    NP    P Y + + Q  P ++ +D
Sbjct: 191 TNLILEKDGDDNPVCRLPGYRAVILQTLPQLRILD 225



>gb:CR382128_1661122 Yarrowia lipolytica chromosome B of strain CLIB99
            of Yarrowia lipolytica.
          Length = 2052

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 59/188 (31%), Positives = 96/188 (51%), Gaps = 9/188 (4%)
 Frame = -2

Query: 863  LKELYVSNNQIAKIEEI--EHFHELQILELGSNKL-RVMENLQTLTNLQELWLGRNRIR- 696
            L+ L +S N I  + +I  E    L  L+L  N+L R+  N+  L  L+ L L  N +  
Sbjct: 768  LEYLDMSRNMIKDVAQIRFERMSALTTLDLSCNQLTRINNNVALLKQLRRLSLSNNNVTD 827

Query: 695  -AINLCGLKCIKKISIQSNRLTSMKG-LEECVALEELYLSHNGIEKMEG-LSTLVNLRVL 525
              + +C L  + ++ +  NRL+S+   + + V LE L L++N I K+   +  LV L+ L
Sbjct: 828  FPMAVCNLSNLIELDLSFNRLSSVPASISKLVNLERLVLNNNYISKLPNDIKNLVQLKEL 887

Query: 524  DVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPC--AN 351
            DV  N+L  +  +++L  LE L+ + N I+S E        + + L  LY +RNP    N
Sbjct: 888  DVRYNRLNNVDALSSLPLLEVLYASKNQITSYEH-------NFESLQCLYFDRNPFTEVN 940

Query: 350  SPNYISTL 327
              N + TL
Sbjct: 941  VSNVLHTL 948



 Score = 53.9 bits (128), Expect = 7e-06
 Identities = 61/226 (26%), Positives = 113/226 (50%), Gaps = 28/226 (12%)
 Frame = -2

Query: 932  LLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKLRV 759
            L+  D+SFN ++S P+ +SK+ + L+ L ++NN I+K+  +I++  +L+ L++  N+L  
Sbjct: 838  LIELDLSFNRLSSVPASISKLVN-LERLVLNNNYISKLPNDIKNLVQLKELDVRYNRLNN 896

Query: 758  MENLQTLTNLQELWLGRNRIRAI--NLCGLKCI-------KKISIQSNRLTSMKGLEECV 606
            ++ L +L  L+ L+  +N+I +   N   L+C+        ++++ SN L ++  L    
Sbjct: 897  VDALSSLPLLEVLYASKNQITSYEHNFESLQCLYFDRNPFTEVNV-SNVLHTLTVLHLSK 955

Query: 605  A---------------LEELYLSHNGIEKM-EGLSTLVNLRVLDVSANKLTAI-SNIANL 477
            A               LE+L L  N    +   L +L  L  L    N L+ + S+I  L
Sbjct: 956  AKLSTLPENFFDRLPNLEKLVLDKNHFVSLPSSLGSLRKLIYLSAVGNNLSVLPSSIGQL 1015

Query: 476  TKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNY 339
            T L+ L L+ NN+  + D       +L  L+TL +  N   + P +
Sbjct: 1016 TTLQFLDLHSNNLRKLPD----EIWNLNVLSTLNVSSNLLDSFPKH 1057



>gb:AF427998_1270118 Drosophila melanogaster protein phosphatase
           regulatory subunit short isoform mRNA, complete cds.
          Length = 223

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 56/170 (32%), Positives = 87/170 (51%)
 Frame = -2

Query: 848 VSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKC 669
           + N  + +   ++H H  +   L   +  V+E  Q LT   E     N +R  +L  L  
Sbjct: 28  IINRSLIESSYLKHVHRGEGRRLHQLEPVVLE--QILTMRLEF---NNILRIDHLWILPN 82

Query: 668 IKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISN 489
           + K+ +  N++ +++ +E    L++L LS N IEK+E L TLVNL VL + +NK+ AI N
Sbjct: 83  LTKLCLNCNKIETIENIEMLTNLKDLNLSFNFIEKIENLDTLVNLEVLSLFSNKIEAIEN 142

Query: 488 IANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNY 339
           I  LT L  + L +N I +VE I       +  L  + LE NP A   N+
Sbjct: 143 IDMLTMLVIISLGNNLIDTVEGIER--FRFMNNLKIINLEGNPIAKRTNF 190



 Score = 51.6 bits (122), Expect = 4e-05
 Identities = 37/111 (33%), Positives = 61/111 (54%), Gaps = 1/111 (0%)
 Frame = -2

Query: 944 IFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKL 765
           + +++L   + FN I     L  +   L +L ++ N+I  IE IE    L+ L L  N +
Sbjct: 57  VLEQILTMRLEFNNILRIDHLW-ILPNLTKLCLNCNKIETIENIEMLTNLKDLNLSFNFI 115

Query: 764 RVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLE 615
             +ENL TL NL+ L L  N+I AI N+  L  +  IS+ +N + +++G+E
Sbjct: 116 EKIENLDTLVNLEVLSLFSNKIEAIENIDMLTMLVIISLGNNLIDTVEGIE 166



>gb:AF427495_1270019 Drosophila melanogaster protein phosphatase 1
           regulatory subunit (PprY) mRNA, complete cds.
          Length = 569

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 56/170 (32%), Positives = 87/170 (51%)
 Frame = -2

Query: 848 VSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKC 669
           + N  + +   ++H H  +   L   +  V+E  Q LT   E     N +R  +L  L  
Sbjct: 28  IINRSLIESSYLKHVHRGEGRRLHQLEPVVLE--QILTMRLEF---NNILRIDHLWILPN 82

Query: 668 IKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISN 489
           + K+ +  N++ +++ +E    L++L LS N IEK+E L TLVNL VL + +NK+ AI N
Sbjct: 83  LTKLCLNCNKIETIENIEMLTNLKDLNLSFNFIEKIENLDTLVNLEVLSLFSNKIEAIEN 142

Query: 488 IANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNY 339
           I  LT L  + L +N I +VE I       +  L  + LE NP A   N+
Sbjct: 143 IDMLTMLVIISLGNNLIDTVEGIER--FRFMNNLKIINLEGNPIAKRTNF 190



 Score = 51.6 bits (122), Expect = 4e-05
 Identities = 37/111 (33%), Positives = 61/111 (54%), Gaps = 1/111 (0%)
 Frame = -2

Query: 944 IFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKL 765
           + +++L   + FN I     L  +   L +L ++ N+I  IE IE    L+ L L  N +
Sbjct: 57  VLEQILTMRLEFNNILRIDHLW-ILPNLTKLCLNCNKIETIENIEMLTNLKDLNLSFNFI 115

Query: 764 RVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLE 615
             +ENL TL NL+ L L  N+I AI N+  L  +  IS+ +N + +++G+E
Sbjct: 116 EKIENLDTLVNLEVLSLFSNKIEAIENIDMLTMLVIISLGNNLIDTVEGIE 166



>gb:HSM801891_1186545 Homo sapiens mRNA; cDNA DKFZp586M1120 (from
           clone DKFZp586M1120).>gb:BC050419_1984330 Homo sapiens
           hypothetical protein DKFZp586M1120, mRNA (cDNA clone
           MGC:54111 IMAGE:5766999), complete cds.
          Length = 523

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 46/139 (33%), Positives = 76/139 (54%)
 Frame = -2

Query: 710 RNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLR 531
           RN +R  NL   + ++K+ + +N +  ++GLE    L  L LS N IE +EGL TLVNL 
Sbjct: 53  RNILRIDNLWQFENLRKLQLDNNIIEKIEGLENLAHLVWLDLSFNNIETIEGLDTLVNLE 112

Query: 530 VLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCAN 351
            L +  N+++ I ++  L KL+ L L +N I ++ +I        + L TL L RNP + 
Sbjct: 113 DLSLFNNRISKIDSLDALVKLQVLSLGNNRIDNMMNI--IYLRRFKCLRTLSLSRNPISE 170

Query: 350 SPNYISTLRQIFPNIQQVD 294
           + +Y   +    P++  +D
Sbjct: 171 AEDYKMFICAYLPDLMYLD 189



 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 56/206 (27%), Positives = 96/206 (46%), Gaps = 14/206 (6%)
 Frame = -2

Query: 944 IFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKL 765
           +FK +L   + F  I     L +  + L++L + NN I KIE +E+   L  L+L  N +
Sbjct: 41  LFKDVLSLQLDFRNILRIDNLWQFEN-LRKLQLDNNIIEKIEGLENLAHLVWLDLSFNNI 99

Query: 764 RVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKG---LEECVALE 597
             +E L TL NL++L L  NRI  I +L  L  ++ +S+ +NR+ +M     L     L 
Sbjct: 100 ETIEGLDTLVNLEDLSLFNNRISKIDSLDALVKLQVLSLGNNRIDNMMNIIYLRRFKCLR 159

Query: 596 ELYLSHNGIEKMEGLSTLV----------NLRVLDVSANKLTAISNIANLTKLEDLWLND 447
            L LS N I + E     +          + R +D    KL    +  ++ +L+     +
Sbjct: 160 TLSLSRNPISEAEDYKMFICAYLPDLMYLDYRRIDDHTKKLAEAKHQYSIDELKH---QE 216

Query: 446 NNISSVEDIAEAVAGSLQKLTTLYLE 369
           N + +  +  +A    L+K  T ++E
Sbjct: 217 NLMQAQLEDEQAQREELEKHKTAFVE 242



 Score = 53.9 bits (128), Expect = 7e-06
 Identities = 37/113 (32%), Positives = 55/113 (48%)
 Frame = -2

Query: 674 KCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAI 495
           K +  + +    +  +  L +   L +L L +N IEK+EGL  L +L  LD+S N +  I
Sbjct: 43  KDVLSLQLDFRNILRIDNLWQFENLRKLQLDNNIIEKIEGLENLAHLVWLDLSFNNIETI 102

Query: 494 SNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYI 336
             +  L  LEDL L +N IS ++ +      +L KL  L L  N   N  N I
Sbjct: 103 EGLDTLVNLEDLSLFNNRISKIDSL-----DALVKLQVLSLGNNRIDNMMNII 150



>gb:AE017290_433052 Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130, chromosome I, section 4 of 14 of the
           complete sequence.>gb:AE016823_1066063 Leptospira
           interrogans serovar Copenhageni str. Fiocruz L1-130,
           chromosome I, complete sequence.
          Length = 402

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 56/178 (31%), Positives = 99/178 (55%), Gaps = 7/178 (3%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKLR 762
           K L   ++  N +T+ S   +    LK L + +NQ+    +EI     LQ+L+LGSN+L 
Sbjct: 209 KNLQTLNLRNNRLTTLSKEIEQLQNLKSLDLRSNQLTIFPKEIGQLKNLQVLDLGSNQLT 268

Query: 761 VM-ENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALEE 594
            + E +  L NLQ L L  N++  +   +  LK ++ + +  N+L ++ K +E+   L+ 
Sbjct: 269 TLPEGIGQLKNLQTLDLDSNQLTTLPQEIKQLKNLQLLDLSYNQLKTLPKEIEQLKNLQT 328

Query: 593 LYLSHNGIEKM-EGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSVE 426
           LYL +N +  + + +  L NL+VL ++ N+LT +   I  L  L++L+LN+N +S  E
Sbjct: 329 LYLGYNQLTVLPKEIGQLQNLKVLFLNNNQLTTLPKEIGQLKNLQELYLNNNQLSIEE 386



 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 64/215 (29%), Positives = 113/215 (52%), Gaps = 8/215 (3%)
 Frame = -2

Query: 938 KKLLVFDVSFNEI-TSPSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKL 765
           K L   ++S N+I T P  + K+   L+ LY+ NNQ+  + +EI    +LQ L L  N+L
Sbjct: 25  KNLRKLNLSANQIKTIPKEIEKLQK-LQSLYLPNNQLTTLPQEIGQLQKLQWLYLPKNQL 83

Query: 764 RVM-ENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALE 597
             + + +  L NL+ L L  N+I+ I   +  L+ ++ + + +N+LT++ + + +   L+
Sbjct: 84  TTLPQEIGQLKNLKSLNLSYNQIKTIPKEIEKLQKLQSLGLDNNQLTTLPQEIGQLQNLQ 143

Query: 596 ELYLSHNGIEKM-EGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSVED 423
            L LS N +  + + +  L NL+ LD+S N+LT +   I +L  L++L+L  N ++    
Sbjct: 144 SLDLSTNRLTTLPQEIGQLQNLQSLDLSTNRLTTLPQEIGHLQNLQELYLVSNQLT---- 199

Query: 422 IAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQI 318
           I     G L+ L TL L  N        I  L+ +
Sbjct: 200 ILPNEIGQLKNLQTLNLRNNRLTTLSKEIEQLQNL 234



 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 62/215 (28%), Positives = 111/215 (51%), Gaps = 8/215 (3%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKL 765
           + L   D+S N +T+ P  +  + + L+ELY+ +NQ+  +  EI     LQ L L +N+L
Sbjct: 163 QNLQSLDLSTNRLTTLPQEIGHLQN-LQELYLVSNQLTILPNEIGQLKNLQTLNLRNNRL 221

Query: 764 RVM-ENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALE 597
             + + ++ L NL+ L L  N++      +  LK ++ + + SN+LT++ +G+ +   L+
Sbjct: 222 TTLSKEIEQLQNLKSLDLRSNQLTIFPKEIGQLKNLQVLDLGSNQLTTLPEGIGQLKNLQ 281

Query: 596 ELYLSHNGIEKM-EGLSTLVNLRVLDVSANKL-TAISNIANLTKLEDLWLNDNNISSVED 423
            L L  N +  + + +  L NL++LD+S N+L T    I  L  L+ L+L  N ++    
Sbjct: 282 TLDLDSNQLTTLPQEIKQLKNLQLLDLSYNQLKTLPKEIEQLKNLQTLYLGYNQLT---- 337

Query: 422 IAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQI 318
           +     G LQ L  L+L  N     P  I  L+ +
Sbjct: 338 VLPKEIGQLQNLKVLFLNNNQLTTLPKEIGQLKNL 372



 Score = 47.4 bits (111), Expect = 7e-04
 Identities = 33/97 (34%), Positives = 53/97 (54%), Gaps = 2/97 (2%)
 Frame = -2

Query: 602 LEELYLSHNGIEKM-EGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSV 429
           L+EL L+ N +  + + +  L NLR L++SAN++  I   I  L KL+ L+L +N ++++
Sbjct: 4   LQELNLNKNQLTILPKEIGQLKNLRKLNLSANQIKTIPKEIEKLQKLQSLYLPNNQLTTL 63

Query: 428 EDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQI 318
                   G LQKL  LYL +N     P  I  L+ +
Sbjct: 64  PQ----EIGQLQKLQWLYLPKNQLTTLPQEIGQLKNL 96



>gb:AE016999_375528 Bacillus cereus ATCC 14579 section 2 of 18 of
           the complete genome.>gb:AE016877_1015778 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 886

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 51/206 (24%), Positives = 105/206 (50%), Gaps = 6/206 (2%)
 Frame = -2

Query: 962 ENSGVSIFKKLLVFDVSFNEITSPSGLSKVS-----STLKELYVSNNQIAKIEEIEHFHE 798
           +N    I KK L+  +    I S  G++K++     + L++L +  + +  I  I     
Sbjct: 65  DNVDAPITKKDLL-QIKTLSIYSGKGINKITGLEYMTNLEKLTLRKSNVKDISAISKLRG 123

Query: 797 LQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKG 621
           L+ ++L SN +  +  ++ L N+  L+L  N+I  +  L  +K IK + +  N +  ++ 
Sbjct: 124 LKYVDLTSNSIESIHPIEQLENINMLFLRDNKISDLTPLSKMKKIKTLDLIGNNIKDIQP 183

Query: 620 LEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNN 441
           L     +++LYL++N I  + G+  L N+ +L +  NK+  + +I+ ++ L +L ++D+ 
Sbjct: 184 LFTLSTMKQLYLANNQISDLTGIDRLNNVELLWIGNNKINNVESISKMSNLIELEISDSE 243

Query: 440 ISSVEDIAEAVAGSLQKLTTLYLERN 363
           I  +  +++     L  L  L LE N
Sbjct: 244 IKDISPLSQ-----LGNLQVLNLEEN 264



 Score = 63.5 bits (153), Expect = 9e-09
 Identities = 43/160 (26%), Positives = 79/160 (49%)
 Frame = -2

Query: 950 VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN 771
           +S  KK+   D+  N I     L  +S T+K+LY++NNQI+ +  I+  + +++L +G+N
Sbjct: 162 LSKMKKIKTLDLIGNNIKDIQPLFTLS-TMKQLYLANNQISDLTGIDRLNNVELLWIGNN 220

Query: 770 KLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEEL 591
           K+  +E++  ++NL EL                      I  + +  +  L +   L+ L
Sbjct: 221 KINNVESISKMSNLIEL---------------------EISDSEIKDISPLSQLGNLQVL 259

Query: 590 YLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTK 471
            L  N I  +  LSTL NL  +++ AN++  +  +  L K
Sbjct: 260 NLEENYISDISPLSTLTNLHEINLGANEIFDVRPVEELGK 299



>gb:BC072707_2556637 Danio rerio zgc:91834, mRNA (cDNA clone
           MGC:91834 IMAGE:7037205), complete cds.
          Length = 329

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 57/226 (25%), Positives = 101/226 (44%)
 Frame = -2

Query: 965 EENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQIL 786
           EE   +S+ + L V  +  N+I+    L   +S L  LY+ NN I+ IE +   H+L  L
Sbjct: 42  EEIDDLSVCRNLTVLYLYDNQISQICNLG-FASNLTHLYMQNNNISCIENLSSLHKLSKL 100

Query: 785 ELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECV 606
            LG N + V+E L+ L +L+EL +   +        L C +K++   + ++S+       
Sbjct: 101 FLGGNSITVVEGLEELKSLKELHVEGQK--------LPCGEKLAFDPHSISSLS------ 146

Query: 605 ALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVE 426
                                  L +L++S N +  + ++A L K+  L+  DN +  ++
Sbjct: 147 ---------------------ETLCILNISKNNIDELWDLAPLRKMTHLFAADNQLHDIQ 185

Query: 425 DIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSE 288
           ++ E V     KL  L L RNP  + P Y   L  +   +  +D +
Sbjct: 186 EL-ETVFSQWFKLRLLDLSRNPVCHKPKYRDRLITVCKFLDDLDGK 230



>gb:AF250284_2221587 Amsacta moorei entomopoxvirus, complete
           genome.>gb:AF250284_2221878 Amsacta moorei
           entomopoxvirus, complete genome.
          Length = 460

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 55/208 (26%), Positives = 96/208 (46%), Gaps = 23/208 (11%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRA--- 693
           LKEL  +N  I  +E IE+F +L  L   + ++  ++ ++ L  L+EL+     I +   
Sbjct: 52  LKELIYNNYYIKSLEGIENFTKLIKLYCYNTRIDSLKGIENLIKLKELYCFNTNINSLVY 111

Query: 692 ----INLCGLKC----------------IKKISIQSNRLTSMKGLEECVALEELYLSHNG 573
               INL  L C                +K+       + S+K ++  + L++L  SH  
Sbjct: 112 LKNLINLTELYCFETNIYSLKGIENLINLKEFDCSYTLIDSLKEIKNLINLQKLNCSHTI 171

Query: 572 IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQ 393
           I  +EG+  L+NL  LD S   + ++  I NL  L+ L   + NI S++++   +  +L+
Sbjct: 172 IYSLEGIENLINLEKLDCSYTSINSLKEIKNLINLKKLECYETNIYSLKELQNLI--NLK 229

Query: 392 KLTTLYLERNPCANSPNYISTLRQIFPN 309
           KL   Y + N      N I+  +  F N
Sbjct: 230 KLDCSYTKINSLKELQNLINLKKLDFHN 257



 Score = 70.5 bits (171), Expect = 7e-11
 Identities = 53/196 (27%), Positives = 98/196 (50%), Gaps = 1/196 (0%)
 Frame = -2

Query: 971 SAEENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQ 792
           S +E   +   KKL   D S+ +I S   L  + + LK+L   N  I  ++ IE+   ++
Sbjct: 218 SLKELQNLINLKKL---DCSYTKINSLKELQNLIN-LKKLDFHNTNIYSLKGIENLINIE 273

Query: 791 ILELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLC-GLKCIKKISIQSNRLTSMKGLE 615
            L   +  +  ++ L+ LTNL+ L      I  I +   L  ++++     ++ S+KG+E
Sbjct: 274 KLNCSNTNIDSLKYLENLTNLKNLICYGINIDFIEILKNLINLEELDCSETKIVSLKGIE 333

Query: 614 ECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNIS 435
             + L+EL  S+  I  ++G+  L+NL+ LD S  K+ ++    NL  LE +      + 
Sbjct: 334 NLINLKELDCSYTKINSLKGIENLINLKKLDCSYTKIDSLKQTKNLINLEQIHCYVTELD 393

Query: 434 SVEDIAEAVAGSLQKL 387
           S++ I   +  +L+KL
Sbjct: 394 SLKGIENLI--NLKKL 407



 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 39/143 (27%), Positives = 78/143 (54%), Gaps = 1/143 (0%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAINL 684
           L+EL  S  +I  ++ IE+   L+ L+    K+  ++ ++ L NL++L     +I ++  
Sbjct: 316 LEELDCSETKIVSLKGIENLINLKELDCSYTKINSLKGIENLINLKKLDCSYTKIDSLKQ 375

Query: 683 C-GLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANK 507
              L  +++I      L S+KG+E  + L++L+  +  I  ++G+  L+NL +L  +   
Sbjct: 376 TKNLINLEQIHCYVTELDSLKGIENLINLKKLFCHNTKINSLKGIENLINLEILYCNNTN 435

Query: 506 LTAISNIANLTKLEDLWLNDNNI 438
           + ++  I NL KLE+L+  + NI
Sbjct: 436 IISLEGIKNLIKLEELYYFNTNI 458



 Score = 60.8 bits (146), Expect = 6e-08
 Identities = 46/189 (24%), Positives = 94/189 (49%), Gaps = 1/189 (0%)
 Frame = -2

Query: 971 SAEENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQ 792
           S +E   +   KKL   D     I S  G+  + + +++L  SN  I  ++ +E+   L+
Sbjct: 240 SLKELQNLINLKKL---DFHNTNIYSLKGIENLIN-IEKLNCSNTNIDSLKYLENLTNLK 295

Query: 791 ILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLE 615
            L      +  +E L+ L NL+EL     +I ++  +  L  +K++     ++ S+KG+E
Sbjct: 296 NLICYGINIDFIEILKNLINLEELDCSETKIVSLKGIENLINLKELDCSYTKINSLKGIE 355

Query: 614 ECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNIS 435
             + L++L  S+  I+ ++    L+NL  +     +L ++  I NL  L+ L+ ++  I+
Sbjct: 356 NLINLKKLDCSYTKIDSLKQTKNLINLEQIHCYVTELDSLKGIENLINLKKLFCHNTKIN 415

Query: 434 SVEDIAEAV 408
           S++ I   +
Sbjct: 416 SLKGIENLI 424



>gb:AF121028_480752 Listeria monocytogenes strain 1065 internalin B
           precursor (inlB) gene, partial cds.>gb:AF121029_480753
           Listeria monocytogenes strain 1419 internalin B
           precursor (inlB) gene, partial cds.>gb:AF121030_480754
           Listeria monocytogenes strain 2324 internalin B
           precursor (inlB) gene, partial cds.>gb:AF121031_480755
           Listeria monocytogenes strain 2393 internalin B
           precursor (inlB) gene, partial cds.>gb:AF121036_480760
           Listeria monocytogenes strain 594 internalin B precursor
           (inlB) gene, partial cds.>gb:AF121037_480761 Listeria
           monocytogenes strain 1181 internalin B precursor (inlB)
           gene, partial cds.>gb:AF121038_480762 Listeria
           monocytogenes strain 1513 internalin B precursor (inlB)
           gene, partial cds.>gb:AF121039_480763 Listeria
           monocytogenes strain 1805 internalin B precursor (inlB)
           gene, partial cds.
          Length = 504

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 52/158 (32%), Positives = 88/158 (55%), Gaps = 3/158 (1%)
 Frame = -2

Query: 749 LQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNG 573
           L  L NL  L+L  N+I+ ++ L  LK +K +S++ N ++ + GL   + LE LYL +N 
Sbjct: 3   LANLKNLGWLFLDENKIKDLSSLKDLKKLKSLSLEHNGISDINGLVHLLQLESLYLGNNK 62

Query: 572 IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQ 393
           +  +  LS L  L  L +  N+++ I  ++ LTKL++L+L+ N+IS +  +A      L+
Sbjct: 63  LTDITILSRLTKLDTLSLEDNEISDIVPLSGLTKLQNLYLSKNHISDLRALA-----GLK 117

Query: 392 KLTTLYLERNPCAN-SPNYISTLRQIFPN-IQQVDSEL 285
            L  L L    C N S N+ + L  + PN ++ +D  L
Sbjct: 118 NLDVLELFSQECLNKSINHQTNL--VVPNTVKNIDGSL 153



 Score = 45.1 bits (105), Expect = 0.003
 Identities = 32/105 (30%), Positives = 52/105 (49%), Gaps = 1/105 (0%)
 Frame = -2

Query: 956 SGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELG 777
           S +   KKL    +  N I+  +GL  +   L+ LY+ NN++  I  +    +L  L L 
Sbjct: 23  SSLKDLKKLKSLSLEHNGISDINGLVHLLQ-LESLYLGNNKLTDITILSRLTKLDTLSLE 81

Query: 776 SNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQS 645
            N++  +  L  LT LQ L+L +N I  +  L GLK +  + + S
Sbjct: 82  DNEISDIVPLSGLTKLQNLYLSKNHISDLRALAGLKNLDVLELFS 126



>gb:AE011451_273099 Leptospira interrogans serovar lai str. 56601
           chromosome I, section 260 of 397 of the complete
           sequence.>gb:AE010300_1006498 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete sequence.
          Length = 288

 Score = 72.0 bits (175), Expect = 3e-11
 Identities = 65/218 (29%), Positives = 114/218 (52%), Gaps = 11/218 (5%)
 Frame = -2

Query: 938 KKLLVFDVSFNEI----TSPSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGS 774
           K +LV D   NE     T P  +  + + LKELY+S N+I  +  EI +   LQ+L L  
Sbjct: 47  KDVLVLDYRDNEENPLKTLPKEIGNLQN-LKELYLSANEITTLPPEIGNLKNLQVLSLNG 105

Query: 773 NKLR-VMENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECV 606
           N+L  + + +  L NL+EL +  N+++ +   +  LK +K++ +  N+L  + + +    
Sbjct: 106 NRLETIPKEIGNLKNLKELSIEWNKLQTLPKEIGNLKNLKELYLSRNQLKILPQEIGNLR 165

Query: 605 ALEELYLSHNGIEKM-EGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISS 432
            L+ ++LS N + K+ + +  L +L  + +  N+ T +   I NL  L +L L  N + S
Sbjct: 166 KLQRIHLSTNELTKLPQEIKNLESLLEIYLYDNQFTTLPKEIGNLKNLRNLVLGRNQLIS 225

Query: 431 VEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQI 318
           +  + E   G+L+ L  LYLE N     P  I+ L+Q+
Sbjct: 226 L--LPE--IGNLKNLKELYLEENQLTMLPKQIAALKQL 259



 Score = 47.8 bits (112), Expect = 5e-04
 Identities = 40/151 (26%), Positives = 82/151 (54%), Gaps = 7/151 (4%)
 Frame = -2

Query: 938 KKLLVFDVSFNEI-TSPSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKL 765
           K L    + +N++ T P  +  + + LKELY+S NQ+  + +EI +  +LQ + L +N+L
Sbjct: 119 KNLKELSIEWNKLQTLPKEIGNLKN-LKELYLSRNQLKILPQEIGNLRKLQRIHLSTNEL 177

Query: 764 -RVMENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTS-MKGLEECVALE 597
            ++ + ++ L +L E++L  N+   +   +  LK ++ + +  N+L S +  +     L+
Sbjct: 178 TKLPQEIKNLESLLEIYLYDNQFTTLPKEIGNLKNLRNLVLGRNQLISLLPEIGNLKNLK 237

Query: 596 ELYLSHNGIEKM-EGLSTLVNLRVLDVSANK 507
           ELYL  N +  + + ++ L  L  L +  N+
Sbjct: 238 ELYLEENQLTMLPKQIAALKQLARLSLKGNQ 268



 Score = 45.4 bits (106), Expect = 0.003
 Identities = 32/107 (29%), Positives = 59/107 (55%), Gaps = 4/107 (3%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKL- 765
           +KL    +S NE+T      K   +L E+Y+ +NQ   + +EI +   L+ L LG N+L 
Sbjct: 165 RKLQRIHLSTNELTKLPQEIKNLESLLEIYLYDNQFTTLPKEIGNLKNLRNLVLGRNQLI 224

Query: 764 RVMENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTS 630
            ++  +  L NL+EL+L  N++  +   +  LK + ++S++ N+  S
Sbjct: 225 SLLPEIGNLKNLKELYLEENQLTMLPKQIAALKQLARLSLKGNQFPS 271



>gb:BC041085_1982963 Homo sapiens leucine-rich repeats and IQ motif
           containing 2, mRNA (cDNA clone MGC:45383 IMAGE:5528397),
           complete cds.
          Length = 865

 Score = 71.6 bits (174), Expect = 3e-11
 Identities = 49/140 (35%), Positives = 77/140 (55%), Gaps = 1/140 (0%)
 Frame = -2

Query: 779 GSNKLRVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA 603
           G    ++  NL    ++  L L +N+I  + NL   K + ++S+ +NRL  M G+ +   
Sbjct: 22  GQGLQKLGPNLPCEADIHTLILDKNQIIKLENLEKCKRLIQLSVANNRLVRMMGVAKLTL 81

Query: 602 LEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVED 423
           L  L L HN I  +EGL  LV+L  L+++ N L A+  I + T L+ L L+DNNIS + D
Sbjct: 82  LRVLNLPHNSIGCVEGLKELVHLEWLNLAGNNLKAMEQINSCTALQHLDLSDNNISQIGD 141

Query: 422 IAEAVAGSLQKLTTLYLERN 363
           +++ V+     L TL L  N
Sbjct: 142 LSKLVS-----LKTLLLHGN 156



 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 60/189 (31%), Positives = 94/189 (49%), Gaps = 9/189 (4%)
 Frame = -2

Query: 896 SPSGLSKVSSTLK------ELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLT 735
           S  GL K+   L        L +  NQI K+E +E    L  L + +N+L  M  +  LT
Sbjct: 21  SGQGLQKLGPNLPCEADIHTLILDKNQIIKLENLEKCKRLIQLSVANNRLVRMMGVAKLT 80

Query: 734 NLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKME 558
            L+ L L  N I  +  L  L  ++ +++  N L +M+ +  C AL+ L LS N I ++ 
Sbjct: 81  LLRVLNLPHNSIGCVEGLKELVHLEWLNLAGNNLKAMEQINSCTALQHLDLSDNNISQIG 140

Query: 557 GLSTLVNLRVLDVSANKLTAISNI-ANLTK-LEDLWLNDNNISSVEDIAEAVAGSLQKLT 384
            LS LV+L+ L +  N +T++    A L + L  L L +N I  + +I  +   SL +L 
Sbjct: 141 DLSKLVSLKTLLLHGNIITSLRMAPAYLPRSLAILSLAENEIRDLNEI--SFLASLTELE 198

Query: 383 TLYLERNPC 357
            L +  NPC
Sbjct: 199 QLSIMNNPC 207



>gb:AF121044_480768 Listeria monocytogenes strain 498 internalin B
           precursor (inlB) gene, partial cds.>gb:AF121045_480769
           Listeria monocytogenes strain 502 internalin B precursor
           (inlB) gene, partial cds.>gb:AF121046_480770 Listeria
           monocytogenes strain 526 internalin B precursor (inlB)
           gene, partial cds.>gb:AF121047_480771 Listeria
           monocytogenes strain 559 internalin B precursor (inlB)
           gene, partial cds.
          Length = 504

 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 52/158 (32%), Positives = 87/158 (55%), Gaps = 3/158 (1%)
 Frame = -2

Query: 749 LQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNG 573
           L  L NL  L+L  N+I+ ++ L  LK +K +S++ N ++ + GL   + LE LYL +N 
Sbjct: 3   LANLKNLGWLFLDENKIKDLSSLKDLKKLKSLSLEHNGISDINGLVHLLQLESLYLGNNK 62

Query: 572 IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQ 393
           +  +  LS L  L  L +  N+++ I  ++ LTKL++L+L+ N+IS +  +A      L+
Sbjct: 63  LTDITILSRLTKLDTLSLEDNEISDIVPLSGLTKLQNLYLSKNHISDLRALA-----GLK 117

Query: 392 KLTTLYLERNPCAN-SPNYISTLRQIFPN-IQQVDSEL 285
            L  L L    C N S N+   L  + PN ++ +D  L
Sbjct: 118 NLDVLELFSQECLNKSINHQMNL--VVPNTVKNIDGSL 153



 Score = 45.1 bits (105), Expect = 0.003
 Identities = 32/105 (30%), Positives = 52/105 (49%), Gaps = 1/105 (0%)
 Frame = -2

Query: 956 SGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELG 777
           S +   KKL    +  N I+  +GL  +   L+ LY+ NN++  I  +    +L  L L 
Sbjct: 23  SSLKDLKKLKSLSLEHNGISDINGLVHLLQ-LESLYLGNNKLTDITILSRLTKLDTLSLE 81

Query: 776 SNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQS 645
            N++  +  L  LT LQ L+L +N I  +  L GLK +  + + S
Sbjct: 82  DNEISDIVPLSGLTKLQNLYLSKNHISDLRALAGLKNLDVLELFS 126



>gb:AL772146_2504462 Zebrafish DNA sequence from clone CH211-12P8 in
           linkage group 7 Contains part of a novel gene similar to
           SCRIB (scrribble), a novel gene similar to SIAHBP1
           (fuse-binding protein-interacting repressor), a novel
           gene similar to HTR5A (5-hydroxytryptamine (serotonin)
           receptor 5A) and three CpG islands, complete sequence.
          Length = 1181

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 59/199 (29%), Positives = 107/199 (53%), Gaps = 7/199 (3%)
 Frame = -2

Query: 920 DVSFNEITSPSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKLRVM-ENL 747
           DVS   +  P+ +  +S+ L  L +  N +  +   +    +L+ L+LGSN L V+ + L
Sbjct: 84  DVSLQSL--PNDIGNLSN-LVTLELRENLLKSLPSSLSFLVKLEQLDLGSNVLEVLPDTL 140

Query: 746 QTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSMKG-LEECVALEELYLSHN 576
             L NL+ELWL RN++ ++   L  L+ +  + +  NRL+ +   +   +AL +L LS N
Sbjct: 141 GALPNLRELWLDRNQLSSLPPELGNLRQLVCLDVSENRLSELPTEISGLIALTDLLLSEN 200

Query: 575 GIEKM-EGLSTLVNLRVLDVSANKLTAISN-IANLTKLEDLWLNDNNISSVEDIAEAVAG 402
            +E + + + +L  L +L V+ N+L  +++ I     L +L L +N + S+        G
Sbjct: 201 LLEILPDSIGSLKKLSILKVNQNRLVHLTDSIGECENLTELMLTENLLQSLP----RSLG 256

Query: 401 SLQKLTTLYLERNPCANSP 345
            L+KLT L ++RN  ++ P
Sbjct: 257 KLKKLTNLNVDRNRLSSVP 275



 Score = 58.5 bits (140), Expect(2) = 2e-10
 Identities = 53/173 (30%), Positives = 97/173 (56%), Gaps = 8/173 (4%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKL 765
           ++L+  DVS N ++  P+ +S + + L +L +S N +  + + I    +L IL++  N+L
Sbjct: 167 RQLVCLDVSENRLSELPTEISGLIA-LTDLLLSENLLEILPDSIGSLKKLSILKVNQNRL 225

Query: 764 -RVMENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSMKG-LEECVALE 597
             + +++    NL EL L  N ++++  +L  LK +  +++  NRL+S+   L  CV+L 
Sbjct: 226 VHLTDSIGECENLTELMLTENLLQSLPRSLGKLKKLTNLNVDRNRLSSVPAELGGCVSLN 285

Query: 596 ELYLSHNGIEKMEG-LSTLVNLRVLDVSANKLTAIS-NIANLTKLEDLWLNDN 444
            L L  N + K+   L+    L VLDV+ N+L  +   +ANL  L+ +WL +N
Sbjct: 286 VLSLRDNRLGKLPPELANATELHVLDVAGNRLQNLPFALANL-NLKAMWLAEN 337



 Score = 51.2 bits (121), Expect = 5e-05
 Identities = 47/168 (27%), Positives = 82/168 (48%), Gaps = 6/168 (3%)
 Frame = -2

Query: 803 HELQILELGSNKLRVME-NLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLT 633
           H L+ L L  N+++ +  ++   T L EL + RN I  I  N+   + ++      N LT
Sbjct: 6   HNLRKLGLSDNEIQKLPPDVANFTQLVELDISRNDISEIPENIKFCQSLEIADFSGNPLT 65

Query: 632 SMK-GLEECVALEELYLSHNGIEKMEG-LSTLVNLRVLDVSANKLTAI-SNIANLTKLED 462
            +  G  +   L  L L+   ++ +   +  L NL  L++  N L ++ S+++ L KLE 
Sbjct: 66  RLPDGFTQLRGLAHLSLNDVSLQSLPNDIGNLSNLVTLELRENLLKSLPSSLSFLVKLEQ 125

Query: 461 LWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQI 318
           L L  N +  + D      G+L  L  L+L+RN  ++ P  +  LRQ+
Sbjct: 126 LDLGSNVLEVLPD----TLGALPNLRELWLDRNQLSSLPPELGNLRQL 169



 Score = 33.5 bits (75), Expect(2) = 0.68
 Identities = 21/80 (26%), Positives = 41/80 (51%), Gaps = 1/80 (1%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIE-EIEHFHELQILELGSNKLR 762
           KKL   +V  N ++S         +L  L + +N++ K+  E+ +  EL +L++  N+L+
Sbjct: 259 KKLTNLNVDRNRLSSVPAELGGCVSLNVLSLRDNRLGKLPPELANATELHVLDVAGNRLQ 318

Query: 761 VMENLQTLTNLQELWLGRNR 702
            +       NL+ +WL  N+
Sbjct: 319 NLPFALANLNLKAMWLAENQ 338



 Score = 30.8 bits (68), Expect(2) = 2e-10
 Identities = 24/68 (35%), Positives = 33/68 (48%), Gaps = 4/68 (5%)
 Frame = -3

Query: 1117 LSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP----V 950
            L +L   I +LSNL    LR+NL+        SS   + +LE+L L  N L+ +P     
Sbjct: 87   LQSLPNDIGNLSNLVTLELRENLLKSLP----SSLSFLVKLEQLDLGSNVLEVLPDTLGA 142

Query: 949  LAYLRNFW 926
            L  LR  W
Sbjct: 143  LPNLRELW 150



 Score = 22.7 bits (47), Expect(2) = 0.68
 Identities = 23/76 (30%), Positives = 32/76 (42%), Gaps = 19/76 (25%)
 Frame = -3

Query: 1123 NRLSALDPRISHLSNLNKFSLRQNLI-----TDAALEPLS--------------SWHTIS 1001
            NRLS L   IS L  L    L +NL+     +  +L+ LS              S     
Sbjct: 177  NRLSELPTEISGLIALTDLLLSENLLEILPDSIGSLKKLSILKVNQNRLVHLTDSIGECE 236

Query: 1000 QLEELVLRDNQLKKIP 953
             L EL+L +N L+ +P
Sbjct: 237  NLTELMLTENLLQSLP 252



>gb:AK019545_1160129 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4921529O18
           product:hypothetical ADP-ribosylation structure
           containing protein, full insert sequence.
          Length = 1117

 Score = 70.9 bits (172), Expect = 6e-11
 Identities = 64/223 (28%), Positives = 102/223 (45%), Gaps = 2/223 (0%)
 Frame = -2

Query: 953 GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS 774
           G+S+F  L    +   +I   SGL +    LKEL+++   I KIE ++    L+ L L  
Sbjct: 11  GLSLFHNLSSLTIVAQDIREISGL-ETCLQLKELWIAECCIEKIEGLQGCRNLEKLYLYY 69

Query: 773 NKLRVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSM-KGLEECVAL 600
           NK+  +ENL+ L  L+ LWL  N I+ I  L  LK +K +++  N ++S+ + L+    L
Sbjct: 70  NKISKIENLEKLIKLEVLWLNHNMIKNIEGLQTLKNLKDLNLAGNLVSSIGRCLDPNEQL 129

Query: 599 EELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
           E+L LS N I   + L                   +N+  LT+L+DL LND    S    
Sbjct: 130 EKLNLSGNQITSFKDL-------------------TNLTKLTRLKDLCLNDPQYKS---- 166

Query: 419 AEAVAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS 291
                             NP     NY + +    P++Q++D+
Sbjct: 167 ------------------NPVCQLCNYSTHVLYHLPSLQRLDT 191



 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 54/180 (30%), Positives = 83/180 (46%), Gaps = 15/180 (8%)
 Frame = -2

Query: 827 KIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQ 648
           +I  +  FH L  L + +  +R +  L+T   L+ELW+          C   CI+KI   
Sbjct: 8   RIVGLSLFHNLSSLTIVAQDIREISGLETCLQLKELWIAE--------C---CIEKI--- 53

Query: 647 SNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKL 468
                  +GL+ C  LE+LYL +N I K+E L  L+ L VL ++ N +  I  +  L  L
Sbjct: 54  -------EGLQGCRNLEKLYLYYNKISKIENLEKLIKLEVLWLNHNMIKNIEGLQTLKNL 106

Query: 467 EDLWLNDNNISSVEDIAEA--------VAGS-------LQKLTTLYLERNPCANSPNYIS 333
           +DL L  N +SS+    +         ++G+       L  LT L   ++ C N P Y S
Sbjct: 107 KDLNLAGNLVSSIGRCLDPNEQLEKLNLSGNQITSFKDLTNLTKLTRLKDLCLNDPQYKS 166



 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 46/135 (34%), Positives = 69/135 (51%), Gaps = 2/135 (1%)
 Frame = -2

Query: 713  GRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNL 534
            G++     NL  L+ +K  S  +N L+ M+GLE CV LEEL L  N I K+EG++ L  L
Sbjct: 849  GQHLFEITNLEKLENLKWASFSNNNLSKMEGLESCVNLEELTLDGNCISKIEGITRLTKL 908

Query: 533  RVLDVSANKLTAIS--NIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNP 360
              L ++ N LT +      NL  L  L L +N I+S+  + +        L  LY+    
Sbjct: 909  SRLSMNNNLLTGLEKHTFDNLLHLHSLSLENNRITSLSALQKTFT-----LIELYI---- 959

Query: 359  CANSPNYISTLRQIF 315
               S NYI+  ++I+
Sbjct: 960  ---SNNYIAVNQEIY 971



 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 42/150 (28%), Positives = 77/150 (51%), Gaps = 6/150 (4%)
 Frame = -2

Query: 941  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR 762
            + K+   ++    +   + L K+ + LK    SNN ++K+E +E    L+ L L  N + 
Sbjct: 839  YSKITALNLDGQHLFEITNLEKLEN-LKWASFSNNNLSKMEGLESCVNLEELTLDGNCIS 897

Query: 761  VMENLQTLTNLQELWLGRNRIRAIN---LCGLKCIKKISIQSNRLTSMKGLEECVALEEL 591
             +E +  LT L  L +  N +  +       L  +  +S+++NR+TS+  L++   L EL
Sbjct: 898  KIEGITRLTKLSRLSMNNNLLTGLEKHTFDNLLHLHSLSLENNRITSLSALQKTFTLIEL 957

Query: 590  YLSHNGI---EKMEGLSTLVNLRVLDVSAN 510
            Y+S+N I   +++  L  L NL +LD+  N
Sbjct: 958  YISNNYIAVNQEIYNLKGLCNLVILDMYGN 987



 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 46/164 (28%), Positives = 82/164 (50%), Gaps = 18/164 (10%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAINL 684
           L++LY+  N+I+KIE +E   +L++L L  N ++ +E LQTL NL++L L  N + +I  
Sbjct: 62  LEKLYLYYNKISKIENLEKLIKLEVLWLNHNMIKNIEGLQTLKNLKDLNLAGNLVSSIGR 121

Query: 683 C--GLKCIKKISIQSNRLTSMKGLEECVALEEL----------------YLSHNGIEKME 558
           C    + ++K+++  N++TS K L     L  L                 L +     + 
Sbjct: 122 CLDPNEQLEKLNLSGNQITSFKDLTNLTKLTRLKDLCLNDPQYKSNPVCQLCNYSTHVLY 181

Query: 557 GLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVE 426
            L +L  L   DVSA +   I  +A+ T ++ +   +  I +V+
Sbjct: 182 HLPSLQRLDTFDVSAKQ---IKELADSTAMKKIMYYNMRIKTVQ 222



 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 37/122 (30%), Positives = 62/122 (50%)
 Frame = -2

Query: 668  IKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISN 489
            I  +++    L  +  LE+   L+    S+N + KMEGL + VNL  L +  N ++ I  
Sbjct: 842  ITALNLDGQHLFEITNLEKLENLKWASFSNNNLSKMEGLESCVNLEELTLDGNCISKIEG 901

Query: 488  IANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQIFPN 309
            I  LTKL  L +N+N ++ +E   +    +L  L +L LE N   +    +S L++ F  
Sbjct: 902  ITRLTKLSRLSMNNNLLTGLE---KHTFDNLLHLHSLSLENNRITS----LSALQKTFTL 954

Query: 308  IQ 303
            I+
Sbjct: 955  IE 956



 Score = 41.2 bits (95), Expect = 0.048
 Identities = 33/117 (28%), Positives = 53/117 (45%), Gaps = 5/117 (4%)
 Frame = -2

Query: 713  GRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNL 534
            G +  +  +L  L  ++K++I  N  T +  +     LE L  SHN +  +EG   L+ L
Sbjct: 656  GNSLSKLRDLAKLTGLRKLNISFNEFTCLDDVYHLYNLEYLDASHNHVITLEGFRGLMKL 715

Query: 533  RVLDVSANKLTAISNIANL-----TKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTL 378
            + LD+S N+L       N+     T L  L +  N       +  +V G L+ LT L
Sbjct: 716  KHLDLSWNQLKKTGEEINVLCKHTTSLLTLDIQHNPWQKPATLRLSVIGRLKTLTHL 772



>gb:AE017323_442720 Listeria monocytogenes str. 4b F2365, section 2
           of 10 of the complete genome.>gb:AE017262_1075076
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 568

 Score = 70.5 bits (171), Expect = 7e-11
 Identities = 58/216 (26%), Positives = 105/216 (48%), Gaps = 22/216 (10%)
 Frame = -2

Query: 920 DVSFNEITSPSGLSKVSSTLKEL------------YVSNNQIAKIEEIEHFHELQILELG 777
           DVS  E+ S S ++  SS +  L             ++NN+I  +  +    +L+ILE  
Sbjct: 68  DVSQAELDSISEVTAESSNIASLEGAQYLNNIDTLILNNNKITDLNSLAGLSKLRILEAN 127

Query: 776 SNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVAL 600
            N+L  +  L  +T+L +L L  N+I+ +N +  L  ++ I + +N++T +  +     L
Sbjct: 128 DNQLSDISALANVTSLHQLRLAGNQIKQLNGVSNLINLETIELSNNQITDISPVSGLKNL 187

Query: 599 EELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
             L + +N I  +  ++ L  L  L    N+++ +S I++L  +E + L+ N IS V  I
Sbjct: 188 IGLGIDYNDISDLSPIAGLAKLSHLTADNNQISDLSPISSLGAMEIMRLDKNQISDVTPI 247

Query: 419 AEAVAGSLQKLTTLYLERN---------PCANSPNY 339
           A     +L  L+ ++L  N         P  NSPN+
Sbjct: 248 A-----NLANLSYVFLAENQISDISSLQPLFNSPNF 278



 Score = 44.3 bits (103), Expect = 0.006
 Identities = 29/111 (26%), Positives = 52/111 (46%)
 Frame = -2

Query: 737 TNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKME 558
           T + E++   N   AI         K ++     TS     E  ++ E+    + I  +E
Sbjct: 41  TPINEIFTDENLANAI---------KATLNKPSTTSDVSQAELDSISEVTAESSNIASLE 91

Query: 557 GLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA 405
           G   L N+  L ++ NK+T ++++A L+KL  L  NDN +S +  +A   +
Sbjct: 92  GAQYLNNIDTLILNNNKITDLNSLAGLSKLRILEANDNQLSDISALANVTS 142



>gb:BC075175_2558286 Xenopus laevis MGC82111 protein, mRNA (cDNA
           clone MGC:82111 IMAGE:7011911), complete cds.
          Length = 524

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 55/204 (26%), Positives = 105/204 (51%), Gaps = 10/204 (4%)
 Frame = -2

Query: 917 VSFNEITS---PSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKL-RVME 753
           +S N+I+    P  +  +S+ L  L +  N +  + E +   H L+ L++G+N+L  + E
Sbjct: 133 LSINDISLQVLPENIGNLSN-LVSLELRENLLTFLPESLAQLHRLEELDVGNNELYNLPE 191

Query: 752 NLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALEELYLS 582
            + +L  L++LWL  N++  +   +  LK +  + +  N+L  + + +    +L +L +S
Sbjct: 192 TIGSLYKLKDLWLDGNQLADLPPEIGNLKNLLCLDLSENKLERLPEEISGLKSLTDLLVS 251

Query: 581 HNGIEKM-EGLSTLVNLRVLDVSANKLTAISN-IANLTKLEDLWLNDNNISSVEDIAEAV 408
           HN IE + +G+  L NL +L V  N+L  +++ I     L +L L +N +     +    
Sbjct: 252 HNSIEVLPDGIGKLKNLSILKVDQNRLMQLTDCIGECESLTELILTENQLL----VLPRS 307

Query: 407 AGSLQKLTTLYLERNPCANSPNYI 336
            G L+KL  L ++RN   + P  I
Sbjct: 308 IGKLKKLCNLNIDRNKLMSLPKEI 331



 Score = 57.4 bits (137), Expect(2) = 8e-11
 Identities = 50/172 (29%), Positives = 90/172 (52%), Gaps = 7/172 (4%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKIEE-IEHFHELQILELGSNKL 765
           K LL  D+S N++   P  +S + S L +L VS+N I  + + I     L IL++  N+L
Sbjct: 220 KNLLCLDLSENKLERLPEEISGLKS-LTDLLVSHNSIEVLPDGIGKLKNLSILKVDQNRL 278

Query: 764 -RVMENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALE 597
            ++ + +    +L EL L  N++  +  ++  LK +  ++I  N+L S+ K +  C +L 
Sbjct: 279 MQLTDCIGECESLTELILTENQLLVLPRSIGKLKKLCNLNIDRNKLMSLPKEIGGCCSLN 338

Query: 596 ELYLSHNGIEKMEG-LSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDN 444
              +  N + ++   ++    L V DV+ N+LT +       KL+ LWL+DN
Sbjct: 339 VFCVRENRLSRIPSEIAQATELHVFDVAGNRLTHLPLSLTSLKLKALWLSDN 390



 Score = 33.1 bits (74), Expect(2) = 8e-11
 Identities = 25/68 (36%), Positives = 36/68 (52%), Gaps = 4/68 (5%)
 Frame = -3

Query: 1117 LSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP----V 950
            L  L   I +LSNL    LR+NL+T    E L+  H   +LEEL + +N+L  +P     
Sbjct: 140  LQVLPENIGNLSNLVSLELRENLLTFLP-ESLAQLH---RLEELDVGNNELYNLPETIGS 195

Query: 949  LAYLRNFW 926
            L  L++ W
Sbjct: 196  LYKLKDLW 203



>gb:AF121040_480764 Listeria monocytogenes strain 122 internalin B
           precursor (inlB) gene, partial cds.>gb:AF121042_480766
           Listeria monocytogenes strain 501 internalin B precursor
           (inlB) gene, partial cds.>gb:AF121043_480767 Listeria
           monocytogenes strain 520 internalin B precursor (inlB)
           gene, partial cds.
          Length = 504

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 51/158 (32%), Positives = 87/158 (55%), Gaps = 3/158 (1%)
 Frame = -2

Query: 749 LQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNG 573
           L  L NL  L+L  N+I+ ++ +  LK +K +S++ N ++ + GL     LE LYL +N 
Sbjct: 3   LANLKNLGWLFLDENKIKDLSSIKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNNK 62

Query: 572 IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQ 393
           +  +  LS L  L  L +  N+++ I  ++ LTKL++L+L+ N+IS +  +A      L+
Sbjct: 63  LTDITILSRLTKLDTLSLEDNEISDIVPLSGLTKLQNLYLSKNHISDLRALA-----GLK 117

Query: 392 KLTTLYLERNPCAN-SPNYISTLRQIFPN-IQQVDSEL 285
            L  L L    C N S N+ + L  + PN ++ +D  L
Sbjct: 118 NLDVLELFSQECLNKSINHQTNL--VVPNTVKNIDGSL 153



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 32/105 (30%), Positives = 52/105 (49%), Gaps = 1/105 (0%)
 Frame = -2

Query: 956 SGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELG 777
           S +   KKL    +  N I+  +GL  +   L+ LY+ NN++  I  +    +L  L L 
Sbjct: 23  SSIKDLKKLKSLSLEHNGISDINGLVHLPQ-LESLYLGNNKLTDITILSRLTKLDTLSLE 81

Query: 776 SNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQS 645
            N++  +  L  LT LQ L+L +N I  +  L GLK +  + + S
Sbjct: 82  DNEISDIVPLSGLTKLQNLYLSKNHISDLRALAGLKNLDVLELFS 126



>gb:AE017290_433053 Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130, chromosome I, section 4 of 14 of the
           complete sequence.>gb:AE016823_1066064 Leptospira
           interrogans serovar Copenhageni str. Fiocruz L1-130,
           chromosome I, complete sequence.
          Length = 521

 Score = 70.1 bits (170), Expect = 1e-10
 Identities = 69/238 (28%), Positives = 118/238 (49%), Gaps = 31/238 (13%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKIE-EIEHFHELQILELGSNKL 765
           + L   D+SFN +T+ P  + ++ + L+ L +  N++A +  EI     LQ L+L SNKL
Sbjct: 232 RNLQELDLSFNSLTTLPKEVGQLEN-LQRLDLHQNRLATLPMEIGQLKNLQELDLNSNKL 290

Query: 764 RVM-ENLQTLTNLQELWLGRNR-------------IRAINLC------------GLKCIK 663
             + + ++ L NLQEL L RN+             ++ +NL              L+ +K
Sbjct: 291 TTLPKEIRQLRNLQELDLHRNQLTTLPKEIGQLQNLKTLNLIVTQLTTLPKEIGELQNLK 350

Query: 662 KISIQSNRLTSM-KGLEECVALEELYLSHNGIEKM-EGLSTLVNLRVLDVSANKLTAI-S 492
            +++  N+LT++ K + E   LE L L  N I  + + +  L NL+ LD+  N+LT +  
Sbjct: 351 TLNLLDNQLTTLPKEIGELQNLEILVLRENRITALPKEIGQLQNLQRLDLHQNQLTTLPK 410

Query: 491 NIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQI 318
            I  L  L++L L++N ++++    E     LQ L  L L+ N     P  I  L+ +
Sbjct: 411 EIGQLQNLQELCLDENQLTTLPKEIE----QLQNLRVLDLDNNQLTTLPKEIGQLQNL 464



 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 60/221 (27%), Positives = 118/221 (53%), Gaps = 9/221 (4%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKL 765
           + L   D+  N++T+ P  + ++ + LK L +   Q+  + +EI     L+ L L  N+L
Sbjct: 301 RNLQELDLHRNQLTTLPKEIGQLQN-LKTLNLIVTQLTTLPKEIGELQNLKTLNLLDNQL 359

Query: 764 RVM-ENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALE 597
             + + +  L NL+ L L  NRI A+   +  L+ ++++ +  N+LT++ K + +   L+
Sbjct: 360 TTLPKEIGELQNLEILVLRENRITALPKEIGQLQNLQRLDLHQNQLTTLPKEIGQLQNLQ 419

Query: 596 ELYLSHNGIEKM-EGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSV-E 426
           EL L  N +  + + +  L NLRVLD+  N+LT +   I  L  L++L L++N +++  +
Sbjct: 420 ELCLDENQLTTLPKEIEQLQNLRVLDLDNNQLTTLPKEIGQLQNLQELCLDENQLTTFPK 479

Query: 425 DIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQ 303
           +I +     L+ L  L+L  NP ++       +R++ P  +
Sbjct: 480 EIRQ-----LKNLQELHLYLNPLSSKEK--KRIRRLLPKCE 513



 Score = 39.7 bits (91), Expect = 0.14
 Identities = 41/154 (26%), Positives = 73/154 (47%), Gaps = 4/154 (2%)
 Frame = -2

Query: 743 TLTNLQELWLGRNRIRAINLCGLKC-IKKISIQSNRLTSM-KGLEECVALEELYLSHNGI 570
           TL  LQ++ +G      + L  L C I+   ++      + K L+  + +  L LS   +
Sbjct: 6   TLNYLQKITIG-----LLFLINLSCKIQAEEVEPEAYQDLTKALQNPLDVRVLILSEQKL 60

Query: 569 EKM-EGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSVEDIAEAVAGSL 396
             + + +  L NL++LD+  N+LTA+   I  L  L++L L+ N+++++        G L
Sbjct: 61  TTLPKEIKQLQNLKLLDLGHNQLTALPKEIGQLRNLQELDLSFNSLTTL----PKEVGQL 116

Query: 395 QKLTTLYLERNPCANSPNYISTLRQIFPNIQQVD 294
           + L  L L        P  I  LR    N+Q++D
Sbjct: 117 ENLQRLNLNSQKLTTLPKEIGQLR----NLQELD 146



>gb:AK012971_1157255 Mus musculus 10, 11 days embryo whole body
           cDNA, RIKEN full-length enriched library,
           clone:2810403B08 product:hypothetical IQ
           calmodulin-binding motif/Leucine-rich repeat containing
           protein, full insert sequence.>gb:BC067049_2105933 Mus
           musculus leucine-rich repeats and IQ motif containing 2,
           mRNA (cDNA clone MGC:91372 IMAGE:30363673), complete
           cds.
          Length = 856

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 58/189 (30%), Positives = 96/189 (50%), Gaps = 9/189 (4%)
 Frame = -2

Query: 896 SPSGLSKVSSTLK------ELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLT 735
           S  GL K+ + L        L +  NQI K+E +E   +L  L + +N+L  M  +  LT
Sbjct: 21  SGQGLQKLGANLPCEADVHTLILDKNQIIKLENLEKCKQLIQLSVANNRLVRMMGVAKLT 80

Query: 734 NLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKME 558
            L+ L L  N I  +  L  L  ++ +++  N L +M+ +  C AL+ L LS N I ++ 
Sbjct: 81  QLRVLNLPHNSIGCVEGLKDLVHLEWLNLAGNNLKTMEQVNSCTALQHLDLSDNNIPQIG 140

Query: 557 GLSTLVNLRVLDVSANKLTAISNI-ANLTK-LEDLWLNDNNISSVEDIAEAVAGSLQKLT 384
            +S L++L+ L +  N +T++    A L + L  L L +N I  + +I  +   SL +L 
Sbjct: 141 DVSKLISLKTLLLHGNIITSLRMAPAYLPRNLSILSLAENEIRDLNEI--SFLASLSELE 198

Query: 383 TLYLERNPC 357
            L +  NPC
Sbjct: 199 QLSIMNNPC 207



>gb:AE017323_442864 Listeria monocytogenes str. 4b F2365, section 2
           of 10 of the complete genome.>gb:AE017262_1075220
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 823

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 57/227 (25%), Positives = 110/227 (48%), Gaps = 4/227 (1%)
 Frame = -2

Query: 956 SGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELG 777
           S +S   KL    +  N+IT  S L  +++ L+ELY++ + I+ I  + +  ++  L LG
Sbjct: 115 SPLSNLVKLTNLYIGTNKITDISALQNLTN-LRELYLNEDNISDISPLANLTKMYSLNLG 173

Query: 776 SN-KLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVA 603
           +N  L  +  L  +T L  L +  ++++ +  +  L  +  +S+  N++  +  L    +
Sbjct: 174 ANHNLSDLSPLSNMTGLNYLTVTESKVKDVTPIANLTDLYSLSLNYNQIEDISPLASLTS 233

Query: 602 LEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVED 423
           L       N I  +  ++ +  L  L +  NK+T +S +ANL++L  L +  N IS +  
Sbjct: 234 LHYFTAYVNQITDITPVANMTRLNSLKIGNNKITDLSPLANLSQLTWLEIGTNQISDINA 293

Query: 422 IAEAVAGSLQKLTTLYLERNPCANSP--NYISTLRQIFPNIQQVDSE 288
           + +     L KL  L +  N  ++    N +S L  +F N  Q+ +E
Sbjct: 294 VKD-----LTKLKMLNVGSNQISDISVLNNLSQLNSLFLNNNQLGNE 335



 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 39/105 (37%), Positives = 61/105 (58%)
 Frame = -2

Query: 677 LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA 498
           L+ I K+ +   ++ S++G+E    LE L L+ N I  +  LS LV L  L +  NK+T 
Sbjct: 76  LESITKLVVAGEKVASIQGIEYLTNLEYLNLNGNQITDISPLSNLVKLTNLYIGTNKITD 135

Query: 497 ISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
           IS + NLT L +L+LN++NIS +  +A     +L K+ +L L  N
Sbjct: 136 ISALQNLTNLRELYLNEDNISDISPLA-----NLTKMYSLNLGAN 175



 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 56/234 (23%), Positives = 106/234 (45%), Gaps = 17/234 (7%)
 Frame = -2

Query: 965 EENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQIL 786
           E+ S ++    L  F    N+IT  + ++ ++  L  L + NN+I  +  + +  +L  L
Sbjct: 223 EDISPLASLTSLHYFTAYVNQITDITPVANMTR-LNSLKIGNNKITDLSPLANLSQLTWL 281

Query: 785 ELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECV 606
           E+G+N++  +  ++ LT L                     K +++ SN+++ +  L    
Sbjct: 282 EIGTNQISDINAVKDLTKL---------------------KMLNVGSNQISDISVLNNLS 320

Query: 605 ALEELYLSHN--GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWL------- 453
            L  L+L++N  G E ME +  L NL  L +S N +T I  +A+L+K++           
Sbjct: 321 QLNSLFLNNNQLGNEDMEVIGGLTNLTTLFLSQNHITDIRPLASLSKMDSADFANQVIKK 380

Query: 452 ---NDNNISSVEDIAEAVAGSLQKLTTL-----YLERNPCANSPNYISTLRQIF 315
              N +   SV +   ++ G+L    T+     Y   N   +SP+Y+  +R  F
Sbjct: 381 PARNFSKTLSVPNNITSIDGTLVTPKTISNNGTYDAPNVNWSSPSYLPEVRYTF 434



 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 40/153 (26%), Positives = 72/153 (47%), Gaps = 1/153 (0%)
 Frame = -2

Query: 872 SSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRA 693
           ++TL  L    NQI    ++       + +     +   E L+++T L         I+ 
Sbjct: 35  AATLATLPAPINQIFPDADLAEGIRAVLQKASVTDVVTQEELESITKLVVAGEKVASIQG 94

Query: 692 INLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           I    L  ++ +++  N++T +  L   V L  LY+  N I  +  L  L NLR L ++ 
Sbjct: 95  IEY--LTNLEYLNLNGNQITDISPLSNLVKLTNLYIGTNKITDISALQNLTNLRELYLNE 152

Query: 512 NKLTAISNIANLTKLEDLWLNDN-NISSVEDIA 417
           + ++ IS +ANLTK+  L L  N N+S +  ++
Sbjct: 153 DNISDISPLANLTKMYSLNLGANHNLSDLSPLS 185



>gb:AE011272_271111 Leptospira interrogans serovar lai str. 56601
           chromosome I, section 81 of 397 of the complete
           sequence.>gb:AE010300_1004510 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete sequence.
          Length = 423

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 67/224 (29%), Positives = 117/224 (52%), Gaps = 8/224 (3%)
 Frame = -2

Query: 950 VSIFKKLLVFDVSFNEI-TSPSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELG 777
           V + + L   D+  N++ T P  + ++ S LK L ++ NQ+  + +EIE    L+ L LG
Sbjct: 198 VMLLETLENLDLRSNKLKTIPKEIRQLKS-LKVLMLTGNQLTSLPKEIEQLQNLKTLNLG 256

Query: 776 SNKLRVME-NLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSMK-GLEEC 609
            N+ +++   +  L NL EL L  N++      +  LK +K +S+  N++T++   + + 
Sbjct: 257 ENRFQILPVEILELKNLLELNLYYNQLVEFPKEVGQLKSLKYLSLYHNQITTLPVEVTQL 316

Query: 608 VALEELYLSHNGIEKM-EGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNIS 435
             L+EL+LS N I  + + +  L NL  L +S NKL A+   I  L KL+ L L +N ++
Sbjct: 317 PDLQELHLSGNKITILPKEILQLKNLEWLSLSNNKLNALPKEIGQLKKLQRLELGNNQLT 376

Query: 434 SVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQ 303
           ++    E     L+ L  L L+ NP   SP     +R++ P  +
Sbjct: 377 TLPKEIE----QLKNLQRLELDSNPI--SPKEKERIRKLLPKCE 414



>gb:BC084248_2563636 Xenopus laevis hypothetical LOC495083, mRNA
           (cDNA clone MGC:81723 IMAGE:6865255), complete cds.
          Length = 524

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 55/204 (26%), Positives = 106/204 (51%), Gaps = 10/204 (4%)
 Frame = -2

Query: 917 VSFNEITS---PSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKL-RVME 753
           +S N+I+    P  +  +S+ L  L +  N +  + E +   H L+ L++G+N+L  + E
Sbjct: 133 LSINDISLQVLPENIGNLSN-LVSLELRENLLTFLPESLAQLHRLEELDVGNNELYDLPE 191

Query: 752 NLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALEELYLS 582
            + +L  L++LWL  N++  +   +  LK +  + +  N+L  + + +    +L +L +S
Sbjct: 192 TIGSLYKLKDLWLDGNQLADLPPEIGNLKNLLCLDLSENKLERLPEEISGLKSLTDLLVS 251

Query: 581 HNGIEKM-EGLSTLVNLRVLDVSANKLTAISN-IANLTKLEDLWLNDNNISSVEDIAEAV 408
           HN IE + +G+  L NL +L V  N+L  +++ I     L ++ L +N +     +    
Sbjct: 252 HNSIEVLPDGIGKLKNLSILKVDQNRLMQLTDCIGECESLTEVILTENQLL----VLPRS 307

Query: 407 AGSLQKLTTLYLERNPCANSPNYI 336
            G L+KL  L ++RN   + PN I
Sbjct: 308 IGKLKKLCNLNIDRNKLMSLPNEI 331



 Score = 56.6 bits (135), Expect(2) = 2e-10
 Identities = 49/172 (28%), Positives = 90/172 (52%), Gaps = 7/172 (4%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKIEE-IEHFHELQILELGSNKL 765
           K LL  D+S N++   P  +S + S L +L VS+N I  + + I     L IL++  N+L
Sbjct: 220 KNLLCLDLSENKLERLPEEISGLKS-LTDLLVSHNSIEVLPDGIGKLKNLSILKVDQNRL 278

Query: 764 -RVMENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSMKG-LEECVALE 597
            ++ + +    +L E+ L  N++  +  ++  LK +  ++I  N+L S+   +  C +L 
Sbjct: 279 MQLTDCIGECESLTEVILTENQLLVLPRSIGKLKKLCNLNIDRNKLMSLPNEIGGCCSLN 338

Query: 596 ELYLSHNGIEKMEG-LSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDN 444
              +  N + ++   ++    L VLDV+ N+LT +       KL+ LWL+DN
Sbjct: 339 VFCVRENRLSRLPSEIAQATELHVLDVAGNRLTHLPLSLTSLKLKALWLSDN 390



 Score = 32.7 bits (73), Expect(2) = 2e-10
 Identities = 25/68 (36%), Positives = 36/68 (52%), Gaps = 4/68 (5%)
 Frame = -3

Query: 1117 LSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP----V 950
            L  L   I +LSNL    LR+NL+T    E L+  H   +LEEL + +N+L  +P     
Sbjct: 140  LQVLPENIGNLSNLVSLELRENLLTFLP-ESLAQLH---RLEELDVGNNELYDLPETIGS 195

Query: 949  LAYLRNFW 926
            L  L++ W
Sbjct: 196  LYKLKDLW 203



>gb:BX538350_1358723 Cryptosporidium parvum chromosome 6, complete
           sequence; segment 1/4.
          Length = 310

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 61/230 (26%), Positives = 115/230 (50%), Gaps = 14/230 (6%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRV 759
           K L   DVS N++ S S L K    L ++ +SNN +  ++EI +   ++IL + +N ++ 
Sbjct: 42  KNLRKIDVSKNKLESVSFL-KYCWNLTDINLSNNNLTSVDEICNLENVKILNISNNSIKS 100

Query: 758 MENLQTLTNLQE----LWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKG-LEECVALE 597
           +ENL     LQ+    L    N+IR I +L   K ++ + +  N    ++     C  L+
Sbjct: 101 IENLCRSPGLQKSLKVLIANHNKIRYIPDLSHFKELETVILSHNEAIEIENPKNHCPKLK 160

Query: 596 ELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSVEDI 420
           ++ LS+N +++         ++ L ++ NK+ ++ S+I  +  ++ L L  N I+ ++ +
Sbjct: 161 KMSLSNNCLKQFPFSLNFNMVQELRLNNNKILSLPSDITYMGNIKILELGHNFITEIDPL 220

Query: 419 AEAVAGSLQKLTTLYLERNPC-------ANSPNYISTLRQIFPNIQQVDS 291
                 SL KL +L + +NPC        ++ N I TL  I   +  +DS
Sbjct: 221 L-----SLTKLKSLNISKNPCIIAEGTEGDNSNSIKTLNLIKEKLPSLDS 265



 Score = 52.0 bits (123), Expect = 3e-05
 Identities = 50/199 (25%), Positives = 94/199 (47%), Gaps = 4/199 (2%)
 Frame = -2

Query: 926 VFDVSFNEITSPSGLSK---VSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           + ++S N I S   L +   +  +LK L  ++N+I  I ++ HF EL+ + L  N+   +
Sbjct: 90  ILNISNNSIKSIENLCRSPGLQKSLKVLIANHNKIRYIPDLSHFKELETVILSHNEAIEI 149

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
           EN +                  N C    +KK+S+ +N L           ++EL L++N
Sbjct: 150 ENPK------------------NHC--PKLKKMSLSNNCLKQFPFSLNFNMVQELRLNNN 189

Query: 575 GIEKM-EGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGS 399
            I  +   ++ + N+++L++  N +T I  + +LTKL+ L ++ N     E      + S
Sbjct: 190 KILSLPSDITYMGNIKILELGHNFITEIDPLLSLTKLKSLNISKNPCIIAEGTEGDNSNS 249

Query: 398 LQKLTTLYLERNPCANSPN 342
           ++ L  L  E+ P  +S N
Sbjct: 250 IKTL-NLIKEKLPSLDSLN 267



 Score = 42.4 bits (98), Expect = 0.021
 Identities = 27/86 (31%), Positives = 47/86 (54%)
 Frame = -2

Query: 599 EELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
           +EL L    I  ++ L+   NLR +DVS NKL ++S +     L D+ L++NN++SV++I
Sbjct: 23  QELKLRELEITGIDELTQAKNLRKIDVSKNKLESVSFLKYCWNLTDINLSNNNLTSVDEI 82

Query: 419 AEAVAGSLQKLTTLYLERNPCANSPN 342
                 +L+ +  L +  N   +  N
Sbjct: 83  C-----NLENVKILNISNNSIKSIEN 103



 Score = 39.3 bits (90), Expect = 0.18
 Identities = 33/114 (28%), Positives = 56/114 (49%), Gaps = 2/114 (1%)
 Frame = -2

Query: 950 VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN 771
           +S FK+L    +S NE             LK++ +SNN + +     +F+ +Q L L +N
Sbjct: 130 LSHFKELETVILSHNEAIEIENPKNHCPKLKKMSLSNNCLKQFPFSLNFNMVQELRLNNN 189

Query: 770 K-LRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLE 615
           K L +  ++  + N++ L LG N I  I+ L  L  +K ++I  N     +G E
Sbjct: 190 KILSLPSDITYMGNIKILELGHNFITEIDPLLSLTKLKSLNISKNPCIIAEGTE 243



>gb:AK029981_1161758 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4932412H11
           product:hypothetical Leucine-rich repeat/Leucine-rich
           repeat, typical subtype containing protein, full insert
           sequence.
          Length = 853

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 66/242 (27%), Positives = 118/242 (48%), Gaps = 31/242 (12%)
 Frame = -2

Query: 950 VSIFKKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKIEE-IEHFHELQILELG 777
           + +F  L + + S+NEI+  P  L ++ + +++L +++N I  +   +EH   L+ L LG
Sbjct: 201 IQLFHNLKILNASYNEISQIPKELLQLEN-MRQLLLNSNHIDTLPSGLEHLRYLETLSLG 259

Query: 776 SNKLR-VMENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEEC 609
            N L  + ++L +L NL+ L L  N++     +LC L  +  +++  N + S+ K + E 
Sbjct: 260 KNMLTYIPDSLSSLKNLRILNLEYNQLTIFSKSLCFLPKLNSLNLTGNMIGSLPKEVREL 319

Query: 608 VALEELYLSHNGI--------------------EKMEGLSTLV----NLRVLDVSANKLT 501
             LE L + HN +                     K+E +S  +     LR+L++  N L 
Sbjct: 320 KNLESLLMDHNKLTFLAVEIFQLPKIKELHLADNKLEAISPKIENFKELRLLNLDKNLLQ 379

Query: 500 AI-SNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLR 324
           +I   I++   LE L L+DNNI   E++ + +   L+ L  L++ RN        IS L 
Sbjct: 380 SIPKKISHCVNLESLSLSDNNI---EELPKKIR-KLKNLRQLHVNRNKMITMTEEISHLS 435

Query: 323 QI 318
            I
Sbjct: 436 NI 437



 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 63/212 (29%), Positives = 100/212 (47%), Gaps = 5/212 (2%)
 Frame = -2

Query: 938  KKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKIE-EIEHFHELQILELGSNKL 765
            +K+   ++++N I   P GL  + S L  L  + N I++I  ++    +L  LEL  NKL
Sbjct: 458  RKITRVELNYNNIMYFPVGLCALQS-LDYLSFNGNYISEIPVDMSFSKQLLHLELNRNKL 516

Query: 764  RVM-ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELY 588
             V  ++L +LTNL+ L L +N+I  I  C                    +   V+L  L 
Sbjct: 517  TVFSKHLCSLTNLEYLDLAKNQIMTIPSC--------------------ISAMVSLHVLI 556

Query: 587  LSHNGIEKM-EGLSTLVNLRVLDVSANKLTAIS-NIANLTKLEDLWLNDNNISSVEDIAE 414
            LS N  E   + L +L NLRVLD+S NKL  I   I+ L +++ L L+ NNI +   +  
Sbjct: 557  LSDNKFESFPKELCSLKNLRVLDISENKLQKIPLEISKLKRIQKLHLS-NNIFTNFPVEL 615

Query: 413  AVAGSLQKLTTLYLERNPCANSPNYISTLRQI 318
                +L++L             P  +S + Q+
Sbjct: 616  CQRQTLEELNISQTSGKKVTRLPEEVSHMTQL 647



>gb:AF121041_480765 Listeria monocytogenes strain 123 internalin B
           precursor (inlB) gene, partial cds.
          Length = 504

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 51/158 (32%), Positives = 86/158 (54%), Gaps = 3/158 (1%)
 Frame = -2

Query: 749 LQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNG 573
           L  L NL  L+L  N I+ ++ +  LK +K +S++ N ++ + GL     LE LYL +N 
Sbjct: 3   LANLKNLGWLFLDENTIKDLSSIKDLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNNK 62

Query: 572 IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQ 393
           +  +  LS L  L  L +  N+++ I  ++ LTKL++L+L+ N+IS +  +A      L+
Sbjct: 63  LTDITILSRLTKLDTLSLEDNEISDIVPLSGLTKLQNLYLSKNHISDLRALA-----GLK 117

Query: 392 KLTTLYLERNPCAN-SPNYISTLRQIFPN-IQQVDSEL 285
            L  L L    C N S N+ + L  + PN ++ +D  L
Sbjct: 118 NLDVLELFSQECLNKSINHQTNL--VVPNTVKNIDGSL 153



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 32/105 (30%), Positives = 52/105 (49%), Gaps = 1/105 (0%)
 Frame = -2

Query: 956 SGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELG 777
           S +   KKL    +  N I+  +GL  +   L+ LY+ NN++  I  +    +L  L L 
Sbjct: 23  SSIKDLKKLKSLSLEHNGISDINGLVHLPQ-LESLYLGNNKLTDITILSRLTKLDTLSLE 81

Query: 776 SNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQS 645
            N++  +  L  LT LQ L+L +N I  +  L GLK +  + + S
Sbjct: 82  DNEISDIVPLSGLTKLQNLYLSKNHISDLRALAGLKNLDVLELFS 126



>gb:AE017298_434925 Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130, chromosome I, section 12 of 14 of the
           complete sequence.>gb:AE016823_1067936 Leptospira
           interrogans serovar Copenhageni str. Fiocruz L1-130,
           chromosome I, complete sequence.
          Length = 423

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 67/224 (29%), Positives = 116/224 (51%), Gaps = 8/224 (3%)
 Frame = -2

Query: 950 VSIFKKLLVFDVSFNEI-TSPSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELG 777
           V + + L   D+  N++ T P  + ++ S LK L ++ NQ+  + +EIE    L+ L LG
Sbjct: 198 VMLLETLENLDLRSNKLKTIPKEIRQLKS-LKVLMLTGNQLTSLPKEIEQLQNLKTLNLG 256

Query: 776 SNKLRVME-NLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSMK-GLEEC 609
            N+ ++    +  L NL EL L  N++      +  LK +K +S+  N++T++   + + 
Sbjct: 257 ENRFQIFPVEILELKNLLELNLYYNQLVEFPKEVGQLKSLKYLSLYHNQITTLPVEVTQL 316

Query: 608 VALEELYLSHNGIEKM-EGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNIS 435
             L+EL+LS N I  + + +  L NL  L +S NKL A+   I  L KL+ L L +N ++
Sbjct: 317 PDLQELHLSGNKITILPKEILQLKNLEWLSLSNNKLNALPKEIGQLKKLQRLELGNNQLT 376

Query: 434 SVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQ 303
           ++    E     L+ L  L L+ NP   SP     +R++ P  +
Sbjct: 377 TLPKEIE----QLKNLQRLELDSNPI--SPKEKERIRKLLPKCE 414



>gb:AE017248_415645 Treponema denticola ATCC 35405, section 3 of 10
           of the complete genome.>gb:AE017226_1069241 Treponema
           denticola ATCC 35405, complete genome.
          Length = 631

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 58/175 (33%), Positives = 98/175 (56%)
 Frame = -2

Query: 950 VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN 771
           V     L   D S N++TS     +  + L+EL  SNN++  +  ++  + LQ L    N
Sbjct: 249 VQSLTSLSKLDCSANQLTSLD--VRNLAALEELDCSNNKLTALY-VQGLNALQELNCSEN 305

Query: 770 KLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEEL 591
           +L  +E +Q LT L+ L  GRN + ++++ GL  +K +S   N LTS+K + +  ALE+L
Sbjct: 306 ELTSLE-IQGLTALEVLDSGRNDLTSLDVQGLPALKILSCTVNELTSLK-VRDLPALEKL 363

Query: 590 YLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVE 426
             S N +  ++ L  L  L+ L+ S N+ T+I NI  LT L++L  + N ++S++
Sbjct: 364 DCSVNQLTSIDILE-LTALKELNCSLNQFTSI-NILKLTALKELDCSTNQLTSLD 416



 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 46/145 (31%), Positives = 84/145 (57%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAINL 684
           L+ELY + N ++ ++ ++    LQ L   +NKL  + N+Q L  LQ L    NR+  +N+
Sbjct: 150 LRELYCNRNHLSSLD-VQSLTALQDLFCNANKLTSL-NVQDLKVLQRLHCNSNRLTLLNV 207

Query: 683 CGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKL 504
             L  ++++    N LTS+  +    AL EL  S N +  ++ + +L +L  LD SAN+L
Sbjct: 208 RDLSALQELDCVGNELTSL-DVHGVTALWELECSKNMLTLLD-VQSLTSLSKLDCSANQL 265

Query: 503 TAISNIANLTKLEDLWLNDNNISSV 429
           T++ ++ NL  LE+L  ++N ++++
Sbjct: 266 TSL-DVRNLAALEELDCSNNKLTAL 289



 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 48/163 (29%), Positives = 88/163 (53%)
 Frame = -2

Query: 914 SFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLT 735
           S N+ TS + L   +  LKEL  S NQ+  ++ + +   L+ L+   NKL  + N+Q L 
Sbjct: 387 SLNQFTSINILKLTA--LKELDCSTNQLTSLD-VRNLAALEKLDCRDNKLTSL-NVQGLN 442

Query: 734 NLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEG 555
            LQ+L+   N + ++ + GLK ++K++   N+LTS+  ++   AL+ L   +N +  +  
Sbjct: 443 TLQKLYCSENELTSLEIQGLKTLQKLNCYKNKLTSL-NVQGLTALQWLNCGYNELTTL-N 500

Query: 554 LSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVE 426
           L  L  LR L+   N L  + ++ ++  L+ L    N +S++E
Sbjct: 501 LKGLHALRDLECFNNNLPEL-DVQDINTLQRLNCYHNKLSTLE 542



 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 39/126 (30%), Positives = 74/126 (58%), Gaps = 2/126 (1%)
 Frame = -2

Query: 788 LELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEEC 609
           L+ G N+L  + N+Q LT LQ+L+   N + ++++ G+  ++ +S   N LTS+  +   
Sbjct: 90  LDCGGNRLTEL-NVQGLTALQKLFCDDNLLTSLDVSGVTALQSLSCGENLLTSL-DVSGL 147

Query: 608 VALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNIS-- 435
             L ELY + N +  ++ + +L  L+ L  +ANKLT++ N+ +L  L+ L  N N ++  
Sbjct: 148 TGLRELYCNRNHLSSLD-VQSLTALQDLFCNANKLTSL-NVQDLKVLQRLHCNSNRLTLL 205

Query: 434 SVEDIA 417
           +V D++
Sbjct: 206 NVRDLS 211



 Score = 46.6 bits (109), Expect = 0.001
 Identities = 31/101 (30%), Positives = 58/101 (57%)
 Frame = -2

Query: 731 LQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGL 552
           + +L  G NR+  +N+ GL  ++K+    N LTS+  +    AL+ L    N +  ++ +
Sbjct: 87  ITKLDCGGNRLTELNVQGLTALQKLFCDDNLLTSL-DVSGVTALQSLSCGENLLTSLD-V 144

Query: 551 STLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV 429
           S L  LR L  + N L+++ ++ +LT L+DL+ N N ++S+
Sbjct: 145 SGLTGLRELYCNRNHLSSL-DVQSLTALQDLFCNANKLTSL 184



>gb:LIINLC_140508 L.ivanovii 23S rRNA, 5S rRNA, tRNA-Asn, tRNA-Thr,
           ORF Z, inlD, and inlC genes.
          Length = 313

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 40/131 (30%), Positives = 70/131 (53%)
 Frame = -2

Query: 860 KELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLC 681
           K LY ++  I  +E ++  + L+ L L  N++  +  L+ L NL  L L  N+++ +N  
Sbjct: 78  KYLYGNDKDIKSLEGLQCLNNLEELHLSRNQISDLSPLKDLANLTLLCLNDNKLKNLNGI 137

Query: 680 GLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLT 501
               + ++ +  N +T +  L     LE L +S N +  ++ L+ L NLR+LD+  NK+ 
Sbjct: 138 PSAKLVRLLVDGNEITDISSLVHVPQLETLTISKNKLSNIDVLAHLTNLRILDLRNNKVR 197

Query: 500 AISNIANLTKL 468
            +S I NL KL
Sbjct: 198 DLSAIGNLKKL 208



 Score = 67.0 bits (162), Expect = 8e-10
 Identities = 59/208 (28%), Positives = 101/208 (48%), Gaps = 3/208 (1%)
 Frame = -2

Query: 959 NSGVSIFKKLLVFDVSFNEITSPSGLSK-VSSTLKELYVSNNQIAKIEEIEHFHELQILE 783
           N G  +   ++   +  ++I    GL+K V   LK+  V++  +    E++   +     
Sbjct: 26  NLGTKVEAAIIPHPMPIDQIFPDPGLAKAVKEALKKRSVTD--VVSQRELDGIRKYLY-- 81

Query: 782 LGSNK-LRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEEC 609
            G++K ++ +E LQ L NL+EL L RN+I  ++ L  L  +  + +  N+L ++ G+   
Sbjct: 82  -GNDKDIKSLEGLQCLNNLEELHLSRNQISDLSPLKDLANLTLLCLNDNKLKNLNGIPSA 140

Query: 608 VALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV 429
             L  L +  N I  +  L  +  L  L +S NKL+ I  +A+LT L  L L +N +  +
Sbjct: 141 -KLVRLLVDGNEITDISSLVHVPQLETLTISKNKLSNIDVLAHLTNLRILDLRNNKVRDL 199

Query: 428 EDIAEAVAGSLQKLTTLYLERNPCANSP 345
             I     G+L+KLT L      C N P
Sbjct: 200 SAI-----GNLKKLTLLDAAFQNCVNEP 222



 Score = 37.4 bits (85), Expect = 0.69
 Identities = 22/73 (30%), Positives = 38/73 (52%)
 Frame = -3

Query: 1105 DPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFW 926
            D ++ +L+ +    L + L+    +  +SS   + QLE L +  N+L  I VLA+L N  
Sbjct: 128  DNKLKNLNGIPSAKLVRLLVDGNEITDISSLVHVPQLETLTISKNKLSNIDVLAHLTNLR 187

Query: 925  YLMFRSTKLHHLA 887
             L  R+ K+  L+
Sbjct: 188  ILDLRNNKVRDLS 200



>gb:PFA929358_1393518 Plasmodium falciparum strain 3D7, chromosome
           9; segment 4/5.
          Length = 1782

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 48/157 (30%), Positives = 79/157 (50%)
 Frame = -2

Query: 815 IEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRL 636
           I+ F+  ++L L +  + +++N+    NL+EL L  N I                     
Sbjct: 70  IKDFYYAKVLSLENRDIVLIQNMNLFKNLEELHLNNNFIE-------------------- 109

Query: 635 TSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLW 456
             ++ LEE + L+ L  S+N I+K++ L+ L NLR L++  N++  I N++N  KL+ L 
Sbjct: 110 -DLENLEELINLKILSASNNKIKKIKNLNNLHNLRELNLHNNEIERIENLSNNKKLQILI 168

Query: 455 LNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSP 345
           L++N I  +EDI       L KL  L +  NP  N P
Sbjct: 169 LSNNYIKHMEDI--IYLKCLDKLKFLNIMNNPICNIP 203



 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 40/131 (30%), Positives = 69/131 (52%), Gaps = 4/131 (3%)
 Frame = -2

Query: 860 KELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-NL 684
           K L + N  I  I+ +  F  L+ L L +N +  +ENL+ L NL+ L    N+I+ I NL
Sbjct: 77  KVLSLENRDIVLIQNMNLFKNLEELHLNNNFIEDLENLEELINLKILSASNNKIKKIKNL 136

Query: 683 CGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEG---LSTLVNLRVLDVSA 513
             L  ++++++ +N +  ++ L     L+ L LS+N I+ ME    L  L  L+ L++  
Sbjct: 137 NNLHNLRELNLHNNEIERIENLSNNKKLQILILSNNYIKHMEDIIYLKCLDKLKFLNIMN 196

Query: 512 NKLTAISNIAN 480
           N +  I  + N
Sbjct: 197 NPICNIPELQN 207



 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 39/145 (26%), Positives = 79/145 (54%), Gaps = 4/145 (2%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-N 687
           L+EL+++NN I  +E +E    L+IL   +NK++ ++NL  L NL+EL L  N I  I N
Sbjct: 98  LEELHLNNNFIEDLENLEELINLKILSASNNKIKKIKNLNNLHNLRELNLHNNEIERIEN 157

Query: 686 LCGLKCIKKISIQSNRLTSMKGLEECVALEE---LYLSHNGIEKMEGLSTLVNLRVLDVS 516
           L   K ++ + + +N +  M+ +     L++   L + +N I  +  L   V   ++++ 
Sbjct: 158 LSNNKKLQILILSNNYIKHMEDIIYLKCLDKLKFLNIMNNPICNIPELQNCVIKNLINIK 217

Query: 515 ANKLTAISNIANLTKLEDLWLNDNN 441
                 +S++  + K +D++++ N+
Sbjct: 218 YFNNIILSSLKKVHK-KDIYIHPND 241



>pir|AC1469|AC1469 internalin like protein (LPXTG motif) [imported]
           - Listeria innocua (strain Clip11262)>gb:AL596164_537637
           Listeria innocua Clip11262 complete genome, segment
           2/12.
          Length = 505

 Score = 68.2 bits (165), Expect = 4e-10
 Identities = 47/184 (25%), Positives = 96/184 (52%), Gaps = 4/184 (2%)
 Frame = -2

Query: 971 SAEENSGVSIFK---KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFH 801
           S  E S +S  K   KL   ++  N I+  + L  +++ + +L + +NQI  I  + +  
Sbjct: 104 SNAEVSDISALKDLTKLTKLEMYQNNISDINVLENLTN-ITDLDLHDNQITDISPVRNLT 162

Query: 800 ELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMK 624
            L +L L  N++  +  + TL+ L +L    N++  I+ + GL  +  +S+  N+++ + 
Sbjct: 163 NLVVLNLSYNQISDISAVSTLSKLNDLGFTDNQVSDISAVAGLNNLSSLSLGYNQISDIS 222

Query: 623 GLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDN 444
            L     L+ L + HN I  +  ++ L NL  + +  N+++ ++ IANLT L  ++L+  
Sbjct: 223 ILTNLTNLDGLSIDHNQISDLTPIANLTNLTFVGLHNNQISDLTPIANLTNLTRMYLSGQ 282

Query: 443 NISS 432
            I++
Sbjct: 283 QITN 286



 Score = 67.0 bits (162), Expect = 8e-10
 Identities = 51/204 (25%), Positives = 98/204 (48%), Gaps = 18/204 (8%)
 Frame = -2

Query: 902 ITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQE 723
           I S  G+  +++ L EL +SN +++ I  ++   +L  LE+  N +  +  L+ LTN+ +
Sbjct: 86  IASIEGIQYLTN-LTELNISNAEVSDISALKDLTKLTKLEMYQNNISDINVLENLTNITD 144

Query: 722 LWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLST 546
           L L  N+I  I+ +  L  +  +++  N+++ +  +     L +L  + N +  +  ++ 
Sbjct: 145 LDLHDNQITDISPVRNLTNLVVLNLSYNQISDISAVSTLSKLNDLGFTDNQVSDISAVAG 204

Query: 545 LVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAV-------------- 408
           L NL  L +  N+++ IS + NLT L+ L ++ N IS +  IA                 
Sbjct: 205 LNNLSSLSLGYNQISDISILTNLTNLDGLSIDHNQISDLTPIANLTNLTFVGLHNNQISD 264

Query: 407 ---AGSLQKLTTLYLERNPCANSP 345
                +L  LT +YL      N+P
Sbjct: 265 LTPIANLTNLTRMYLSGQQITNNP 288



 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 52/175 (29%), Positives = 84/175 (48%), Gaps = 7/175 (4%)
 Frame = -2

Query: 845 SNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLC-GLKC 669
           SN  IA IE I++   L  L + + ++  +  L+ LT L +L + +N I  IN+   L  
Sbjct: 82  SNLPIASIEGIQYLTNLTELNISNAEVSDISALKDLTKLTKLEMYQNNISDINVLENLTN 141

Query: 668 IKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISN 489
           I  + +  N++T +  +     L  L LS+N I  +  +STL  L  L  + N+++ IS 
Sbjct: 142 ITDLDLHDNQITDISPVRNLTNLVVLNLSYNQISDISAVSTLSKLNDLGFTDNQVSDISA 201

Query: 488 IANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN------PCANSPN 342
           +A L  L  L L  N IS +     ++  +L  L  L ++ N      P AN  N
Sbjct: 202 VAGLNNLSSLSLGYNQISDI-----SILTNLTNLDGLSIDHNQISDLTPIANLTN 251



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 29/107 (27%), Positives = 56/107 (52%)
 Frame = -2

Query: 638 LTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDL 459
           + S++G++    L EL +S+  +  +  L  L  L  L++  N ++ I+ + NLT + DL
Sbjct: 86  IASIEGIQYLTNLTELNISNAEVSDISALKDLTKLTKLEMYQNNISDINVLENLTNITDL 145

Query: 458 WLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQI 318
            L+DN I+ +  +      +L  L  L L  N  ++  + +STL ++
Sbjct: 146 DLHDNQITDISPVR-----NLTNLVVLNLSYNQISDI-SAVSTLSKL 186



>pir|AD1822|AD1822 leucine-rich-repeat protein [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_681116 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 1119

 Score = 63.2 bits (152), Expect(2) = 5e-10
 Identities = 67/213 (31%), Positives = 107/213 (50%), Gaps = 8/213 (3%)
 Frame = -2

Query: 932 LLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILEL-GSNKLR 762
           L   ++S+N+IT  P  L+K+++ L +L +S NQI +I E +     L  L L G+ +  
Sbjct: 151 LTQLNLSYNQITEIPEALAKLTN-LTQLNLSYNQITEIPEALAKLTNLTQLNLRGNQRTE 209

Query: 761 VMENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALEEL 591
           + E L  LTNL  L L  N+   I   L  L  + ++ +  N++  + + + +   L  L
Sbjct: 210 IPEALAKLTNLTRLNLSYNQRTEIPEALAKLTNLTQLILSDNQIKEIPETIAKLTNLTHL 269

Query: 590 YLSHNGIEKM-EGLSTLVNLRVLDVSANKLTAISN-IANLTKLEDLWLNDNNISSVEDIA 417
            LS N I+++ E ++ L NL  L +  N++  I   IA LT L  L L+ N I   ++I 
Sbjct: 270 ILSGNQIKEIPETIAKLTNLTQLGLDGNQIKEIPEAIAKLTNLTQLGLDGNQI---KEIP 326

Query: 416 EAVAGSLQKLTTLYLERNPCANSPNYISTLRQI 318
           EA+   L  LT L L  N     P  I+ L  +
Sbjct: 327 EAIT-KLTNLTHLILSGNQIKEIPETIAKLTNL 358



 Score = 35.0 bits (79), Expect = 3.4
 Identities = 22/81 (27%), Positives = 45/81 (55%), Gaps = 1/81 (1%)
 Frame = -3

Query: 1123 NRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP-VL 947
            N+ + +   ++ L+NL + +L  N  T+   E L+    ++ L +L+L DNQ+K+IP  +
Sbjct: 205  NQRTEIPEALAKLTNLTRLNLSYNQRTEIP-EALAK---LTNLTQLILSDNQIKEIPETI 260

Query: 946  AYLRNFWYLMFRSTKLHHLAD 884
            A L N  +L+    ++  + +
Sbjct: 261  AKLTNLTHLILSGNQIKEIPE 281



 Score = 33.9 bits (76), Expect = 7.6
 Identities = 32/103 (31%), Positives = 43/103 (41%), Gaps = 24/103 (23%)
 Frame = -2

Query: 554 LSTLVNLRVLDVSANKLTAISNI------------------------ANLTKLEDLWLND 447
           L +L NLR LD+S N L  I ++                        A LT L  L L+D
Sbjct: 76  LLSLPNLRKLDISGNPLEGIPDVVMQILHLEELILIRVQLTEIPEALAKLTNLTQLILSD 135

Query: 446 NNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQI 318
           N I+   +I EA+A  L  LT L L  N     P  ++ L  +
Sbjct: 136 NQIT---EIPEALA-KLTNLTQLNLSYNQITEIPEALAKLTNL 174



 Score = 24.6 bits (52), Expect(2) = 5e-10
 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%)
 Frame = -3

Query: 1006 ISQLEELVLRDNQLKKIP-VLAYLRNFWYL 920
            ++ L +L+L DNQ+ +IP  LA L N   L
Sbjct: 125  LTNLTQLILSDNQITEIPEALAKLTNLTQL 154



>gb:BC073119_2557024 Xenopus laevis MGC83642 protein, mRNA (cDNA
           clone MGC:83642 IMAGE:5085089), complete cds.
          Length = 807

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 49/150 (32%), Positives = 80/150 (53%), Gaps = 2/150 (1%)
 Frame = -2

Query: 728 QELWLGRNRIRAINLCGLKC--IKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEG 555
           Q L L +N+I  +     KC  + ++S+ +NRL  M G+ + + L  L L HN I  +EG
Sbjct: 36  QTLILDKNQIIKLEHVE-KCRNLVQLSVANNRLVRMMGVAKLIHLRVLNLPHNSIGYVEG 94

Query: 554 LSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLY 375
           L  LV+L  ++++ N L  I  I + T L+ L L+DNNIS + D+++     L+ L TL 
Sbjct: 95  LKDLVHLEWINLAGNNLKIIDQINSSTSLQHLDLSDNNISQIGDLSK-----LKSLKTLL 149

Query: 374 LERNPCANSPNYISTLRQIFPNIQQVDSEL 285
           L  N  A+     + L Q    +   ++E+
Sbjct: 150 LHGNNIASLRAASACLPQSLTILSLAENEI 179



 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 50/184 (27%), Positives = 92/184 (50%), Gaps = 6/184 (3%)
 Frame = -2

Query: 896 SPSGLSKVSSTL------KELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLT 735
           S  GL K+S TL      + L +  NQI K+E +E    L  L + +N+L          
Sbjct: 18  SGQGLQKLSPTLPFGNDTQTLILDKNQIIKLEHVEKCRNLVQLSVANNRL---------- 67

Query: 734 NLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEG 555
                      +R + +  L  ++ +++  N +  ++GL++ V LE + L+ N ++ ++ 
Sbjct: 68  -----------VRMMGVAKLIHLRVLNLPHNSIGYVEGLKDLVHLEWINLAGNNLKIIDQ 116

Query: 554 LSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLY 375
           +++  +L+ LD+S N ++ I +++ L  L+ L L+ NNI+S   +  A A   Q LT L 
Sbjct: 117 INSSTSLQHLDLSDNNISQIGDLSKLKSLKTLLLHGNNIAS---LRAASACLPQSLTILS 173

Query: 374 LERN 363
           L  N
Sbjct: 174 LAEN 177



>gb:AC002397_2049807 Mouse chromosome 6 BAC-284H12 (Research
           Genetics mouse BAC library) complete
           sequence.>gb:BC049601_2100080 Mus musculus leucine rich
           protein, B7 gene, mRNA (cDNA clone MGC:58258
           IMAGE:6743951), complete cds.
          Length = 340

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 63/219 (28%), Positives = 107/219 (48%), Gaps = 6/219 (2%)
 Frame = -2

Query: 920 DVSFNEITSPSGLSKVSSTLKELYVSNNQI--AKIEEIEHFHELQILELGSNKLRVMENL 747
           D+S N IT  S L+ ++  L  L    NQ+  A++ E+ +   LQI     N++   E +
Sbjct: 94  DISENHITDISPLNSLTHLLW-LKADGNQLRSARMNELPY---LQIASFSYNQIIDTEGI 149

Query: 746 QTLTNLQELWLGRNRIRAINLCG---LKCIKKISIQSNRLTSMKGLEECVALEELYLSHN 576
                L  L L  NRI  +       L  +  + ++ N+L S KG+     L+ LYL+ N
Sbjct: 150 FH-PRLGSLDLKGNRIHQVTGLDPERLSSLHTLELRGNQLESTKGIY-LPKLKNLYLAQN 207

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIA-NLTKLEDLWLNDNNISSVEDIAEAVAGS 399
            ++K+EGL  L NL  L +  N++  ++  +  +  L+ L L  N IS + ++A+     
Sbjct: 208 LLKKVEGLENLSNLTTLHLRDNQIETLNGFSQEMKSLQYLNLRSNMISDLAELAK--LRD 265

Query: 398 LQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELF 282
           L KL  L L  NPCA+  +Y         +++++D E +
Sbjct: 266 LPKLRALVLLDNPCADETDYRQEALVQMAHLERLDKEFY 304



>gb:CR380950_1649791 Candida glabrata strain CBS138 chromosome D
            complete sequence.
          Length = 2082

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 73/268 (27%), Positives = 115/268 (42%), Gaps = 15/268 (5%)
 Frame = -2

Query: 1118 FVGVRPPYFPPLQSQQILSSPEPHYRRRARASFVVAHHFPTRGTSAQG*SAEENSGV--- 948
            F  V P +F P Q Q+++ S   H   R          F    +  +      N+ +   
Sbjct: 829  FHPVTPSHFTPEQEQRLMRSEFVHVDLRNMDLTTPPIIFYQHTSEIESLDVSNNANIFLP 888

Query: 947  -----SIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQIL 786
                 S  K L +  V+      P+ +++    L  L +  N I K+   I     L IL
Sbjct: 889  LEFIESAIKLLSLRMVNIRASRFPANITEAYK-LVSLELQRNFIRKVPSSISKLVNLTIL 947

Query: 785  ELGSNKL-RVMENLQTLTNLQELWLGRNRI----RAINLCGLKCIKKISIQSNRLTSM-K 624
             L  N L R+      L NLQ L L  NR       IN C    + +I +  N++  + K
Sbjct: 948  NLQCNGLDRLPSGFSQLKNLQLLDLSSNRFAHYPEVINFC--TNLLQIDLSYNKIHHLPK 1005

Query: 623  GLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDN 444
               + V L ++ LSHN +  +  LS L NLR L++  N++  I+   N   L++L+L DN
Sbjct: 1006 SCRQLVKLAKMNLSHNKLTHVGDLSELKNLRTLNLRFNRINTIN--TNAPNLQNLFLTDN 1063

Query: 443  NISSVEDIAEAVAGSLQKLTTLYLERNP 360
             IS+ ++       +L KL  L ++ NP
Sbjct: 1064 RISNFDE-------NLPKLRALEIQENP 1084



 Score = 57.4 bits (137), Expect = 6e-07
 Identities = 57/216 (26%), Positives = 95/216 (43%), Gaps = 3/216 (1%)
 Frame = -2

Query: 956  SGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILEL 780
            SG S  K L + D+S N       +    + L ++ +S N+I  + +      +L  + L
Sbjct: 959  SGFSQLKNLQLLDLSSNRFAHYPEVINFCTNLLQIDLSYNKIHHLPKSCRQLVKLAKMNL 1018

Query: 779  GSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVAL 600
              NKL  + +L  L NL+ L L  NRI  IN      ++ + +  NR+++    E    L
Sbjct: 1019 SHNKLTHVGDLSELKNLRTLNLRFNRINTINT-NAPNLQNLFLTDNRISNFD--ENLPKL 1075

Query: 599  EELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISN--IANLTKLEDLWLNDNNISSVE 426
              L +  N I  +      +N+  L ++  KL +I       L +LE L LN+NN++ + 
Sbjct: 1076 RALEIQENPITSISFREYPMNMTSLSLNKAKLASIPGEIFKKLLRLEKLELNENNLTRL- 1134

Query: 425  DIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQI 318
                +    L KL  L   RN   + P   S L+ +
Sbjct: 1135 ---PSEISLLTKLVYLSAARNKLESIPQEFSKLKSL 1167



>gb:AE017291_433396 Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130, chromosome I, section 5 of 14 of the
           complete sequence.>gb:AE016823_1066407 Leptospira
           interrogans serovar Copenhageni str. Fiocruz L1-130,
           chromosome I, complete sequence.
          Length = 288

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 63/218 (28%), Positives = 113/218 (51%), Gaps = 11/218 (5%)
 Frame = -2

Query: 938 KKLLVFDVSFNEI----TSPSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGS 774
           K +LV +   NE     T P  +  + + LKELY+S N+I  +  EI +   LQ+L L  
Sbjct: 47  KDVLVLNYRDNEENPLKTLPKEIGNLQN-LKELYLSANEITTLPPEIGNLKNLQVLSLNG 105

Query: 773 NKLR-VMENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECV 606
           N+L  + + +  L  L+EL +  N+++ +   +  LK +K++ +  N+L  + + +    
Sbjct: 106 NRLETIPKEIGNLKKLKELSIEWNKLQTLPKEIGNLKNLKELYLSRNQLKILPQEIGNLR 165

Query: 605 ALEELYLSHNGIEKM-EGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISS 432
            L+ ++LS N + K+ + +  L +L  + +  N+ T +   I NL  L +L L  N + S
Sbjct: 166 KLQRIHLSTNELTKLPQEIKNLESLLEIYLYDNQFTTLPKEIGNLKNLRNLVLGRNQLIS 225

Query: 431 VEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQI 318
           +  + E   G+L+ L  LYLE N     P  I+ L+Q+
Sbjct: 226 L--LPE--IGNLKNLKELYLEENQLTMLPKQIAALKQL 259



 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 41/151 (27%), Positives = 83/151 (54%), Gaps = 7/151 (4%)
 Frame = -2

Query: 938 KKLLVFDVSFNEI-TSPSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKL 765
           KKL    + +N++ T P  +  + + LKELY+S NQ+  + +EI +  +LQ + L +N+L
Sbjct: 119 KKLKELSIEWNKLQTLPKEIGNLKN-LKELYLSRNQLKILPQEIGNLRKLQRIHLSTNEL 177

Query: 764 -RVMENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTS-MKGLEECVALE 597
            ++ + ++ L +L E++L  N+   +   +  LK ++ + +  N+L S +  +     L+
Sbjct: 178 TKLPQEIKNLESLLEIYLYDNQFTTLPKEIGNLKNLRNLVLGRNQLISLLPEIGNLKNLK 237

Query: 596 ELYLSHNGIEKM-EGLSTLVNLRVLDVSANK 507
           ELYL  N +  + + ++ L  L  L +  N+
Sbjct: 238 ELYLEENQLTMLPKQIAALKQLARLSLKGNQ 268



 Score = 45.4 bits (106), Expect = 0.003
 Identities = 32/107 (29%), Positives = 59/107 (55%), Gaps = 4/107 (3%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKL- 765
           +KL    +S NE+T      K   +L E+Y+ +NQ   + +EI +   L+ L LG N+L 
Sbjct: 165 RKLQRIHLSTNELTKLPQEIKNLESLLEIYLYDNQFTTLPKEIGNLKNLRNLVLGRNQLI 224

Query: 764 RVMENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTS 630
            ++  +  L NL+EL+L  N++  +   +  LK + ++S++ N+  S
Sbjct: 225 SLLPEIGNLKNLKELYLEENQLTMLPKQIAALKQLARLSLKGNQFPS 271



>pir|D97302|D97302 hypothetical protein CAC3273 [imported] -
           Clostridium acetobutylicum>gb:AE007823_230568
           Clostridium acetobutylicum ATCC 824 section 311 of 356
           of the complete genome.>gb:AE001437_1093523 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 500

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 54/225 (24%), Positives = 103/225 (45%), Gaps = 25/225 (11%)
 Frame = -2

Query: 908 NEITSPSG--LSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLT 735
           N I  P+G    +    +   Y +N  I  ++ IE+   L+ L   +  ++ +  L++LT
Sbjct: 276 NMINKPTGSLYKEDVQGITSFYNTNPNIHYLDGIENLSNLEFLTFSNTPIKDLTPLKSLT 335

Query: 734 NLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKME 558
            L+ L L    I     +  L  +  +S+Q+  L+ +  L     L++L+L +N I  ++
Sbjct: 336 KLKHLQLDNVTINDFTPIASLTNLTNLSLQNTGLSDLSVLNNLTNLKDLFLGNNNISNID 395

Query: 557 GLSTL----------------------VNLRVLDVSANKLTAISNIANLTKLEDLWLNDN 444
            L+ L                       NL ++D+S N +T +S++ANL+ L  L+L++N
Sbjct: 396 ALANLHNLTTVSLLGNHIKNINSLANLYNLNLIDLSYNIITDLSSLANLSNLNKLYLSNN 455

Query: 443 NISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQIFPN 309
           N+ ++  +       L  L TL +  N   N  + + +L+   PN
Sbjct: 456 NLENISSL-----NKLSNLQTLDIS-NTLVNKSD-VDSLQAALPN 493



 Score = 36.6 bits (83), Expect = 1.2
 Identities = 19/53 (35%), Positives = 32/53 (60%)
 Frame = -2

Query: 932 LLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS 774
           L + D+S+N IT  S L+ +S+ L +LY+SNN +  I  +     LQ L++ +
Sbjct: 425 LNLIDLSYNIITDLSSLANLSN-LNKLYLSNNNLENISSLNKLSNLQTLDISN 476



 Score = 34.7 bits (78), Expect = 4.5
 Identities = 24/64 (37%), Positives = 33/64 (51%)
 Frame = -3

Query: 1096 ISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYLM 917
            +++L NLN   L  N+ITD     LSS   +S L +L L +N L+ I  L  L N   L 
Sbjct: 419  LANLYNLNLIDLSYNIITD-----LSSLANLSNLNKLYLSNNNLENISSLNKLSNLQTLD 473

Query: 916  FRST 905
              +T
Sbjct: 474  ISNT 477



>pir|C97302|C97302 hypothetical protein CAC3272 [imported] -
            Clostridium acetobutylicum>gb:AE007822_230567 Clostridium
            acetobutylicum ATCC 824 section 310 of 356 of the
            complete genome.>gb:AE001437_1093522 Clostridium
            acetobutylicum ATCC 824, complete genome.
          Length = 701

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 54/204 (26%), Positives = 92/204 (45%)
 Frame = -2

Query: 920  DVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQT 741
            D++   + S +G+  +++ L+ LY++NN I  I  +++   L  L L  N +  +  L +
Sbjct: 516  DLTGKGLRSLNGIENLTN-LQTLYLANNYIIDIAPLKNLTNLNTLVLDDNSVSDLSPLSS 574

Query: 740  LTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKM 561
            L NL                     K +S+  N  + +  L+  + L  L  S+N +  +
Sbjct: 575  LNNL---------------------KSLSLPQNNFSDITPLKNLINLNHLDFSYNNVIDI 613

Query: 560  EGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTT 381
              L  L NL  L  S N +  IS I N+  L+ L LN N I+++  +      +L  L T
Sbjct: 614  TPLKNLTNLVTLLASYNNINDISAITNVGNLQILGLNSNKINNLTPL-----NTLTNLNT 668

Query: 380  LYLERNPCANSPNYISTLRQIFPN 309
            LY+  N   +    I+TL+   PN
Sbjct: 669  LYISNNLVTHEG--INTLKTALPN 690



 Score = 51.2 bits (121), Expect = 5e-05
 Identities = 36/129 (27%), Positives = 62/129 (48%), Gaps = 3/129 (2%)
 Frame = -2

Query: 668 IKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISN 489
           I+ I +    L S+ G+E    L+ LYL++N I  +  L  L NL  L +  N ++ +S 
Sbjct: 512 IQSIDLTGKGLRSLNGIENLTNLQTLYLANNYIIDIAPLKNLTNLNTLVLDDNSVSDLSP 571

Query: 488 IANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLY---LERNPCANSPNYISTLRQI 318
           +++L  L+ L L  NN S +  +   +  +L  L   Y   ++  P  N  N + TL   
Sbjct: 572 LSSLNNLKSLSLPQNNFSDITPLKNLI--NLNHLDFSYNNVIDITPLKNLTNLV-TLLAS 628

Query: 317 FPNIQQVDS 291
           + NI  + +
Sbjct: 629 YNNINDISA 637



 Score = 45.1 bits (105), Expect = 0.003
 Identities = 26/94 (27%), Positives = 50/94 (53%)
 Frame = -2

Query: 644 NRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLE 465
           N+ T      + + ++ + L+  G+  + G+  L NL+ L ++ N +  I+ + NLT L 
Sbjct: 498 NKPTGTLYKSDVLQIQSIDLTGKGLRSLNGIENLTNLQTLYLANNYIIDIAPLKNLTNLN 557

Query: 464 DLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
            L L+DN++S +  ++     SL  L +L L +N
Sbjct: 558 TLVLDDNSVSDLSPLS-----SLNNLKSLSLPQN 586



>sp|P49606|CYAA_USTMA Adenylate cyclase (EC 4.6.1.1) (ATP
            pyrophosphate-lyase) (Adenylyl
            cyclase).>pir|A55481|A55481 adenylate cyclase (EC
            4.6.1.1) uac1 - smut fungus (Ustilago
            maydis)>gb:USMUAC1A_1726939 Corn smut fungus uac1 gene,
            complete cds.
          Length = 2493

 Score = 67.8 bits (164), Expect = 5e-10
 Identities = 51/178 (28%), Positives = 94/178 (52%), Gaps = 7/178 (3%)
 Frame = -2

Query: 872  SSTLKELYVSNNQIAKIEEI--EHFHELQILELGSNKLRVMEN-LQTLTNLQELWLGRNR 702
            S TL  L VSNN+I ++  +  +   EL  L++ +N+L  + +   +++ L+ L +  NR
Sbjct: 1155 SETLTHLDVSNNRIVELAHVSLDLIPELMSLKVQNNRLFDLPSYFSSISTLRNLNISNNR 1214

Query: 701  IRAIN--LCGLKCIKKISIQSNRLTSMKG-LEECVALEELYLSHNGIEKM-EGLSTLVNL 534
                   +C +  +  + +  N +T +   +   + LE   L+ N +EK+ + +S LV+L
Sbjct: 1215 FEEFPKVICDVPSLVDLDVSFNSITELPAEIANLINLERFILAGNELEKLPDSMSELVSL 1274

Query: 533  RVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNP 360
            R +D+  NK+  +S++  L +L+++    NNI S     EA  G   +LT + L RNP
Sbjct: 1275 RTIDLRRNKVQDVSSLLGLPRLQNIQAESNNIKSF----EATLG--PQLTQVELGRNP 1326



 Score = 45.1 bits (105), Expect = 0.003
 Identities = 56/241 (23%), Positives = 103/241 (42%), Gaps = 30/241 (12%)
 Frame = -2

Query: 950  VSIFKKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKI---------------- 822
            + +  +L+   V  N +   PS  S +S TL+ L +SNN+  +                 
Sbjct: 1176 LDLIPELMSLKVQNNRLFDLPSYFSSIS-TLRNLNISNNRFEEFPKVICDVPSLVDLDVS 1234

Query: 821  --------EEIEHFHELQILELGSNKL-RVMENLQTLTNLQELWLGRNRIRAI-NLCGLK 672
                     EI +   L+   L  N+L ++ +++  L +L+ + L RN+++ + +L GL 
Sbjct: 1235 FNSITELPAEIANLINLERFILAGNELEKLPDSMSELVSLRTIDLRRNKVQDVSSLLGLP 1294

Query: 671  CIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKME-GLSTLVNLRVLDVSANKLTAI 495
             ++ I  +SN + S +       L ++ L  N + K+     T  +L  LD+S+  +T +
Sbjct: 1295 RLQNIQAESNNIKSFEATLG-PQLTQVELGRNPLSKVRIAALTTCDLTSLDLSSTNMTRL 1353

Query: 494  SN--IANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQ 321
                   L  L  L L+ N +  + D      G L++L  L    N  A  P  I  L+ 
Sbjct: 1354 EEGLFPQLPALVKLTLDGNQLVVLPD----TLGDLKRLEMLSCSNNLLATLPESIGDLKA 1409

Query: 320  I 318
            +
Sbjct: 1410 L 1410



 Score = 42.7 bits (99), Expect = 0.016
 Identities = 57/233 (24%), Positives = 99/233 (42%), Gaps = 10/233 (4%)
 Frame = -2

Query: 956  SGVSIFKKLLVFDVSFNEITSPSGLSKVSST-LKELYVSNNQIAKI--EEIEHFHELQIL 786
            S +S    L V ++SFNEI      S  + T L+ELY+S NQ++ I  +++    EL+IL
Sbjct: 1528 SVLSELTSLEVLNLSFNEIFEIPDFSLQTLTKLRELYISGNQLSTIPSDDLVVLQELRIL 1587

Query: 785  ELGSNKLRVM-ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEEC 609
             L  NKL  +   L  L  L  L +G N            + K +I +        +   
Sbjct: 1588 HLNCNKLTTLPTELGKLKKLANLDVGNN------------VLKYNIANWHYDWNWNMNP- 1634

Query: 608  VALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLND------ 447
               E  YL+ +G  ++E     +  ++ D+   + + IS+ + LT L  L L D      
Sbjct: 1635 ---ELRYLNLSGNTRLE-----IKTKLSDMGFTRKSNISDFSRLTSLRMLGLMDVTMPLH 1686

Query: 446  NNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSE 288
            +N +  E     V  SL ++  +           + +S +  + P  ++ + E
Sbjct: 1687 SNATPDESDNRRVRTSLSQVNGMAYGIADALGKHDNLSVIDLVIPTFRKDEGE 1739



 Score = 39.3 bits (90), Expect = 0.18
 Identities = 39/123 (31%), Positives = 57/123 (46%), Gaps = 5/123 (4%)
 Frame = -2

Query: 797  LQILELGSNKLR--VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMK 624
            LQ L LG N+L   V   L  LT+L+ L L  N I  I    L+ + K            
Sbjct: 1512 LQKLRLGDNRLGDDVFSVLSELTSLEVLNLSFNEIFEIPDFSLQTLTK------------ 1559

Query: 623  GLEECVALEELYLSHNGIEKM--EGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWL 453
                   L ELY+S N +  +  + L  L  LR+L ++ NKLT + + +  L KL +L +
Sbjct: 1560 -------LRELYISGNQLSTIPSDDLVVLQELRILHLNCNKLTTLPTELGKLKKLANLDV 1612

Query: 452  NDN 444
             +N
Sbjct: 1613 GNN 1615



>gb:BC088034_2565547 Xenopus tropicalis hypothetical LOC496765, mRNA
           (cDNA clone MGC:108296 IMAGE:7021454), complete cds.
          Length = 605

 Score = 67.4 bits (163), Expect = 6e-10
 Identities = 59/214 (27%), Positives = 116/214 (54%), Gaps = 6/214 (2%)
 Frame = -2

Query: 950 VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGS 774
           +S+   L+V D+  N+I S     K  + L++L +S+N+I ++ +E++H   L+ L L  
Sbjct: 101 ISLLPALVVLDIHDNQIVSLPCAIKELTNLQKLNISHNKIKQLPKELQHLQNLKSLLLQH 160

Query: 773 NKLRVM-ENLQTLTNLQELWLGRNRIRAIN--LCGLKCIKKISIQSNRLTSMKG-LEECV 606
           N+L  + +++  L+ L+EL +  N +R+I+  +  L  + K ++ SN+LT++   + +  
Sbjct: 161 NQLEELPDSIGHLSILEELDVSNNCLRSISSSVGQLTGLVKFNLSSNKLTALPTEIGKMK 220

Query: 605 ALEELYLSHNGIEKMEG-LSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV 429
            L++L  + N +E +   ++ + +L  L +  NKLT +  +  LTKL++L + +N I   
Sbjct: 221 NLKQLDCTSNLLENVPASVAGMESLEQLYLRQNKLTYLPELPFLTKLKELHVGNNQI--- 277

Query: 428 EDIAEAVAGSLQKLTTLYLERNPCANSPNYISTL 327
           + +      +L  L+ L L  N     P  IS L
Sbjct: 278 QTLGPEHLQNLSSLSVLELRYNKLKVLPEEISLL 311



 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 48/162 (29%), Positives = 85/162 (52%), Gaps = 7/162 (4%)
 Frame = -2

Query: 959 NSGVSIFKKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKIE-EIEHFHELQIL 786
           +S V     L+ F++S N++T+ P+ + K+ + LK+L  ++N +  +   +     L+ L
Sbjct: 190 SSSVGQLTGLVKFNLSSNKLTALPTEIGKMKN-LKQLDCTSNLLENVPASVAGMESLEQL 248

Query: 785 ELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECV 606
            L  NKL  +  L  LT L+EL +G N+I+ +    L+ +  +S+   R   +K L E +
Sbjct: 249 YLRQNKLTYLPELPFLTKLKELHVGNNQIQTLGPEHLQNLSSLSVLELRYNKLKVLPEEI 308

Query: 605 A----LEELYLSHNGIEKME-GLSTLVNLRVLDVSANKLTAI 495
           +    LE L LS+N +  +   L +L NL+ L +  N L  I
Sbjct: 309 SLLNGLERLDLSNNDLGSLPCTLGSLPNLKSLQLEGNPLRGI 350



 Score = 46.6 bits (109), Expect = 0.001
 Identities = 38/128 (29%), Positives = 67/128 (52%), Gaps = 6/128 (4%)
 Frame = -2

Query: 716 LGRNRIRAI--NLCGLKCIKKISIQSNRLTSMKG-LEECVALEELYLSHNGIEKM-EGLS 549
           LG N+I +I  NLC L  +  I +++N LTS+   +E    L+ + LS N  +   + L 
Sbjct: 459 LGFNKISSISLNLCMLLKLTHIDMRNNVLTSLPSEMEAMTRLQSVILSFNRFKHFPDVLY 518

Query: 548 TLVNLRVLDVSANKLTAI--SNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLY 375
            +  L  + +S+N++ +I  + +  +TKL  L L +N++  +        G+ + L  L+
Sbjct: 519 RIPTLETILISSNQIGSIDPTQLIKMTKLSTLDLQNNDLLQI----PPALGNCESLRALH 574

Query: 374 LERNPCAN 351
           LE NP  N
Sbjct: 575 LEGNPFRN 582



 Score = 34.7 bits (78), Expect = 4.5
 Identities = 20/64 (31%), Positives = 34/64 (53%)
 Frame = -3

Query: 1129 TANRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPV 950
            ++N+L+AL   I  + NL +     NL+ +      +S   +  LE+L LR N+L  +P 
Sbjct: 205  SSNKLTALPTEIGKMKNLKQLDCTSNLLENVP----ASVAGMESLEQLYLRQNKLTYLPE 260

Query: 949  LAYL 938
            L +L
Sbjct: 261  LPFL 264



>gb:AL596090_2070793 Mouse DNA sequence from clone RP23-135F6 on
           chromosome 11 Contains the 5' end of the gene for the
           likely ortholog of H. sapiens target of myb1-like 2
           (chicken) (TOM1L2) (A730055F12Rik), a
           glyceraldehyde-3-phosphate dehydrogenase (Gapd)
           pseudogene, the gene for a novel Leucine Rich Repeat
           domain-containing protein (4930449E07Rik), the Atpaf2
           gene for ATP synthase mitochondrial F1 complex assembly
           factor 2, the gene for a novel protein (4933439F18Rik),
           an acid phosphatase 1 soluble (Acp1) pseudogene, a
           ribosomal protein S4, X-linked (Rps4x) pseudogene, the
           Drg2 gene for developmentally regulated GTP binding
           protein 2, the 5' end of the Myo15 gene for myosin XV
           and four CpG islands, complete sequence.
          Length = 208

 Score = 67.4 bits (163), Expect = 6e-10
 Identities = 43/124 (34%), Positives = 69/124 (55%)
 Frame = -2

Query: 710 RNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLR 531
           +N +R  NL   + +KK+ + +N +  ++GL   + L  L LS N IE +EGL TLVNL 
Sbjct: 53  QNILRIDNLWQFENLKKLQLNNNIIERIEGLTNLIHLVWLDLSFNNIEAIEGLDTLVNLE 112

Query: 530 VLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCAN 351
            L +S N+++ + ++  L KL+ L L +N IS++ +I          L TL L  NP + 
Sbjct: 113 DLSLSNNRISKVDSLDALVKLQVLSLGNNQISNMMNI--IYLRRFPCLRTLSLAGNPVSE 170

Query: 350 SPNY 339
           +  Y
Sbjct: 171 AEEY 174



 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 38/113 (33%), Positives = 62/113 (54%)
 Frame = -2

Query: 674 KCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAI 495
           K +  + +    +  +  L +   L++L L++N IE++EGL+ L++L  LD+S N + AI
Sbjct: 43  KDVLSLQLDFQNILRIDNLWQFENLKKLQLNNNIIERIEGLTNLIHLVWLDLSFNNIEAI 102

Query: 494 SNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYI 336
             +  L  LEDL L++N IS V+ +      +L KL  L L  N  +N  N I
Sbjct: 103 EGLDTLVNLEDLSLSNNRISKVDSL-----DALVKLQVLSLGNNQISNMMNII 150



 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 40/133 (30%), Positives = 70/133 (52%), Gaps = 4/133 (3%)
 Frame = -2

Query: 944 IFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKL 765
           +FK +L   + F  I     L +  + LK+L ++NN I +IE + +   L  L+L  N +
Sbjct: 41  LFKDVLSLQLDFQNILRIDNLWQFEN-LKKLQLNNNIIERIEGLTNLIHLVWLDLSFNNI 99

Query: 764 RVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKG---LEECVALE 597
             +E L TL NL++L L  NRI  + +L  L  ++ +S+ +N++++M     L     L 
Sbjct: 100 EAIEGLDTLVNLEDLSLSNNRISKVDSLDALVKLQVLSLGNNQISNMMNIIYLRRFPCLR 159

Query: 596 ELYLSHNGIEKME 558
            L L+ N + + E
Sbjct: 160 TLSLAGNPVSEAE 172



>gb:AK049695_1168926 Mus musculus 12 days embryo spinal cord cDNA,
           RIKEN full-length enriched library, clone:C530040K17
           product:hypothetical Leucine-rich repeat
           cysteine-containing subfamily/Leucine-rich repeat
           containing protein, full insert
           sequence.>gb:AL596090_2070792 Mouse DNA sequence from
           clone RP23-135F6 on chromosome 11 Contains the 5' end of
           the gene for the likely ortholog of H. sapiens target of
           myb1-like 2 (chicken) (TOM1L2) (A730055F12Rik), a
           glyceraldehyde-3-phosphate dehydrogenase (Gapd)
           pseudogene, the gene for a novel Leucine Rich Repeat
           domain-containing protein (4930449E07Rik), the Atpaf2
           gene for ATP synthase mitochondrial F1 complex assembly
           factor 2, the gene for a novel protein (4933439F18Rik),
           an acid phosphatase 1 soluble (Acp1) pseudogene, a
           ribosomal protein S4, X-linked (Rps4x) pseudogene, the
           Drg2 gene for developmentally regulated GTP binding
           protein 2, the 5' end of the Myo15 gene for myosin XV
           and four CpG islands, complete sequence.
          Length = 278

 Score = 67.4 bits (163), Expect = 6e-10
 Identities = 43/124 (34%), Positives = 69/124 (55%)
 Frame = -2

Query: 710 RNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLR 531
           +N +R  NL   + +KK+ + +N +  ++GL   + L  L LS N IE +EGL TLVNL 
Sbjct: 53  QNILRIDNLWQFENLKKLQLNNNIIERIEGLTNLIHLVWLDLSFNNIEAIEGLDTLVNLE 112

Query: 530 VLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCAN 351
            L +S N+++ + ++  L KL+ L L +N IS++ +I          L TL L  NP + 
Sbjct: 113 DLSLSNNRISKVDSLDALVKLQVLSLGNNQISNMMNI--IYLRRFPCLRTLSLAGNPVSE 170

Query: 350 SPNY 339
           +  Y
Sbjct: 171 AEEY 174



 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 38/113 (33%), Positives = 62/113 (54%)
 Frame = -2

Query: 674 KCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAI 495
           K +  + +    +  +  L +   L++L L++N IE++EGL+ L++L  LD+S N + AI
Sbjct: 43  KDVLSLQLDFQNILRIDNLWQFENLKKLQLNNNIIERIEGLTNLIHLVWLDLSFNNIEAI 102

Query: 494 SNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYI 336
             +  L  LEDL L++N IS V+ +      +L KL  L L  N  +N  N I
Sbjct: 103 EGLDTLVNLEDLSLSNNRISKVDSL-----DALVKLQVLSLGNNQISNMMNII 150



 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 40/133 (30%), Positives = 70/133 (52%), Gaps = 4/133 (3%)
 Frame = -2

Query: 944 IFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKL 765
           +FK +L   + F  I     L +  + LK+L ++NN I +IE + +   L  L+L  N +
Sbjct: 41  LFKDVLSLQLDFQNILRIDNLWQFEN-LKKLQLNNNIIERIEGLTNLIHLVWLDLSFNNI 99

Query: 764 RVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKG---LEECVALE 597
             +E L TL NL++L L  NRI  + +L  L  ++ +S+ +N++++M     L     L 
Sbjct: 100 EAIEGLDTLVNLEDLSLSNNRISKVDSLDALVKLQVLSLGNNQISNMMNIIYLRRFPCLR 159

Query: 596 ELYLSHNGIEKME 558
            L L+ N + + E
Sbjct: 160 TLSLAGNPVSEAE 172



>gb:AK015430_1158383 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4930449E07
           product:hypothetical Leucine-rich repeat
           cysteine-containing subfamily/Leucine-rich repeat
           containing protein, full insert
           sequence.>gb:AL596090_2070791 Mouse DNA sequence from
           clone RP23-135F6 on chromosome 11 Contains the 5' end of
           the gene for the likely ortholog of H. sapiens target of
           myb1-like 2 (chicken) (TOM1L2) (A730055F12Rik), a
           glyceraldehyde-3-phosphate dehydrogenase (Gapd)
           pseudogene, the gene for a novel Leucine Rich Repeat
           domain-containing protein (4930449E07Rik), the Atpaf2
           gene for ATP synthase mitochondrial F1 complex assembly
           factor 2, the gene for a novel protein (4933439F18Rik),
           an acid phosphatase 1 soluble (Acp1) pseudogene, a
           ribosomal protein S4, X-linked (Rps4x) pseudogene, the
           Drg2 gene for developmentally regulated GTP binding
           protein 2, the 5' end of the Myo15 gene for myosin XV
           and four CpG islands, complete
           sequence.>gb:BC018412_2092709 Mus musculus RIKEN cDNA
           4930449E07 gene, mRNA (cDNA clone MGC:25699
           IMAGE:3673669), complete cds.
          Length = 523

 Score = 67.4 bits (163), Expect = 6e-10
 Identities = 43/124 (34%), Positives = 69/124 (55%)
 Frame = -2

Query: 710 RNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLR 531
           +N +R  NL   + +KK+ + +N +  ++GL   + L  L LS N IE +EGL TLVNL 
Sbjct: 53  QNILRIDNLWQFENLKKLQLNNNIIERIEGLTNLIHLVWLDLSFNNIEAIEGLDTLVNLE 112

Query: 530 VLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCAN 351
            L +S N+++ + ++  L KL+ L L +N IS++ +I          L TL L  NP + 
Sbjct: 113 DLSLSNNRISKVDSLDALVKLQVLSLGNNQISNMMNI--IYLRRFPCLRTLSLAGNPVSE 170

Query: 350 SPNY 339
           +  Y
Sbjct: 171 AEEY 174



 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 38/113 (33%), Positives = 62/113 (54%)
 Frame = -2

Query: 674 KCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAI 495
           K +  + +    +  +  L +   L++L L++N IE++EGL+ L++L  LD+S N + AI
Sbjct: 43  KDVLSLQLDFQNILRIDNLWQFENLKKLQLNNNIIERIEGLTNLIHLVWLDLSFNNIEAI 102

Query: 494 SNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYI 336
             +  L  LEDL L++N IS V+ +      +L KL  L L  N  +N  N I
Sbjct: 103 EGLDTLVNLEDLSLSNNRISKVDSL-----DALVKLQVLSLGNNQISNMMNII 150



 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 40/133 (30%), Positives = 70/133 (52%), Gaps = 4/133 (3%)
 Frame = -2

Query: 944 IFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKL 765
           +FK +L   + F  I     L +  + LK+L ++NN I +IE + +   L  L+L  N +
Sbjct: 41  LFKDVLSLQLDFQNILRIDNLWQFEN-LKKLQLNNNIIERIEGLTNLIHLVWLDLSFNNI 99

Query: 764 RVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKG---LEECVALE 597
             +E L TL NL++L L  NRI  + +L  L  ++ +S+ +N++++M     L     L 
Sbjct: 100 EAIEGLDTLVNLEDLSLSNNRISKVDSLDALVKLQVLSLGNNQISNMMNIIYLRRFPCLR 159

Query: 596 ELYLSHNGIEKME 558
            L L+ N + + E
Sbjct: 160 TLSLAGNPVSEAE 172



>gb:LIAJ4808_140500 Listeria ivanovii i-inlB, i-inlJ, i-inlI,
           i-inlH, i-inlG genes.
          Length = 615

 Score = 67.4 bits (163), Expect = 6e-10
 Identities = 62/208 (29%), Positives = 98/208 (47%), Gaps = 2/208 (0%)
 Frame = -2

Query: 962 ENSGVSIFKKLLVFDVSFNEITSPSGLS-KVSSTLKELYVSNNQIAKIEEIEHFHELQIL 786
           E+  VSI K L +     NEI    G++ +V   L +  VS+  I   +E+    +    
Sbjct: 338 ESHAVSISKPLPI-----NEIFPDPGIANEVKRILCKKSVSD--IVTQKELNSIRKY--F 388

Query: 785 ELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEEC 609
               + ++ +E LQ LTNL+EL L  N+I  ++ L  L  +  + +  N+L S+ G+   
Sbjct: 389 NCNESNVKSLEGLQFLTNLEELHLSENQISDLSPLKDLTNLSTLYLNKNKLKSLNGIPTA 448

Query: 608 VALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV 429
             L  L +  N +   + LS  + L  L +S NKL  I+ +ANLTKL  L L  N +  +
Sbjct: 449 -KLVRLVVDDNELSDADPLSDSLRLESLSMSKNKLRNINGLANLTKLRTLNLKKNELRDL 507

Query: 428 EDIAEAVAGSLQKLTTLYLERNPCANSP 345
             +       L+KL +L      C N P
Sbjct: 508 SPLRR-----LKKLNSLDASWQTCVNEP 530



 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 38/122 (31%), Positives = 67/122 (54%), Gaps = 1/122 (0%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIR-A 693
           + LKELY+S N+I+ +  ++   +L +L +  NKL  + ++ T   L  L +  N +R A
Sbjct: 95  TNLKELYLSRNEISDLSPLKDLTKLSLLCINKNKLENLSDIPT-AQLVRLLVDDNELRDA 153

Query: 692 INLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
            +L  LK ++ +SI  N+L +++GL     L+ L LS N +  +  L  L  +  LD++ 
Sbjct: 154 DSLVHLKHLETLSISKNKLKNIEGLSHLSKLKLLDLSRNELRNLSVLKRLKKISWLDLTC 213

Query: 512 NK 507
            K
Sbjct: 214 QK 215



 Score = 47.0 bits (110), Expect = 9e-04
 Identities = 34/119 (28%), Positives = 60/119 (50%), Gaps = 7/119 (5%)
 Frame = -2

Query: 659 ISIQSNRLTSMKGLEECVALEEL-----YLSHN--GIEKMEGLSTLVNLRVLDVSANKLT 501
           I+ +  R+   K + + V  +EL     Y + N   ++ +EGL  L NL  L +S N+++
Sbjct: 359 IANEVKRILCKKSVSDIVTQKELNSIRKYFNCNESNVKSLEGLQFLTNLEELHLSENQIS 418

Query: 500 AISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLR 324
            +S + +LT L  L+LN N + S+  I  A      KL  L ++ N  +++     +LR
Sbjct: 419 DLSPLKDLTNLSTLYLNKNKLKSLNGIPTA------KLVRLVVDDNELSDADPLSDSLR 471



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 29/97 (29%), Positives = 51/97 (52%)
 Frame = -2

Query: 641 RLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLED 462
           ++ S++G++    L+ELYLS N I  +  L  L  L +L ++ NKL  +S+I    +L  
Sbjct: 84  KIESLEGVQYFTNLKELYLSRNEISDLSPLKDLTKLSLLCINKNKLENLSDIPT-AQLVR 142

Query: 461 LWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCAN 351
           L ++DN +   + +       L+ L TL + +N   N
Sbjct: 143 LLVDDNELRDADSLVH-----LKHLETLSISKNKLKN 174



 Score = 42.4 bits (98), Expect = 0.021
 Identities = 24/65 (36%), Positives = 38/65 (58%), Gaps = 4/65 (6%)
 Frame = -2

Query: 593 LYLSHNG----IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVE 426
           L L  NG    IE +EG+    NL+ L +S N+++ +S + +LTKL  L +N N + ++ 
Sbjct: 74  LVLEFNGNGCKIESLEGVQYFTNLKELYLSRNEISDLSPLKDLTKLSLLCINKNKLENLS 133

Query: 425 DIAEA 411
           DI  A
Sbjct: 134 DIPTA 138



>gb:BC083838_2108901 Rattus norvegicus cDNA clone MGC:94955
           IMAGE:7113397, complete cds.
          Length = 523

 Score = 67.0 bits (162), Expect = 8e-10
 Identities = 44/139 (31%), Positives = 74/139 (53%)
 Frame = -2

Query: 710 RNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLR 531
           +N +R  NL   + ++K+ + +N +  ++GLE    L  L LS N IE +EGL TLVNL 
Sbjct: 53  QNILRIDNLWQFENLRKLQLNNNIIERIEGLENLTHLVWLDLSFNNIEAIEGLDTLVNLE 112

Query: 530 VLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCAN 351
            L +S N+++ I ++  L  L+ L L +N I+++ +I          L TL L  NP + 
Sbjct: 113 DLSLSHNRISKIDSLDPLVNLQVLSLGNNQINNMMNI--IYLRRFPCLRTLSLSGNPVSE 170

Query: 350 SPNYISTLRQIFPNIQQVD 294
           +  Y   +    P++  +D
Sbjct: 171 AEEYKVFIYAYLPDLVYLD 189



 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 42/133 (31%), Positives = 70/133 (52%), Gaps = 4/133 (3%)
 Frame = -2

Query: 944 IFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKL 765
           +FK +L   + F  I     L +  + L++L ++NN I +IE +E+   L  L+L  N +
Sbjct: 41  LFKDVLALQLDFQNILRIDNLWQFEN-LRKLQLNNNIIERIEGLENLTHLVWLDLSFNNI 99

Query: 764 RVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKG---LEECVALE 597
             +E L TL NL++L L  NRI  I +L  L  ++ +S+ +N++ +M     L     L 
Sbjct: 100 EAIEGLDTLVNLEDLSLSHNRISKIDSLDPLVNLQVLSLGNNQINNMMNIIYLRRFPCLR 159

Query: 596 ELYLSHNGIEKME 558
            L LS N + + E
Sbjct: 160 TLSLSGNPVSEAE 172



 Score = 53.9 bits (128), Expect = 7e-06
 Identities = 36/115 (31%), Positives = 58/115 (50%), Gaps = 9/115 (7%)
 Frame = -2

Query: 674 KCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAI 495
           K +  + +    +  +  L +   L +L L++N IE++EGL  L +L  LD+S N + AI
Sbjct: 43  KDVLALQLDFQNILRIDNLWQFENLRKLQLNNNIIERIEGLENLTHLVWLDLSFNNIEAI 102

Query: 494 SNIANLTKLEDLWLNDNNISSVEDIAEAV------AGSLQ---KLTTLYLERNPC 357
             +  L  LEDL L+ N IS ++ +   V       G+ Q    +  +YL R PC
Sbjct: 103 EGLDTLVNLEDLSLSHNRISKIDSLDPLVNLQVLSLGNNQINNMMNIIYLRRFPC 157



>gb:AK173256_2070190 Mus musculus mRNA for mKIAA1764 protein.
          Length = 1034

 Score = 67.0 bits (162), Expect = 8e-10
 Identities = 66/245 (26%), Positives = 102/245 (41%), Gaps = 6/245 (2%)
 Frame = -2

Query: 1010 HHFPTRGT--SAQG*SAEENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNN 837
            H  P  GT  +A     E   G S    +   D   + I+  S    + S++  + +  N
Sbjct: 1    HPLPVAGTMEAAVCSEIEREDGDSSCGDVCFMDKGLHSISELS----LDSSIHAINLHCN 56

Query: 836  QIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKI 657
             I+KI  I+H   L+ L+L SN++  +E L TLT L  L                     
Sbjct: 57   NISKISSIDHIWNLRHLDLSSNQISQIEGLNTLTKLCTL--------------------- 95

Query: 656  SIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANL 477
            ++  N +T ++GLE  V L +L LS+N I  + GL  L  L+                  
Sbjct: 96   NLSCNLITRVEGLEALVNLTKLNLSYNHINDLSGLMPLHGLKY----------------- 138

Query: 476  TKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLER----NPCANSPNYISTLRQIFPN 309
             KL  + L+ N I S+  + +   G L  LT L LE+    NP    P Y + + Q  P 
Sbjct: 139  -KLRYIDLHSNYIDSIHHLLQCTVG-LHFLTNLILEKDGEGNPICLIPGYRAIILQTLPQ 196

Query: 308  IQQVD 294
            ++ +D
Sbjct: 197  LRILD 201



>gb:AB016816_1864811 Homo sapiens MASL1 mRNA, complete cds.
          Length = 1052

 Score = 67.0 bits (162), Expect = 8e-10
 Identities = 63/209 (30%), Positives = 105/209 (50%), Gaps = 8/209 (3%)
 Frame = -2

Query: 920 DVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKLR-VMEN 750
           DVSFN +   P  LS +S  L+ L V +NQ+     ++     L+ L++ SN+LR + E+
Sbjct: 164 DVSFNRLAHLPDSLSCLSR-LRTLDVDHNQLTAFPRQLLQLVALEELDVSSNRLRGLPED 222

Query: 749 LQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSMKGLEECV-ALEELYLSH 579
           +  L  L+ LWL    +  +    C L  ++ + + +N L ++     C+  L+ L LS 
Sbjct: 223 ISALRALKILWLSGAELGTLPAGFCELASLESLMLDNNGLQALPAQFSCLQRLKMLNLSS 282

Query: 578 NGIEKM-EGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSVEDIAEAVA 405
           N  E+    L  L  L  L +S N+LT++ S I+ L +L  LWL++N I  + D    + 
Sbjct: 283 NLFEEFPAALLPLAGLEELYLSRNQLTSVPSLISGLGRLLTLWLDNNRIRYLPDSIVELT 342

Query: 404 GSLQKLTTLYLERNPCANSPNYISTLRQI 318
           G    L  L L+ N  A  P++   L ++
Sbjct: 343 G----LEELVLQGNQIAVLPDHFGQLSRV 367



 Score = 57.0 bits (136), Expect = 8e-07
 Identities = 61/210 (29%), Positives = 102/210 (48%), Gaps = 8/210 (3%)
 Frame = -2

Query: 950 VSIFKKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELG 777
           +S   +L   DV  N++T+ P  L ++ + L+EL VS+N++  + E+I     L+IL L 
Sbjct: 177 LSCLSRLRTLDVDHNQLTAFPRQLLQLVA-LEELDVSSNRLRGLPEDISALRALKILWLS 235

Query: 776 SNKLRVME-NLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSMKG-LEEC 609
             +L  +      L +L+ L L  N ++A+      L+ +K +++ SN        L   
Sbjct: 236 GAELGTLPAGFCELASLESLMLDNNGLQALPAQFSCLQRLKMLNLSSNLFEEFPAALLPL 295

Query: 608 VALEELYLSHNGIEKMEGL-STLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNIS 435
             LEELYLS N +  +  L S L  L  L +  N++  +  +I  LT LE+L L  N I+
Sbjct: 296 AGLEELYLSRNQLTSVPSLISGLGRLLTLWLDNNRIRYLPDSIVELTGLEELVLQGNQIA 355

Query: 434 SVEDIAEAVAGSLQKLTTLYLERNPCANSP 345
            + D      G L ++    ++ NP    P
Sbjct: 356 VLPD----HFGQLSRVGLWKIKDNPLIQPP 381



 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 51/181 (28%), Positives = 88/181 (48%), Gaps = 7/181 (3%)
 Frame = -2

Query: 893 PSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWL 714
           P GL     +L+ L +  N+ A++          + ELG +             L EL +
Sbjct: 79  PEGLGSALGSLRVLVLRRNRFARLPPA-------VAELGHH-------------LTELDV 118

Query: 713 GRNRIRAIN---LCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNGIEKM-EGLS 549
             NR+ A+    +  L+ ++K+++  N+L ++      +A LEEL +S N +  + + LS
Sbjct: 119 SHNRLTALGAEVVSALRELRKLNLSHNQLPALPAQLGALAHLEELDVSFNRLAHLPDSLS 178

Query: 548 TLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSV-EDIAEAVAGSLQKLTTLY 375
            L  LR LDV  N+LTA    +  L  LE+L ++ N +  + EDI+     +L+ L  L+
Sbjct: 179 CLSRLRTLDVDHNQLTAFPRQLLQLVALEELDVSSNRLRGLPEDIS-----ALRALKILW 233

Query: 374 L 372
           L
Sbjct: 234 L 234



 Score = 33.5 bits (75), Expect = 10.0
 Identities = 28/83 (33%), Positives = 40/83 (48%), Gaps = 3/83 (3%)
 Frame = -3

Query: 1123 NRLSALDPRISHLSNLNKFSLRQNLITD--AALEPLSSWHTISQLEELVLRDNQLKKIP- 953
            N L AL  + S L  L   +L  NL  +  AAL PL+       LEEL L  NQL  +P 
Sbjct: 260  NGLQALPAQFSCLQRLKMLNLSSNLFEEFPAALLPLAG------LEELYLSRNQLTSVPS 313

Query: 952  VLAYLRNFWYLMFRSTKLHHLAD 884
            +++ L     L   + ++ +L D
Sbjct: 314  LISGLGRLLTLWLDNNRIRYLPD 336



>gb:AF154916_1772937 Chlamydomonas reinhardtii variable flagellar
           number protein (VFL1) gene, complete cds.
          Length = 1216

 Score = 67.0 bits (162), Expect = 8e-10
 Identities = 50/161 (31%), Positives = 83/161 (51%), Gaps = 7/161 (4%)
 Frame = -2

Query: 752 NLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKG--LEECVALEELYLS 582
           +L  LTNL+ L L  N I  I+ L GL  +  +++ SN ++++    L     L  L L+
Sbjct: 38  DLHRLTNLRRLCLHGNNIAHIDGLTGLTALVDLNLSSNAVSAIDAGALRGLTRLTSLNLA 97

Query: 581 HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLT----KLEDLWLNDNNISSVEDIAE 414
            N ++ + GL  L NL  L++S N +T+I+ +A L     KL++L L  N + +++  A 
Sbjct: 98  SNRLQTVTGLDGLSNLETLNLSFNYITSIAGLAALAGPLCKLKNLNLKQNQLHNLQ--AF 155

Query: 413 AVAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS 291
           +V      L  L +  NP  + PNY   L  +   + Q+DS
Sbjct: 156 SVLVGCMGLRWLQVAGNPVCSLPNYAQALASVLSQVTQLDS 196



>gb:AC013430_1537933 Genomic sequence for Arabidopsis thaliana BAC
           F3F9 from chromosome I, complete sequence.
          Length = 413

 Score = 67.0 bits (162), Expect = 8e-10
 Identities = 53/168 (31%), Positives = 77/168 (45%), Gaps = 7/168 (4%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           ++LK + +SNN I +I        L  L L  NK+ V+E L+ LT L+ L L  NRI  I
Sbjct: 183 TSLKSIDLSNNFIVQITPASLPKGLHALNLSKNKISVIEGLRDLTRLRVLDLSYNRISRI 242

Query: 689 NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSAN 510
                                +GL  C  ++ELYL+ N I  +EGL  L+ L VLD+S N
Sbjct: 243 G--------------------QGLSNCTLIKELYLAGNKISNVEGLHRLLKLIVLDLSFN 282

Query: 509 KLTA-------ISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKL 387
           K+         ++N  +L  L  L     N    + + + V+  L KL
Sbjct: 283 KIATTKAIGQLVANYNSLVALNILGNPIQNNVGEDQLRKTVSSLLPKL 330



>gb:AK029802_1161665 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4930568O20
           product:hypothetical ADP-ribosylation structure
           containing protein, full insert sequence.
          Length = 1052

 Score = 67.0 bits (162), Expect = 8e-10
 Identities = 65/220 (29%), Positives = 99/220 (45%), Gaps = 16/220 (7%)
 Frame = -2

Query: 944 IFKKLLVFDVSFNEITSPSGLSKVSSTLK-ELYVSNNQIAKIEEIEHFHELQILELGSNK 768
           I K+L + +    EI    G    S T K E++ S     +I  +  FH L  L + +  
Sbjct: 12  IIKELCLCNGLTYEIVGQEG----SDTSKLEMFFSG--YPRIVGLSLFHNLSSLTIVAQD 65

Query: 767 LRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELY 588
           +R +  L+T   L+ELW+          C   CI+KI          +GL+ C  LE+LY
Sbjct: 66  IREISGLETCLQLKELWIAE--------C---CIEKI----------EGLQGCRNLEKLY 104

Query: 587 LSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEA- 411
           L +N I K+E L  L+ L VL ++ N +  I  +  L  L+DL L  N +SS+    +  
Sbjct: 105 LYYNKISKIENLEKLIKLEVLWLNHNMIKNIEGLQTLKNLKDLNLAGNLVSSIGRCLDPN 164

Query: 410 -------VAGS-------LQKLTTLYLERNPCANSPNYIS 333
                  ++G+       L  LT L   ++ C N P Y S
Sbjct: 165 EQLEKLNLSGNQITSFKDLTNLTKLTRLKDLCLNDPQYKS 204



 Score = 53.9 bits (128), Expect = 7e-06
 Identities = 30/73 (41%), Positives = 43/73 (58%)
 Frame = -2

Query: 713  GRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNL 534
            G++     NL  L+ +K  S  +N L+ M+GLE CV LEEL L  N I K+EG++ L  L
Sbjct: 886  GQHLFEITNLEKLENLKWASFSNNNLSKMEGLESCVNLEELTLDGNCISKIEGITRLTKL 945

Query: 533  RVLDVSANKLTAI 495
              L ++ N LT +
Sbjct: 946  SRLSMNNNLLTGL 958



 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 27/81 (33%), Positives = 44/81 (54%)
 Frame = -2

Query: 668  IKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISN 489
            I  +++    L  +  LE+   L+    S+N + KMEGL + VNL  L +  N ++ I  
Sbjct: 879  ITALNLDGQHLFEITNLEKLENLKWASFSNNNLSKMEGLESCVNLEELTLDGNCISKIEG 938

Query: 488  IANLTKLEDLWLNDNNISSVE 426
            I  LTKL  L +N+N ++ +E
Sbjct: 939  ITRLTKLSRLSMNNNLLTGLE 959



 Score = 41.2 bits (95), Expect = 0.048
 Identities = 33/117 (28%), Positives = 53/117 (45%), Gaps = 5/117 (4%)
 Frame = -2

Query: 713  GRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNL 534
            G +  +  +L  L  ++K++I  N  T +  +     LE L  SHN +  +EG   L+ L
Sbjct: 693  GNSLSKLRDLAKLTGLRKLNISFNEFTCLDDVYHLYNLEYLDASHNHVITLEGFRGLMKL 752

Query: 533  RVLDVSANKLTAISNIANL-----TKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTL 378
            + LD+S N+L       N+     T L  L +  N       +  +V G L+ LT L
Sbjct: 753  KHLDLSWNQLKKTGEEINVLCKHTTSLLTLDIQHNPWQKPATLRLSVIGRLKTLTHL 809



>gb:AE012851_286314 Chlorobium tepidum TLS section 72 of 194 of the
           complete genome.>gb:AE006470_933482 Chlorobium tepidum
           TLS complete genome.
          Length = 402

 Score = 67.0 bits (162), Expect = 8e-10
 Identities = 48/165 (29%), Positives = 82/165 (49%), Gaps = 1/165 (0%)
 Frame = -2

Query: 917 VSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTL 738
           VS  EI+    LS + + L+ELY S   ++ +  +     L+ L     ++  +E L+ L
Sbjct: 220 VSSTEISDLEPLSALVN-LEELYCSETMVSDLTPVSGLFRLEKLSCYKTEITSIEALRNL 278

Query: 737 TNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKM 561
           TNL EL +    + ++  L  L+ ++ +      +TS++ L   VAL+EL +    I  +
Sbjct: 279 TNLSELGINSTGVSSLEPLARLENLEYLRCSRTAITSLEPLRNLVALKELSIEQTAIHTL 338

Query: 560 EGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVE 426
           E LS LV L  L ++   + +I+ + NL  LE L L+   I   E
Sbjct: 339 EPLSGLVELEELFITGTLVDSIAPLMNLMSLEKLELSAGRIPQSE 383



 Score = 47.0 bits (110), Expect = 9e-04
 Identities = 38/158 (24%), Positives = 71/158 (44%), Gaps = 23/158 (14%)
 Frame = -2

Query: 821 EEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQS 645
           EE+  F     L   + ++  +  +  L NL++L      + ++  L  L+ ++++    
Sbjct: 141 EELLDFLNATSLRCNNMRIHNLAPVSLLENLEQLRCDETPVESLEPLRNLRNLRRLYAFD 200

Query: 644 NRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVS----------------- 516
              TS+  L + ++L+ L++S   I  +E LS LVNL  L  S                 
Sbjct: 201 CDFTSLDPLRDILSLKLLWVSSTEISDLEPLSALVNLEELYCSETMVSDLTPVSGLFRLE 260

Query: 515 -----ANKLTAISNIANLTKLEDLWLNDNNISSVEDIA 417
                  ++T+I  + NLT L +L +N   +SS+E +A
Sbjct: 261 KLSCYKTEITSIEALRNLTNLSELGINSTGVSSLEPLA 298



 Score = 34.7 bits (78), Expect = 4.5
 Identities = 25/95 (26%), Positives = 46/95 (48%)
 Frame = -2

Query: 692 INLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           +N   L+C    +++ + L  +  LE    LE+L      +E +E L  L NLR L    
Sbjct: 147 LNATSLRCN---NMRIHNLAPVSLLEN---LEQLRCDETPVESLEPLRNLRNLRRLYAFD 200

Query: 512 NKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAV 408
              T++  + ++  L+ LW++   IS +E ++  V
Sbjct: 201 CDFTSLDPLRDILSLKLLWVSSTEISDLEPLSALV 235



>pir|G96811|G96811 unknown protein T11I11.17 [imported] -
           Arabidopsis thaliana>gb:AE005173_895346 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC012680_1537812 Arabidopsis thaliana
           chromosome 1 BAC T11I11 genomic sequence, complete
           sequence.>gb:AY065224_1566376 Arabidopsis thaliana
           unknown protein (At1g78230) mRNA, complete cds.
          Length = 581

 Score = 67.0 bits (162), Expect = 8e-10
 Identities = 53/168 (31%), Positives = 77/168 (45%), Gaps = 7/168 (4%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           ++LK + +SNN I +I        L  L L  NK+ V+E L+ LT L+ L L  NRI  I
Sbjct: 351 TSLKSIDLSNNFIVQITPASLPKGLHALNLSKNKISVIEGLRDLTRLRVLDLSYNRISRI 410

Query: 689 NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSAN 510
                                +GL  C  ++ELYL+ N I  +EGL  L+ L VLD+S N
Sbjct: 411 G--------------------QGLSNCTLIKELYLAGNKISNVEGLHRLLKLIVLDLSFN 450

Query: 509 KLTA-------ISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKL 387
           K+         ++N  +L  L  L     N    + + + V+  L KL
Sbjct: 451 KIATTKAIGQLVANYNSLVALNILGNPIQNNVGEDQLRKTVSSLLPKL 498



>gb:BC062888_2105043 Mus musculus scribbled homolog (Drosophila),
           mRNA (cDNA clone MGC:86000 IMAGE:5721250), complete cds.
          Length = 1612

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 55/173 (31%), Positives = 90/173 (52%), Gaps = 6/173 (3%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM-ENLQTLTNLQELWLGRNRIRAI- 690
           LK L  S + + K+E+         L+LG N L V+ + L  L NL+ELWL RN++ A+ 
Sbjct: 163 LKSLPASLSFLVKLEQ---------LDLGGNDLEVLPDTLGALPNLRELWLDRNQLSALP 213

Query: 689 -NLCGLKCIKKISIQSNRLTSMK-GLEECVALEELYLSHNGIEKM-EGLSTLVNLRVLDV 519
             L  L+ +  + +  NRL  +   L     L +L LS N ++++ EG+  L  L +L V
Sbjct: 214 PELGNLRRLVCLDVSENRLEELPVELGGLALLTDLLLSQNLLQRLPEGIGQLKQLSILKV 273

Query: 518 SANKLTAISN-IANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
             N+L  ++  I +   L +L L +N ++++        G L KLT L ++RN
Sbjct: 274 DQNRLCEVTEAIGDCENLSELILTENLLTALPH----SLGKLTKLTNLNVDRN 322



 Score = 53.9 bits (128), Expect = 7e-06
 Identities = 57/197 (28%), Positives = 95/197 (48%), Gaps = 8/197 (4%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKIEE-IEHFHELQILELGSNKL 765
           ++L+  DVS N +   P  L  ++  L +L +S N + ++ E I    +L IL++  N+L
Sbjct: 220 RRLVCLDVSENRLEELPVELGGLA-LLTDLLLSQNLLQRLPEGIGQLKQLSILKVDQNRL 278

Query: 764 -RVMENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSMKG-LEECVALE 597
             V E +    NL EL L  N + A+  +L  L  +  +++  N L  +   +  CVAL 
Sbjct: 279 CEVTEAIGDCENLSELILTENLLTALPHSLGKLTKLTNLNVDRNHLEVLPPEIGGCVALS 338

Query: 596 ELYLSHNGIEKMEG-LSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
            L L  N +  +   L+    L VLDV+ N+L ++        L+ LWL +N    +   
Sbjct: 339 VLSLRDNRLAVLPPELAHTAELHVLDVAGNRLRSLPFALTHLNLKALWLAENQAQPMLRF 398

Query: 419 -AEAVAGSLQKLTTLYL 372
             E  A + +K+ T YL
Sbjct: 399 QTEDDAQTGEKVLTCYL 415



>gb:BC060689_2104139 Mus musculus scribbled homolog (Drosophila),
           mRNA (cDNA clone MGC:66791 IMAGE:6417366), complete cds.
          Length = 929

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 55/173 (31%), Positives = 90/173 (52%), Gaps = 6/173 (3%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM-ENLQTLTNLQELWLGRNRIRAI- 690
           LK L  S + + K+E+         L+LG N L V+ + L  L NL+ELWL RN++ A+ 
Sbjct: 163 LKSLPASLSFLVKLEQ---------LDLGGNDLEVLPDTLGALPNLRELWLDRNQLSALP 213

Query: 689 -NLCGLKCIKKISIQSNRLTSMK-GLEECVALEELYLSHNGIEKM-EGLSTLVNLRVLDV 519
             L  L+ +  + +  NRL  +   L     L +L LS N ++++ EG+  L  L +L V
Sbjct: 214 PELGNLRRLVCLDVSENRLEELPVELGGLALLTDLLLSQNLLQRLPEGIGQLKQLSILKV 273

Query: 518 SANKLTAISN-IANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
             N+L  ++  I +   L +L L +N ++++        G L KLT L ++RN
Sbjct: 274 DQNRLCEVTEAIGDCENLSELILTENLLTALPH----SLGKLTKLTNLNVDRN 322



 Score = 53.9 bits (128), Expect = 7e-06
 Identities = 57/197 (28%), Positives = 95/197 (48%), Gaps = 8/197 (4%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKIEE-IEHFHELQILELGSNKL 765
           ++L+  DVS N +   P  L  ++  L +L +S N + ++ E I    +L IL++  N+L
Sbjct: 220 RRLVCLDVSENRLEELPVELGGLA-LLTDLLLSQNLLQRLPEGIGQLKQLSILKVDQNRL 278

Query: 764 -RVMENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSMKG-LEECVALE 597
             V E +    NL EL L  N + A+  +L  L  +  +++  N L  +   +  CVAL 
Sbjct: 279 CEVTEAIGDCENLSELILTENLLTALPHSLGKLTKLTNLNVDRNHLEVLPPEIGGCVALS 338

Query: 596 ELYLSHNGIEKMEG-LSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
            L L  N +  +   L+    L VLDV+ N+L ++        L+ LWL +N    +   
Sbjct: 339 VLSLRDNRLAVLPPELAHTAELHVLDVAGNRLRSLPFALTHLNLKALWLAENQAQPMLRF 398

Query: 419 -AEAVAGSLQKLTTLYL 372
             E  A + +K+ T YL
Sbjct: 399 QTEDDAQTGEKVLTCYL 415



>gb:AK122211_2068876 Mus musculus mRNA for mKIAA0147 protein.
          Length = 1694

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 55/173 (31%), Positives = 90/173 (52%), Gaps = 6/173 (3%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM-ENLQTLTNLQELWLGRNRIRAI- 690
           LK L  S + + K+E+         L+LG N L V+ + L  L NL+ELWL RN++ A+ 
Sbjct: 220 LKSLPASLSFLVKLEQ---------LDLGGNDLEVLPDTLGALPNLRELWLDRNQLSALP 270

Query: 689 -NLCGLKCIKKISIQSNRLTSMK-GLEECVALEELYLSHNGIEKM-EGLSTLVNLRVLDV 519
             L  L+ +  + +  NRL  +   L     L +L LS N ++++ EG+  L  L +L V
Sbjct: 271 PELGNLRRLVCLDVSENRLEELPVELGGLALLTDLLLSQNLLQRLPEGIGQLKQLSILKV 330

Query: 518 SANKLTAISN-IANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
             N+L  ++  I +   L +L L +N ++++        G L KLT L ++RN
Sbjct: 331 DQNRLCEVTEAIGDCENLSELILTENLLTALPH----SLGKLTKLTNLNVDRN 379



 Score = 53.9 bits (128), Expect = 7e-06
 Identities = 57/197 (28%), Positives = 95/197 (48%), Gaps = 8/197 (4%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKIEE-IEHFHELQILELGSNKL 765
           ++L+  DVS N +   P  L  ++  L +L +S N + ++ E I    +L IL++  N+L
Sbjct: 277 RRLVCLDVSENRLEELPVELGGLA-LLTDLLLSQNLLQRLPEGIGQLKQLSILKVDQNRL 335

Query: 764 -RVMENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSMKG-LEECVALE 597
             V E +    NL EL L  N + A+  +L  L  +  +++  N L  +   +  CVAL 
Sbjct: 336 CEVTEAIGDCENLSELILTENLLTALPHSLGKLTKLTNLNVDRNHLEVLPPEIGGCVALS 395

Query: 596 ELYLSHNGIEKMEG-LSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
            L L  N +  +   L+    L VLDV+ N+L ++        L+ LWL +N    +   
Sbjct: 396 VLSLRDNRLAVLPPELAHTAELHVLDVAGNRLRSLPFALTHLNLKALWLAENQAQPMLRF 455

Query: 419 -AEAVAGSLQKLTTLYL 372
             E  A + +K+ T YL
Sbjct: 456 QTEDDAQTGEKVLTCYL 472



>gb:AF441233_2065835 Mus musculus PDZ-domain protein scribble mRNA,
           complete cds.
          Length = 1665

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 55/173 (31%), Positives = 90/173 (52%), Gaps = 6/173 (3%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM-ENLQTLTNLQELWLGRNRIRAI- 690
           LK L  S + + K+E+         L+LG N L V+ + L  L NL+ELWL RN++ A+ 
Sbjct: 163 LKSLPASLSFLVKLEQ---------LDLGGNDLEVLPDTLGALPNLRELWLDRNQLSALP 213

Query: 689 -NLCGLKCIKKISIQSNRLTSMK-GLEECVALEELYLSHNGIEKM-EGLSTLVNLRVLDV 519
             L  L+ +  + +  NRL  +   L     L +L LS N ++++ EG+  L  L +L V
Sbjct: 214 PELGNLRRLVCLDVSENRLEELPVELGGLALLTDLLLSQNLLQRLPEGIGQLKQLSILKV 273

Query: 518 SANKLTAISN-IANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
             N+L  ++  I +   L +L L +N ++++        G L KLT L ++RN
Sbjct: 274 DQNRLCEVTEAIGDCENLSELILTENLLTALPH----SLGKLTKLTNLNVDRN 322



 Score = 53.9 bits (128), Expect = 7e-06
 Identities = 57/197 (28%), Positives = 95/197 (48%), Gaps = 8/197 (4%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKIEE-IEHFHELQILELGSNKL 765
           ++L+  DVS N +   P  L  ++  L +L +S N + ++ E I    +L IL++  N+L
Sbjct: 220 RRLVCLDVSENRLEELPVELGGLA-LLTDLLLSQNLLQRLPEGIGQLKQLSILKVDQNRL 278

Query: 764 -RVMENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSMKG-LEECVALE 597
             V E +    NL EL L  N + A+  +L  L  +  +++  N L  +   +  CVAL 
Sbjct: 279 CEVTEAIGDCENLSELILTENLLTALPHSLGKLTKLTNLNVDRNHLEVLPPEIGGCVALS 338

Query: 596 ELYLSHNGIEKMEG-LSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
            L L  N +  +   L+    L VLDV+ N+L ++        L+ LWL +N    +   
Sbjct: 339 VLSLRDNRLAVLPPELAHTAELHVLDVAGNRLRSLPFALTHLNLKALWLAENQAQPMLRF 398

Query: 419 -AEAVAGSLQKLTTLYL 372
             E  A + +K+ T YL
Sbjct: 399 QTEDDAQTGEKVLTCYL 415



>gb:AK128037_1917010 Homo sapiens cDNA FLJ46156 fis, clone
           TESTI4001569.
          Length = 1111

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 37/106 (34%), Positives = 62/106 (58%)
 Frame = -2

Query: 737 TNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKME 558
           + L+  +LG  RI  ++L     +  ++I +  +  + GLE C+ L+EL+++   IEK+E
Sbjct: 35  SKLEMFFLGYPRIVGLSL--FPNLTSLTIVAQDIKEISGLEPCLQLKELWIAECRIEKIE 92

Query: 557 GLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
           GL    NL  L +  NK++ I N+  L KL+ LWLN N I ++E +
Sbjct: 93  GLQECRNLEKLYLYFNKISKIENLEKLIKLKVLWLNHNTIKNIEGL 138



 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 48/189 (25%), Positives = 91/189 (48%), Gaps = 15/189 (7%)
 Frame = -2

Query: 941  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR 762
            + K+   ++    +   + L K+ + LK    SNN + K+E +E    L+ L L  N + 
Sbjct: 886  YLKITALNLDGQHLFEITNLEKLEN-LKWASFSNNNLTKMEGLESCINLEELTLDGNCIS 944

Query: 761  VMENLQTLTNLQELWLGRNRIRAIN---LCGLKCIKKISIQSNRLTSMKGLEECVALEEL 591
             +E +  +T L  L +  N +          +  +  +S+++NR+TS+ GL++   L EL
Sbjct: 945  KIEGISKMTKLTRLSINNNLLTGWEEHTFDNMLHLHSLSLENNRITSLSGLQKSFTLVEL 1004

Query: 590  YLSHNGI---EKMEGLSTLVNLRVLDVSAN---------KLTAISNIANLTKLEDLWLND 447
            Y+S+N I   ++M  L  L NL +LD+  N         +L  I ++  L  L+ + +  
Sbjct: 1005 YISNNYIAVNQEMHNLKGLCNLVILDMCGNIIIWNQENYRLFVIFHLPELKALDGIPIEP 1064

Query: 446  NNISSVEDI 420
            +   S +D+
Sbjct: 1065 SETDSAKDL 1073



 Score = 63.5 bits (153), Expect = 9e-09
 Identities = 41/119 (34%), Positives = 61/119 (51%), Gaps = 2/119 (1%)
 Frame = -2

Query: 713  GRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNL 534
            G++     NL  L+ +K  S  +N LT M+GLE C+ LEEL L  N I K+EG+S +  L
Sbjct: 896  GQHLFEITNLEKLENLKWASFSNNNLTKMEGLESCINLEELTLDGNCISKIEGISKMTKL 955

Query: 533  RVLDVSANKLTAIS--NIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
              L ++ N LT        N+  L  L L +N I+S+  + ++       L  LY+  N
Sbjct: 956  TRLSINNNLLTGWEEHTFDNMLHLHSLSLENNRITSLSGLQKSFT-----LVELYISNN 1009



 Score = 60.5 bits (145), Expect = 8e-08
 Identities = 49/178 (27%), Positives = 79/178 (44%), Gaps = 15/178 (8%)
 Frame = -2

Query: 827 KIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQ 648
           +I  +  F  L  L + +  ++ +  L+    L+ELW+   RI  I              
Sbjct: 46  RIVGLSLFPNLTSLTIVAQDIKEISGLEPCLQLKELWIAECRIEKI-------------- 91

Query: 647 SNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKL 468
                  +GL+EC  LE+LYL  N I K+E L  L+ L+VL ++ N +  I  +  L  L
Sbjct: 92  -------EGLQECRNLEKLYLYFNKISKIENLEKLIKLKVLWLNHNTIKNIEGLQTLKNL 144

Query: 467 EDLWLNDNNISSVEDIAEA--------VAGS-------LQKLTTLYLERNPCANSPNY 339
           +DL L  N I+S+    ++        ++G+       L  LT L   ++ C N P Y
Sbjct: 145 KDLNLAGNLINSIGRCLDSNEQLERLNLSGNQICSFKELTNLTRLPCLKDLCLNDPQY 202



 Score = 52.0 bits (123), Expect = 3e-05
 Identities = 55/206 (26%), Positives = 87/206 (42%), Gaps = 16/206 (7%)
 Frame = -2

Query: 932  LLVFDVSFNEITSPSGLS-KVSSTLKELYVSNNQIAKIEEIE---------HFHELQILE 783
            LL  D+  N    P+ L   V   LK L   N      EE              +L +L 
Sbjct: 789  LLTLDIQHNPWQKPATLRLSVIGRLKTLTHLNGVFISEEEATAAMKFIAGTRITQLSLLR 848

Query: 782  LGSNK------LRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKG 621
              S K      L +  + + LT + +L      +     C LK I  +++    L  +  
Sbjct: 849  HSSTKEERPRILSIWPSAKILTQVSKLG---PHLHLSGNCYLK-ITALNLDGQHLFEITN 904

Query: 620  LEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNN 441
            LE+   L+    S+N + KMEGL + +NL  L +  N ++ I  I+ +TKL  L +N+N 
Sbjct: 905  LEKLENLKWASFSNNNLTKMEGLESCINLEELTLDGNCISKIEGISKMTKLTRLSINNNL 964

Query: 440  ISSVEDIAEAVAGSLQKLTTLYLERN 363
            ++  E   E    ++  L +L LE N
Sbjct: 965  LTGWE---EHTFDNMLHLHSLSLENN 987



 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 50/202 (24%), Positives = 84/202 (41%), Gaps = 5/202 (2%)
 Frame = -2

Query: 968  AEENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQI 789
            +++N  VS+F K L FD   +E+       ++ +  K + + +  I  + +   +  +  
Sbjct: 644  SKKNPEVSVFSKDLKFD---DEVIKME--PRIKARPKLISLDDKTILSLAKTSVYSHIVS 698

Query: 788  LELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEEC 609
            L L  N L  + +L  LT L                     +K++I  N  T +  +   
Sbjct: 699  LNLHGNSLSKLRDLSKLTGL---------------------RKLNISFNEFTCLDDVYHL 737

Query: 608  VALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANL-----TKLEDLWLNDN 444
              LE L  SHN +  +EG   L+ L+ LD+S N+L    N  N+     T L  L +  N
Sbjct: 738  YNLEYLDASHNHVITLEGFRGLMKLKHLDLSWNQLKKSGNEINMLCKHTTSLLTLDIQHN 797

Query: 443  NISSVEDIAEAVAGSLQKLTTL 378
                   +  +V G L+ LT L
Sbjct: 798  PWQKPATLRLSVIGRLKTLTHL 819



>gb:AK040079_1165552 Mus musculus 0 day neonate thymus cDNA, RIKEN
           full-length enriched library, clone:A430056P16
           product:hypothetical IQ calmodulin-binding
           motif/Leucine-rich repeat containing protein, full
           insert sequence.>gb:AK079884_1172825 Mus musculus 0 day
           neonate thymus cDNA, RIKEN full-length enriched library,
           clone:A430099J11 product:hypothetical IQ
           calmodulin-binding motif/Leucine-rich repeat containing
           protein, full insert sequence.
          Length = 158

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 43/135 (31%), Positives = 76/135 (56%), Gaps = 1/135 (0%)
 Frame = -2

Query: 779 GSNKLRVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA 603
           G    ++  NL    ++  L L +N+I  + NL   K + ++S+ +NRL  M G+ +   
Sbjct: 22  GQGLQKLGANLPCEADVHTLILDKNQIIKLENLEKCKQLIQLSVANNRLVRMMGVAKLTQ 81

Query: 602 LEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVED 423
           L  L L HN I  +EGL  LV+L  L+++ N L  +  + + T L+ L L+DNNI  + D
Sbjct: 82  LRVLNLPHNSIGCVEGLKDLVHLEWLNLAGNNLKTMEQVNSCTALQHLDLSDNNIPQIGD 141

Query: 422 IAEAVAGSLQKLTTL 378
           +++ +  SL+ L+++
Sbjct: 142 VSKLI--SLKMLSSV 154



 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 41/131 (31%), Positives = 69/131 (52%), Gaps = 7/131 (5%)
 Frame = -2

Query: 896 SPSGLSKVSSTLK------ELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLT 735
           S  GL K+ + L        L +  NQI K+E +E   +L  L + +N+L  M  +  LT
Sbjct: 21  SGQGLQKLGANLPCEADVHTLILDKNQIIKLENLEKCKQLIQLSVANNRLVRMMGVAKLT 80

Query: 734 NLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKME 558
            L+ L L  N I  +  L  L  ++ +++  N L +M+ +  C AL+ L LS N I ++ 
Sbjct: 81  QLRVLNLPHNSIGCVEGLKDLVHLEWLNLAGNNLKTMEQVNSCTALQHLDLSDNNIPQIG 140

Query: 557 GLSTLVNLRVL 525
            +S L++L++L
Sbjct: 141 DVSKLISLKML 151



>gb:AK016559_1158779 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4932441F23
           product:hypothetical RNI-like structure containing
           protein, full insert sequence.
          Length = 847

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 58/206 (28%), Positives = 92/206 (44%), Gaps = 6/206 (2%)
 Frame = -2

Query: 893 PSGLSKVS--STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQEL 720
           P  +S++S  S++  + +  N I+KI  I+H   L+ L+L SN++  +E L TLT L  L
Sbjct: 5   PHSISELSLDSSIHAINLHCNNISKISSIDHIWNLRHLDLSSNQISQIEGLNTLTKLCTL 64

Query: 719 WLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLV 540
                                ++  N +T ++GLE  V L +L LS+N I  + GL  L 
Sbjct: 65  ---------------------NLSCNLITRVEGLEALVNLTKLNLSYNHINDLSGLMPLH 103

Query: 539 NLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLER-- 366
            L+                   KL  + L+ N I S+  + +   G L  LT L LE+  
Sbjct: 104 GLKY------------------KLRYIDLHSNYIDSIHHLLQCTVG-LHFLTNLILEKDG 144

Query: 365 --NPCANSPNYISTLRQIFPNIQQVD 294
             NP    P Y + + Q  P ++ +D
Sbjct: 145 EGNPICLIPGYRAIILQTLPQLRILD 170



>gb:AE017323_442727 Listeria monocytogenes str. 4b F2365, section 2
           of 10 of the complete genome.>gb:AE017262_1075083
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 361

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 48/167 (28%), Positives = 84/167 (50%), Gaps = 1/167 (0%)
 Frame = -2

Query: 860 KELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-NL 684
           +EL VS + +   E+++    +  ++ G   L  ME L    NL+ + L +N+I  + NL
Sbjct: 64  QELGVSEDTVVTQEQLDTIETMVYVDFGVEDLTGMEYLH---NLKFVDLSQNKISKLENL 120

Query: 683 CGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKL 504
             L  ++ +S+  N++T +  L     L  L L  N I  +     L NLR+L++S+N+L
Sbjct: 121 ANLTELETVSLNYNQITDITPLMNSPKLYNLELGVNQISTLPSFENLTNLRILNLSSNQL 180

Query: 503 TAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
             IS + +  +L +L ++ NNIS +  ++E        L   Y E N
Sbjct: 181 KDISALKDTPQLTNLSISANNISDISVLSEC-----DNLQVFYAESN 222



 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 37/150 (24%), Positives = 75/150 (50%), Gaps = 1/150 (0%)
 Frame = -2

Query: 866 TLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN 687
           T++ +   +  +  +  +E+ H L+ ++L  NK+  +ENL  LT L+ + L  N+I  I 
Sbjct: 81  TIETMVYVDFGVEDLTGMEYLHNLKFVDLSQNKISKLENLANLTELETVSLNYNQITDIT 140

Query: 686 -LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSAN 510
            L     +  + +  N+++++   E    L  L LS N ++ +  L     L  L +SAN
Sbjct: 141 PLMNSPKLYNLELGVNQISTLPSFENLTNLRILNLSSNQLKDISALKDTPQLTNLSISAN 200

Query: 509 KLTAISNIANLTKLEDLWLNDNNISSVEDI 420
            ++ IS ++    L+  +   N ++S+E +
Sbjct: 201 NISDISVLSECDNLQVFYAESNQLTSIEPL 230



 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 43/153 (28%), Positives = 80/153 (52%), Gaps = 2/153 (1%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           +L    +++N+IT  + L   S  L  L +  NQI+ +   E+   L+IL L SN+L+ +
Sbjct: 125 ELETVSLNYNQITDITPLMN-SPKLYNLELGVNQISTLPSFENLTNLRILNLSSNQLKDI 183

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKC--IKKISIQSNRLTSMKGLEECVALEELYLS 582
             L+    L  L +  N I  I++   +C  ++    +SN+LTS++ L     LE    +
Sbjct: 184 SALKDTPQLTNLSISANNISDISVLS-ECDNLQVFYAESNQLTSIEPLRNKTKLEYFDAN 242

Query: 581 HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIA 483
            N I+ +  LST+  +R + +  N+++  S++A
Sbjct: 243 FNQIKDVTPLSTIPTIRSIKIEENQISDFSSLA 275



>gb:BC070827_2555796 Xenopus laevis hypothetical protein MGC83921,
           mRNA (cDNA clone MGC:83921 IMAGE:6861019), complete cds.
          Length = 1030

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 54/198 (27%), Positives = 92/198 (46%), Gaps = 4/198 (2%)
 Frame = -2

Query: 875 VSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIR 696
           ++S L  + +  NQI+KIE + H   LQ L+L SN +  +E L +L +LQ L        
Sbjct: 26  LNSNLYSINLHCNQISKIEGLRHLCYLQHLDLSSNLITKIEGLDSLASLQSL-------- 77

Query: 695 AINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVS 516
                        ++  N+LT ++GLE+   L++L LS+N I+ + GL  L         
Sbjct: 78  -------------NLSCNKLTRVEGLEKLFNLKKLNLSYNSIQDLTGLIPLHGWN----- 119

Query: 515 ANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLER----NPCANS 348
                         KL  L+L+ N I+S++++ ++  G L  L  L LE+    NP  ++
Sbjct: 120 -------------HKLSHLYLHSNCINSIDEVLQSTVG-LNCLLHLTLEQNAKGNPVCHA 165

Query: 347 PNYISTLRQIFPNIQQVD 294
             Y   + +  P +  +D
Sbjct: 166 LGYREIILENLPQLNSLD 183



 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 39/115 (33%), Positives = 65/115 (56%)
 Frame = -2

Query: 692 INLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSA 513
           + +C    +  I++  N+++ ++GL     L+ L LS N I K+EGL +L +L+ L++S 
Sbjct: 22  LEICLNSNLYSINLHCNQISKIEGLRHLCYLQHLDLSSNLITKIEGLDSLASLQSLNLSC 81

Query: 512 NKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANS 348
           NKLT +  +  L  L+ L L+ N+I  +  +   + G   KL+ LYL  N C NS
Sbjct: 82  NKLTRVEGLEKLFNLKKLNLSYNSIQDLTGLI-PLHGWNHKLSHLYLHSN-CINS 134



>gb:BC065773_2105620 Mus musculus cDNA clone MGC:73529
           IMAGE:3418132, complete cds.
          Length = 157

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 40/126 (31%), Positives = 70/126 (55%), Gaps = 1/126 (0%)
 Frame = -2

Query: 779 GSNKLRVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA 603
           G    ++  NL    ++  L L +N+I  + NL   K + ++S+ +NRL  M G+ +   
Sbjct: 22  GQGLQKLGANLPCEADVHTLILDKNQIIKLENLEKCKQLIQLSVANNRLVRMMGVAKLTQ 81

Query: 602 LEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVED 423
           L  L L HN I  +EGL  LV+L  L+++ N L  +  + + T L+ L L+DNNI  + D
Sbjct: 82  LRVLNLPHNSIGCVEGLKDLVHLEWLNLAGNNLKTMEQVNSCTALQHLDLSDNNIPQIGD 141

Query: 422 IAEAVA 405
           +++ ++
Sbjct: 142 VSKLIS 147



 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 43/134 (32%), Positives = 70/134 (52%), Gaps = 7/134 (5%)
 Frame = -2

Query: 896 SPSGLSKVSSTLK------ELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLT 735
           S  GL K+ + L        L +  NQI K+E +E   +L  L + +N+L  M  +  LT
Sbjct: 21  SGQGLQKLGANLPCEADVHTLILDKNQIIKLENLEKCKQLIQLSVANNRLVRMMGVAKLT 80

Query: 734 NLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKME 558
            L+ L L  N I  +  L  L  ++ +++  N L +M+ +  C AL+ L LS N I ++ 
Sbjct: 81  QLRVLNLPHNSIGCVEGLKDLVHLEWLNLAGNNLKTMEQVNSCTALQHLDLSDNNIPQIG 140

Query: 557 GLSTLVNLRVLDVS 516
            +S L++L+V  VS
Sbjct: 141 DVSKLISLKVSGVS 154



>gb:AY062238_1935516 Homo sapiens scribble (SCRIB) mRNA, complete
           cds.
          Length = 1630

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 55/173 (31%), Positives = 89/173 (51%), Gaps = 6/173 (3%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM-ENLQTLTNLQELWLGRNRIRAI- 690
           LK L  S + + K+E+         L+LG N L V+ + L  L NL+ELWL RN++ A+ 
Sbjct: 163 LKSLPASLSFLVKLEQ---------LDLGGNDLEVLPDTLGALPNLRELWLDRNQLSALP 213

Query: 689 -NLCGLKCIKKISIQSNRLTSMKG-LEECVALEELYLSHNGIEKM-EGLSTLVNLRVLDV 519
             L  L+ +  + +  NRL  +   L   V L +L LS N + ++ +G+  L  L +L V
Sbjct: 214 PELGNLRRLVCLDVSENRLEELPAELGGLVLLTDLLLSQNLLRRLPDGIGQLKQLSILKV 273

Query: 518 SANKLTAISN-IANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
             N+L  ++  I +   L +L L +N + ++        G L KLT L ++RN
Sbjct: 274 DQNRLCEVTEAIGDCENLSELILTENLLMAL----PRSLGKLTKLTNLNVDRN 322



 Score = 53.9 bits (128), Expect = 7e-06
 Identities = 56/197 (28%), Positives = 96/197 (48%), Gaps = 8/197 (4%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKIEE-IEHFHELQILELGSNKL 765
           ++L+  DVS N +   P+ L  +   L +L +S N + ++ + I    +L IL++  N+L
Sbjct: 220 RRLVCLDVSENRLEELPAELGGLV-LLTDLLLSQNLLRRLPDGIGQLKQLSILKVDQNRL 278

Query: 764 -RVMENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSMKG-LEECVALE 597
             V E +    NL EL L  N + A+  +L  L  +  +++  N L ++   +  CVAL 
Sbjct: 279 CEVTEAIGDCENLSELILTENLLMALPRSLGKLTKLTNLNVDRNHLEALPPEIGGCVALS 338

Query: 596 ELYLSHNGIEKMEG-LSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
            L L  N +  +   L+    L VLDV+ N+L ++        L+ LWL +N    +   
Sbjct: 339 VLSLRDNRLAVLPPELAHTTELHVLDVAGNRLQSLPFALTHLNLKALWLAENQAQPMLRF 398

Query: 419 -AEAVAGSLQKLTTLYL 372
             E  A + +K+ T YL
Sbjct: 399 QTEDDARTGEKVLTCYL 415



>gb:AF271734_1894095 Homo sapiens SCRIB1 variant N1 (SCRIB1) mRNA,
           complete cds.
          Length = 1601

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 55/173 (31%), Positives = 89/173 (51%), Gaps = 6/173 (3%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM-ENLQTLTNLQELWLGRNRIRAI- 690
           LK L  S + + K+E+         L+LG N L V+ + L  L NL+ELWL RN++ A+ 
Sbjct: 134 LKSLPASLSFLVKLEQ---------LDLGGNDLEVLPDTLGALPNLRELWLDRNQLSALP 184

Query: 689 -NLCGLKCIKKISIQSNRLTSMKG-LEECVALEELYLSHNGIEKM-EGLSTLVNLRVLDV 519
             L  L+ +  + +  NRL  +   L   V L +L LS N + ++ +G+  L  L +L V
Sbjct: 185 PELGNLRRLVCLDVSENRLEELPAELGGLVLLTDLLLSQNLLRRLPDGIGQLKQLSILKV 244

Query: 518 SANKLTAISN-IANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
             N+L  ++  I +   L +L L +N + ++        G L KLT L ++RN
Sbjct: 245 DQNRLCEVTEAIGDCENLSELILTENLLMAL----PRSLGKLTKLTNLNVDRN 293



 Score = 53.9 bits (128), Expect = 7e-06
 Identities = 56/197 (28%), Positives = 96/197 (48%), Gaps = 8/197 (4%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKIEE-IEHFHELQILELGSNKL 765
           ++L+  DVS N +   P+ L  +   L +L +S N + ++ + I    +L IL++  N+L
Sbjct: 191 RRLVCLDVSENRLEELPAELGGLV-LLTDLLLSQNLLRRLPDGIGQLKQLSILKVDQNRL 249

Query: 764 -RVMENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSMKG-LEECVALE 597
             V E +    NL EL L  N + A+  +L  L  +  +++  N L ++   +  CVAL 
Sbjct: 250 CEVTEAIGDCENLSELILTENLLMALPRSLGKLTKLTNLNVDRNHLEALPPEIGGCVALS 309

Query: 596 ELYLSHNGIEKMEG-LSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
            L L  N +  +   L+    L VLDV+ N+L ++        L+ LWL +N    +   
Sbjct: 310 VLSLRDNRLAVLPPELAHTTELHVLDVAGNRLQSLPFALTHLNLKALWLAENQAQPMLRF 369

Query: 419 -AEAVAGSLQKLTTLYL 372
             E  A + +K+ T YL
Sbjct: 370 QTEDDARTGEKVLTCYL 386



>gb:AF240677_1892467 Homo sapiens CRIB1 (CRIB1) mRNA, complete
           cds.>gb:D63481_1994815 Homo sapiens mRNA for KIAA0147
           protein, partial cds.
          Length = 1630

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 55/173 (31%), Positives = 89/173 (51%), Gaps = 6/173 (3%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM-ENLQTLTNLQELWLGRNRIRAI- 690
           LK L  S + + K+E+         L+LG N L V+ + L  L NL+ELWL RN++ A+ 
Sbjct: 163 LKSLPASLSFLVKLEQ---------LDLGGNDLEVLPDTLGALPNLRELWLDRNQLSALP 213

Query: 689 -NLCGLKCIKKISIQSNRLTSMKG-LEECVALEELYLSHNGIEKM-EGLSTLVNLRVLDV 519
             L  L+ +  + +  NRL  +   L   V L +L LS N + ++ +G+  L  L +L V
Sbjct: 214 PELGNLRRLVCLDVSENRLEELPAELGGLVLLTDLLLSQNLLRRLPDGIGQLKQLSILKV 273

Query: 518 SANKLTAISN-IANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
             N+L  ++  I +   L +L L +N + ++        G L KLT L ++RN
Sbjct: 274 DQNRLCEVTEAIGDCENLSELILTENLLMAL----PRSLGKLTKLTNLNVDRN 322



 Score = 53.9 bits (128), Expect = 7e-06
 Identities = 56/197 (28%), Positives = 96/197 (48%), Gaps = 8/197 (4%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKIEE-IEHFHELQILELGSNKL 765
           ++L+  DVS N +   P+ L  +   L +L +S N + ++ + I    +L IL++  N+L
Sbjct: 220 RRLVCLDVSENRLEELPAELGGLV-LLTDLLLSQNLLRRLPDGIGQLKQLSILKVDQNRL 278

Query: 764 -RVMENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSMKG-LEECVALE 597
             V E +    NL EL L  N + A+  +L  L  +  +++  N L ++   +  CVAL 
Sbjct: 279 CEVTEAIGDCENLSELILTENLLMALPRSLGKLTKLTNLNVDRNHLEALPPEIGGCVALS 338

Query: 596 ELYLSHNGIEKMEG-LSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
            L L  N +  +   L+    L VLDV+ N+L ++        L+ LWL +N    +   
Sbjct: 339 VLSLRDNRLAVLPPELAHTTELHVLDVAGNRLQSLPFALTHLNLKALWLAENQAQPMLRF 398

Query: 419 -AEAVAGSLQKLTTLYL 372
             E  A + +K+ T YL
Sbjct: 399 QTEDDARTGEKVLTCYL 415



>gb:AC121489_1740239 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1217B09, complete sequence.
          Length = 624

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 55/177 (31%), Positives = 84/177 (47%), Gaps = 7/177 (3%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           S+L+ + +S N I +I        L  L+L  NK+ V+E L+ LT L+ L L  N+I  I
Sbjct: 393 SSLRAVNLSGNLIVQISSGSLPKGLHSLDLSRNKISVIEGLRELTRLRVLNLSYNKISRI 452

Query: 689 NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSAN 510
                                 GL  C A+ ELYL+ N I  +EGL  L+ L V+D+S N
Sbjct: 453 G--------------------HGLSNCGAIRELYLAGNKISDVEGLHRLLKLAVVDLSFN 492

Query: 509 KLTAISN----IANLTKLEDLWLNDNNISS---VEDIAEAVAGSLQKLTTLYLERNP 360
           K+T        +AN + L  L L  N + +    + + ++ +G L +L   YL + P
Sbjct: 493 KITTTKALGQLVANYSSLRALNLVGNPVQTNIGDDALRKSASGLLSRLE--YLNKQP 547



>gb:AK080249_1172910 Mus musculus adult male aorta and vein cDNA,
           RIKEN full-length enriched library, clone:A530089L15
           product:hypothetical IQ calmodulin-binding
           motif/Leucine-rich repeat containing protein, full
           insert sequence.
          Length = 151

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 40/126 (31%), Positives = 70/126 (55%), Gaps = 1/126 (0%)
 Frame = -2

Query: 779 GSNKLRVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA 603
           G    ++  NL    ++  L L +N+I  + NL   K + ++S+ +NRL  M G+ +   
Sbjct: 22  GQGLQKLGANLPCEADVHTLILDKNQIIKLENLEKCKQLIQLSVANNRLVRMMGVAKLTQ 81

Query: 602 LEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVED 423
           L  L L HN I  +EGL  LV+L  L+++ N L  +  + + T L+ L L+DNNI  + D
Sbjct: 82  LRVLNLPHNSIGCVEGLKDLVHLEWLNLAGNNLKTMEQVNSCTALQHLDLSDNNIPQIGD 141

Query: 422 IAEAVA 405
           +++ ++
Sbjct: 142 VSKLIS 147



 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 40/129 (31%), Positives = 67/129 (51%), Gaps = 7/129 (5%)
 Frame = -2

Query: 896 SPSGLSKVSSTLK------ELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLT 735
           S  GL K+ + L        L +  NQI K+E +E   +L  L + +N+L  M  +  LT
Sbjct: 21  SGQGLQKLGANLPCEADVHTLILDKNQIIKLENLEKCKQLIQLSVANNRLVRMMGVAKLT 80

Query: 734 NLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKME 558
            L+ L L  N I  +  L  L  ++ +++  N L +M+ +  C AL+ L LS N I ++ 
Sbjct: 81  QLRVLNLPHNSIGCVEGLKDLVHLEWLNLAGNNLKTMEQVNSCTALQHLDLSDNNIPQIG 140

Query: 557 GLSTLVNLR 531
            +S L++L+
Sbjct: 141 DVSKLISLK 149



>gb:AE017291_433313 Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130, chromosome I, section 5 of 14 of the
           complete sequence.>gb:AE016823_1066324 Leptospira
           interrogans serovar Copenhageni str. Fiocruz L1-130,
           chromosome I, complete sequence.
          Length = 413

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 66/215 (30%), Positives = 113/215 (52%), Gaps = 10/215 (4%)
 Frame = -2

Query: 908 NEITS-PSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKLRVM-ENLQTL 738
           N++T+ P  + ++ + LK L+++NNQ+  + EEI     LQ L L  N+L ++ + +  L
Sbjct: 113 NQLTTLPEEIGQLQN-LKVLHLNNNQLTTLPEEIGKLQNLQELNLFVNRLNILPKEIGRL 171

Query: 737 TNLQELWLGRNRIRAI--NLCGLKCIKKISI--QSNRLTSM-KGLEECVALEELYLSHNG 573
            NLQEL+L  NR+  +   +  L+ ++K+S+  ++   T + K + +   L+EL+L  N 
Sbjct: 172 QNLQELYLSLNRLTILPEEIGQLESLRKLSLGGKNKPFTILPKEITQLQNLQELHLKFNR 231

Query: 572 IEKM-EGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSVEDIAEAVAGS 399
           +  + + +  L NLR+LD+  N+LT +   I  L  L  L L+ N ++    I       
Sbjct: 232 LTVLPKEIGQLQNLRILDLYQNRLTILPKEIGQLKNLLVLDLSGNQLT----ILPKEITQ 287

Query: 398 LQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVD 294
           LQ L  L LE N     P  I+     F N+Q +D
Sbjct: 288 LQNLQELNLEYNRFEAFPKEITQ----FQNLQVLD 318



 Score = 63.5 bits (153), Expect = 9e-09
 Identities = 62/209 (29%), Positives = 104/209 (49%), Gaps = 9/209 (4%)
 Frame = -2

Query: 917 VSFNEITS-PSGLSKVSSTLKELYVSNNQIAKI--EEIEHFHELQILELGSNKLRVM-EN 750
           +S N +T  P  + ++ S  K      N+   I  +EI     LQ L L  N+L V+ + 
Sbjct: 179 LSLNRLTILPEEIGQLESLRKLSLGGKNKPFTILPKEITQLQNLQELHLKFNRLTVLPKE 238

Query: 749 LQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALEELYLSH 579
           +  L NL+ L L +NR+  +   +  LK +  + +  N+LT + K + +   L+EL L +
Sbjct: 239 IGQLQNLRILDLYQNRLTILPKEIGQLKNLLVLDLSGNQLTILPKEITQLQNLQELNLEY 298

Query: 578 NGIEKM-EGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSVEDIAEAVA 405
           N  E   + ++   NL+VLD+  N+LT +   I  L  L+ L L+ N ++++        
Sbjct: 299 NRFEAFPKEITQFQNLQVLDLYQNRLTTLPEEIGQLQNLQKLHLSRNQLTTL----PKEI 354

Query: 404 GSLQKLTTLYLERNPCANSPNYISTLRQI 318
           G LQKL +L L+ N  A  P  I  L+ +
Sbjct: 355 GRLQKLESLGLDHNQLATLPEEIKQLKNL 383



 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 43/141 (30%), Positives = 84/141 (59%), Gaps = 8/141 (5%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKL 765
           K LLV D+S N++T  P  ++++ + L+EL +  N+     +EI  F  LQ+L+L  N+L
Sbjct: 266 KNLLVLDLSGNQLTILPKEITQLQN-LQELNLEYNRFEAFPKEITQFQNLQVLDLYQNRL 324

Query: 764 RVM-ENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALE 597
             + E +  L NLQ+L L RN++  +   +  L+ ++ + +  N+L ++ + +++   L+
Sbjct: 325 TTLPEEIGQLQNLQKLHLSRNQLTTLPKEIGRLQKLESLGLDHNQLATLPEEIKQLKNLK 384

Query: 596 ELYLSHNGI--EKMEGLSTLV 540
           +LYL +N +  EK+E +  L+
Sbjct: 385 KLYLHNNPLLSEKIERIRKLL 405



>gb:AE011460_273202 Leptospira interrogans serovar lai str. 56601
           chromosome I, section 269 of 397 of the complete
           sequence.>gb:AE010300_1006601 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete sequence.
          Length = 408

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 66/215 (30%), Positives = 113/215 (52%), Gaps = 10/215 (4%)
 Frame = -2

Query: 908 NEITS-PSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKLRVM-ENLQTL 738
           N++T+ P  + ++ + LK L+++NNQ+  + EEI     LQ L L  N+L ++ + +  L
Sbjct: 108 NQLTTLPEEIGQLQN-LKVLHLNNNQLTTLPEEIGKLQNLQELNLFVNRLNILPKEIGRL 166

Query: 737 TNLQELWLGRNRIRAI--NLCGLKCIKKISI--QSNRLTSM-KGLEECVALEELYLSHNG 573
            NLQEL+L  NR+  +   +  L+ ++K+S+  ++   T + K + +   L+EL+L  N 
Sbjct: 167 QNLQELYLSLNRLTILPEEIGQLESLRKLSLGGKNKPFTILPKEITQLQNLQELHLKFNR 226

Query: 572 IEKM-EGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSVEDIAEAVAGS 399
           +  + + +  L NLR+LD+  N+LT +   I  L  L  L L+ N ++    I       
Sbjct: 227 LTVLPKEIGQLQNLRILDLYQNRLTILPKEIGQLKNLLVLDLSGNQLT----ILPKEITQ 282

Query: 398 LQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVD 294
           LQ L  L LE N     P  I+     F N+Q +D
Sbjct: 283 LQNLQELNLEYNRFEAFPKEITQ----FQNLQVLD 313



 Score = 63.5 bits (153), Expect = 9e-09
 Identities = 62/209 (29%), Positives = 104/209 (49%), Gaps = 9/209 (4%)
 Frame = -2

Query: 917 VSFNEITS-PSGLSKVSSTLKELYVSNNQIAKI--EEIEHFHELQILELGSNKLRVM-EN 750
           +S N +T  P  + ++ S  K      N+   I  +EI     LQ L L  N+L V+ + 
Sbjct: 174 LSLNRLTILPEEIGQLESLRKLSLGGKNKPFTILPKEITQLQNLQELHLKFNRLTVLPKE 233

Query: 749 LQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALEELYLSH 579
           +  L NL+ L L +NR+  +   +  LK +  + +  N+LT + K + +   L+EL L +
Sbjct: 234 IGQLQNLRILDLYQNRLTILPKEIGQLKNLLVLDLSGNQLTILPKEITQLQNLQELNLEY 293

Query: 578 NGIEKM-EGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSVEDIAEAVA 405
           N  E   + ++   NL+VLD+  N+LT +   I  L  L+ L L+ N ++++        
Sbjct: 294 NRFEAFPKEITQFQNLQVLDLYQNRLTTLPKEIGQLQNLQKLHLSRNQLTTL----PKEI 349

Query: 404 GSLQKLTTLYLERNPCANSPNYISTLRQI 318
           G LQKL +L L+ N  A  P  I  L+ +
Sbjct: 350 GRLQKLESLGLDHNQLATLPEEIKQLKNL 378



 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 42/141 (29%), Positives = 84/141 (59%), Gaps = 8/141 (5%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKL 765
           K LLV D+S N++T  P  ++++ + L+EL +  N+     +EI  F  LQ+L+L  N+L
Sbjct: 261 KNLLVLDLSGNQLTILPKEITQLQN-LQELNLEYNRFEAFPKEITQFQNLQVLDLYQNRL 319

Query: 764 RVM-ENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALE 597
             + + +  L NLQ+L L RN++  +   +  L+ ++ + +  N+L ++ + +++   L+
Sbjct: 320 TTLPKEIGQLQNLQKLHLSRNQLTTLPKEIGRLQKLESLGLDHNQLATLPEEIKQLKNLK 379

Query: 596 ELYLSHNGI--EKMEGLSTLV 540
           +LYL +N +  EK+E +  L+
Sbjct: 380 KLYLHNNPLLSEKIERIRKLL 400



>gb:CR382138_1670776 Debaryomyces hansenii chromosome F of strain
            CBS767 of Debaryomyces hansenii.
          Length = 1357

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 49/167 (29%), Positives = 84/167 (50%), Gaps = 3/167 (1%)
 Frame = -2

Query: 920  DVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQT 741
            D+S N I    GL K    +  L VS+N I  +     +H+LQ L +  NKL  + N+  
Sbjct: 899  DLSDNNIKFLDGLPK---RVLNLNVSHNDIEHMTSFNKYHDLQHLNVSFNKLSNLSNVSN 955

Query: 740  LTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLE--ECVALEELYLSHNGI 570
              +L EL    N++ +I+ +  L+ + +I +  N L         + V L+EL +S N I
Sbjct: 956  NIHLTELTALNNKLVSIDGIRKLENLTRIDVSQNDLMGEIDFANFKLVNLQELNISENSI 1015

Query: 569  EKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV 429
            + + GL  L  LR+L+ + N++  IS +   + L+ + L  NN+  +
Sbjct: 1016 QSLSGLECLPRLRILNANENQIMHISCMEKHSHLKKMLLKLNNLQKL 1062



 Score = 57.4 bits (137), Expect = 6e-07
 Identities = 54/222 (24%), Positives = 105/222 (47%), Gaps = 18/222 (8%)
 Frame = -2

Query: 971  SAEENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQ 792
            S +  SG+    +L + + + N+I   S + K  S LK++ +  N + K+  +E +  ++
Sbjct: 1014 SIQSLSGLECLPRLRILNANENQIMHISCMEK-HSHLKKMLLKLNNLQKLN-LEPYPFIR 1071

Query: 791  ILELGSNKLRVMENLQTLTNLQELWL-GRNRIRAIN--LCGLKCIKKISIQSN------- 642
             L +  N L V+ + + L +L+EL    +N    IN  L G   I K+ +  N       
Sbjct: 1072 CLRIDGNNLNVVTDFKKLRHLEELSCKSQNNPDVINNMLNGSNDILKLDLSGNGNFDLFP 1131

Query: 641  RLTSMKGL------EECVALEELYLSHNGIEKMEG--LSTLVNLRVLDVSANKLTAISNI 486
               ++ GL      E  + L  L LS   + K+     ++  N+R L+++ N L+ I+ +
Sbjct: 1132 NNPNVSGLNHNIHYEPFLNLNVLVLSAMNLSKLPADFAASFPNIRELNLNFNNLSNIAAL 1191

Query: 485  ANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNP 360
            + +  ++ L++  NN+  +  + E++ G    L  L L  NP
Sbjct: 1192 SKMQNIKRLYMVSNNVREIGSVVESLKGVRNTLRVLDLRLNP 1233



 Score = 50.8 bits (120), Expect = 6e-05
 Identities = 58/263 (22%), Positives = 109/263 (41%), Gaps = 40/263 (15%)
 Frame = -2

Query: 953  GVSIFKKLLVFDVSFNEITSPSGLSKVSST-LKELYVSNNQIAKIEEIEHFHELQILELG 777
            G+   + L   DVS N++      +      L+EL +S N I  +  +E    L+IL   
Sbjct: 974  GIRKLENLTRIDVSQNDLMGEIDFANFKLVNLQELNISENSIQSLSGLECLPRLRILNAN 1033

Query: 776  SNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALE 597
             N++  +  ++  ++L+++ L  N ++ +NL     I+ + I  N L  +   ++   LE
Sbjct: 1034 ENQIMHISCMEKHSHLKKMLLKLNNLQKLNLEPYPFIRCLRIDGNNLNVVTDFKKLRHLE 1093

Query: 596  ELY------------------------LSHNG-------IEKMEGLS------TLVNLRV 528
            EL                         LS NG          + GL+        +NL V
Sbjct: 1094 ELSCKSQNNPDVINNMLNGSNDILKLDLSGNGNFDLFPNNPNVSGLNHNIHYEPFLNLNV 1153

Query: 527  LDVSANKLTAI--SNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCA 354
            L +SA  L+ +     A+   + +L LN NN+S++     A    +Q +  LY+  N   
Sbjct: 1154 LVLSAMNLSKLPADFAASFPNIRELNLNFNNLSNI-----AALSKMQNIKRLYMVSNNVR 1208

Query: 353  NSPNYISTLRQIFPNIQQVDSEL 285
               + + +L+ +   ++ +D  L
Sbjct: 1209 EIGSVVESLKGVRNTLRVLDLRL 1231



 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 48/197 (24%), Positives = 90/197 (45%), Gaps = 11/197 (5%)
 Frame = -2

Query: 920  DVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQ-----------ILELGS 774
            +VSFN       + + +   ++   S N +  I +I      Q           IL +G 
Sbjct: 803  EVSFNLPNMTDEIHETTHEYEDKSPSLNNVTHISQINDMTFSQTKKKLVAVITDILSVGQ 862

Query: 773  NKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEE 594
            N   +  N + +T++       + I+ +N   L  +  + +  N +  + GL + V    
Sbjct: 863  NFRPI--NWEKVTDIAMTGYQLDSIKDLNKF-LPRLNNVDLSDNNIKFLDGLPKRVL--N 917

Query: 593  LYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAE 414
            L +SHN IE M   +   +L+ L+VS NKL+ +SN++N   L +L   +N + S++ I +
Sbjct: 918  LNVSHNDIEHMTSFNKYHDLQHLNVSFNKLSNLSNVSNNIHLTELTALNNKLVSIDGIRK 977

Query: 413  AVAGSLQKLTTLYLERN 363
                 L+ LT + + +N
Sbjct: 978  -----LENLTRIDVSQN 989



>gb:AK039037_1165260 Mus musculus adult male hypothalamus cDNA,
           RIKEN full-length enriched library, clone:A230089E22
           product:hypothetical ADP-ribosylation structure
           containing protein, full insert sequence.
          Length = 363

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 64/220 (29%), Positives = 95/220 (43%), Gaps = 16/220 (7%)
 Frame = -2

Query: 944 IFKKLLVFDVSFNEITSPSGLSKVSSTLK-ELYVSNNQIAKIEEIEHFHELQILELGSNK 768
           I K+L + +    EI    G    S T K E++ S     +I  +  FH L  L + +  
Sbjct: 12  IIKELCLCNGLTYEIVGQEG----SDTSKLEMFFSG--YPRIVGLSLFHNLSSLTIVAQD 65

Query: 767 LRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELY 588
           +R +  L+T   L+ELW+          C   CI+KI          +GL+ C  LE+LY
Sbjct: 66  IREISGLETCLQLKELWIAE--------C---CIEKI----------EGLQGCRNLEKLY 104

Query: 587 LSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAE-- 414
           L +N I K+E L  L+ L VL ++ N +  I  +  L  L+DL L  N +SS+    +  
Sbjct: 105 LYYNKISKIENLEKLIKLEVLWLNHNMIKNIEGLQTLKNLKDLNLAGNLVSSIGRCLDPN 164

Query: 413 -------------AVAGSLQKLTTLYLERNPCANSPNYIS 333
                             L  LT L   ++ C N P Y S
Sbjct: 165 EQLEKLNLFGNQITSFKDLTNLTKLTRLKDLCLNDPQYKS 204



>gb:LMIRPA_141505 L.monocytogenes irpA gene.
          Length = 297

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 43/145 (29%), Positives = 77/145 (53%), Gaps = 1/145 (0%)
 Frame = -2

Query: 776 SNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVAL 600
           ++ ++ +  +Q  TNL+EL L  N+I  ++ L  L  ++++S+  NRL ++ G+     L
Sbjct: 84  NSNIQSLAGMQFFTNLKELHLSHNQISDLSPLKDLTKLEELSVNRNRLKNLNGIPSA-CL 142

Query: 599 EELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
             L+L +N +   + L  L NL +L +  NKL +I  +  L+KLE L L+ N I++   +
Sbjct: 143 SRLFLDNNELRDTDSLIHLKNLEILSIRNNKLKSIVMLGFLSKLEVLDLHGNEITNTGGL 202

Query: 419 AEAVAGSLQKLTTLYLERNPCANSP 345
                  L+K+  + L    C N P
Sbjct: 203 TR-----LKKVNWIDLTGQKCVNEP 222



 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 41/158 (25%), Positives = 75/158 (47%)
 Frame = -2

Query: 923 FDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQ 744
           F+   + I S +G+ +  + LKEL++S+NQI+ +                        L+
Sbjct: 80  FNGDNSNIQSLAGM-QFFTNLKELHLSHNQISDLSP----------------------LK 116

Query: 743 TLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEK 564
            LT L+EL + RNR++ +N     C+ ++ + +N L     L     LE L + +N ++ 
Sbjct: 117 DLTKLEELSVNRNRLKNLNGIPSACLSRLFLDNNELRDTDSLIHLKNLEILSIRNNKLKS 176

Query: 563 MEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLN 450
           +  L  L  L VLD+  N++T    +  L K+   W++
Sbjct: 177 IVMLGFLSKLEVLDLHGNEITNTGGLTRLKKVN--WID 212



 Score = 46.6 bits (109), Expect = 0.001
 Identities = 28/115 (24%), Positives = 59/115 (51%)
 Frame = -2

Query: 680 GLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLT 501
           GL    K ++    +T +   +E   ++     ++ I+ + G+    NL+ L +S N+++
Sbjct: 51  GLANAAKQNLGKQSVTDLVSQKELSGVQNFNGDNSNIQSLAGMQFFTNLKELHLSHNQIS 110

Query: 500 AISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYI 336
            +S + +LTKLE+L +N N + ++  I  A       L+ L+L+ N   ++ + I
Sbjct: 111 DLSPLKDLTKLEELSVNRNRLKNLNGIPSAC------LSRLFLDNNELRDTDSLI 159



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 39/128 (30%), Positives = 68/128 (53%), Gaps = 1/128 (0%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL    V+ N + + +G+   S+ L  L++ NN++   + + H   L+IL + +NKL+ +
Sbjct: 120 KLEELSVNRNRLKNLNGIP--SACLSRLFLDNNELRDTDSLIHLKNLEILSIRNNKLKSI 177

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALE-ELYLSH 579
             L  L+ L+ L L  N I   N  GL  +KK++     LT  K + E V  + ELY++ 
Sbjct: 178 VMLGFLSKLEVLDLHGNEI--TNTGGLTRLKKVNWID--LTGQKCVNEPVKYQPELYIA- 232

Query: 578 NGIEKMEG 555
           N ++  +G
Sbjct: 233 NAVKDPDG 240



>gb:LMINLCINF_141501 L.monocytogenes ORF2, ORF1, rplS, inlC, infC,
           and rpmI genes.>gb:LMINLCREP_141504 L.monocytogenes inlC
           gene.
          Length = 297

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 43/145 (29%), Positives = 77/145 (53%), Gaps = 1/145 (0%)
 Frame = -2

Query: 776 SNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVAL 600
           ++ ++ +  +Q  TNL+EL L  N+I  ++ L  L  ++++S+  NRL ++ G+     L
Sbjct: 84  NSNIQSLAGMQFFTNLKELHLSHNQISDLSPLKDLTKLEELSVNRNRLKNLNGIPSA-CL 142

Query: 599 EELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
             L+L +N +   + L  L NL +L +  NKL +I  +  L+KLE L L+ N I++   +
Sbjct: 143 SRLFLDNNELRDTDSLIHLKNLEILSIRNNKLKSIVMLGFLSKLEVLDLHGNEITNTGGL 202

Query: 419 AEAVAGSLQKLTTLYLERNPCANSP 345
                  L+K+  + L    C N P
Sbjct: 203 TR-----LKKVNWIDLTGQKCVNEP 222



 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 41/158 (25%), Positives = 75/158 (47%)
 Frame = -2

Query: 923 FDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQ 744
           F+   + I S +G+ +  + LKEL++S+NQI+ +                        L+
Sbjct: 80  FNGDNSNIQSLAGM-QFFTNLKELHLSHNQISDLSP----------------------LK 116

Query: 743 TLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEK 564
            LT L+EL + RNR++ +N     C+ ++ + +N L     L     LE L + +N ++ 
Sbjct: 117 DLTKLEELSVNRNRLKNLNGIPSACLSRLFLDNNELRDTDSLIHLKNLEILSIRNNKLKS 176

Query: 563 MEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLN 450
           +  L  L  L VLD+  N++T    +  L K+   W++
Sbjct: 177 IVMLGFLSKLEVLDLHGNEITNTGGLTRLKKVN--WID 212



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 28/115 (24%), Positives = 59/115 (51%)
 Frame = -2

Query: 680 GLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLT 501
           GL    K ++    +T +   +E   ++     ++ I+ + G+    NL+ L +S N+++
Sbjct: 51  GLANAVKQNLGKQSVTDLVSQKELSGVQNFNGDNSNIQSLAGMQFFTNLKELHLSHNQIS 110

Query: 500 AISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYI 336
            +S + +LTKLE+L +N N + ++  I  A       L+ L+L+ N   ++ + I
Sbjct: 111 DLSPLKDLTKLEELSVNRNRLKNLNGIPSAC------LSRLFLDNNELRDTDSLI 159



 Score = 45.4 bits (106), Expect = 0.003
 Identities = 37/120 (30%), Positives = 64/120 (53%), Gaps = 1/120 (0%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL    V+ N + + +G+   S+ L  L++ NN++   + + H   L+IL + +NKL+ +
Sbjct: 120 KLEELSVNRNRLKNLNGIP--SACLSRLFLDNNELRDTDSLIHLKNLEILSIRNNKLKSI 177

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALE-ELYLSH 579
             L  L+ L+ L L  N I   N  GL  +KK++     LT  K + E V  + ELY+++
Sbjct: 178 VMLGFLSKLEVLDLHGNEI--TNTGGLTRLKKVNWID--LTGQKCVNEPVKYQPELYITN 233



>pir|AB1298|AB1298 internalin C [imported] - Listeria monocytogenes
           (strain EGD-e)>gb:AL591981_536277 Listeria monocytogenes
           strain EGD, complete genome, segment 9/12.
          Length = 296

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 43/145 (29%), Positives = 77/145 (53%), Gaps = 1/145 (0%)
 Frame = -2

Query: 776 SNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVAL 600
           ++ ++ +  +Q  TNL+EL L  N+I  ++ L  L  ++++S+  NRL ++ G+     L
Sbjct: 83  NSNIQSLAGMQFFTNLKELHLSHNQISDLSPLKDLTKLEELSVNRNRLKNLNGIPSA-CL 141

Query: 599 EELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
             L+L +N +   + L  L NL +L +  NKL +I  +  L+KLE L L+ N I++   +
Sbjct: 142 SRLFLDNNELRDTDSLIHLKNLEILSIRNNKLKSIVMLGFLSKLEVLDLHGNEITNTGGL 201

Query: 419 AEAVAGSLQKLTTLYLERNPCANSP 345
                  L+K+  + L    C N P
Sbjct: 202 TR-----LKKVNWIDLTGQKCVNEP 221



 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 41/158 (25%), Positives = 75/158 (47%)
 Frame = -2

Query: 923 FDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQ 744
           F+   + I S +G+ +  + LKEL++S+NQI+ +                        L+
Sbjct: 79  FNGDNSNIQSLAGM-QFFTNLKELHLSHNQISDLSP----------------------LK 115

Query: 743 TLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEK 564
            LT L+EL + RNR++ +N     C+ ++ + +N L     L     LE L + +N ++ 
Sbjct: 116 DLTKLEELSVNRNRLKNLNGIPSACLSRLFLDNNELRDTDSLIHLKNLEILSIRNNKLKS 175

Query: 563 MEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLN 450
           +  L  L  L VLD+  N++T    +  L K+   W++
Sbjct: 176 IVMLGFLSKLEVLDLHGNEITNTGGLTRLKKVN--WID 211



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 28/115 (24%), Positives = 59/115 (51%)
 Frame = -2

Query: 680 GLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLT 501
           GL    K ++    +T +   +E   ++     ++ I+ + G+    NL+ L +S N+++
Sbjct: 50  GLANAVKQNLGKQSVTDLVSQKELSGVQNFNGDNSNIQSLAGMQFFTNLKELHLSHNQIS 109

Query: 500 AISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYI 336
            +S + +LTKLE+L +N N + ++  I  A       L+ L+L+ N   ++ + I
Sbjct: 110 DLSPLKDLTKLEELSVNRNRLKNLNGIPSAC------LSRLFLDNNELRDTDSLI 158



 Score = 45.4 bits (106), Expect = 0.003
 Identities = 37/120 (30%), Positives = 64/120 (53%), Gaps = 1/120 (0%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL    V+ N + + +G+   S+ L  L++ NN++   + + H   L+IL + +NKL+ +
Sbjct: 119 KLEELSVNRNRLKNLNGIP--SACLSRLFLDNNELRDTDSLIHLKNLEILSIRNNKLKSI 176

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALE-ELYLSH 579
             L  L+ L+ L L  N I   N  GL  +KK++     LT  K + E V  + ELY+++
Sbjct: 177 VMLGFLSKLEVLDLHGNEI--TNTGGLTRLKKVNWID--LTGQKCVNEPVKYQPELYITN 232



>gb:BC061202_2104412 Mus musculus RIKEN cDNA 1200008A14 gene, mRNA
           (cDNA clone IMAGE:30248071), partial cds.
          Length = 996

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 62/215 (28%), Positives = 96/215 (44%), Gaps = 6/215 (2%)
 Frame = -2

Query: 920 DVSFNE--ITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENL 747
           DV F +  + S S LS + S++  + +  N I+KI  I+H   L+ L+L SN++  +E L
Sbjct: 20  DVCFMDKGLHSISELS-LDSSIHAINLHCNNISKISSIDHIWNLRHLDLSSNQISQIEGL 78

Query: 746 QTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIE 567
            TLT L  L                     ++  N +T ++GLE  V L +L LS+N I 
Sbjct: 79  NTLTKLCTL---------------------NLSCNLITRVEGLEALVNLTKLNLSYNHIN 117

Query: 566 KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKL 387
            + GL  L  L+                   KL  + L+ N I S+  + +   G L  L
Sbjct: 118 DLSGLMPLHGLKY------------------KLRYIDLHSNYIDSIHHLLQCTVG-LHFL 158

Query: 386 TTLYLER----NPCANSPNYISTLRQIFPNIQQVD 294
           T L LE+    NP    P Y + + Q  P ++ +D
Sbjct: 159 TNLILEKDGEGNPICLIPGYRAIILQTLPQLRILD 193



>gb:AK122473_2069138 Mus musculus mRNA for mKIAA1225 protein.
          Length = 1401

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 53/199 (26%), Positives = 99/199 (49%), Gaps = 7/199 (3%)
 Frame = -2

Query: 893 PSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKLRVM-ENLQTLTNLQEL 720
           P  +     TL+ELY+  NQI ++ +++ +   L  L L  N L  +  ++  L NL+EL
Sbjct: 63  PKEIFTFEKTLEELYLDANQIEELPKQLFNCQSLHKLSLPDNDLTTLPASIANLINLREL 122

Query: 719 WLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALEELYLSHNGIEKM-EGL 552
            + +N I+    N+   K +  +    N ++ +  G  + + L +LYL+   +E +    
Sbjct: 123 DVSKNGIQEFPENIKNCKVLTIVEASVNPISKLPDGFSQLLNLTQLYLNDAFLEFLPANF 182

Query: 551 STLVNLRVLDVSANKLTAISNIAN-LTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLY 375
             L  L++L++  N+L  +    N LT+LE L L  N  + V ++ E ++G    L   +
Sbjct: 183 GRLTKLQILELRENQLKMLPKTMNRLTQLERLDLGSNEFTEVPEVLEQLSG----LREFW 238

Query: 374 LERNPCANSPNYISTLRQI 318
           ++ N     P +I +LRQ+
Sbjct: 239 MDGNRLTFIPGFIGSLRQL 257



 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 57/212 (26%), Positives = 100/212 (47%), Gaps = 5/212 (2%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKIE-EIEHFHELQILELGSNKL 765
           K L + + S N I+  P G S++ + L +LY+++  +  +        +LQILEL  N+L
Sbjct: 140 KVLTIVEASVNPISKLPDGFSQLLN-LTQLYLNDAFLEFLPANFGRLTKLQILELRENQL 198

Query: 764 RVM-ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELY 588
           +++ + +  LT L+ L LG N    +                     + LE+   L E +
Sbjct: 199 KMLPKTMNRLTQLERLDLGSNEFTEVP--------------------EVLEQLSGLREFW 238

Query: 587 LSHNGIEKMEG-LSTLVNLRVLDVSANKLTAISN-IANLTKLEDLWLNDNNISSVEDIAE 414
           +  N +  + G + +L  L  LDVS N +  +   I+     +D  L+ N   S++ + E
Sbjct: 239 MDGNRLTFIPGFIGSLRQLTYLDVSKNNIEMVEEGISTCENPQDFLLSSN---SLQQLPE 295

Query: 413 AVAGSLQKLTTLYLERNPCANSPNYISTLRQI 318
            + GSL+ +TTL ++ N     P+ I  LR I
Sbjct: 296 TI-GSLKNVTTLKIDENQLMYLPDSIGGLRSI 326



>gb:AK004646_1152478 Mus musculus adult male lung cDNA, RIKEN
           full-length enriched library, clone:1200008A14
           product:hypothetical RNI-like structure containing
           protein, full insert sequence.
          Length = 993

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 62/215 (28%), Positives = 96/215 (44%), Gaps = 6/215 (2%)
 Frame = -2

Query: 920 DVSFNE--ITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENL 747
           DV F +  + S S LS + S++  + +  N I+KI  I+H   L+ L+L SN++  +E L
Sbjct: 20  DVCFMDKGLHSISELS-LDSSIHAINLHCNNISKISSIDHIWNLRHLDLSSNQISQIEGL 78

Query: 746 QTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIE 567
            TLT L  L                     ++  N +T ++GLE  V L +L LS+N I 
Sbjct: 79  NTLTKLCTL---------------------NLSCNLITRVEGLEALVNLTKLNLSYNHIN 117

Query: 566 KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKL 387
            + GL  L  L+                   KL  + L+ N I S+  + +   G L  L
Sbjct: 118 DLSGLMPLHGLKY------------------KLRYIDLHSNYIDSIHHLLQCTVG-LHFL 158

Query: 386 TTLYLER----NPCANSPNYISTLRQIFPNIQQVD 294
           T L LE+    NP    P Y + + Q  P ++ +D
Sbjct: 159 TNLILEKDGEGNPICLIPGYRAIILQTLPQLRILD 193



>gb:AE014187_938771 Plasmodium falciparum 3D7 chromosome 14 complete
            sequence.>gb:AE014821_1227847 Plasmodium falciparum 3D7
            chromosome 14 section 6 of 13 of the complete sequence.
          Length = 1146

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 56/206 (27%), Positives = 97/206 (47%), Gaps = 13/206 (6%)
 Frame = -2

Query: 863  LKELYVSNNQIAKIEEIEHFHELQILELGSNK------------LRVMENLQTLTNLQEL 720
            LK L +SNN I  I  I     L+ L L +NK              V+ + ++L +L   
Sbjct: 862  LKFLNISNNYINNIHNIGPLDNLKALILNNNKHINENSFMGEHERNVLNSFKSLEDLDIS 921

Query: 719  WLGRNRIRAINLC-GLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTL 543
            +   ++      C  LK +K ++++ N + S+K LE    L+ L LS+N I K+   S  
Sbjct: 922  FCLLSKTNFFKKCPNLKNLKTLNLEGNNINSIKYLENLERLKVLNLSNNKISKISPDSFP 981

Query: 542  VNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
             +L  L++S N +  +S   NL  +E L L  N I ++++       +L+KL TLYL  N
Sbjct: 982  KSLENLNISNNLIRNLSPFDNLKNVETLDLRVNRIDNIDEF--KYLKNLEKLKTLYLNGN 1039

Query: 362  PCANSPNYISTLRQIFPNIQQVDSEL 285
                   +   ++ +   I+  D+++
Sbjct: 1040 --RKIKEHFIIIKNMLTQIENFDNKI 1063



 Score = 42.0 bits (97), Expect = 0.028
 Identities = 32/128 (25%), Positives = 69/128 (53%), Gaps = 4/128 (3%)
 Frame = -2

Query: 863  LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAINL 684
            LK L +SNN I  +  +    +L++L L +NK+  ++ L     ++ L L  N ++ IN 
Sbjct: 659  LKVLDLSNNGIEHLTNLTLPKQLKVLNLRNNKIFCIDFLHDKLEIEMLILDNNELKNINK 718

Query: 683  CG-LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN---LRVLDVS 516
               LK +K +    N+L+++   ++C +L+E+ + +N I+ +  +  + N   L  +++ 
Sbjct: 719  VNVLKKLKILRCSHNKLSTIPLFQKC-SLKEMDIHNNFIKDITHIVLIKNKQSLICINIY 777

Query: 515  ANKLTAIS 492
             NK+  ++
Sbjct: 778  NNKINFLN 785



 Score = 41.6 bits (96), Expect = 0.037
 Identities = 35/130 (26%), Positives = 67/130 (51%), Gaps = 3/130 (2%)
 Frame = -2

Query: 938  KKLLVFDVSFNEIT--SPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKL 765
            ++L V ++S N+I+  SP    K   +L+ L +SNN I  +   ++   ++ L+L  N++
Sbjct: 960  ERLKVLNLSNNKISKISPDSFPK---SLENLNISNNLIRNLSPFDNLKNVETLDLRVNRI 1016

Query: 764  RVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKK-ISIQSNRLTSMKGLEECVALEELY 588
              ++  + L NL++L       + + L G + IK+   I  N LT ++  +  +  E+  
Sbjct: 1017 DNIDEFKYLKNLEKL-------KTLYLNGNRKIKEHFIIIKNMLTQIENFDNKIMKEQNN 1069

Query: 587  LSHNGIEKME 558
            L+ N  EK E
Sbjct: 1070 LTSNLEEKRE 1079



 Score = 38.1 bits (87), Expect = 0.40
 Identities = 25/86 (29%), Positives = 45/86 (52%)
 Frame = -2

Query: 602 LEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVED 423
           L+ L LS+NGIE +  L+    L+VL++  NK+  I  + +  ++E L L++N + ++  
Sbjct: 659 LKVLDLSNNGIEHLTNLTLPKQLKVLNLRNNKIFCIDFLHDKLEIEMLILDNNELKNINK 718

Query: 422 IAEAVAGSLQKLTTLYLERNPCANSP 345
           +       L+KL  L    N  +  P
Sbjct: 719 V-----NVLKKLKILRCSHNKLSTIP 739



 Score = 35.4 bits (80), Expect = 2.6
 Identities = 40/186 (21%), Positives = 77/186 (41%), Gaps = 17/186 (9%)
 Frame = -2

Query: 950  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEI---EHFHELQILEL 780
            V++ KKL +   S N++++     K S  LKE+ + NN I  I  I   ++   L  + +
Sbjct: 719  VNVLKKLKILRCSHNKLSTIPLFQKCS--LKEMDIHNNFIKDITHIVLIKNKQSLICINI 776

Query: 779  GSNKLRVME-NLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVA 603
             +NK+  +  +L  +     L +  N           C+++         ++  L+    
Sbjct: 777  YNNKINFLNLDLYLIHIFPNLLILNN----------SCVERRQNSEKYFKNIYTLDVFFD 826

Query: 602  LEELYLSHNGIEKME-------------GLSTLVNLRVLDVSANKLTAISNIANLTKLED 462
            +  +Y  +  ++ +E                   NL+ L++S N +  I NI  L  L+ 
Sbjct: 827  IYNMYPPYTSLQSLEINNLKIKNILFDINNDNFYNLKFLNISNNYINNIHNIGPLDNLKA 886

Query: 461  LWLNDN 444
            L LN+N
Sbjct: 887  LILNNN 892



>pir|AI1174|AI1174 internalin, probable peptidoglycan bound protein
           (LPXTG motif) homolog lmo0801 [imported] - Listeria
           monocytogenes  (strain EGD-e)>gb:AL591976_535292
           Listeria monocytogenes strain EGD, complete genome,
           segment 4/12.
          Length = 646

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 53/198 (26%), Positives = 97/198 (48%), Gaps = 23/198 (11%)
 Frame = -2

Query: 950 VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN 771
           V+  KKL    ++ N+IT  S ++ +++ L   Y  NN I+ I  +++  +L I    + 
Sbjct: 121 VANLKKLTTLLINTNQITDISPVADLAN-LTTFYCGNNPISDISAVQNLTKLSIFNCYTA 179

Query: 770 KLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSN---------RLTSMKG 621
            +  +  ++ L NL+ L LG N I  I+ +  L  ++ +S  +N          LT++  
Sbjct: 180 NVEDISPVKNLVNLKTLSLGSNNIHDISDIEKLTALEYLSFSNNPVENPEVIGNLTNLNT 239

Query: 620 L-------------EECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIAN 480
           L                  L+ +YL +N I  +  +S   N+  L+++ N++T I+ +AN
Sbjct: 240 LWLYNAQIRNIDFTANLPKLKSVYLYNNQISNISEVSNWANIEYLELNNNQITDITPVAN 299

Query: 479 LTKLEDLWLNDNNISSVE 426
           LT L+ L LND  I++ E
Sbjct: 300 LTTLKTLKLNDQIITNRE 317



 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 29/77 (37%), Positives = 45/77 (58%)
 Frame = -2

Query: 581 HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG 402
           + GI+ +EG+  L N+  LDV  N++T I+ +ANL KL  L +N N I+ +  +A+    
Sbjct: 90  NKGIKSIEGVEYLQNITELDVEKNQITDIAPVANLKKLTTLLINTNQITDISPVAD---- 145

Query: 401 SLQKLTTLYLERNPCAN 351
            L  LTT Y   NP ++
Sbjct: 146 -LANLTTFYCGNNPISD 161



>gb:BC064859_2553900 Xenopus tropicalis hypothetical protein
           MGC75617, mRNA (cDNA clone MGC:75617 IMAGE:5379328),
           complete cds.
          Length = 524

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 55/204 (26%), Positives = 105/204 (51%), Gaps = 10/204 (4%)
 Frame = -2

Query: 917 VSFNEITS---PSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKL-RVME 753
           +S N+I+    P  +  +S+ L  L +  N +  + E +   H L+ L++G+N+L  + E
Sbjct: 133 LSINDISLQVLPENIGNLSN-LVSLELRENLLTFLPESLAQLHRLEELDIGNNELYNLPE 191

Query: 752 NLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALEELYLS 582
            + +L  L++LWL  N++  +   +  LK +  + +  N+L  + + +    +L +L +S
Sbjct: 192 TIGSLYKLKDLWLDGNQLADLPPEIGHLKNLLCLDLSENKLERLPEEISGLKSLTDLLVS 251

Query: 581 HNGIEKM-EGLSTLVNLRVLDVSANKLTAISN-IANLTKLEDLWLNDNNISSVEDIAEAV 408
           HN IE + +G+  L NL +L V  N+L  +++ I     L +L L +N +     +    
Sbjct: 252 HNSIEVLPDGIGKLKNLSILKVDQNRLMQLTDCIGECESLTELILTENQLL----VLPRS 307

Query: 407 AGSLQKLTTLYLERNPCANSPNYI 336
            G L+KL  L ++RN   + P  I
Sbjct: 308 IGKLKKLCNLNIDRNKLMSLPKEI 331



 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 51/172 (29%), Positives = 90/172 (52%), Gaps = 7/172 (4%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKIEE-IEHFHELQILELGSNKL 765
           K LL  D+S N++   P  +S + S L +L VS+N I  + + I     L IL++  N+L
Sbjct: 220 KNLLCLDLSENKLERLPEEISGLKS-LTDLLVSHNSIEVLPDGIGKLKNLSILKVDQNRL 278

Query: 764 -RVMENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALE 597
            ++ + +    +L EL L  N++  +  ++  LK +  ++I  N+L S+ K +  C  L 
Sbjct: 279 MQLTDCIGECESLTELILTENQLLVLPRSIGKLKKLCNLNIDRNKLMSLPKEIGGCCGLN 338

Query: 596 ELYLSHNGIEKMEG-LSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDN 444
              +  N + ++   ++    L VLDV+ N+LT +       KL+ LWL+DN
Sbjct: 339 VFCVRENRLSRIPSEIAKATELHVLDVAGNRLTHLPLSLTSLKLKALWLSDN 390



 Score = 33.9 bits (76), Expect = 7.6
 Identities = 34/105 (32%), Positives = 51/105 (48%), Gaps = 7/105 (6%)
 Frame = -3

Query: 1117 LSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP----V 950
            L  L   I +LSNL    LR+NL+T    E L+  H   +LEEL + +N+L  +P     
Sbjct: 140  LQVLPENIGNLSNLVSLELRENLLTFLP-ESLAQLH---RLEELDIGNNELYNLPETIGS 195

Query: 949  LAYLRNFWYLMFRSTKLHHLADCPRSPVH*RSSMSLII---KLQR 824
            L  L++ W         + LAD P    H ++ + L +   KL+R
Sbjct: 196  LYKLKDLW------LDGNQLADLPPEIGHLKNLLCLDLSENKLER 234



>gb:AY623659_1341386 Schistosoma mansoni Sm50 protein mRNA, complete
           cds.
          Length = 466

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 49/167 (29%), Positives = 78/167 (46%), Gaps = 2/167 (1%)
 Frame = -2

Query: 854 LYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGL 675
           LY+  N  +KIE +E +  L+ L L  N L  ++ L     L+ L+L +N I  I     
Sbjct: 148 LYLHYNGFSKIENLEEYTNLKCLFLEVNGLLKIDGLHNQIELRSLYLSKNLIHKI----- 202

Query: 674 KCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAI 495
                           + LE    L+ L +S+N I+K+E L  L N   L +S NKLT I
Sbjct: 203 ----------------ENLEHMKYLDTLDVSYNMIQKIENLDLLPNFTKLIISHNKLTEI 246

Query: 494 SNIANLTKLEDLWLNDNNISSVED--IAEAVAGSLQKLTTLYLERNP 360
           +++ +L +   L + D   + ++D  + E V   +  L  LY + NP
Sbjct: 247 NDLIHLIQCSKLSVLDIQYNFIKDSNVVEEVFAKIPNLRVLYNQGNP 293



 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 47/163 (28%), Positives = 73/163 (44%)
 Frame = -2

Query: 791 ILELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEE 612
           IL L  N    +ENL+  TNL+ L+L                     + N L  + GL  
Sbjct: 147 ILYLHYNGFSKIENLEEYTNLKCLFL---------------------EVNGLLKIDGLHN 185

Query: 611 CVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISS 432
            + L  LYLS N I K+E L  +  L  LDVS N +  I N+  L     L ++ N ++ 
Sbjct: 186 QIELRSLYLSKNLIHKIENLEHMKYLDTLDVSYNMIQKIENLDLLPNFTKLIISHNKLTE 245

Query: 431 VEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQ 303
           + D+   +  S  KL+ L ++ N   +S N +  +    PN++
Sbjct: 246 INDLIHLIQCS--KLSVLDIQYNFIKDS-NVVEEVFAKIPNLR 285



 Score = 52.8 bits (125), Expect = 2e-05
 Identities = 40/135 (29%), Positives = 66/135 (48%), Gaps = 1/135 (0%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN- 687
           L+ LY+S N I KIE +EH   L  L++  N ++ +ENL  L N  +L +  N++  IN 
Sbjct: 189 LRSLYLSKNLIHKIENLEHMKYLDTLDVSYNMIQKIENLDLLPNFTKLIISHNKLTEIND 248

Query: 686 LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANK 507
           L  L    K+S+   +   +K   +   +EE++     I  +  L    N  + +V   +
Sbjct: 249 LIHLIQCSKLSVLDIQYNFIK---DSNVVEEVFAK---IPNLRVLYNQGNPFIREVKNYR 302

Query: 506 LTAISNIANLTKLED 462
              I+   NLT L+D
Sbjct: 303 KNIINQCKNLTYLDD 317



>gb:AK082721_1173637 Mus musculus 0 day neonate cerebellum cDNA,
           RIKEN full-length enriched library, clone:C230096L03
           product:SIMILAR TO SCRIBBLED (LANO ADAPTOR PROTEIN)
           (LEUCINE-RICH REPEATS PROTEIN) homolog [Homo sapiens],
           full insert sequence.
          Length = 443

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 57/172 (33%), Positives = 89/172 (51%), Gaps = 7/172 (4%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKIEE-IEHFHELQILELGSNKL 765
           K LL  DVS N +   P  +S ++S L  L +S N +  I E I    +L IL+L  N+L
Sbjct: 139 KNLLCLDVSENRLERLPEEISGLTS-LTYLVISQNLLETIPEGIGKLKKLSILKLDQNRL 197

Query: 764 -RVMENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALE 597
            ++ E +    NL EL L  NR+  +  ++  LK +  ++   N+L S+ K +  C +L 
Sbjct: 198 TQLPEAIGDCENLTELVLTENRLLTLPKSIGKLKKLSNLNADRNKLVSLPKEIGGCCSLT 257

Query: 596 ELYLSHNGIEKMEG-LSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDN 444
              +  N + ++   +S  V L VLDV+ NKL  +       KL+ LWL+DN
Sbjct: 258 MFCIRDNRLTRLPAEVSQAVELHVLDVAGNKLHHLPLSLTTLKLKALWLSDN 309



 Score = 53.5 bits (127), Expect = 9e-06
 Identities = 58/209 (27%), Positives = 104/209 (49%), Gaps = 9/209 (4%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILE-LGSNKLRV 759
           +L+  DVS N+I            L+    S + + ++ E   F ELQ L  L  N + +
Sbjct: 2   QLVELDVSRNDIPEIPESIAFCKALQVADFSGDPLTRLPE--SFPELQNLTCLSVNDISL 59

Query: 758 M---ENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALE 597
               EN+  L NL  L L  N +  +  +L  L+ ++++ + +N + ++ + +   + L+
Sbjct: 60  QSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLK 119

Query: 596 ELYLSHNGIEKM-EGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSVED 423
           +L+L  N + ++ + +  L NL  LDVS N+L  +   I+ LT L  L ++ N    +E 
Sbjct: 120 DLWLDGNQLSELPQEIGNLKNLLCLDVSENRLERLPEEISGLTSLTYLVISQN---LLET 176

Query: 422 IAEAVAGSLQKLTTLYLERNPCANSPNYI 336
           I E + G L+KL+ L L++N     P  I
Sbjct: 177 IPEGI-GKLKKLSILKLDQNRLTQLPEAI 204



 Score = 29.3 bits (64), Expect(2) = 4.3
 Identities = 20/80 (25%), Positives = 37/80 (46%), Gaps = 1/80 (1%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIE-EIEHFHELQILELGSNKLR 762
           KKL   +   N++ S         +L    + +N++ ++  E+    EL +L++  NKL 
Sbjct: 231 KKLSNLNADRNKLVSLPKEIGGCCSLTMFCIRDNRLTRLPAEVSQAVELHVLDVAGNKLH 290

Query: 761 VMENLQTLTNLQELWLGRNR 702
            +    T   L+ LWL  N+
Sbjct: 291 HLPLSLTTLKLKALWLSDNQ 310



 Score = 24.3 bits (51), Expect(2) = 4.3
 Identities = 18/57 (31%), Positives = 29/57 (50%)
 Frame = -3

Query: 1123 NRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP 953
            NRL  L   IS L++L    + QNL+ +   E +     + +L  L L  N+L ++P
Sbjct: 149  NRLERLPEEISGLTSLTYLVISQNLL-ETIPEGIGK---LKKLSILKLDQNRLTQLP 201



>gb:AE017328_444234 Listeria monocytogenes str. 4b F2365, section 7
           of 10 of the complete genome.>gb:AE017262_1076590
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 297

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 42/145 (28%), Positives = 77/145 (53%), Gaps = 1/145 (0%)
 Frame = -2

Query: 776 SNKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVAL 600
           ++ ++ +  +Q  TNL+EL L  N+I  ++ L  L  ++++S+  NRL ++ G+     L
Sbjct: 84  NSNIKSLAGMQFFTNLKELHLSHNQISDLSPLKDLTKLEELSVNRNRLKNLNGIPSA-CL 142

Query: 599 EELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
             L++ +N +   + L  L NL +L +  NKL +I  +  L+KLE L L+ N I++   +
Sbjct: 143 SRLFVDNNELRDTDSLIHLKNLEILSIRNNKLKSIVMLGFLSKLEVLDLHGNEITNTGGL 202

Query: 419 AEAVAGSLQKLTTLYLERNPCANSP 345
                  L+K+  + L    C N P
Sbjct: 203 TR-----LKKVNWIDLTGQKCVNEP 222



 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 41/158 (25%), Positives = 75/158 (47%)
 Frame = -2

Query: 923 FDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQ 744
           F+   + I S +G+ +  + LKEL++S+NQI+ +                        L+
Sbjct: 80  FNGDNSNIKSLAGM-QFFTNLKELHLSHNQISDLSP----------------------LK 116

Query: 743 TLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEK 564
            LT L+EL + RNR++ +N     C+ ++ + +N L     L     LE L + +N ++ 
Sbjct: 117 DLTKLEELSVNRNRLKNLNGIPSACLSRLFVDNNELRDTDSLIHLKNLEILSIRNNKLKS 176

Query: 563 MEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLN 450
           +  L  L  L VLD+  N++T    +  L K+   W++
Sbjct: 177 IVMLGFLSKLEVLDLHGNEITNTGGLTRLKKVN--WID 212



 Score = 46.6 bits (109), Expect = 0.001
 Identities = 38/120 (31%), Positives = 64/120 (53%), Gaps = 1/120 (0%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KL    V+ N + + +G+   S+ L  L+V NN++   + + H   L+IL + +NKL+ +
Sbjct: 120 KLEELSVNRNRLKNLNGIP--SACLSRLFVDNNELRDTDSLIHLKNLEILSIRNNKLKSI 177

Query: 755 ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALE-ELYLSH 579
             L  L+ L+ L L  N I   N  GL  +KK++     LT  K + E V  + ELY+++
Sbjct: 178 VMLGFLSKLEVLDLHGNEI--TNTGGLTRLKKVNWID--LTGQKCVNEPVRYQPELYITN 233



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 27/115 (23%), Positives = 59/115 (51%)
 Frame = -2

Query: 680 GLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLT 501
           GL    K ++    +T +   +E   ++     ++ I+ + G+    NL+ L +S N+++
Sbjct: 51  GLANAVKQNLGKQSVTDLVSQKELSGVQNFNGDNSNIKSLAGMQFFTNLKELHLSHNQIS 110

Query: 500 AISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYI 336
            +S + +LTKLE+L +N N + ++  I  A       L+ L+++ N   ++ + I
Sbjct: 111 DLSPLKDLTKLEELSVNRNRLKNLNGIPSAC------LSRLFVDNNELRDTDSLI 159



>pir|T41119|T41119 internalin- related, Leucine rich repeat containing
            protein - fission yeast (Schizosaccharomyces
            pombe)>gb:SPCC1739_1721049 S.pombe chromosome III cosmid
            c1739.
          Length = 1045

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 73/281 (25%), Positives = 123/281 (43%), Gaps = 31/281 (11%)
 Frame = -2

Query: 1100 PYFPPLQSQQILSSPEPHYRRRARASFVVAHHFPTRGTSAQG*SAEENSGVSIFKKLLVF 921
            P+  PL+ Q +  S  P +  R  +      + P   +S    S +  S   +F      
Sbjct: 502  PHSFPLRKQNVAQSEFPKHSLRDNSE-----NAPQILSSFHDLSLQNESFDEMFNGRYEN 556

Query: 920  DVSFNEITSPSGL-SKVSSTLKELYVSNNQ-----IAKIEEIEHFHELQI-LELGSNKLR 762
                  I+S SGL SK     +  +  + Q     ++ +E  E F +  I L++    L 
Sbjct: 557  GSPIPFISSGSGLKSKADKDAEYSFSVSRQSIIQILSDVEPYEPFWKRIIQLDISRRHLD 616

Query: 761  VMENLQTLT-NLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL 585
             +  L  L  +++EL L  N I  +  C +  I+ ++   NRL+S+      + L+ L +
Sbjct: 617  SLIGLSELCPSIEELTLEGNEIAYLTGCPVT-IRDLNAVENRLSSLTSFSNLLNLQYLDI 675

Query: 584  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNI-----------------------ANLT 474
            S+N +E + GLS+L++LR L V +N L ++  I                       +NL 
Sbjct: 676  SYNQLEDLTGLSSLIHLRELKVDSNHLWSLDGIQHLDGLLKLSACNNRIKELSFTNSNLH 735

Query: 473  KLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCAN 351
            +LE+L L +N I  +E+I+     SLQ L  L L+ N   N
Sbjct: 736  RLEELLLGNNEIEEIEEIS-----SLQNLMVLQLDNNKLTN 771



 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 58/245 (23%), Positives = 104/245 (42%), Gaps = 47/245 (19%)
 Frame = -2

Query: 953  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS 774
            G+     LL      N I   S  +     L+EL + NN+I +IEEI     L +L+L +
Sbjct: 707  GIQHLDGLLKLSACNNRIKELSFTNSNLHRLEELLLGNNEIEEIEEISSLQNLMVLQLDN 766

Query: 773  NKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRL-------------- 636
            NKL  ++  Q + +L+ L +  N I  + +     ++ + +  NR               
Sbjct: 767  NKLTNLKASQPMIHLRILRISNNAIHQLEVDQFPHLRTLYMDLNRFNRPPDIRRLKRLVN 826

Query: 635  ---------TSMKGLEECVALEELYLSHN------------GIEKME------------G 555
                      S   ++  + +  LYLS+N            G+  +E             
Sbjct: 827  FSFRTQDPEASNFVIQPSLDIRNLYLSNNTFVTLDCKHMFLGVRYLELANVQLKEVPKYI 886

Query: 554  LSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLY 375
             +++ NLRVLD+S N ++ I ++  L  +  L+L  N I  + ++ + +A +L++L  L 
Sbjct: 887  ATSMPNLRVLDLSHNYISDIESLKPLQMIHRLYLVGNRIKKMRNLCDILA-NLKQLNVLD 945

Query: 374  LERNP 360
            L  NP
Sbjct: 946  LRMNP 950



>gb:BC050692_1984486 Homo sapiens erbb2 interacting protein, mRNA
           (cDNA clone IMAGE:6163747), partial cds.
          Length = 633

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 52/199 (26%), Positives = 99/199 (49%), Gaps = 7/199 (3%)
 Frame = -2

Query: 893 PSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKLRVM-ENLQTLTNLQEL 720
           P  +     TL+ELY+  NQI ++ +++ +   L  L L  N L  +  ++  L NL+EL
Sbjct: 38  PKEIFTFEKTLEELYLDANQIEELPKQLFNCQSLHKLSLPDNDLTTLPASIANLINLREL 97

Query: 719 WLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALEELYLSHNGIEKM-EGL 552
            + +N I+    N+   K +  +    N ++ +  G  + + L +LYL+   +E +    
Sbjct: 98  DVSKNGIQEFPENIKNCKVLTIVEASVNPISKLPDGFSQLLNLTQLYLNDAFLEFLPANF 157

Query: 551 STLVNLRVLDVSANKLTAISNIAN-LTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLY 375
             L  L++L++  N+L  +    N LT+LE L L  N  + V ++ E ++G    L   +
Sbjct: 158 GRLTKLQILELRENQLKMLPKTMNRLTQLERLDLGSNEFTEVPEVLEQLSG----LKEFW 213

Query: 374 LERNPCANSPNYISTLRQI 318
           ++ N     P +I +L+Q+
Sbjct: 214 MDANRLTFIPGFIGSLKQL 232



 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 51/189 (26%), Positives = 97/189 (51%), Gaps = 7/189 (3%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEE-IEHFHELQILELGSNKL-RVMENLQTLTNLQELWLGRNRIRAI 690
           L+ L +  NQ+  + + +    +L+ L+LGSN+   V E L+ L+ L+E W+  NR+  I
Sbjct: 163 LQILELRENQLKMLPKTMNRLTQLERLDLGSNEFTEVPEVLEQLSGLKEFWMDANRLTFI 222

Query: 689 N--LCGLKCIKKISIQSNRLTSM-KGLEECVALEELYLSHNGIEKM-EGLSTLVNLRVLD 522
              +  LK +  + +  N +  + +G+  C  L++L LS N ++++ E + +L N+  L 
Sbjct: 223 PGFIGSLKQLTYLDVSKNNIEMVEEGISTCENLQDLLLSSNSLQQLPETIGSLKNITTLK 282

Query: 521 VSANKLTAI-SNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSP 345
           +  N+L  +  +I  L  +E+L   D + + VE +  ++ G L  L T   + N     P
Sbjct: 283 IDENQLMYLPDSIGGLISVEEL---DCSFNEVEALPSSI-GQLTNLRTFAADHNYLQQLP 338

Query: 344 NYISTLRQI 318
             I + + I
Sbjct: 339 PEIGSWKNI 347



>gb:AF276423_1894367 Homo sapiens densin-180-like protein mRNA,
           complete cds.
          Length = 1412

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 52/199 (26%), Positives = 99/199 (49%), Gaps = 7/199 (3%)
 Frame = -2

Query: 893 PSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKLRVM-ENLQTLTNLQEL 720
           P  +     TL+ELY+  NQI ++ +++ +   L  L L  N L  +  ++  L NL+EL
Sbjct: 38  PKEIFTFEKTLEELYLDANQIEELPKQLFNCQSLHKLSLPDNDLTTLPASIANLINLREL 97

Query: 719 WLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALEELYLSHNGIEKM-EGL 552
            + +N I+    N+   K +  +    N ++ +  G  + + L +LYL+   +E +    
Sbjct: 98  DVSKNGIQEFPENIKNCKVLTIVEASVNPISKLPDGFSQLLNLTQLYLNDAFLEFLPANF 157

Query: 551 STLVNLRVLDVSANKLTAISNIAN-LTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLY 375
             L  L++L++  N+L  +    N LT+LE L L  N  + V ++ E ++G    L   +
Sbjct: 158 GRLTKLQILELRENQLKMLPKTMNRLTQLERLDLGSNEFTEVPEVLEQLSG----LKEFW 213

Query: 374 LERNPCANSPNYISTLRQI 318
           ++ N     P +I +L+Q+
Sbjct: 214 MDANRLTFIPGFIGSLKQL 232



 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 51/189 (26%), Positives = 97/189 (51%), Gaps = 7/189 (3%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEE-IEHFHELQILELGSNKL-RVMENLQTLTNLQELWLGRNRIRAI 690
           L+ L +  NQ+  + + +    +L+ L+LGSN+   V E L+ L+ L+E W+  NR+  I
Sbjct: 163 LQILELRENQLKMLPKTMNRLTQLERLDLGSNEFTEVPEVLEQLSGLKEFWMDANRLTFI 222

Query: 689 N--LCGLKCIKKISIQSNRLTSM-KGLEECVALEELYLSHNGIEKM-EGLSTLVNLRVLD 522
              +  LK +  + +  N +  + +G+  C  L++L LS N ++++ E + +L N+  L 
Sbjct: 223 PGFIGSLKQLTYLDVSKNNIEMVEEGISTCENLQDLLLSSNSLQQLPETIGSLKNITTLK 282

Query: 521 VSANKLTAI-SNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSP 345
           +  N+L  +  +I  L  +E+L   D + + VE +  ++ G L  L T   + N     P
Sbjct: 283 IDENQLMYLPDSIGGLISVEEL---DCSFNEVEALPSSI-GQLTNLRTFAADHNYLQQLP 338

Query: 344 NYISTLRQI 318
             I + + I
Sbjct: 339 PEIGSWKNI 347



>gb:AX277638_1465109 Sequence 1 from Patent
           WO0177323.>gb:AB033051_1866231 Homo sapiens mRNA for
           KIAA1225 protein, partial cds.>gb:AF263744_1893726 Homo
           sapiens erbb2-interacting protein ERBIN mRNA, complete
           cds.
          Length = 1371

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 52/199 (26%), Positives = 99/199 (49%), Gaps = 7/199 (3%)
 Frame = -2

Query: 893 PSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKLRVM-ENLQTLTNLQEL 720
           P  +     TL+ELY+  NQI ++ +++ +   L  L L  N L  +  ++  L NL+EL
Sbjct: 38  PKEIFTFEKTLEELYLDANQIEELPKQLFNCQSLHKLSLPDNDLTTLPASIANLINLREL 97

Query: 719 WLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALEELYLSHNGIEKM-EGL 552
            + +N I+    N+   K +  +    N ++ +  G  + + L +LYL+   +E +    
Sbjct: 98  DVSKNGIQEFPENIKNCKVLTIVEASVNPISKLPDGFSQLLNLTQLYLNDAFLEFLPANF 157

Query: 551 STLVNLRVLDVSANKLTAISNIAN-LTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLY 375
             L  L++L++  N+L  +    N LT+LE L L  N  + V ++ E ++G    L   +
Sbjct: 158 GRLTKLQILELRENQLKMLPKTMNRLTQLERLDLGSNEFTEVPEVLEQLSG----LKEFW 213

Query: 374 LERNPCANSPNYISTLRQI 318
           ++ N     P +I +L+Q+
Sbjct: 214 MDANRLTFIPGFIGSLKQL 232



 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 51/189 (26%), Positives = 97/189 (51%), Gaps = 7/189 (3%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEE-IEHFHELQILELGSNKL-RVMENLQTLTNLQELWLGRNRIRAI 690
           L+ L +  NQ+  + + +    +L+ L+LGSN+   V E L+ L+ L+E W+  NR+  I
Sbjct: 163 LQILELRENQLKMLPKTMNRLTQLERLDLGSNEFTEVPEVLEQLSGLKEFWMDANRLTFI 222

Query: 689 N--LCGLKCIKKISIQSNRLTSM-KGLEECVALEELYLSHNGIEKM-EGLSTLVNLRVLD 522
              +  LK +  + +  N +  + +G+  C  L++L LS N ++++ E + +L N+  L 
Sbjct: 223 PGFIGSLKQLTYLDVSKNNIEMVEEGISTCENLQDLLLSSNSLQQLPETIGSLKNITTLK 282

Query: 521 VSANKLTAI-SNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSP 345
           +  N+L  +  +I  L  +E+L   D + + VE +  ++ G L  L T   + N     P
Sbjct: 283 IDENQLMYLPDSIGGLISVEEL---DCSFNEVEALPSSI-GQLTNLRTFAADHNYLQQLP 338

Query: 344 NYISTLRQI 318
             I + + I
Sbjct: 339 PEIGSWKNI 347



>gb:AE013599_1130840 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003833_1226814 Drosophila melanogaster
           chromosome 2R, section 17 of 74 of the complete
           sequence.
          Length = 188

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 45/129 (34%), Positives = 72/129 (55%), Gaps = 5/129 (3%)
 Frame = -2

Query: 749 LQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECV-ALEELYLSHN 576
           L TL   + + +  N I  I  L G+KC+K +S+  N +  + GLE     LEEL+LS+N
Sbjct: 44  LGTLVQCERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYN 103

Query: 575 GIEKMEGLSTLVNLRVLDVSANKL---TAISNIANLTKLEDLWLNDNNISSVEDIAEAVA 405
            IEK++GL+ L  L+VL +S N +   +  + +A +  LEDL +  N +S   D     A
Sbjct: 104 LIEKIKGLTGLKCLKVLYISNNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRA 163

Query: 404 GSLQKLTTL 378
             +++L T+
Sbjct: 164 ECIKRLPTI 172



>pir|AH1216|AH1216 internalin, probable peptidoglycan bound protein
            (LPXTG motif) homolog lmo1136 [imported] - Listeria
            monocytogenes  (strain EGD-e)>gb:AL591978_535627 Listeria
            monocytogenes strain EGD, complete genome, segment 6/12.
          Length = 539

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 54/230 (23%), Positives = 106/230 (46%), Gaps = 4/230 (1%)
 Frame = -2

Query: 1019 VVAHHFPTRGTSAQG*SAEENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSN 840
            + A HF ++G  +         GV   K L       N+++    LS ++  L+ + +  
Sbjct: 78   IKALHFDSKGVQSL-------EGVEYLKNLTQVFGYGNQVSDLGPLSNLTK-LEVIQMPR 129

Query: 839  NQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLC-GLKCIK 663
            NQI+ +  I +   L  L+   N L+ +E ++ LTN+ EL +  N I  IN    +  ++
Sbjct: 130  NQISDLTPIANLTALMSLDFEFNNLQTIEPIKNLTNMLELNVSANPISDINAVKNMTQLE 189

Query: 662  KISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIA 483
             ++++   ++ +  +E    +   +   N I  +  L  +  L  L +  N++  +S I 
Sbjct: 190  FLTLRDCEVSDLSPVENLSNMLMFWAGRNNISDITPLKNMSKLLGLSLFGNQIKDVSVIK 249

Query: 482  NLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLY---LERNPCANSPN 342
            NLT LED  +  N +S +  +A +   +L+ LT  +   ++ +P  N  N
Sbjct: 250  NLTSLEDFDIKANQVSDISSLATST--TLETLTLSFNQIIDISPLKNLTN 297



 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 38/164 (23%), Positives = 85/164 (51%), Gaps = 1/164 (0%)
 Frame = -2

Query: 908 NEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNL 729
           NEI +   L++V +   +L  + + + + +     + ++ L   S  ++ +E ++ L NL
Sbjct: 45  NEIFTDPKLAQVVADWLKLPAATSSVTQTQ----LNTIKALHFDSKGVQSLEGVEYLKNL 100

Query: 728 QELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGL 552
            +++   N++  +  L  L  ++ I +  N+++ +  +    AL  L    N ++ +E +
Sbjct: 101 TQVFGYGNQVSDLGPLSNLTKLEVIQMPRNQISDLTPIANLTALMSLDFEFNNLQTIEPI 160

Query: 551 STLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
             L N+  L+VSAN ++ I+ + N+T+LE L L D  +S +  +
Sbjct: 161 KNLTNMLELNVSANPISDINAVKNMTQLEFLTLRDCEVSDLSPV 204



 Score = 33.5 bits (75), Expect = 10.0
 Identities = 25/83 (30%), Positives = 44/83 (53%)
 Frame = -2

Query: 935 KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
           KLL   +  N+I   S +  ++S L++  +  NQ++ I  +     L+ L L  N++  +
Sbjct: 231 KLLGLSLFGNQIKDVSVIKNLTS-LEDFDIKANQVSDISSLATSTTLETLTLSFNQIIDI 289

Query: 755 ENLQTLTNLQELWLGRNRIRAIN 687
             L+ LTNL  L L  N+ RA++
Sbjct: 290 SPLKNLTNLTRLEL-ENQTRALD 311



>gb:BC073124_2557027 Xenopus laevis MGC84527 protein, mRNA (cDNA
           clone MGC:84527 IMAGE:5079485), complete cds.
          Length = 605

 Score = 64.3 bits (155), Expect = 5e-09
 Identities = 56/215 (26%), Positives = 114/215 (53%), Gaps = 6/215 (2%)
 Frame = -2

Query: 950 VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGS 774
           +S+   L+V D+  N+I S     +  + L++L +S+N+I ++  E++H   L+   L  
Sbjct: 101 ISLLPALVVLDIHDNQIASLPCAIRELTNLQKLNISHNKIKQLPNELQHLQNLKSFLLQH 160

Query: 773 NKLRVM-ENLQTLTNLQELWLGRNRIRAIN--LCGLKCIKKISIQSNRLTSMKG-LEECV 606
           N+L  + +++  L+ L+EL +  N +R+++  +  L  + K ++ SN+LT++   + +  
Sbjct: 161 NQLEELPDSIGHLSILEELDVSNNCLRSVSSSVGQLTGLVKFNLSSNKLTALPTEIGKMK 220

Query: 605 ALEELYLSHNGIEKMEG-LSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV 429
            L +L  + N +E +   ++ + +L  L +  NKLT +  +  LTKL++L + +N I   
Sbjct: 221 NLRQLDCTSNLLENVPASVAGMESLEQLYLRQNKLTYLPELPFLTKLKELHVGNNQI--- 277

Query: 428 EDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLR 324
           + +      +L  L+ L L  N     P  IS L+
Sbjct: 278 QTLGPEHLQNLSSLSVLELRYNKLKVLPKEISLLK 312



 Score = 57.4 bits (137), Expect = 6e-07
 Identities = 47/162 (29%), Positives = 86/162 (53%), Gaps = 7/162 (4%)
 Frame = -2

Query: 959 NSGVSIFKKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKIE-EIEHFHELQIL 786
           +S V     L+ F++S N++T+ P+ + K+ + L++L  ++N +  +   +     L+ L
Sbjct: 190 SSSVGQLTGLVKFNLSSNKLTALPTEIGKMKN-LRQLDCTSNLLENVPASVAGMESLEQL 248

Query: 785 ELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECV 606
            L  NKL  +  L  LT L+EL +G N+I+ +    L+ +  +S+   R   +K L + +
Sbjct: 249 YLRQNKLTYLPELPFLTKLKELHVGNNQIQTLGPEHLQNLSSLSVLELRYNKLKVLPKEI 308

Query: 605 A----LEELYLSHNGIEKM-EGLSTLVNLRVLDVSANKLTAI 495
           +    LE L LS+N I  + + L +L NL+ L +  N L  I
Sbjct: 309 SLLKGLERLDLSNNDIGSLPDTLGSLPNLKSLQLDGNPLRGI 350



 Score = 34.7 bits (78), Expect = 4.5
 Identities = 20/64 (31%), Positives = 34/64 (53%)
 Frame = -3

Query: 1129 TANRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPV 950
            ++N+L+AL   I  + NL +     NL+ +      +S   +  LE+L LR N+L  +P 
Sbjct: 205  SSNKLTALPTEIGKMKNLRQLDCTSNLLENVP----ASVAGMESLEQLYLRQNKLTYLPE 260

Query: 949  LAYL 938
            L +L
Sbjct: 261  LPFL 264



>gb:AE017343_1755590 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 765

 Score = 64.3 bits (155), Expect = 5e-09
 Identities = 44/173 (25%), Positives = 87/173 (50%), Gaps = 2/173 (1%)
 Frame = -2

Query: 875 VSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIR 696
           + +T++ L+V+ N +  +  + H   LQ L++  NKL  +  L  L +L+EL +  N I 
Sbjct: 342 IPTTVRTLHVAGNLLTSLTAVNHLRNLQYLDISRNKLDSVAQLGCLIHLRELKVDDNAIC 401

Query: 695 AIN-LCGLKCIKKISIQSNRLTSMK-GLEECVALEELYLSHNGIEKMEGLSTLVNLRVLD 522
            +  +  + C+ K+S  +N+L  +     +   LE L LS+N I  ++ L  L ++  ++
Sbjct: 402 DLEGIMEMDCLIKLSCVNNKLDMLDLSAAKWSKLESLNLSNNNISIIKDLHRLSSVASIN 461

Query: 521 VSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
           +  N+L  ++    +  +  L  +DN+I+S +           K+ TLY + N
Sbjct: 462 LEGNRLCTLTPQIPMPSVRILRFSDNHIASFD------ISLFPKIRTLYADNN 508



 Score = 40.4 bits (93), Expect = 0.081
 Identities = 25/97 (25%), Positives = 50/97 (51%), Gaps = 12/97 (12%)
 Frame = -2

Query: 668 IKKISIQSNRLTSMKGLEECV------------ALEELYLSHNGIEKMEGLSTLVNLRVL 525
           +K I ++  +  S+  L+E +             +  L+++ N +  +  ++ L NL+ L
Sbjct: 312 LKMIDLRGKKADSVARLKEFLPNLDEINFGIPTTVRTLHVAGNLLTSLTAVNHLRNLQYL 371

Query: 524 DVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAE 414
           D+S NKL +++ +  L  L +L ++DN I  +E I E
Sbjct: 372 DISRNKLDSVAQLGCLIHLRELKVDDNAICDLEGIME 408



>gb:CNS07EGI_1374407 chromosome IX of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 399

 Score = 64.3 bits (155), Expect = 5e-09
 Identities = 52/183 (28%), Positives = 96/183 (52%), Gaps = 6/183 (3%)
 Frame = -2

Query: 965 EENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEE-IEHFHELQI 789
           E + G+     L   D++ N + S          +  L +S N  ++I   I     L+ 
Sbjct: 61  EIHPGIGSLVGLTWIDLTRNRLRSLPDEMANLKRVSGLGLSENNFSEIPRCIFKMTNLRK 120

Query: 788 LELGSNKLRVM-ENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSMK-G 621
               SNK+R + ++++ L NL ++ L  N I ++    C LK +  +++ +N+L  +  G
Sbjct: 121 FGFFSNKIRAIPKDIRFLINLIKIDLSNNEISSLPDEFCELKNLNWLNLSNNKLQKLPDG 180

Query: 620 LEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAIS-NIANLTKLEDLWLNDN 444
           +   V LEEL L  N + ++  +S+L  LR+L V  N+LT+++ +I+ L+ +E L  +DN
Sbjct: 181 INNLVQLEELGLGANCLTELPDMSSLKKLRILPVFKNQLTSVNQSISRLSSIEKLDFSDN 240

Query: 443 NIS 435
           NI+
Sbjct: 241 NIT 243



 Score = 41.6 bits (96), Expect = 0.037
 Identities = 25/83 (30%), Positives = 51/83 (61%), Gaps = 3/83 (3%)
 Frame = -2

Query: 668 IKKISIQSNRLTSM-KGLEECVALEELYLSHNGIEKME-GLSTLVNLRVLDVSANKLTAI 495
           I  + +  N++  + + ++E  AL  L L+ N IE++  G+ +LV L  +D++ N+L ++
Sbjct: 26  INWLILSDNKIREVPESIKELKALSRLALNDNRIEEIHPGIGSLVGLTWIDLTRNRLRSL 85

Query: 494 SN-IANLTKLEDLWLNDNNISSV 429
            + +ANL ++  L L++NN S +
Sbjct: 86  PDEMANLKRVSGLGLSENNFSEI 108



>gb:AK047468_1168113 Mus musculus 10 days neonate cerebellum cDNA,
           RIKEN full-length enriched library, clone:B930067N07
           product:hypothetical Leucine-rich repeat
           cysteine-containing subfamily/Leucine-rich repeat
           containing protein, full insert sequence.
          Length = 212

 Score = 64.3 bits (155), Expect = 5e-09
 Identities = 36/97 (37%), Positives = 60/97 (61%)
 Frame = -2

Query: 710 RNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLR 531
           +N +R  NL   + +KK+ + +N +  ++GL   + L  L LS N IE +EGL TLVNL 
Sbjct: 53  QNILRIDNLWQFENLKKLQLNNNIIERIEGLTNLIHLVWLDLSFNNIEAIEGLDTLVNLE 112

Query: 530 VLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
            L +S N+++ + ++  L KL+ L L +N IS++ +I
Sbjct: 113 DLSLSNNRISKVDSLDALVKLQVLSLGNNQISNMMNI 149



 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 38/113 (33%), Positives = 62/113 (54%)
 Frame = -2

Query: 674 KCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAI 495
           K +  + +    +  +  L +   L++L L++N IE++EGL+ L++L  LD+S N + AI
Sbjct: 43  KDVLSLQLDFQNILRIDNLWQFENLKKLQLNNNIIERIEGLTNLIHLVWLDLSFNNIEAI 102

Query: 494 SNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYI 336
             +  L  LEDL L++N IS V+ +      +L KL  L L  N  +N  N I
Sbjct: 103 EGLDTLVNLEDLSLSNNRISKVDSL-----DALVKLQVLSLGNNQISNMMNII 150



 Score = 54.3 bits (129), Expect = 5e-06
 Identities = 34/110 (30%), Positives = 62/110 (56%), Gaps = 1/110 (0%)
 Frame = -2

Query: 944 IFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKL 765
           +FK +L   + F  I     L +  + LK+L ++NN I +IE + +   L  L+L  N +
Sbjct: 41  LFKDVLSLQLDFQNILRIDNLWQFEN-LKKLQLNNNIIERIEGLTNLIHLVWLDLSFNNI 99

Query: 764 RVMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGL 618
             +E L TL NL++L L  NRI  + +L  L  ++ +S+ +N++++M  +
Sbjct: 100 EAIEGLDTLVNLEDLSLSNNRISKVDSLDALVKLQVLSLGNNQISNMMNI 149



>gb:AE014296_1136355 Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE003531_1214324 Drosophila melanogaster
            chromosome 3L, section 54 of 83 of the complete
            sequence.>gb:AF204158_1250813 Drosophila melanogaster
            cell surface receptor TOLLO (Tollo) gene, complete
            cds.>gb:AF247764_1255258 Drosophila melanogaster Toll-8
            mRNA, complete cds.>gb:AY118551_1300273 Drosophila
            melanogaster LD33590 full insert cDNA.
          Length = 1346

 Score = 64.3 bits (155), Expect = 5e-09
 Identities = 69/280 (24%), Positives = 119/280 (42%), Gaps = 57/280 (20%)
 Frame = -2

Query: 1094 FPPLQSQQILSSPEPHYRRRARASFVVAHHFPTRGTSAQG*SAEENSGVSIFKKLLVFDV 915
            F PL S QIL   + +  +     F    +  T   S    S  E   +   K LLV  +
Sbjct: 352  FRPLASLQILKLEDNYIDQLPGGIFADLTNLHTLILSRNRISVIEQRTLQGLKNLLVLSL 411

Query: 914  SFNEITSPSGLSKVS-STLKELYVSNNQIAKIEE-IEHFHELQILELGSNKLRVMEN--- 750
             FN I+     S V+ S L++L++++N++  + E + H   L+ L++G N +  +EN   
Sbjct: 412  DFNRISRMDQRSLVNCSQLQDLHLNDNKLQAVPEALAHVQLLKTLDVGENMISQIENTSI 471

Query: 749  -----------------------LQTLTNLQELWLGRNRIRAINLCGLKC---IKKISIQ 648
                                      +++LQ L L +N++++I    L+    ++ I + 
Sbjct: 472  TQLESLYGLRMTENSLTHIRRGVFDRMSSLQILNLSQNKLKSIEAGSLQRNSQLQAIRLD 531

Query: 647  SNRLTSMKGL-EECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANL-- 477
             N+L S+ GL  E   L  L +S N +EK +     + L+ LDV AN++T + N   +  
Sbjct: 532  GNQLKSIAGLFTELPNLVWLNISGNRLEKFDYSHIPIGLQWLDVRANRITQLGNYFEIES 591

Query: 476  -----------------------TKLEDLWLNDNNISSVE 426
                                     +E L+LNDN IS ++
Sbjct: 592  ELSLSTFDASYNLLTEITASSIPNSVEVLYLNDNQISKIQ 631



 Score = 60.8 bits (146), Expect = 6e-08
 Identities = 66/232 (28%), Positives = 109/232 (46%), Gaps = 16/232 (6%)
 Frame = -2

Query: 932 LLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKIEE--IEHFHELQILELGSNKLR 762
           L V D+S N +TS P  L   +  L+E+Y+ NN I  +         EL +L+L SN+L 
Sbjct: 260 LRVVDLSANRLTSLPPELFAETKQLQEIYLRNNSINVLAPGIFGELAELLVLDLASNELN 319

Query: 761 VME-NLQTLTNLQELW---LGRNRIRAIN---LCGLKCIKKISIQSNRLTSMKG--LEEC 609
               N  T   L+ L    L  N+I  +       L  ++ + ++ N +  + G    + 
Sbjct: 320 SQWINAATFVGLKRLMMLDLSANKISRLEAHIFRPLASLQILKLEDNYIDQLPGGIFADL 379

Query: 608 VALEELYLSHNGIEKMEG--LSTLVNLRVLDVSANKLTAIS--NIANLTKLEDLWLNDNN 441
             L  L LS N I  +E   L  L NL VL +  N+++ +   ++ N ++L+DL LNDN 
Sbjct: 380 TNLHTLILSRNRISVIEQRTLQGLKNLLVLSLDFNRISRMDQRSLVNCSQLQDLHLNDNK 439

Query: 440 ISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSEL 285
           + +V    EA+A  +Q L TL +  N  +   N   T  +    ++  ++ L
Sbjct: 440 LQAV---PEALA-HVQLLKTLDVGENMISQIENTSITQLESLYGLRMTENSL 487



 Score = 47.4 bits (111), Expect = 7e-04
 Identities = 54/196 (27%), Positives = 92/196 (46%), Gaps = 3/196 (1%)
 Frame = -2

Query: 941 FKKLLVFDVSFNEI-TSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKL 765
           F++L   D+S N I   P G+     +L+ L  S N   KI++I +F+      L S K 
Sbjct: 151 FRQLERLDLSLNNIWLIPDGMVCPLKSLQHLNASYN---KIQDISNFYFSA--SLSSRKA 205

Query: 764 RVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL 585
           RV  +      LQ L L  N++ ++    L  + +++  +    SM  L +         
Sbjct: 206 RVCGS-----TLQSLDLSANKMVSLPTAMLSALGRLTHLNMAKNSMSFLAD--------- 251

Query: 584 SHNGIEKMEGLSTLVNLRVLDVSANKLTAI--SNIANLTKLEDLWLNDNNISSVEDIAEA 411
                   EGL   ++LRV+D+SAN+LT++     A   +L++++L +N   S+  +A  
Sbjct: 252 -----RAFEGL---LSLRVVDLSANRLTSLPPELFAETKQLQEIYLRNN---SINVLAPG 300

Query: 410 VAGSLQKLTTLYLERN 363
           + G L +L  L L  N
Sbjct: 301 IFGELAELLVLDLASN 316



 Score = 38.1 bits (87), Expect = 0.40
 Identities = 30/116 (25%), Positives = 60/116 (51%), Gaps = 9/116 (7%)
 Frame = -2

Query: 932 LLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHE--LQILELGSNKLRV 759
           L  FD S+N +T  +  S + ++++ LY+++NQI+KI+    F +  L  ++L  N+L  
Sbjct: 595 LSTFDASYNLLTEITA-SSIPNSVEVLYLNDNQISKIQPYTFFKKPNLTRVDLVRNRLTT 653

Query: 758 ME-NLQTLT------NLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEE 612
           +E N   L+       + E ++G N       C L  ++K++ +S     +  L++
Sbjct: 654 LEPNALRLSPIAEDREIPEFYIGHNAYECD--CNLDWLQKVNRESRTQPQLMDLDQ 707



 Score = 37.7 bits (86), Expect = 0.53
 Identities = 31/108 (28%), Positives = 57/108 (52%), Gaps = 9/108 (8%)
 Frame = -2

Query: 788  LELGSNKLRVMENLQTL--TNLQELWLGRNRIRAIN---LCGLKCIKKISIQSNRLTSMK 624
            L L  N  R +++   +    L+ L L  +RI  ++     GL  ++ + +QSN+L ++ 
Sbjct: 796  LYLDGNNFRELQSHAFIGRKRLKVLHLNHSRIEVLHNRTFYGLLELEVLQLQSNQLKALN 855

Query: 623  GLE--ECVALEELYLSHNGIEKMEGL--STLVNLRVLDVSANKLTAIS 492
            G E      L+ELYL HN I  ++ L  + L +L++L +  N +T+ +
Sbjct: 856  GNEFQGLDNLQELYLQHNAIATIDTLTFTHLYHLKILRLDHNAITSFA 903



>gb:AF332199_1897064 Homo sapiens leucine-rich repeats protein mRNA,
           complete cds.>gb:AF359380_1898890 Homo sapiens LANO
           adaptor protein (LANO) mRNA, complete
           cds.>gb:AL513211_1928758 Human DNA sequence from clone
           RP13-476E20 on chromosome 6 Contains a novel gene, the
           5' end of the LRRC1 gene for leucine rich repeat
           containing 1 and a CpG island, complete
           sequence.>gb:BC003193_1968767 Homo sapiens leucine rich
           repeat containing 1, mRNA (cDNA clone MGC:936
           IMAGE:3504090), complete cds.>gb:HS523E19_1998980 Human
           DNA sequence from clone RP3-523E19 on chromosome
           6p11.2-12.3 Contains the 3' end of the LRRC1 gene for
           leucine rich repeat containing 1, a novel gene and the
           5' end of a novel gene, complete sequence.
          Length = 524

 Score = 61.6 bits (148), Expect(2) = 6e-09
 Identities = 58/214 (27%), Positives = 107/214 (50%), Gaps = 9/214 (4%)
 Frame = -2

Query: 950 VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILE-LGS 774
           ++ F +L+  DVS NEI            L+    S N + ++ E   F ELQ L  L  
Sbjct: 78  IANFMQLVELDVSRNEIPEIPESISFCKALQVADFSGNPLTRLPE--SFPELQNLTCLSV 135

Query: 773 NKLRVM---ENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEE 612
           N + +    EN+  L NL  L L  N +  +  +L  L+ ++++ + +N + ++ + +  
Sbjct: 136 NDISLQSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGA 195

Query: 611 CVALEELYLSHNGIEKM-EGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNI 438
            + L++L+L  N + ++ + +  L NL  LDVS N+L  +   I+ LT L DL ++ N +
Sbjct: 196 LLHLKDLWLDGNQLSELPQEIGNLKNLLCLDVSENRLERLPEEISGLTSLTDLVISQNLL 255

Query: 437 SSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYI 336
            ++ D      G L+KL+ L +++N     P  +
Sbjct: 256 ETIPD----GIGKLKKLSILKVDQNRLTQLPEAV 285



 Score = 57.4 bits (137), Expect = 6e-07
 Identities = 51/172 (29%), Positives = 89/172 (51%), Gaps = 7/172 (4%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKIEE-IEHFHELQILELGSNKL 765
           K LL  DVS N +   P  +S ++S L +L +S N +  I + I    +L IL++  N+L
Sbjct: 220 KNLLCLDVSENRLERLPEEISGLTS-LTDLVISQNLLETIPDGIGKLKKLSILKVDQNRL 278

Query: 764 -RVMENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALE 597
            ++ E +    +L EL L  N++  +  ++  LK +  ++   N+L S+ K +  C +L 
Sbjct: 279 TQLPEAVGECESLTELVLTENQLLTLPKSIGKLKKLSNLNADRNKLVSLPKEIGGCCSLT 338

Query: 596 ELYLSHNGIEKMEG-LSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDN 444
              +  N + ++   +S    L VLDV+ N+L  +       KL+ LWL+DN
Sbjct: 339 VFCVRDNRLTRIPAEVSQATELHVLDVAGNRLLHLPLSLTALKLKALWLSDN 390



 Score = 30.4 bits (67), Expect(2) = 1.5
 Identities = 39/163 (23%), Positives = 72/163 (44%), Gaps = 4/163 (2%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIE-EIEHFHELQILELGSNKLR 762
           KKL   +   N++ S         +L    V +N++ +I  E+    EL +L++  N+L 
Sbjct: 312 KKLSNLNADRNKLVSLPKEIGGCCSLTVFCVRDNRLTRIPAEVSQATELHVLDVAGNRLL 371

Query: 761 VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNR-LTSMKGLEECVALEELYL 585
            +    T   L+ LWL  N+ + +          ++ Q++   T+ + +  CV L +L  
Sbjct: 372 HLPLSLTALKLKALWLSDNQSQPL----------LTFQTDTDYTTGEKILTCVLLPQLPS 421

Query: 584 SHNGIEKMEGLSTLVNLRVLDVS--ANKLTAISNIANLTKLED 462
                E +     L NL V DVS  A    A++ ++ +  +ED
Sbjct: 422 EPTCQENLPRCGALENL-VNDVSDEAWNERAVNRVSAIRFVED 463



 Score = 24.6 bits (52), Expect(2) = 1.5
 Identities = 24/76 (31%), Positives = 34/76 (44%), Gaps = 19/76 (25%)
 Frame = -3

Query: 1123 NRLSALDPRISHLSNLNKFSLRQNLITD-----AALEPLS----SWHTISQ--------- 998
            NRL  L   IS L++L    + QNL+         L+ LS      + ++Q         
Sbjct: 230  NRLERLPEEISGLTSLTDLVISQNLLETIPDGIGKLKKLSILKVDQNRLTQLPEAVGECE 289

Query: 997  -LEELVLRDNQLKKIP 953
             L ELVL +NQL  +P
Sbjct: 290  SLTELVLTENQLLTLP 305



 Score = 22.3 bits (46), Expect(2) = 6e-09
 Identities = 9/15 (60%), Positives = 13/15 (86%)
 Frame = -3

Query: 997 LEELVLRDNQLKKIP 953
           LEEL+L  NQL+++P
Sbjct: 38  LEELLLDANQLRELP 52



>gb:BC087542_2110054 Mus musculus leucine rich repeat containing 1,
           mRNA (cDNA clone MGC:90936 IMAGE:4934980), complete cds.
          Length = 524

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 56/172 (32%), Positives = 89/172 (51%), Gaps = 7/172 (4%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKIEE-IEHFHELQILELGSNKL 765
           K LL  DVS N +   P  +S ++S L  L +S N +  I E I    +L IL+L  N+L
Sbjct: 220 KNLLCLDVSENRLERLPEEISGLTS-LTYLVISQNLLETIPEGIGKLKKLSILKLDQNRL 278

Query: 764 -RVMENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALE 597
            ++ E +    NL EL L  NR+  +  ++  LK +  ++   N+L S+ K +  C +L 
Sbjct: 279 TQLPEAIGDCENLTELVLTENRLLTLPKSIGKLKKLSNLNADRNKLVSLPKEIGGCCSLT 338

Query: 596 ELYLSHNGIEKMEG-LSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDN 444
              +  N + ++   +S  V L VLDV+ N+L  +       KL+ LWL+DN
Sbjct: 339 MFCIRDNRLTRLPAEVSQAVELHVLDVAGNRLHHLPLSLTTLKLKALWLSDN 390



 Score = 57.8 bits (138), Expect(2) = 9e-08
 Identities = 60/214 (28%), Positives = 107/214 (50%), Gaps = 9/214 (4%)
 Frame = -2

Query: 950 VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILE-LGS 774
           ++ F +L+  DVS N+I            L+    S N + ++ E   F ELQ L  L  
Sbjct: 78  IANFMQLVELDVSRNDIPEIPESIAFCKALQVADFSGNPLTRLPE--SFPELQNLTCLSV 135

Query: 773 NKLRVM---ENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEE 612
           N + +    EN+  L NL  L L  N +  +  +L  L+ ++++ + +N + ++ + +  
Sbjct: 136 NDISLQSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGA 195

Query: 611 CVALEELYLSHNGIEKM-EGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNI 438
            + L++L+L  N + ++ + +  L NL  LDVS N+L  +   I+ LT L  L ++ N  
Sbjct: 196 LLHLKDLWLDGNQLSELPQEIGNLKNLLCLDVSENRLERLPEEISGLTSLTYLVISQN-- 253

Query: 437 SSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYI 336
             +E I E + G L+KL+ L L++N     P  I
Sbjct: 254 -LLETIPEGI-GKLKKLSILKLDQNRLTQLPEAI 285



 Score = 28.1 bits (61), Expect(2) = 9.0
 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 1/80 (1%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIE-EIEHFHELQILELGSNKLR 762
           KKL   +   N++ S         +L    + +N++ ++  E+    EL +L++  N+L 
Sbjct: 312 KKLSNLNADRNKLVSLPKEIGGCCSLTMFCIRDNRLTRLPAEVSQAVELHVLDVAGNRLH 371

Query: 761 VMENLQTLTNLQELWLGRNR 702
            +    T   L+ LWL  N+
Sbjct: 372 HLPLSLTTLKLKALWLSDNQ 391



 Score = 24.3 bits (51), Expect(2) = 9.0
 Identities = 18/57 (31%), Positives = 29/57 (50%)
 Frame = -3

Query: 1123 NRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP 953
            NRL  L   IS L++L    + QNL+ +   E +     + +L  L L  N+L ++P
Sbjct: 230  NRLERLPEEISGLTSLTYLVISQNLL-ETIPEGIGK---LKKLSILKLDQNRLTQLP 282



 Score = 22.3 bits (46), Expect(2) = 9e-08
 Identities = 9/15 (60%), Positives = 13/15 (86%)
 Frame = -3

Query: 997 LEELVLRDNQLKKIP 953
           LEEL+L  NQL+++P
Sbjct: 38  LEELLLDANQLRELP 52



>gb:BC046591_2099296 Mus musculus leucine rich repeat containing 1,
           mRNA (cDNA clone IMAGE:6308934), partial cds.
          Length = 596

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 56/172 (32%), Positives = 89/172 (51%), Gaps = 7/172 (4%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKIEE-IEHFHELQILELGSNKL 765
           K LL  DVS N +   P  +S ++S L  L +S N +  I E I    +L IL+L  N+L
Sbjct: 292 KNLLCLDVSENRLERLPEEISGLTS-LTYLVISQNLLETIPEGIGKLKKLSILKLDQNRL 350

Query: 764 -RVMENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALE 597
            ++ E +    NL EL L  NR+  +  ++  LK +  ++   N+L S+ K +  C +L 
Sbjct: 351 TQLPEAIGDCENLTELVLTENRLLTLPKSIGKLKKLSNLNADRNKLVSLPKEIGGCCSLT 410

Query: 596 ELYLSHNGIEKMEG-LSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDN 444
              +  N + ++   +S  V L VLDV+ N+L  +       KL+ LWL+DN
Sbjct: 411 MFCIRDNRLTRLPAEVSQAVELHVLDVAGNRLHHLPLSLTTLKLKALWLSDN 462



 Score = 57.8 bits (138), Expect(2) = 8e-08
 Identities = 60/214 (28%), Positives = 107/214 (50%), Gaps = 9/214 (4%)
 Frame = -2

Query: 950 VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILE-LGS 774
           ++ F +L+  DVS N+I            L+    S N + ++ E   F ELQ L  L  
Sbjct: 150 IANFMQLVELDVSRNDIPEIPESIAFCKALQVADFSGNPLTRLPE--SFPELQNLTCLSV 207

Query: 773 NKLRVM---ENLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEE 612
           N + +    EN+  L NL  L L  N +  +  +L  L+ ++++ + +N + ++ + +  
Sbjct: 208 NDISLQSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGA 267

Query: 611 CVALEELYLSHNGIEKM-EGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNI 438
            + L++L+L  N + ++ + +  L NL  LDVS N+L  +   I+ LT L  L ++ N  
Sbjct: 268 LLHLKDLWLDGNQLSELPQEIGNLKNLLCLDVSENRLERLPEEISGLTSLTYLVISQN-- 325

Query: 437 SSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYI 336
             +E I E + G L+KL+ L L++N     P  I
Sbjct: 326 -LLETIPEGI-GKLKKLSILKLDQNRLTQLPEAI 357



 Score = 28.1 bits (61), Expect(2) = 8.9
 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 1/80 (1%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIE-EIEHFHELQILELGSNKLR 762
           KKL   +   N++ S         +L    + +N++ ++  E+    EL +L++  N+L 
Sbjct: 384 KKLSNLNADRNKLVSLPKEIGGCCSLTMFCIRDNRLTRLPAEVSQAVELHVLDVAGNRLH 443

Query: 761 VMENLQTLTNLQELWLGRNR 702
            +    T   L+ LWL  N+
Sbjct: 444 HLPLSLTTLKLKALWLSDNQ 463



 Score = 24.3 bits (51), Expect(2) = 8.9
 Identities = 18/57 (31%), Positives = 29/57 (50%)
 Frame = -3

Query: 1123 NRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP 953
            NRL  L   IS L++L    + QNL+ +   E +     + +L  L L  N+L ++P
Sbjct: 302  NRLERLPEEISGLTSLTYLVISQNLL-ETIPEGIGK---LKKLSILKLDQNRLTQLP 354



 Score = 22.3 bits (46), Expect(2) = 8e-08
 Identities = 9/15 (60%), Positives = 13/15 (86%)
 Frame = -3

Query: 997 LEELVLRDNQLKKIP 953
           LEEL+L  NQL+++P
Sbjct: 110 LEELLLDANQLRELP 124



>gb:AE011492_273558 Leptospira interrogans serovar lai str. 56601
           chromosome I, section 301 of 397 of the complete
           sequence.>gb:AE010300_1006957 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete sequence.
          Length = 311

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 53/177 (29%), Positives = 93/177 (52%), Gaps = 6/177 (3%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKL 765
           + L   D+S N +T+ P  +  + + L++LY+ +NQ+  +  EI     LQ L L +N+L
Sbjct: 141 QNLQSLDLSTNRLTTLPQEIGHLQN-LQDLYLVSNQLTILPNEIGQLKNLQTLNLRNNRL 199

Query: 764 RVM-ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSM-KGLEECVALEEL 591
             + + ++ L NL                     K + ++SN+LT+  K +E+   L+ L
Sbjct: 200 TTLSKEIEQLQNL---------------------KSLDLRSNQLTTFPKEIEQLKNLQVL 238

Query: 590 YLSHNGIEKM-EGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSVE 426
            L  N +  + EG+  L NL+ LD+ +N+LT +   I  L  L++L+LN+N +SS E
Sbjct: 239 DLGSNQLTTLPEGIGQLKNLQTLDLDSNQLTTLPQEIGQLQNLQELFLNNNQLSSQE 295



>gb:AE011492_273556 Leptospira interrogans serovar lai str. 56601
           chromosome I, section 301 of 397 of the complete
           sequence.>gb:AE010300_1006955 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete sequence.
          Length = 452

 Score = 63.9 bits (154), Expect = 7e-09
 Identities = 57/201 (28%), Positives = 103/201 (51%), Gaps = 7/201 (3%)
 Frame = -2

Query: 899 TSPSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKLRVM-ENLQTLTNLQ 726
           T P  + ++ + LK L + +NQ+  + +EI     L+IL L  N++  + + +  L NLQ
Sbjct: 200 TLPKEIGELQN-LKTLNLLDNQLTTLPKEIGELQNLEILVLRENRITALPKEIGQLQNLQ 258

Query: 725 ELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALEELYLSHNGIEKM-E 558
            L L +N++  +   +  L+ ++++ +  N+LT++ K + +   L+EL L  N +  + +
Sbjct: 259 WLDLHQNQLTTLPKEIGQLQNLQRLDLHQNQLTTLPKEIGQLQNLQELCLDENQLTTLPK 318

Query: 557 GLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTT 381
            +  L NLRVLD+  N+LT +   +  L  L+ L L  N +S++        G LQ L  
Sbjct: 319 EIEQLQNLRVLDLDNNQLTTLPKEVLRLQSLQVLALGSNRLSTL----PKEIGQLQNLQV 374

Query: 380 LYLERNPCANSPNYISTLRQI 318
           L L  N     P  I  L+ +
Sbjct: 375 LGLISNQLTTLPKEIGQLQNL 395



>gb:AY577975_2538309 Petromyzon marinus clone 12.33 variable
           lymphocyte receptor gene, partial cds.
          Length = 257

 Score = 63.5 bits (153), Expect = 9e-09
 Identities = 57/189 (30%), Positives = 93/189 (49%), Gaps = 11/189 (5%)
 Frame = -2

Query: 893 PSGLSKVSSTLKELYVSNNQIAKIEE--IEHFHELQILELGSNKLRVMEN--LQTLTNLQ 726
           P+G+   +  L+ LY+  NQI K+E    +    L  L LG+N+L  +       L NLQ
Sbjct: 32  PAGIPTTTKILR-LYI--NQITKLEPGVFDSLTALTFLNLGNNQLTALPEGVFDHLVNLQ 88

Query: 725 ELWLGRNRIRAIN---LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKME- 558
           +LWL  N++ ++       L  +K++ +  N+L S+        L+EL+LS   +  +  
Sbjct: 89  KLWLNSNQLTSLPAGVFDKLTQLKELGLDQNQLKSISAGMFDRVLQELHLSSKQLTDLPE 148

Query: 557 -GLSTLVNLRVLDVSANKLTAI--SNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKL 387
            G   LVNL+ L +  N++ A+       LT+L  L L +N + S   I      +L+ L
Sbjct: 149 GGFERLVNLKELHLYRNQMKALPAGLFDELTQLTLLELQNNQLKS---IPRGAFDNLKSL 205

Query: 386 TTLYLERNP 360
           T +YL  NP
Sbjct: 206 THIYLFNNP 214



 Score = 41.6 bits (96), Expect = 0.037
 Identities = 36/119 (30%), Positives = 61/119 (51%), Gaps = 8/119 (6%)
 Frame = -2

Query: 908 NEITS-PSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVME--NLQTL 738
           N++TS P+G+    + LKEL +  NQ+  I        LQ L L S +L  +     + L
Sbjct: 95  NQLTSLPAGVFDKLTQLKELGLDQNQLKSISAGMFDRVLQELHLSSKQLTDLPEGGFERL 154

Query: 737 TNLQELWLGRNRIRAIN---LCGLKCIKKISIQSNRLTSMK--GLEECVALEELYLSHN 576
            NL+EL L RN+++A+       L  +  + +Q+N+L S+     +   +L  +YL +N
Sbjct: 155 VNLKELHLYRNQMKALPAGLFDELTQLTLLELQNNQLKSIPRGAFDNLKSLTHIYLFNN 213



>gb:AY510704_2085800 Mus musculus toll-like receptor 11 (Tlr11)
           mRNA, complete cds.
          Length = 926

 Score = 63.5 bits (153), Expect = 9e-09
 Identities = 63/207 (30%), Positives = 111/207 (53%), Gaps = 17/207 (8%)
 Frame = -2

Query: 932 LLVFDVSFNEITSPSGLSKVSS-TLKELYVSNNQIAKIEEIE----HFHELQILELGSNK 768
           L   D+S+N     +G+  +   TL  L +    +  ++  +    H H L ++  G  K
Sbjct: 219 LETLDLSYNLQLKQAGVRDLYGLTLHSLILDGTPLKALDLTDSGLLHLHFLSLVGTGIEK 278

Query: 767 LRVMENLQTLTNLQELWLGRNRIRAI----NLCGLKCIKKISIQSNRLTSM--KGLEECV 606
             V  +L   + L+ L LG+N+I+ I     + G K ++ +S+  N L ++  + L    
Sbjct: 279 --VPASLTGYSELRALDLGKNQIQNILENGEIPGYKALEFLSLHDNHLQTLPTRFLHTLP 336

Query: 605 ALEELYLSHNGI----EKMEGLSTLVNLRVLDVSANKLTAISN--IANLTKLEDLWLNDN 444
            L++L LS N +    E  EGL +  NL+VLD+S N+L  + +  ++ L++L++LWL+ N
Sbjct: 337 QLQKLNLSMNKLGPILELPEGLFS-TNLKVLDLSYNQLCDVPHGALSLLSQLQELWLSGN 395

Query: 443 NISSVEDIAEAVAGSLQKLTTLYLERN 363
           NISS+ +  E++ G L++L TL L  N
Sbjct: 396 NISSLSN--ESLQG-LRQLRTLDLSWN 419



>gb:AL445928_1927740 Human DNA sequence from clone RP11-305E17 on
           chromosome 1, complete sequence.
          Length = 339

 Score = 63.5 bits (153), Expect = 9e-09
 Identities = 61/199 (30%), Positives = 91/199 (45%), Gaps = 5/199 (2%)
 Frame = -2

Query: 899 TSPSGLSKVSSTLKELYVSNNQIAKIEE-IEHFHELQILELGSNKL-RVMENLQTLTNLQ 726
           T PS L K++  L+E  +    + KI E I  F  L +L+L  N +  +   +  LT LQ
Sbjct: 74  TLPSSLLKLNQ-LQEWQLHRTGLLKIPEFIGRFQNLIVLDLSRNTISEIPPGIGLLTRLQ 132

Query: 725 ELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNG--IEKMEGL 552
           EL L  N+I+                    T  K L  C +LE+L L+ N    +  + L
Sbjct: 133 ELILSYNKIK--------------------TVPKELSNCASLEKLELAVNRDICDLPQEL 172

Query: 551 STLVNLRVLDVSANKLTAIS-NIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLY 375
           S L+ L  LD+S N  T I   + N+  LE L +  N +  + D  E     +Q L TL+
Sbjct: 173 SNLLKLTHLDLSMNDFTTIPLAVLNMPALEWLDMGSNKLEQLPDTIE----RMQNLHTLW 228

Query: 374 LERNPCANSPNYISTLRQI 318
           L+RN     P  IS ++ +
Sbjct: 229 LQRNEITCLPQTISNMKNL 247



>gb:AL445928_1927739 Human DNA sequence from clone RP11-305E17 on
           chromosome 1, complete sequence.>gb:AY358131_1947010
           Homo sapiens clone DNA174687 densin hlg (UNQ6500) mRNA,
           complete cds.>gb:BC009613_1972139 Homo sapiens
           hypothetical protein MGC14816, mRNA (cDNA clone
           MGC:14816 IMAGE:4245944), complete cds.
          Length = 335

 Score = 63.5 bits (153), Expect = 9e-09
 Identities = 61/199 (30%), Positives = 91/199 (45%), Gaps = 5/199 (2%)
 Frame = -2

Query: 899 TSPSGLSKVSSTLKELYVSNNQIAKIEE-IEHFHELQILELGSNKL-RVMENLQTLTNLQ 726
           T PS L K++  L+E  +    + KI E I  F  L +L+L  N +  +   +  LT LQ
Sbjct: 74  TLPSSLLKLNQ-LQEWQLHRTGLLKIPEFIGRFQNLIVLDLSRNTISEIPPGIGLLTRLQ 132

Query: 725 ELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNG--IEKMEGL 552
           EL L  N+I+                    T  K L  C +LE+L L+ N    +  + L
Sbjct: 133 ELILSYNKIK--------------------TVPKELSNCASLEKLELAVNRDICDLPQEL 172

Query: 551 STLVNLRVLDVSANKLTAIS-NIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLY 375
           S L+ L  LD+S N  T I   + N+  LE L +  N +  + D  E     +Q L TL+
Sbjct: 173 SNLLKLTHLDLSMNDFTTIPLAVLNMPALEWLDMGSNKLEQLPDTIE----RMQNLHTLW 228

Query: 374 LERNPCANSPNYISTLRQI 318
           L+RN     P  IS ++ +
Sbjct: 229 LQRNEITCLPQTISNMKNL 247



>gb:AY444997_1606514 Paracoccidioides brasiliensis adenylate cyclase
            (cyr1) gene, complete cds.
          Length = 2093

 Score = 63.5 bits (153), Expect = 9e-09
 Identities = 58/238 (24%), Positives = 106/238 (44%), Gaps = 46/238 (19%)
 Frame = -2

Query: 893  PSGLSKVSSTLKELYVSNNQIAKIE--EIEHFHELQILELGSNKLRVMEN-LQTLTNLQE 723
            P+ LS +++ L  L +SNN++ +++  E+ + H L  L++ +N L  +         L+ 
Sbjct: 738  PASLS-LATRLTYLDISNNRLEQLDNAELHNLHGLVSLKMSNNNLSTLPAYFGDFPALRS 796

Query: 722  LWLGRNRIRAINLC--GLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEG-- 555
            L +  N  R    C   LK +  + I  N+++ +  +     LE L++++NG+    G  
Sbjct: 797  LNISSNSYRTFPECLYNLKSLVDLDISFNKISELSDIGRLTTLERLWVTNNGLHGPLGET 856

Query: 554  LSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVE----------------- 426
               LVNL+ +D   N +T+I NI +L +LE L +  N++S+                   
Sbjct: 857  FRDLVNLKEIDARFNSITSIDNITHLPRLERLLIGHNSVSTFSGSFMKLRTLALDHCPVT 916

Query: 425  --------------DIAEA--------VAGSLQKLTTLYLERNPCANSPNYISTLRQI 318
                          +IA A        +  ++  LT L L +N      +YI TLR++
Sbjct: 917  EFDLTSPLPTLTSLNIASAKLVQFKDTLFTNIPHLTKLILNKNHFVTLSSYIGTLRKL 974



 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 58/213 (27%), Positives = 103/213 (48%), Gaps = 6/213 (2%)
 Frame = -2

Query: 938  KKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRV 759
            K L+  D+SFN+I+  S + ++ +TL+ L+V+NN +                LG      
Sbjct: 815  KSLVDLDISFNKISELSDIGRL-TTLERLWVTNNGLHG-------------PLG------ 854

Query: 758  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS 582
             E  + L NL+E+    N I +I N+  L  ++++ I  N +++  G    + L  L L 
Sbjct: 855  -ETFRDLVNLKEIDARFNSITSIDNITHLPRLERLLIGHNSVSTFSG--SFMKLRTLALD 911

Query: 581  HNGIEKMEGLSTLVNLRVLDVSANKL-----TAISNIANLTKLEDLWLNDNNISSVEDIA 417
            H  + + +  S L  L  L++++ KL     T  +NI +LTK   L LN N+  ++    
Sbjct: 912  HCPVTEFDLTSPLPTLTSLNIASAKLVQFKDTLFTNIPHLTK---LILNKNHFVTL---- 964

Query: 416  EAVAGSLQKLTTLYLERNPCANSPNYISTLRQI 318
             +  G+L+KL    + +NP +  P  I  L ++
Sbjct: 965  SSYIGTLRKLEHFSISKNPLSTLPPTIGCLTEL 997



 Score = 52.8 bits (125), Expect = 2e-05
 Identities = 48/163 (29%), Positives = 81/163 (49%), Gaps = 8/163 (4%)
 Frame = -2

Query: 902  ITSPSGLSKVSSTLKELYVSNNQIAKIEE--IEHFHELQILE-LGSNKLRVMENLQTLTN 732
            IT P  L K +S +  L +S N    I +  I+    L+ L+ +G+   R+  +L   T 
Sbjct: 687  ITLPITLYKRASEIISLNLSRNLALDIPKDFIQSCINLRELKYIGNEAWRLPASLSLATR 746

Query: 731  LQELWLGRNRIRAIN---LCGLKCIKKISIQSNRLTSMKG-LEECVALEELYLSHNGIEK 564
            L  L +  NR+  ++   L  L  +  + + +N L+++     +  AL  L +S N    
Sbjct: 747  LTYLDISNNRLEQLDNAELHNLHGLVSLKMSNNNLSTLPAYFGDFPALRSLNISSNSYRT 806

Query: 563  M-EGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNI 438
              E L  L +L  LD+S NK++ +S+I  LT LE LW+ +N +
Sbjct: 807  FPECLYNLKSLVDLDISFNKISELSDIGRLTTLERLWVTNNGL 849



 Score = 41.2 bits (95), Expect = 0.048
 Identities = 37/149 (24%), Positives = 71/149 (47%), Gaps = 11/149 (7%)
 Frame = -2

Query: 1109 VRPPYFPPLQSQQILSSPEPHY-RRRARASFVVAHHFPTRGTSAQG*SAEENSGVSIFKK 933
            V  P+ P ++   ++S         R  ++F     F   G+  Q   A+      +F++
Sbjct: 1103 VSMPHNPTVKKSSVISRAATETPSSRKDSTFSQRISFTFAGSLKQLYLADNRLEDDVFQQ 1162

Query: 932  LL------VFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKI--EEIEHFHELQILEL 780
            L       + ++S+NE+T  P GL +    L EL+VS NQ++ +  +++E    L++L +
Sbjct: 1163 LAFLVEIRILNLSYNELTEIPQGLLRRWQYLVELHVSGNQLSALPSDDLEESSSLKVLHI 1222

Query: 779  GSNKLRVM-ENLQTLTNLQELWLGRNRIR 696
              NK +V+   L  +  L  L +G N ++
Sbjct: 1223 NGNKFQVLPAELCKVNRLAILDVGSNSLK 1251



>gb:AY043351_1560999 Emericella nidulans adenylate cyclase (cyaA)
            gene, complete cds.
          Length = 2132

 Score = 63.5 bits (153), Expect = 9e-09
 Identities = 46/179 (25%), Positives = 88/179 (49%), Gaps = 7/179 (3%)
 Frame = -2

Query: 875  VSSTLKELYVSNNQIAKIEE--IEHFHELQILELGSNKL-RVMENLQTLTNLQELWLGRN 705
            ++S L  L VSNN + +++   ++    L  ++L +N+L ++ +      +L+ L +  N
Sbjct: 795  LASRLTYLDVSNNFLDQLDHANLDRLQGLVSIKLANNRLTKLPDYFGNFKSLRSLNIASN 854

Query: 704  RIRAIN--LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKM--EGLSTLVN 537
              +     LC LK +  + I  N ++ +  +    +LE L++++NG      E +  LVN
Sbjct: 855  NFQVFPEFLCNLKSLVDLDISFNNISELPNIGNLTSLERLWMTNNGFRGPFGESIKDLVN 914

Query: 536  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNP 360
            L+ +D   N++  I ++  L +LE L +  N++S          GS  KL  L L+  P
Sbjct: 915  LKEIDARFNEIVNIDSLTLLPRLEQLLIGHNSVSKFR-------GSFPKLRNLVLDHCP 966



 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 46/161 (28%), Positives = 77/161 (47%), Gaps = 8/161 (4%)
 Frame = -2

Query: 902  ITSPSGLSKVSSTLKELYVSNNQIAKIEE--IEHFHEL-QILELGSNKLRVMENLQTLTN 732
            +T P  L K +  +  L +S N    + +  I+    L +I  +GS  LR+  +    + 
Sbjct: 739  VTIPIALYKKAPEIISLNLSRNLELDVPKDFIQGCINLREIKYIGSEALRLPPSFSLASR 798

Query: 731  LQELWLGRNRIRAI---NLCGLKCIKKISIQSNRLTSMKG-LEECVALEELYLSHNGIEK 564
            L  L +  N +  +   NL  L+ +  I + +NRLT +        +L  L ++ N  + 
Sbjct: 799  LTYLDVSNNFLDQLDHANLDRLQGLVSIKLANNRLTKLPDYFGNFKSLRSLNIASNNFQV 858

Query: 563  M-EGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDN 444
              E L  L +L  LD+S N ++ + NI NLT LE LW+ +N
Sbjct: 859  FPEFLCNLKSLVDLDISFNNISELPNIGNLTSLERLWMTNN 899



 Score = 43.9 bits (102), Expect = 0.007
 Identities = 51/214 (23%), Positives = 96/214 (44%), Gaps = 7/214 (3%)
 Frame = -2

Query: 938  KKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKI--EEIEHFHELQILELGSNKL 765
            K L+  D+SFN I+    +  ++S L+ L+++NN       E I+    L+ ++   N++
Sbjct: 867  KSLVDLDISFNNISELPNIGNLTS-LERLWMTNNGFRGPFGESIKDLVNLKEIDARFNEI 925

Query: 764  RVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL 585
              +++L  L  L++L +G N                S+   R +  K       L  L L
Sbjct: 926  VNIDSLTLLPRLEQLLIGHN----------------SVSKFRGSFPK-------LRNLVL 962

Query: 584  SHNGIEKMEGLSTLVNLRVLDVSANKL-----TAISNIANLTKLEDLWLNDNNISSVEDI 420
             H  + + +  + +  L  L++++ KL     T   ++ NLTK   L L+ N+  S+   
Sbjct: 963  DHCPVTQFDIDAPMPTLTSLNIASAKLVQFRDTLFDSLPNLTK---LILDKNHFMSM--- 1016

Query: 419  AEAVAGSLQKLTTLYLERNPCANSPNYISTLRQI 318
                 G L+KL    + +NP ++ P  I  L ++
Sbjct: 1017 -SPHIGKLRKLEHFSMAKNPLSSLPPSIGCLTEL 1049



 Score = 38.5 bits (88), Expect = 0.31
 Identities = 25/89 (28%), Positives = 50/89 (56%), Gaps = 4/89 (4%)
 Frame = -2

Query: 950  VSIFKKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKI--EEIEHFHELQILEL 780
            +S   +L + ++S+N +   P GL K    L ELY+S N++  +  +++E    L+IL +
Sbjct: 1214 LSFIPELRIVNLSYNVLNEIPPGLLKRWPLLTELYLSGNELTSLPSDDLEEGSSLKILNI 1273

Query: 779  GSNKLRVM-ENLQTLTNLQELWLGRNRIR 696
             +N+ +V+   L  ++ L  L +G N ++
Sbjct: 1274 NANRFQVLPAELCKVSKLSILDVGSNYLK 1302



>gb:AY231707_1177000 Drosophila yakuba clone yak-em_sds22 mRNA
           sequence.
          Length = 145

 Score = 63.5 bits (153), Expect = 9e-09
 Identities = 45/139 (32%), Positives = 69/139 (49%), Gaps = 1/139 (0%)
 Frame = -2

Query: 833 IAKIEEIEHFH-ELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKI 657
           +A IEE+     +   L+L   ++  +EN + LT ++ L+L  N I+ I           
Sbjct: 28  VASIEEVITIDPDCYELDLNHRRIEKLENFEPLTRIERLFLRWNLIKKIE---------- 77

Query: 656 SIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANL 477
                 L+S+K       L EL L  N I K+E L  L  L VLD+S N+LT I N+  L
Sbjct: 78  -----NLSSLK------TLIELELYDNQITKIENLDDLTELEVLDISFNRLTKIENLDKL 126

Query: 476 TKLEDLWLNDNNISSVEDI 420
            KLE ++   N I+ +E++
Sbjct: 127 VKLEKVYFVSNRITQIENL 145



 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 37/103 (35%), Positives = 60/103 (58%), Gaps = 1/103 (0%)
 Frame = -2

Query: 857 ELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-NLC 681
           EL +++ +I K+E  E    ++ L L  N ++ +ENL +L  L EL L  N+I  I NL 
Sbjct: 43  ELDLNHRRIEKLENFEPLTRIERLFLRWNLIKKIENLSSLKTLIELELYDNQITKIENLD 102

Query: 680 GLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGL 552
            L  ++ + I  NRLT ++ L++ V LE++Y   N I ++E L
Sbjct: 103 DLTELEVLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENL 145



 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 28/74 (37%), Positives = 44/74 (59%)
 Frame = -2

Query: 911 FNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTN 732
           +N I     LS +  TL EL + +NQI KIE ++   EL++L++  N+L  +ENL  L  
Sbjct: 70  WNLIKKIENLSSLK-TLIELELYDNQITKIENLDDLTELEVLDISFNRLTKIENLDKLVK 128

Query: 731 LQELWLGRNRIRAI 690
           L++++   NRI  I
Sbjct: 129 LEKVYFVSNRITQI 142



 Score = 46.6 bits (109), Expect = 0.001
 Identities = 30/83 (36%), Positives = 47/83 (56%), Gaps = 1/83 (1%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-N 687
           ++ L++  N I KIE +     L  LEL  N++  +ENL  LT L+ L +  NR+  I N
Sbjct: 63  IERLFLRWNLIKKIENLSSLKTLIELELYDNQITKIENLDDLTELEVLDISFNRLTKIEN 122

Query: 686 LCGLKCIKKISIQSNRLTSMKGL 618
           L  L  ++K+   SNR+T ++ L
Sbjct: 123 LDKLVKLEKVYFVSNRITQIENL 145



>gb:AE016959_1022238 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC079935_1733057
           Genomic sequence for Oryza sativa (japonica
           cultivar-group) cultivar Nipponbare clone OSJNBa0095C06,
           from Chromosome 10, complete
           sequence.>gb:AE017085_1752057 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 39 of 77 of the
           complete sequence.
          Length = 644

 Score = 63.5 bits (153), Expect = 9e-09
 Identities = 60/177 (33%), Positives = 80/177 (45%), Gaps = 7/177 (3%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           S+L+ + +S N I  I        L  L+L  NK+  +E L+ LT L+ L L  NRI  I
Sbjct: 420 SSLRAINLSGNFIVHISPGSLPKGLHSLDLSRNKIANIEGLRELTKLRVLNLSYNRISRI 479

Query: 689 NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSAN 510
                                 GL  C AL ELYL+ N I  +EGL  L+ L VLD+  N
Sbjct: 480 G--------------------HGLSGCTALRELYLAGNKISDVEGLHRLLKLAVLDLGFN 519

Query: 509 KLTAI----SNIANLTKLEDLWLNDNNI-SSVED--IAEAVAGSLQKLTTLYLERNP 360
           K+T        +AN   L  L L  N + ++V D  +  AV G L  L   YL + P
Sbjct: 520 KVTTARALGQLVANYHSLRALNLVGNPVQANVGDDALRRAVTGLLPHLA--YLNKQP 574



>pir|AD1570|AD1570 internalin, probable peptidoglycan bound protein
            (LPXTG motif) homolog lin1101 [imported] - Listeria
            innocua (strain Clip11262)>gb:AL596167_538446 Listeria
            innocua Clip11262 complete genome, segment 5/12.
          Length = 517

 Score = 63.5 bits (153), Expect = 9e-09
 Identities = 54/236 (22%), Positives = 110/236 (46%), Gaps = 4/236 (1%)
 Frame = -2

Query: 1037 RARASFVVAHHFPTRGTSAQG*SAEENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLK 858
            +++ + V + HF ++G  +         GV   K L       N+++    LS ++  L+
Sbjct: 72   QSQLNTVKSLHFDSKGVQSL-------EGVEYLKNLTQVFGYGNQVSDLGPLSNLTQ-LE 123

Query: 857  ELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLC- 681
             + +  NQI+ +  I +   L  L+   N L+ +E ++ LTN+ EL +  N I  I+   
Sbjct: 124  IIQMPRNQISDLTPISNLTALMSLDFEFNNLQTIEPIKNLTNMLELNVSANPISDISAVK 183

Query: 680  GLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLT 501
             +  ++ ++I+   ++ +  +E    +   +   N I  +  L  +  L  L +  N++ 
Sbjct: 184  NMTQLEFLTIRDCEVSDLSPVENLSNMLMFWAGRNNISDITPLKNMPKLLGLSLFGNQIK 243

Query: 500  AISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLY---LERNPCANSPN 342
             +S + NLT LED  L  N +S +  +A +   +L+ LT  +   ++ +P  N  N
Sbjct: 244  DVSVVKNLTSLEDFDLKANQVSDISSLATST--TLETLTLSFNQIIDISPLKNLTN 297



 Score = 57.4 bits (137), Expect = 6e-07
 Identities = 39/164 (23%), Positives = 85/164 (51%), Gaps = 1/164 (0%)
 Frame = -2

Query: 908 NEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNL 729
           NEI S   L++V +   +L  + + + + +     + ++ L   S  ++ +E ++ L NL
Sbjct: 45  NEIFSDPKLAQVVADWLKLPSATSAVTQSQ----LNTVKSLHFDSKGVQSLEGVEYLKNL 100

Query: 728 QELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGL 552
            +++   N++  +  L  L  ++ I +  N+++ +  +    AL  L    N ++ +E +
Sbjct: 101 TQVFGYGNQVSDLGPLSNLTQLEIIQMPRNQISDLTPISNLTALMSLDFEFNNLQTIEPI 160

Query: 551 STLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI 420
             L N+  L+VSAN ++ IS + N+T+LE L + D  +S +  +
Sbjct: 161 KNLTNMLELNVSANPISDISAVKNMTQLEFLTIRDCEVSDLSPV 204



 Score = 37.7 bits (86), Expect = 0.53
 Identities = 29/108 (26%), Positives = 53/108 (49%), Gaps = 13/108 (12%)
 Frame = -2

Query: 602 LEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVED 423
           ++ L+    G++ +EG+  L NL  +    N+++ +  ++NLT+LE + +  N IS +  
Sbjct: 78  VKSLHFDSKGVQSLEGVEYLKNLTQVFGYGNQVSDLGPLSNLTQLEIIQMPRNQISDLTP 137

Query: 422 IAEAVA--------GSLQ-----KLTTLYLERNPCANSPNYISTLRQI 318
           I+   A         +LQ     K  T  LE N  AN  + IS ++ +
Sbjct: 138 ISNLTALMSLDFEFNNLQTIEPIKNLTNMLELNVSANPISDISAVKNM 185



>sp|P23466|CYAA_SACKL Adenylate cyclase (EC 4.6.1.1) (ATP
            pyrophosphate-lyase) (Adenylyl cyclase).>pir|JQ1145|OYBYK
            adenylate cyclase (EC 4.6.1.1) - yeast (Saccharomyces
            kluyveri)>gb:SKADECYC_1715213 Saccharomyces kluyveri gene
            for adenylyl cyclase.
          Length = 1839

 Score = 63.5 bits (153), Expect = 9e-09
 Identities = 57/216 (26%), Positives = 106/216 (49%), Gaps = 4/216 (1%)
 Frame = -2

Query: 953  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIE-EIEHFHELQILELG 777
            G S  K L + D+S N+  +   +    + L ++ +S N+I  +   I    +L  + L 
Sbjct: 721  GFSKLKNLQLLDISSNKFVNYPEVINSCTNLLQIDLSYNKIHSLPVSINQLVKLAKMNLF 780

Query: 776  SNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALE 597
            +N+L  + +L  + NL+ L L  NR+ +I  C    ++ + +  NR+++    ++   L 
Sbjct: 781  NNRLTSVGDLSQMKNLRTLNLRCNRVTSIE-CHAPNLQNLFLTDNRISTFD--DDLTRLR 837

Query: 596  ELYLSHNGIEKME-GLSTLVNLRVLDVSANKLTAISN--IANLTKLEDLWLNDNNISSVE 426
             L L  N I  M  G + + N+  L ++  KL++ S   ++ L +LE L LN+NN++ + 
Sbjct: 838  TLELQQNPITSMVCGGNYMANMTSLSLNKAKLSSFSAELLSKLPRLEKLELNENNLTQL- 896

Query: 425  DIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQI 318
                     L +L  L + RN   + P+ IS LR +
Sbjct: 897  ---PPEINKLTRLIYLSVARNKLESIPDEISDLRSL 929



 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 55/233 (23%), Positives = 109/233 (46%), Gaps = 23/233 (9%)
 Frame = -2

Query: 920  DVSFN-EITSPSGLSKVSSTLKELYVSNNQIAKIE-EIEHFHELQILELGSNKLR-VMEN 750
            DVS N  I  P    + +  L  L + N + +K    +   ++L  L+L  N ++ V ++
Sbjct: 639  DVSNNANIFLPLDFIESAIKLSSLRMVNIRASKFPANVTDAYKLVSLDLERNFIKKVPDS 698

Query: 749  LQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALEELYLSH 579
            +  L NL  + L  N +  +      LK ++ + I SN+  +  + +  C  L ++ LS+
Sbjct: 699  IFKLNNLTIVNLQCNNLERLPPGFSKLKNLQLLDISSNKFVNYPEVINSCTNLLQIDLSY 758

Query: 578  NGIEKME-GLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG 402
            N I  +   ++ LV L  +++  N+LT++ +++ +  L  L L  N ++S+E  A  +  
Sbjct: 759  NKIHSLPVSINQLVKLAKMNLFNNRLTSVGDLSQMKNLRTLNLRCNRVTSIECHAPNLQN 818

Query: 401  -------------SLQKLTTLYLERNPCAN---SPNYISTLRQIFPNIQQVDS 291
                          L +L TL L++NP  +     NY++ +  +  N  ++ S
Sbjct: 819  LFLTDNRISTFDDDLTRLRTLELQQNPITSMVCGGNYMANMTSLSLNKAKLSS 871



 Score = 40.8 bits (94), Expect = 0.062
 Identities = 27/88 (30%), Positives = 44/88 (50%), Gaps = 3/88 (3%)
 Frame = -2

Query: 950  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKI--EEIEHFHELQILELG 777
            V+ F+ L   ++S+N     S L      L ELY+S N    +  E ++H   L++L L 
Sbjct: 1001 VNTFQNLKTLNLSYNNFVEISDLKL--QNLTELYLSGNNFTSLPGEAVQHLRSLKVLMLN 1058

Query: 776  SNK-LRVMENLQTLTNLQELWLGRNRIR 696
             NK L +   L  L+ L  L +G N+++
Sbjct: 1059 GNKLLSLPAELSQLSRLSVLDVGSNQLK 1086



>gb:AB079056_1197944 Ciona intestinalis LRR37 mRNA for axonemal
           leucine-rich repeat protein, complete cds.
          Length = 325

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 60/249 (24%), Positives = 108/249 (43%), Gaps = 50/249 (20%)
 Frame = -2

Query: 884 LSKVSSTLKELYVS----NNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELW 717
           L K+ + L   YV        +  IE +  F  ++ +++  N L  +  L  LT+L  L 
Sbjct: 45  LCKIGNGLAHAYVRLDAHERDLTDIELLRKFIHVRYVDVSGNLLEDISPLNNLTHLLTLK 104

Query: 716 LGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLST--L 543
             +N ++   L  L  ++ +++  N++TS +G+E  + LE+L L+ N I  + GL+   L
Sbjct: 105 ADKNNLKTAKLDPLPYLQIMNLSGNKITSTEGVEHPL-LEQLNLNSNLIPLVSGLNPKFL 163

Query: 542 VNLRVLDVSANKLT------------------AISNIANLTKLEDLW---LNDN------ 444
            NL  L++  NKLT                  ++  + +L KLE+L    L DN      
Sbjct: 164 TNLTTLELRGNKLTTTAGIYLPNLKNLYLAGNSLKQVEDLDKLENLMILHLRDNQIDKLD 223

Query: 443 -----------------NISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQIF 315
                            N+S ++++ + VA  L  L  L L  NPC     Y   +  + 
Sbjct: 224 GFTENMKKLQYINLRANNVSDLKELKKMVA--LPMLRALVLNDNPCLEEDGYRMEVLIVL 281

Query: 314 PNIQQVDSE 288
             ++++D +
Sbjct: 282 RKLERLDKD 290



>gb:PFMAL13_1191528 Plasmodium falciparum 3D7 chromosome 13, ***
           SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 256

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 50/175 (28%), Positives = 88/175 (50%), Gaps = 8/175 (4%)
 Frame = -2

Query: 938 KKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRV 759
           K +L  D   N I    G   +      LY++N    KIE +++ H L+ L L +N L  
Sbjct: 2   KNILNNDEVKNIIEKNEGYYSIIELNDVLYLNNKLYTKIECLQNLHNLKTLYLNNNALEK 61

Query: 758 MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS 582
           +E L+   NL  L+L  N+I+ I NL  L  ++ ++++ N +  ++ LE    LE+L LS
Sbjct: 62  IEGLECCINLIALYLNCNQIKRIENLNNLIRLRILNLEDNNIFVIENLECLDCLEDLNLS 121

Query: 581 HNGIEKMEGLSTLV-----NLRVLDVSANKLT--AISNIANLTKLEDLWLNDNNI 438
           +N +      +T +      + +L++S N++    + N+  L  L  L+L +N I
Sbjct: 122 NNCLGSKGSPNTSILHKNKKIYILNLSNNQINEDILDNLLMLENLSILYLMNNPI 176



 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 49/168 (29%), Positives = 80/168 (47%), Gaps = 6/168 (3%)
 Frame = -2

Query: 848 VSNNQIAK--IEEIEHFHEL----QILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN 687
           + NN   K  IE+ E ++ +     +L L +     +E LQ L NL+ L+L  N +  I 
Sbjct: 4   ILNNDEVKNIIEKNEGYYSIIELNDVLYLNNKLYTKIECLQNLHNLKTLYLNNNALEKI- 62

Query: 686 LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANK 507
                               +GLE C+ L  LYL+ N I+++E L+ L+ LR+L++  N 
Sbjct: 63  --------------------EGLECCINLIALYLNCNQIKRIENLNNLIRLRILNLEDNN 102

Query: 506 LTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN 363
           +  I N+  L  LEDL L++N + S      ++    +K+  L L  N
Sbjct: 103 IFVIENLECLDCLEDLNLSNNCLGSKGSPNTSILHKNKKIYILNLSNN 150



>gb:AE014187_938962 Plasmodium falciparum 3D7 chromosome 14 complete
           sequence.>gb:AE014824_1228038 Plasmodium falciparum 3D7
           chromosome 14 section 9 of 13 of the complete sequence.
          Length = 338

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 59/223 (26%), Positives = 102/223 (45%), Gaps = 27/223 (12%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           S  KEL + N  I + EE+     LQ ++L  NKL+ ++ ++   NLQ++ L +N I  I
Sbjct: 34  SNCKELILKNRNIEECEELYQMKNLQKIDLSENKLKDLKMVEMNLNLQQIILQKNIIDNI 93

Query: 689 N-----------------------LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSH 579
           N                       +C LK IK + +  N +  +  L     LE L L +
Sbjct: 94  NYLNNINNLTYLNLSYNKIKIIDHICQLKNIKTLILAYNEIEKVPNLSSLQNLEVLILKN 153

Query: 578 NGIEKM-EGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV-EDIAEAVA 405
           N IEK  +    + +L+ + +S NK+      ++ +++ +L LN+N + ++ +DI     
Sbjct: 154 NMIEKFTKPAKEMRHLKKISLSFNKIREFYFGSHFSQIYELRLNNNKLINISKDII---- 209

Query: 404 GSLQKLTTLYLERNPCANSP--NYISTLRQIFPNIQQVDSELF 282
             +  L  L ++ N   N    NY+S L  +  NI   D+  F
Sbjct: 210 -YMTNLKLLCIQNNFIINQDFLNYLSQLNYL-KNIVLSDNPFF 250



>gb:AE017253_417269 Treponema denticola ATCC 35405, section 8 of 10
           of the complete genome.>gb:AE017226_1070865 Treponema
           denticola ATCC 35405, complete genome.
          Length = 273

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 44/119 (36%), Positives = 70/119 (58%), Gaps = 1/119 (0%)
 Frame = -2

Query: 797 LQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGL 618
           L+ L   +NKL V+ NL+ LT+L+ LW G N +  +NL  LK +  ++ + N+LT +  L
Sbjct: 155 LKRLGCNNNKLEVL-NLEGLTSLEHLWCGNNLLNKLNLTDLKSLTGLNCEKNKLTEL-DL 212

Query: 617 EECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDL-WLNDN 444
               ALE L+ S N + K+  L+  ++L+ LD S+N LT +    N  +L DL +LN +
Sbjct: 213 TGLTALEHLWCSKNLLTKL-NLTKALHLQSLDCSSNMLTEL----NTEELNDLQYLNSS 266



 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 41/130 (31%), Positives = 72/130 (55%)
 Frame = -2

Query: 752 NLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNG 573
           N+Q L NL++L    NR+  +N+ GL  +K+++ + NRL+S+  +    ALE L+ + N 
Sbjct: 85  NVQGLKNLEKLNCSGNRLTELNIEGLNNLKELACRYNRLSSL-DVAHLPALEFLWCTANL 143

Query: 572 IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQ 393
           +  +  L+ + +L+ L  + NKL  + N+  LT LE LW  +N ++ +          L+
Sbjct: 144 LTDL-NLTGMSSLKRLGCNNNKLEVL-NLEGLTSLEHLWCGNNLLNKLN------LTDLK 195

Query: 392 KLTTLYLERN 363
            LT L  E+N
Sbjct: 196 SLTGLNCEKN 205



>gb:BC029858_1979652 Homo sapiens B7 gene, transcript variant 1,
           mRNA (cDNA clone MGC:34414 IMAGE:5170643), complete cds.
          Length = 343

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 58/219 (26%), Positives = 104/219 (47%), Gaps = 6/219 (2%)
 Frame = -2

Query: 920 DVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQT 741
           D+S N +T  S L+ ++  L     ++  + +  ++     LQI     N++   E +  
Sbjct: 97  DISENHLTDLSPLNYLTHLL--WLKADGNLLRSAQMNELPYLQIASFAYNQITDTEGISH 154

Query: 740 LTNLQELWLGRNRIRAINLCGLKCIKKISIQS-----NRLTSMKGLEECVALEELYLSHN 576
              L+ L L  N I  +   GL   K IS+ +     N+L S  G+     L+ LYL+ N
Sbjct: 155 -PRLETLNLKGNSIHMVT--GLDPEKLISLHTVELRGNQLESTLGIN-LPKLKNLYLAQN 210

Query: 575 GIEKMEGLSTLVNLRVLDVSANKLTAISNIA-NLTKLEDLWLNDNNISSVEDIAEAVAGS 399
            ++K+EGL  L NL  L +  N++  +S  +  +  L+ L L  N ++++ ++A+     
Sbjct: 211 MLKKVEGLEDLSNLTTLHLRDNQIDTLSGFSREMKSLQYLNLRGNMVANLGELAK--LRD 268

Query: 398 LQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELF 282
           L KL  L L  NPC +  +Y        P ++++D E +
Sbjct: 269 LPKLRALVLLDNPCTDETSYRQEALVQMPYLERLDKEFY 307



>gb:BC024009_1978208 Homo sapiens similar to RIKEN cDNA 4930457P18,
           mRNA (cDNA clone MGC:26709 IMAGE:4822973), complete cds.
          Length = 638

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 52/150 (34%), Positives = 79/150 (52%), Gaps = 16/150 (10%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-N 687
           L+ L++ +N I KIE +E   EL+ L L  N LR +ENL+ L  L  L L  N I+ I N
Sbjct: 44  LRCLWLQSNGIQKIENLEAQTELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTIEN 103

Query: 686 LCGLKCIKKISIQSNRLTSMKG---LEECVALEELYLSHNGIEKMEGLS---TLVNLRVL 525
           L  L  +  + +  N L +++    L+EC+ L  L LSHN +   E LS   ++ +LRVL
Sbjct: 104 LSCLPVLNTLQMAHNHLETVEDIQHLQECLRLCVLDLSHNKLSDPEILSILESMPDLRVL 163

Query: 524 DVSAN---------KLTAISNIANLTKLED 462
           ++  N         + T    + +LT L+D
Sbjct: 164 NLMGNPVIRQIPNYRRTVTVRLKHLTYLDD 193



 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 51/173 (29%), Positives = 90/173 (52%), Gaps = 8/173 (4%)
 Frame = -2

Query: 854 LYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-NLCG 678
           LY+      +IE +E +  L+ L L SN ++ +ENL+  T L+ L+L  N +R I NL  
Sbjct: 25  LYLHFKGFDRIENLEEYTGLRCLWLQSNGIQKIENLEAQTELRCLFLQMNLLRKIENLEP 84

Query: 677 LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTL---VNLRVLDVSANK 507
           L+ +  +++ +N + +++ L     L  L ++HN +E +E +  L   + L VLD+S NK
Sbjct: 85  LQKLDALNLSNNYIKTIENLSCLPVLNTLQMAHNHLETVEDIQHLQECLRLCVLDLSHNK 144

Query: 506 LTAISNIANLTKLEDL----WLNDNNISSVEDIAEAVAGSLQKLTTLYLERNP 360
           L+    ++ L  + DL     + +  I  + +    V   L+ LT  YL+  P
Sbjct: 145 LSDPEILSILESMPDLRVLNLMGNPVIRQIPNYRRTVTVRLKHLT--YLDDRP 195



>gb:AK057238_1911943 Homo sapiens cDNA FLJ32676 fis, clone
           TESTI1000168, weakly similar to PROTEIN PHOSPHATASES PP1
           REGULATORY SUBUNIT SDS22.
          Length = 418

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 52/150 (34%), Positives = 79/150 (52%), Gaps = 16/150 (10%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-N 687
           L+ L++ +N I KIE +E   EL+ L L  N LR +ENL+ L  L  L L  N I+ I N
Sbjct: 131 LRCLWLQSNGIQKIENLEAQTELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTIEN 190

Query: 686 LCGLKCIKKISIQSNRLTSMKG---LEECVALEELYLSHNGIEKMEGLS---TLVNLRVL 525
           L  L  +  + +  N L +++    L+EC+ L  L LSHN +   E LS   ++ +LRVL
Sbjct: 191 LSCLPVLNTLQMAHNHLETVEDIQHLQECLRLCVLDLSHNKLSDPEILSILESMPDLRVL 250

Query: 524 DVSAN---------KLTAISNIANLTKLED 462
           ++  N         + T    + +LT L+D
Sbjct: 251 NLMGNPVIRQIPNYRRTVTVRLKHLTYLDD 280



 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 51/173 (29%), Positives = 90/173 (52%), Gaps = 8/173 (4%)
 Frame = -2

Query: 854 LYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-NLCG 678
           LY+      +IE +E +  L+ L L SN ++ +ENL+  T L+ L+L  N +R I NL  
Sbjct: 112 LYLHFKGFDRIENLEEYTGLRCLWLQSNGIQKIENLEAQTELRCLFLQMNLLRKIENLEP 171

Query: 677 LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTL---VNLRVLDVSANK 507
           L+ +  +++ +N + +++ L     L  L ++HN +E +E +  L   + L VLD+S NK
Sbjct: 172 LQKLDALNLSNNYIKTIENLSCLPVLNTLQMAHNHLETVEDIQHLQECLRLCVLDLSHNK 231

Query: 506 LTAISNIANLTKLEDL----WLNDNNISSVEDIAEAVAGSLQKLTTLYLERNP 360
           L+    ++ L  + DL     + +  I  + +    V   L+ LT  YL+  P
Sbjct: 232 LSDPEILSILESMPDLRVLNLMGNPVIRQIPNYRRTVTVRLKHLT--YLDDRP 282



>gb:AF290191_1783582 Cryptococcus neoformans var. grubii adenylate
            cyclase (CAC1) gene, complete cds.
          Length = 2271

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 48/159 (30%), Positives = 84/159 (52%), Gaps = 8/159 (5%)
 Frame = -2

Query: 878  KVSSTLKELYVSNNQIAKIEEIEHFHELQIL---ELGSNKLRVMEN-LQTLTNLQELWLG 711
            + S+TL  L VS N+IA +E +   HE++ L   ++ +NKL  M +    + +L+ L + 
Sbjct: 1024 RASTTLARLDVSCNRIADLESVA-LHEVETLVSLKVQNNKLTSMPSYFAQMKSLKYLNIS 1082

Query: 710  RNRIRAIN--LCGLKCIKKISIQSNRLTSMKG-LEECVALEELYLSHNGIEKM-EGLSTL 543
             N+       +C +  +  + +  N +  +   + +  +LE+L L  N I K  E   TL
Sbjct: 1083 NNKFETFPSVVCEMSNLVDLDVSFNNIAELPAKMSDLKSLEKLGLYSNDISKFPESFCTL 1142

Query: 542  VNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVE 426
             NLR+LDV  NK+T +S +  L  L  L  ++NNI +++
Sbjct: 1143 ANLRILDVRRNKITDLSAVYALPNLATLQADNNNIVTLD 1181



 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 60/215 (27%), Positives = 96/215 (44%), Gaps = 11/215 (5%)
 Frame = -2

Query: 956  SGVSIFKKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILE 783
            S V     L+  DVSFN I   P+ +S + S L++L + +N I+K  E       L+IL+
Sbjct: 1091 SVVCEMSNLVDLDVSFNNIAELPAKMSDLKS-LEKLGLYSNDISKFPESFCTLANLRILD 1149

Query: 782  LGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSM------KG 621
            +  NK+  +  +  L NL  L    N I  ++      +++ S+  N +T          
Sbjct: 1150 VRRNKITDLSAVYALPNLATLQADNNNIVTLDAQLGANVRQFSVPHNSVTRFTLAPPPNM 1209

Query: 620  LEECVALEELYLSHNGIEKM--EGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLN 450
                  L  L LSH  I  +  E  S L NL  L+++ N+ T + + +  LT LE     
Sbjct: 1210 AVVTYMLTNLDLSHGKISTLADEAFSGLTNLVTLNLNFNQFTKLPATLGRLTSLEVFSCT 1269

Query: 449  DNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSP 345
            DN +    ++  A  G LQ+L  + L  N   + P
Sbjct: 1270 DNML----NLVPAGFGKLQRLRMINLHNNNLKSLP 1300



>gb:AE017347_1758010 Cryptococcus neoformans var. neoformans JEC21
           chromosome 7, complete sequence.
          Length = 1344

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 48/159 (30%), Positives = 84/159 (52%), Gaps = 8/159 (5%)
 Frame = -2

Query: 878 KVSSTLKELYVSNNQIAKIEEIEHFHELQIL---ELGSNKLRVMEN-LQTLTNLQELWLG 711
           + S+TL  L VS N+IA +E +   HE++ L   ++ +NKL  M +    + +L+ L + 
Sbjct: 97  RASTTLARLDVSCNRIADLESVA-LHEVETLVSLKVQNNKLTSMPSYFAQMKSLKYLNIS 155

Query: 710 RNRIRAIN--LCGLKCIKKISIQSNRLTSMKG-LEECVALEELYLSHNGIEKM-EGLSTL 543
            N+       +C +  +  + +  N +  +   + +  +LE+L L  N I    E  STL
Sbjct: 156 NNKFETFPSVVCEMSNLVDLDVSFNNIAELPAKMSDLKSLEKLGLYSNDISNFPESFSTL 215

Query: 542 VNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVE 426
            NLR+LDV  NK+T +S +  L  L  L  ++NNI +++
Sbjct: 216 ANLRILDVRRNKITDLSAVYALPNLATLQADNNNIVTLD 254



 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 58/215 (26%), Positives = 95/215 (44%), Gaps = 11/215 (5%)
 Frame = -2

Query: 956 SGVSIFKKLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILE 783
           S V     L+  DVSFN I   P+ +S + S L++L + +N I+   E       L+IL+
Sbjct: 164 SVVCEMSNLVDLDVSFNNIAELPAKMSDLKS-LEKLGLYSNDISNFPESFSTLANLRILD 222

Query: 782 LGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSM------KG 621
           +  NK+  +  +  L NL  L    N I  ++      +++ S+  N +T          
Sbjct: 223 VRRNKITDLSAVYALPNLATLQADNNNIVTLDAQLGANVRQFSVPHNSVTRFTLAPPPNM 282

Query: 620 LEECVALEELYLSHNGIEKM--EGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLN 450
                 L  L LSH  I  +  E  S L NL  L+++ N+ T + + +  LT LE     
Sbjct: 283 AVVTYMLTNLDLSHGKISTLADEAFSGLTNLITLNLNFNQFTKLPATLDRLTSLEVFSCT 342

Query: 449 DNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSP 345
           DN +    ++  A  G L++L  + L  N   + P
Sbjct: 343 DNML----NLVPAGFGKLRRLRVINLHNNNLKSLP 373



>gb:AE016814_1745668 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome I, complete sequence.
          Length = 1874

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 76/271 (28%), Positives = 123/271 (45%), Gaps = 12/271 (4%)
 Frame = -2

Query: 932  LLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
            LL  D+S+N+I S P  ++++   L ++ +SNN+I  + ++     L+ L+L  N++  +
Sbjct: 755  LLQLDLSYNKIRSLPDSMNQLQK-LAKINLSNNRITHVNDLSKMTSLRTLDLRYNRIESI 813

Query: 755  ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSH- 579
            +    + NLQ L+L  NR+   +   L  ++ + +Q N L+        + L+  YL H 
Sbjct: 814  K--CRVPNLQNLFLTENRLTMFDDDQL-MLRTLELQRNPLS-------ILTLKNDYLEHL 863

Query: 578  --NGIEKME-------GLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSV 429
                I K +        L  L  L  L++S N LT +  +I +L KL  L +  N + S+
Sbjct: 864  TSLSISKAKLAVLPESLLRRLPRLEKLELSENSLTVLPPDIKHLKKLVHLSVAKNKLESL 923

Query: 428  EDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA**VILSQKPL 249
             D       SL+ L  L L  N     P  +STL   F NI            +LS    
Sbjct: 924  PD----EIASLKNLKMLDLHCNNLMTLPAALSTLSLTFVNISS---------NMLSGHHE 970

Query: 248  IL*RFQTQRNIIDSLLLIQSAADEMLNSH*W 156
            +   FQ   NI  SL+ + SAAD  +    W
Sbjct: 971  LYRTFQGTSNIAKSLMFL-SAADNQMGDKFW 1000



 Score = 40.0 bits (92), Expect = 0.11
 Identities = 53/203 (26%), Positives = 89/203 (43%), Gaps = 9/203 (4%)
 Frame = -2

Query: 872  SSTLKELYVSNNQ-----IAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGR 708
            +S ++ L VSNN      +  IE +     L+++ + ++  R   N+   T L  L L R
Sbjct: 636  TSDIESLDVSNNANIFLPLDFIESVIKLSSLRMVNIRAS--RFPSNICEATKLITLDLER 693

Query: 707  NRIRAINLCGLKCIKKISIQSNRLTSMKGLE-ECVALEELYLSHNGIEKMEGLSTLVNLR 531
            N            IK++  Q ++LT++  L   C  L+ L           G   L +L+
Sbjct: 694  N-----------FIKRVPDQMSKLTNLTILNLRCNELDRL---------PRGFKDLKSLQ 733

Query: 530  VLDVSANKLTAISNIAN-LTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPC- 357
            +LD+S+NK      + N  T L  L L+ N I S+ D        LQKL  + L  N   
Sbjct: 734  LLDISSNKFNIYPEVINSCTNLLQLDLSYNKIRSLPD----SMNQLQKLAKINLSNNRIT 789

Query: 356  -ANSPNYISTLRQIFPNIQQVDS 291
              N  + +++LR +     +++S
Sbjct: 790  HVNDLSKMTSLRTLDLRYNRIES 812



>gb:A90928_1451119 Sequence 1 from Patent WO9829538.
          Length = 1874

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 76/271 (28%), Positives = 123/271 (45%), Gaps = 12/271 (4%)
 Frame = -2

Query: 932  LLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM 756
            LL  D+S+N+I S P  ++++   L ++ +SNN+I  + ++     L+ L+L  N++  +
Sbjct: 755  LLQLDLSYNKIRSLPDSMNQLQK-LAKINLSNNRITHVNDLSKMTSLRTLDLRYNRIESI 813

Query: 755  ENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSH- 579
            +    + NLQ L+L  NR+   +   L  ++ + +Q N L+        + L+  YL H 
Sbjct: 814  K--CRVPNLQNLFLTENRLTMFDDDQL-MLRTLELQRNPLS-------ILTLKNDYLEHL 863

Query: 578  --NGIEKME-------GLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSV 429
                I K +        L  L  L  L++S N LT +  +I +L KL  L +  N + S+
Sbjct: 864  TSLSISKAKLAVLPESLLRRLPRLEKLELSENSLTVLPPDIKHLKKLVHLSVAKNKLESL 923

Query: 428  EDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA**VILSQKPL 249
             D       SL+ L  L L  N     P  +STL   F NI            +LS    
Sbjct: 924  PD----EIASLKNLKMLDLHCNNLMTLPAALSTLSLTFVNISS---------NMLSGHHE 970

Query: 248  IL*RFQTQRNIIDSLLLIQSAADEMLNSH*W 156
            +   FQ   NI  SL+ + SAAD  +    W
Sbjct: 971  LYRTFQGTSNIAKSLMFL-SAADNQMGDKFW 1000



 Score = 40.0 bits (92), Expect = 0.11
 Identities = 53/203 (26%), Positives = 89/203 (43%), Gaps = 9/203 (4%)
 Frame = -2

Query: 872  SSTLKELYVSNNQ-----IAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGR 708
            +S ++ L VSNN      +  IE +     L+++ + ++  R   N+   T L  L L R
Sbjct: 636  TSDIESLDVSNNANIFLPLDFIESVIKLSSLRMVNIRAS--RFPSNICEATKLITLDLER 693

Query: 707  NRIRAINLCGLKCIKKISIQSNRLTSMKGLE-ECVALEELYLSHNGIEKMEGLSTLVNLR 531
            N            IK++  Q ++LT++  L   C  L+ L           G   L +L+
Sbjct: 694  N-----------FIKRVPDQMSKLTNLTILNLRCNELDRL---------PRGFKDLKSLQ 733

Query: 530  VLDVSANKLTAISNIAN-LTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPC- 357
            +LD+S+NK      + N  T L  L L+ N I S+ D        LQKL  + L  N   
Sbjct: 734  LLDISSNKFNIYPEVINSCTNLLQLDLSYNKIRSLPD----SMNQLQKLAKINLSNNRIT 789

Query: 356  -ANSPNYISTLRQIFPNIQQVDS 291
              N  + +++LR +     +++S
Sbjct: 790  HVNDLSKMTSLRTLDLRYNRIES 812



>gb:AC125735_1208073 Leishmania major strain Friedlin chromosome 3,
           complete sequence.
          Length = 925

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 47/162 (29%), Positives = 84/162 (51%), Gaps = 21/162 (12%)
 Frame = -2

Query: 716 LGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLV 540
           L RN ++ + +L  L+ + +++   NR++ + GL   ++L +L L+HN +E ++ +S LV
Sbjct: 52  LSRNELQELTSLQPLRSLTRLNASYNRISLVDGLP--LSLTQLNLAHNKLEHLDCVSQLV 109

Query: 539 NLRVLDVSANKLTAISNIANLTKLEDLWLNDNNI-------------------SSVEDIA 417
           +LR LDVS N+LT++  + +   LE L  +DN I                   + VED+ 
Sbjct: 110 HLRELDVSFNRLTSLVGLHSRVPLEVLRADDNRIDRTSGLKELRSLRMASLSNNYVEDVD 169

Query: 416 EAV-AGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVD 294
           E +   +   L  L L  NP   +  Y  TL ++ P++  +D
Sbjct: 170 ELLFVSTTPSLQLLNLVGNPVTRARRYRQTLAELQPSLVSLD 211



 Score = 36.2 bits (82), Expect = 1.5
 Identities = 34/158 (21%), Positives = 71/158 (44%), Gaps = 3/158 (1%)
 Frame = -2

Query: 965 EENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQIL 786
           +E + +   + L   + S+N I+   GL     +L +L +++N++  ++ +     L+ L
Sbjct: 58  QELTSLQPLRSLTRLNASYNRISLVDGLPL---SLTQLNLAHNKLEHLDCVSQLVHLREL 114

Query: 785 ELGSNKLRVMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECV 606
           ++  N+L  +  L +   L+ L                         NR+    GL+E  
Sbjct: 115 DVSFNRLTSLVGLHSRVPLEVL---------------------RADDNRIDRTSGLKELR 153

Query: 605 ALEELYLSHNGIEKMEGL---STLVNLRVLDVSANKLT 501
           +L    LS+N +E ++ L   ST  +L++L++  N +T
Sbjct: 154 SLRMASLSNNYVEDVDELLFVSTTPSLQLLNLVGNPVT 191



>gb:HSM804649_1187246 Homo sapiens mRNA; cDNA DKFZp686C1634 (from
           clone DKFZp686C1634).
          Length = 548

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 52/150 (34%), Positives = 79/150 (52%), Gaps = 16/150 (10%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-N 687
           L+ L++ +N I KIE +E   EL+ L L  N LR +ENL+ L  L  L L  N I+ I N
Sbjct: 131 LRCLWLQSNGIQKIENLEAQTELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTIEN 190

Query: 686 LCGLKCIKKISIQSNRLTSMKG---LEECVALEELYLSHNGIEKMEGLS---TLVNLRVL 525
           L  L  +  + +  N L +++    L+EC+ L  L LSHN +   E LS   ++ +LRVL
Sbjct: 191 LSCLPVLNTLQMAHNHLETVEDIQHLQECLRLCVLDLSHNKLSDPEILSILESMPDLRVL 250

Query: 524 DVSAN---------KLTAISNIANLTKLED 462
           ++  N         + T    + +LT L+D
Sbjct: 251 NLMGNPVIRQIPNYRRTVTVRLKHLTYLDD 280



 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 51/173 (29%), Positives = 90/173 (52%), Gaps = 8/173 (4%)
 Frame = -2

Query: 854 LYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-NLCG 678
           LY+      +IE +E +  L+ L L SN ++ +ENL+  T L+ L+L  N +R I NL  
Sbjct: 112 LYLHFKGFDRIENLEEYTGLRCLWLQSNGIQKIENLEAQTELRCLFLQMNLLRKIENLEP 171

Query: 677 LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTL---VNLRVLDVSANK 507
           L+ +  +++ +N + +++ L     L  L ++HN +E +E +  L   + L VLD+S NK
Sbjct: 172 LQKLDALNLSNNYIKTIENLSCLPVLNTLQMAHNHLETVEDIQHLQECLRLCVLDLSHNK 231

Query: 506 LTAISNIANLTKLEDL----WLNDNNISSVEDIAEAVAGSLQKLTTLYLERNP 360
           L+    ++ L  + DL     + +  I  + +    V   L+ LT  YL+  P
Sbjct: 232 LSDPEILSILESMPDLRVLNLMGNPVIRQIPNYRRTVTVRLKHLT--YLDDRP 282



>gb:HSM804641_1187244 Homo sapiens mRNA; cDNA DKFZp686E1933 (from
           clone DKFZp686E1933).
          Length = 548

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 52/150 (34%), Positives = 79/150 (52%), Gaps = 16/150 (10%)
 Frame = -2

Query: 863 LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-N 687
           L+ L++ +N I KIE +E   EL+ L L  N LR +ENL+ L  L  L L  N I+ I N
Sbjct: 131 LRCLWLQSNGIQKIENLEAQTELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTIEN 190

Query: 686 LCGLKCIKKISIQSNRLTSMKG---LEECVALEELYLSHNGIEKMEGLS---TLVNLRVL 525
           L  L  +  + +  N L +++    L+EC+ L  L LSHN +   E LS   ++ +LRVL
Sbjct: 191 LSCLPVLNTLQMAHNHLETVEDIQHLQECLRLCVLDLSHNKLSDPEILSILESMPDLRVL 250

Query: 524 DVSAN---------KLTAISNIANLTKLED 462
           ++  N         + T    + +LT L+D
Sbjct: 251 NLMGNPVIRQIPNYRRTVTVRLKHLTYLDD 280



 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 51/173 (29%), Positives = 90/173 (52%), Gaps = 8/173 (4%)
 Frame = -2

Query: 854 LYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-NLCG 678
           LY+      +IE +E +  L+ L L SN ++ +ENL+  T L+ L+L  N +R I NL  
Sbjct: 112 LYLHFKGFDRIENLEEYTGLRCLWLQSNGIQKIENLEAQTELRCLFLQMNLLRKIENLEP 171

Query: 677 LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTL---VNLRVLDVSANK 507
           L+ +  +++ +N + +++ L     L  L ++HN +E +E +  L   + L VLD+S NK
Sbjct: 172 LQKLDALNLSNNYIKTIENLSCLPVLNTLQMAHNHLETVEDIQHLQECLRLCVLDLSHNK 231

Query: 506 LTAISNIANLTKLEDL----WLNDNNISSVEDIAEAVAGSLQKLTTLYLERNP 360
           L+    ++ L  + DL     + +  I  + +    V   L+ LT  YL+  P
Sbjct: 232 LSDPEILSILESMPDLRVLNLMGNPVIRQIPNYRRTVTVRLKHLT--YLDDRP 282



>gb:LIAJ4808_140499 Listeria ivanovii i-inlB, i-inlJ, i-inlI,
           i-inlH, i-inlG genes.
          Length = 272

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 41/133 (30%), Positives = 71/133 (53%), Gaps = 1/133 (0%)
 Frame = -2

Query: 740 LTNLQELWLGRNRI-RAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEK 564
           L N  +  LG+  +   ++   L  I+K++     + S+KG+E    L +LYLS+N I  
Sbjct: 51  LANAVKRQLGKQSVTEVVSQRELDEIQKLNGNGCNIKSIKGVEYLTNLTKLYLSYNHISD 110

Query: 563 MEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLT 384
           +  L++L  L VL +  NKL  I+++ANLTKL  L++++N +  +  +       L+ L 
Sbjct: 111 ISALASLSQLEVLSLKQNKLKDINSLANLTKLRCLYVSNNQLRDLWALE-----GLKNLE 165

Query: 383 TLYLERNPCANSP 345
            +  E   C N+P
Sbjct: 166 YVDAEEQTCTNNP 178



 Score = 52.0 bits (123), Expect = 3e-05
 Identities = 35/152 (23%), Positives = 67/152 (44%), Gaps = 1/152 (0%)
 Frame = -2

Query: 953 GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS 774
           G  ++   ++  +  NEI    GL+          +    + ++       E+Q L    
Sbjct: 28  GTKVYAAGILHSIPINEIFQDYGLANAVKR----QLGKQSVTEVVSQRELDEIQKLNGNG 83

Query: 773 NKLRVMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALE 597
             ++ ++ ++ LTNL +L+L  N I  I+ L  L  ++ +S++ N+L  +  L     L 
Sbjct: 84  CNIKSIKGVEYLTNLTKLYLSYNHISDISALASLSQLEVLSLKQNKLKDINSLANLTKLR 143

Query: 596 ELYLSHNGIEKMEGLSTLVNLRVLDVSANKLT 501
            LY+S+N +  +  L  L NL  +D      T
Sbjct: 144 CLYVSNNQLRDLWALEGLKNLEYVDAEEQTCT 175



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 32/112 (28%), Positives = 57/112 (50%), Gaps = 1/112 (0%)
 Frame = -2

Query: 869 STLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI 690
           + L +LY+S N I+ I  +    +L++L L  NKL+ + +L  LT L+ L++  N++R +
Sbjct: 96  TNLTKLYLSYNHISDISALASLSQLEVLSLKQNKLKDINSLANLTKLRCLYVSNNQLRDL 155

Query: 689 -NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN 537
             L GLK ++ +  +    T+       V  +   +  N I+ M G S   N
Sbjct: 156 WALEGLKNLEYVDAEEQTCTN-----NPVVYKPKVVIPNTIKDMSGKSVTPN 202



>pir|AH1469|AH1469 internalin protein homolog lin0295 [imported] -
           Listeria innocua (strain Clip11262)>gb:AL596164_537642
           Listeria innocua Clip11262 complete genome, segment
           2/12.
          Length = 361

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 37/150 (24%), Positives = 77/150 (51%), Gaps = 1/150 (0%)
 Frame = -2

Query: 866 TLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN 687
           T+K +      +  +  +E+ H L++++L  N +  ++NL  LT L+ + L  N+I  I 
Sbjct: 81  TIKTMVYIAFGVEDLTGMEYLHNLKLVDLSQNNISNLDNLANLTELEIVSLNYNQITDIT 140

Query: 686 -LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSAN 510
            L  L  +  + +  N+++++   E    L+ L LS N ++ +  L     L  L +SAN
Sbjct: 141 PLMNLPKLNNLELGVNQISTLPSFENLTNLKILNLSSNQLKDISALKDTPLLTNLSISAN 200

Query: 509 KLTAISNIANLTKLEDLWLNDNNISSVEDI 420
            ++ IS ++    L+  + + N ++S+E +
Sbjct: 201 NISDISVLSEFDNLQVFYADSNQLTSIEPL 230



 Score = 60.8 bits (146), Expect = 6e-08
 Identities = 43/150 (28%), Positives = 77/150 (51%), Gaps = 1/150 (0%)
 Frame = -2

Query: 860 KELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMENLQTLTNLQELWLGRNRIRAI-NL 684
           +EL VS + +   E+++    +  +  G   L  ME L    NL+ + L +N I  + NL
Sbjct: 64  QELGVSQDTVVTQEQLDTIKTMVYIAFGVEDLTGMEYLH---NLKLVDLSQNNISNLDNL 120

Query: 683 CGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKL 504
             L  ++ +S+  N++T +  L     L  L L  N I  +     L NL++L++S+N+L
Sbjct: 121 ANLTELEIVSLNYNQITDITPLMNLPKLNNLELGVNQISTLPSFENLTNLKILNLSSNQL 180

Query: 503 TAISNIANLTKLEDLWLNDNNISSVEDIAE 414
             IS + +   L +L ++ NNIS +  ++E
Sbjct: 181 KDISALKDTPLLTNLSISANNISDISVLSE 210



 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 48/184 (26%), Positives = 92/184 (50%), Gaps = 23/184 (12%)
 Frame = -2

Query: 965 EENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQIL 786
           E+ +G+     L + D+S N I++   L+ ++  L+ + ++ NQI  I  + +  +L  L
Sbjct: 93  EDLTGMEYLHNLKLVDLSQNNISNLDNLANLTE-LEIVSLNYNQITDITPLMNLPKLNNL 151

Query: 785 ELGSNKLRVMENLQTLTNLQELWLGRNRIRAIN-------LCGLKC----IKKISI---- 651
           ELG N++  + + + LTNL+ L L  N+++ I+       L  L      I  IS+    
Sbjct: 152 ELGVNQISTLPSFENLTNLKILNLSSNQLKDISALKDTPLLTNLSISANNISDISVLSEF 211

Query: 650 --------QSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAI 495
                    SN+LTS++ L     LE    + N I+ +  LST+  ++ + +  N+++  
Sbjct: 212 DNLQVFYADSNQLTSIEPLRNKTQLEYFNANFNQIKDVTPLSTIPTIKSIKIEENQISDF 271

Query: 494 SNIA 483
           S++A
Sbjct: 272 SSLA 275



>gb:AK122498_2069163 Mus musculus mRNA for mKIAA1365 protein.
          Length = 1497

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 52/199 (26%), Positives = 100/199 (50%), Gaps = 7/199 (3%)
 Frame = -2

Query: 893 PSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKLRVM-ENLQTLTNLQEL 720
           P  +     TL+ELY+  NQI ++ +++ +   L+ L +  N L  +  ++ +L NL+EL
Sbjct: 45  PKEVFNFERTLEELYLDANQIEELPKQLFNCQALRKLSIPDNDLSSLPTSIASLVNLKEL 104

Query: 719 WLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM-KGLEECVALEELYLSHNGIEKM-EGL 552
            + +N ++    N+   KC+  I    N ++ +  G  + + L +LYL+   +E +    
Sbjct: 105 DISKNGVQEFPENIKCCKCLTIIEASVNPISKLPDGFTQLLNLTQLYLNDAFLEFLPANF 164

Query: 551 STLVNLRVLDVSANKL-TAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLY 375
             LV LR+L++  N L T   ++  L +LE L L +N  S + ++ +     +Q L  L+
Sbjct: 165 GRLVKLRILELRENHLKTLPKSMHKLAQLERLDLGNNEFSELPEVLD----QIQNLRELW 220

Query: 374 LERNPCANSPNYISTLRQI 318
           ++ N     P  I  L+ +
Sbjct: 221 MDNNALQVLPGSIGKLKML 239



>gb:AF068716_1238363 Caenorhabditis elegans cosmid F26D11, complete
           sequence.>gb:CEL276590_1365791 Caenorhabditis elegans
           mRNA for LET-413 protein.
          Length = 679

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 50/166 (30%), Positives = 90/166 (54%), Gaps = 6/166 (3%)
 Frame = -2

Query: 797 LQILELGSNKLRVME-NLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM 627
           L++LE   N LR +  ++  L  L+EL LG+N + A+   +  L  +++  +  N LTS+
Sbjct: 153 LRVLEARDNLLRTIPLSIVELRKLEELDLGQNELEALPAEIGKLTSLREFYVDINSLTSL 212

Query: 626 K-GLEECVALEELYLSHNGIEKM-EGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLW 456
              +  C  L++L +S N I ++ E L  + NL  L++S N++  + S+   L +L+ L 
Sbjct: 213 PDSISGCRMLDQLDVSENQIIRLPENLGRMPNLTDLNISINEIIELPSSFGELKRLQMLK 272

Query: 455 LNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQI 318
            + N++ ++     +  G  Q LT LYL +N   + P+ I  LRQ+
Sbjct: 273 ADRNSLHNLT----SEIGKCQSLTELYLGQNFLTDLPDTIGDLRQL 314



 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 49/177 (27%), Positives = 91/177 (51%), Gaps = 8/177 (4%)
 Frame = -2

Query: 920 DVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKLR-VMEN 750
           DVS N+I   P  L ++ + L +L +S N+I ++         LQ+L+   N L  +   
Sbjct: 226 DVSENQIIRLPENLGRMPN-LTDLNISINEIIELPSSFGELKRLQMLKADRNSLHNLTSE 284

Query: 749 LQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSMKG-LEECVALEELYLSH 579
           +    +L EL+LG+N +  +   +  L+ +  +++  N L+ +   +  C +L  L L  
Sbjct: 285 IGKCQSLTELYLGQNFLTDLPDTIGDLRQLTTLNVDCNNLSDIPDTIGNCKSLTVLSLRQ 344

Query: 578 NGIEKME-GLSTLVNLRVLDVSANKLTAIS-NIANLTKLEDLWLNDNNISSVEDIAE 414
           N + ++   +    NL VLDV++NKL  +   +  L KL+ LWL++N   S+  ++E
Sbjct: 345 NILTELPMTIGKCENLTVLDVASNKLPHLPFTVKVLYKLQALWLSENQTQSILKLSE 401



 Score = 52.0 bits (123), Expect = 3e-05
 Identities = 36/91 (39%), Positives = 56/91 (61%), Gaps = 2/91 (2%)
 Frame = -2

Query: 602 LEELYLSHNGIEKMEG-LSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSV 429
           LE+L L+ N I++++  L +L +LR+LDVS N+L  + + I NLT+L +L LN N+I+ +
Sbjct: 38  LEDLNLTMNNIKELDHRLFSLRHLRILDVSDNELAVLPAEIGNLTQLIELNLNRNSIAKL 97

Query: 428 EDIAEAVAGSLQKLTTLYLERNPCANSPNYI 336
            D  +    + + LTTL L  NP    P  I
Sbjct: 98  PDTMQ----NCKLLTTLNLSSNPFTRLPETI 124



>gb:AF068716_1238362 Caenorhabditis elegans cosmid F26D11, complete
           sequence.
          Length = 699

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 50/166 (30%), Positives = 90/166 (54%), Gaps = 6/166 (3%)
 Frame = -2

Query: 797 LQILELGSNKLRVME-NLQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSM 627
           L++LE   N LR +  ++  L  L+EL LG+N + A+   +  L  +++  +  N LTS+
Sbjct: 153 LRVLEARDNLLRTIPLSIVELRKLEELDLGQNELEALPAEIGKLTSLREFYVDINSLTSL 212

Query: 626 K-GLEECVALEELYLSHNGIEKM-EGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLW 456
              +  C  L++L +S N I ++ E L  + NL  L++S N++  + S+   L +L+ L 
Sbjct: 213 PDSISGCRMLDQLDVSENQIIRLPENLGRMPNLTDLNISINEIIELPSSFGELKRLQMLK 272

Query: 455 LNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQI 318
            + N++ ++     +  G  Q LT LYL +N   + P+ I  LRQ+
Sbjct: 273 ADRNSLHNLT----SEIGKCQSLTELYLGQNFLTDLPDTIGDLRQL 314



 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 49/177 (27%), Positives = 91/177 (51%), Gaps = 8/177 (4%)
 Frame = -2

Query: 920 DVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKI-EEIEHFHELQILELGSNKLR-VMEN 750
           DVS N+I   P  L ++ + L +L +S N+I ++         LQ+L+   N L  +   
Sbjct: 226 DVSENQIIRLPENLGRMPN-LTDLNISINEIIELPSSFGELKRLQMLKADRNSLHNLTSE 284

Query: 749 LQTLTNLQELWLGRNRIRAI--NLCGLKCIKKISIQSNRLTSMKG-LEECVALEELYLSH 579
           +    +L EL+LG+N +  +   +  L+ +  +++  N L+ +   +  C +L  L L  
Sbjct: 285 IGKCQSLTELYLGQNFLTDLPDTIGDLRQLTTLNVDCNNLSDIPDTIGNCKSLTVLSLRQ 344

Query: 578 NGIEKME-GLSTLVNLRVLDVSANKLTAIS-NIANLTKLEDLWLNDNNISSVEDIAE 414
           N + ++   +    NL VLDV++NKL  +   +  L KL+ LWL++N   S+  ++E
Sbjct: 345 NILTELPMTIGKCENLTVLDVASNKLPHLPFTVKVLYKLQALWLSENQTQSILKLSE 401



 Score = 52.0 bits (123), Expect = 3e-05
 Identities = 36/91 (39%), Positives = 56/91 (61%), Gaps = 2/91 (2%)
 Frame = -2

Query: 602 LEELYLSHNGIEKMEG-LSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSV 429
           LE+L L+ N I++++  L +L +LR+LDVS N+L  + + I NLT+L +L LN N+I+ +
Sbjct: 38  LEDLNLTMNNIKELDHRLFSLRHLRILDVSDNELAVLPAEIGNLTQLIELNLNRNSIAKL 97

Query: 428 EDIAEAVAGSLQKLTTLYLERNPCANSPNYI 336
            D  +    + + LTTL L  NP    P  I
Sbjct: 98  PDTMQ----NCKLLTTLNLSSNPFTRLPETI 124


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,361,244,475
Number of Sequences: 1806583
Number of extensions: 28881278
Number of successful extensions: 89695
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 77860
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 87567
length of database: 581,917,975
effective HSP length: 128
effective length of database: 350,675,351
effective search space used: 108709358810
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)