BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig9920
         (804 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP005493_1852814 Oryza sativa (japonica cultivar-group) genom...   188   1e-46   
pir|H96586|H96586 hypothetical protein F20D21.31 [imported] - Ar...   176   5e-43   Arabidopsis thaliana [mouse-ear cress]
pir|G90103|G90103 rubredoxin [imported] - Guillardia theta nucle...    89   7e-17   Guillardia theta
gb:AY123111_1579979 Griffithsia japonica rubredoxin mRNA, comple...    84   2e-15   
gb:AP008231_580066 Synechococcus elongatus PCC 6301 DNA, complet...    77   5e-13   
sp|P73068|RUBR_SYNY3|RUBR_SYNY3 Rubredoxin (Rd).>pir|S75176|S75176 rubredox...    75   1e-12   Synechocystis sp.
gb:BA000039_727480 Thermosynechococcus elongatus BP-1 DNA, compl...    73   7e-12   
sp|Q9XBL8|RUBR_ANAVA|RUBR_ANAVA Rubredoxin (Rd).>gb:AVA012181_583518 Anabae...    71   3e-11   
sp|Q9WWN1|RUBR_ANASP|RUBR_ANASP Rubredoxin (Rd).>pir|AD2286|AD2286 rubredox...    70   5e-11   Anabaena sp.
gb:APC012180_582234 Anabaena PCC7120 hoxR gene and ndhCKJ gene c...    69   1e-10   
gb:BA000045_740929 Gloeobacter violaceus PCC 7421 DNA, complete ...    67   3e-10   
gb:AE013163_289741 Thermoanaerobacter tengcongensis MB4, section...    67   3e-10   
sp|Q9AE66|RUB4_RHOER|RUB4_RHOER Rubredoxin 4.>gb:RER297269_162899 Rhodococc...    65   1e-09   Rhodococcus erythropolis
pir|AC1953|AC1953 rubrerythrin [imported] - Nostoc sp. (strain P...    65   1e-09   Nostoc sp. PCC 7120
sp|O26258|RUBR_METTH|RUBR_METTH Probable rubredoxin (RD).>pir|G69073|G69073...    65   2e-09   Methanothermobacter thermautotrophicus
gb:AY548447_627425 Fremyella diplosiphon clone 3107H12 putative ...    64   3e-09   
gb:AE017282_428014 Methylococcus capsulatus str. Bath, complete ...    64   3e-09   
sp|P58025|RUB3_CHLTE|RUB3_CHLTE Rubredoxin 3 (Rd 3).>gb:AE012952_287483 Chl...    64   3e-09   Chlorobaculum tepidum
pir|T44570|RUPF rubredoxin [validated] - Pyrococcus furiosus>gb:...    64   4e-09   
sp|P24297|RUBR_PYRFU|RUBR_PYRFU Rubredoxin (Rd).                                  64   4e-09   Pyrococcus furiosus
pir|D69418|D69418 rubredoxin (rd-2) homolog - Archaeoglobus fulg...    63   6e-09   Archaeoglobus fulgidus
sp|Q9AE63|RUB2_RHOER|RUB2_RHOER Rubredoxin 2.>gb:RER9586_162929 Rhodococcus...    63   6e-09   Rhodococcus erythropolis
gb:AY075046_587806 Synechococcus sp. PCC 7002 hypothetical prote...    63   7e-09   
gb:AP006618_561016 Nocardia farcinica IFM 10152 DNA, complete ge...    63   7e-09   
sp|P28151|RUBL_RHILV|RUBL_RHILV Probable rubredoxin hupI.>pir|S27340|S27340...    63   7e-09   Rhizobium leguminosarum bv. viciae
gb:AF388181_506499 Rhodococcus sp. Q15 putative alkane-1-monooxy...    62   1e-08   
sp|P00270|RUBR_DESGI|RUBR_DESGI Rubredoxin (Rd).>pir|A00275|RUDVEG rubredox...    62   1e-08   Desulfovibrio gigas
gb:CBRUBRDOX_845462 C.butyricum gene encoding rubredoxin.              62   1e-08   
gb:AE017180_401476 Geobacter sulfurreducens PCA, complete genome.      62   1e-08   
sp|P00269|RUBR_DESVH|RUBR_DESVH Rubredoxin (Rd).>pir|B33962|RUDV rubredoxin...    62   1e-08   Desulfovibrio vulgaris
sp|P09947|RUBR_CHLLT|RUBR_CHLLT Rubredoxin (Rd).>pir|A27537|A27537 rubredox...    62   2e-08   Chlorobaculum thiosulfatiphilum
sp|Q9FDN6|HRB_MOOTH|HRB_MOOTH High molecular weight rubredoxin (Nitric oxi...    62   2e-08   Moorella thermoacetica
pir|H72348|H72348 rubredoxin - Thermotoga maritima (strain MSB8)...    61   2e-08   Thermotoga maritima
gb:BX569689_775108 Synechococcus sp. WH8102 complete genome; seg...    61   3e-08   
sp|Q9V099|RUBR_PYRAB|RUBR_PYRAB Rubredoxin (Rd).>pir|E75136|E75136 rubredox...    61   3e-08   Pyrococcus abyssi
pir|H69359|H69359 rubredoxin (rd-1) homolog - Archaeoglobus fulg...    60   4e-08   Archaeoglobus fulgidus
gb:AE017162_394837 Prochlorococcus marinus subsp. marinus str. C...    60   5e-08   
sp|P19500|RUBR_CLOTS|RUBR_CLOTS Rubredoxin (Rd).>pir|A33173|A33173 rubredox...    60   5e-08   Thermoanaerobacterium thermosaccharolyticum
gb:AF321851_499760 Desulfovibrio desulfuricans bacterioferritin ...    60   6e-08   
pir|D70593|D70593 probable rubB protein - Mycobacterium tubercul...    60   6e-08   Mycobacterium tuberculosis
sp|Q93PP8|RUB2_DESDE|RUB2_DESDE Rubredoxin 2 (Rd-2).                              60   6e-08   Desulfovibrio desulfuricans
sp|P15412|RUBR_DESVM|RUBR_DESVM Rubredoxin (Rd).>pir|JX0241|JX0241 rubredox...    59   8e-08   Desulfovibrio vulgaris
gb:AP006878_575676 Thermococcus kodakaraensis strain KOD1 DNA, c...    59   1e-07   
gb:AE004969_60613 Neisseria gonorrhoeae FA 1090, complete genome.      59   1e-07   
gb:BX572100_799236 Prochlorococcus marinus MIT9313 complete geno...    59   1e-07   
gb:TISHUPS_197737 Thiocapsa roseopersicina hydrogenase small sub...    59   1e-07   
gb:D86986_120934 Pseudomonas hydrogenovora hup genes, complete a...    59   1e-07   
gb:AB112870_13767 Gordonia sp. TF6 alkB2, rubA3, rubA4 genes for...    59   1e-07   
pir|H81133|H81133 rubredoxin NMB0993 [imported] - Neisseria meni...    59   1e-07   Neisseria meningitidis serogroup B
sp|P30778|RUBR_AZOVI|RUBR_AZOVI Rubredoxin (Rd).>pir|S22223|E44915 rubredox...    59   1e-07   Azotobacter vinelandii
gb:AF214145_488914 Rhodobacter sphaeroides hup gene cluster, par...    58   2e-07   
gb:AE017180_399150 Geobacter sulfurreducens PCA, complete genome.      58   2e-07   
sp|P56263|RUBR_HELMO|RUBR_HELMO Rubredoxin (Rd).>pir|S65620|S65620 rubredox...    58   2e-07   Heliobacillus mobilis
gb:CCE238458_845537 Clostridium cellulolyticum rub gene for rubr...    57   3e-07   
gb:AF202316_488081 Moorella thermoacetica rubredoxin Rd (rub), N...    57   3e-07   
gb:AE008766_243224 Salmonella typhimurium LT2, section 70 of 220...    57   3e-07   
gb:DBRBORUB_124049 D.baarsii rbo & rub genes.                          57   3e-07   
pir|AF0676|AF0676 hydrogenase-1 operon protein HyaF2 [imported] ...    57   3e-07   Salmonella enterica subsp. enterica serovar Typhi
gb:BX572090_795921 Prochlorococcus marinus MED4 complete genome;...    57   4e-07   
gb:BX569695_777271 Synechococcus sp. WH8102 complete genome; seg...    57   4e-07   
gb:AE017162_394784 Prochlorococcus marinus subsp. marinus str. C...    57   4e-07   
gb:CP000026_76152 Salmonella enterica subsp. enterica serovar Pa...    57   4e-07   
pir|A59199|A59199 hybrid cluster [4Fe-2S-3O] protein MTH1453 [si...    57   5e-07   Methanothermobacter thermautotrophicus str. Delta H
sp|P14071|RUBR_BUTME|RUBR_BUTME Rubredoxin (Rd).>pir|JU0127|JU0127 rubredox...    57   5e-07   [Butyribacterium] methylotrophicum
sp|Q03009|HUPJ_RHOCA|HUPJ_RHOCA Probable rubredoxin hupJ.>pir|S32946|S25690...    57   5e-07   Rhodobacter capsulatus
sp|P23474|RUBR_CLOST|RUBR_CLOST Rubredoxin (Rd).>pir|A33182|A33182 rubredox...    56   7e-07   Acetoanaerobium sticklandii
sp|P58992|RUB1_CHLTE|RUB1_CHLTE Rubredoxin 1 (Rd 1).>gb:AE012873_286575 Chl...    56   7e-07   Chlorobaculum tepidum
gb:AE017249_416098 Treponema denticola ATCC 35405, section 4 of ...    56   9e-07   
gb:AB090267_12106 Desulfovibrio vulgaris orf-1, fur, rbr, rlp, g...    56   9e-07   
pir|AE2375|AE2375 rubredoxin [imported] - Nostoc sp. (strain PCC...    56   9e-07   Nostoc sp. PCC 7120
gb:AE016794_334694 Pseudomonas putida KT2440 section 21 of 21 of...    55   1e-06   
pir|B69075|B69075 rubredoxin - Methanobacterium thermoautotrophi...    55   1e-06   Methanothermobacter thermautotrophicus str. Delta H
gb:AY658305_2147315 Synthetic construct Peudomonas aeruginosa cl...    55   2e-06   
gb:AE016966_369062 Coxiella burnetii strain RSA 493, section 7 o...    55   2e-06   
pir|JU0074|JU0074 rubredoxin - Clostridium perfringens                 55   2e-06   Clostridium perfringens
sp|Q9AL94|RUBR_CLOAB|RUBR_CLOAB Rubredoxin (Rd).>pir|G97241|G97241 rubredox...    55   2e-06   Clostridium acetobutylicum
sp|P14072|RUB2_CLOPE|RUB2_CLOPE Rubredoxin 2 (Rd 2).>gb:BA000016_673820 Clo...    55   2e-06   Clostridium perfringens
gb:AF082663_477606 Rhodococcus sp. NCIMB12038 naphthalene degrad...    55   2e-06   
gb:AE016910_355113 Chromobacterium violaceum ATCC 12472 section ...    55   2e-06   
gb:DVU82323_124384 Desulfovibrio vulgaris ferric uptake regulato...    55   2e-06   
sp|Q58145|RUB1_METJA|RUB1_METJA Probable rubredoxin 1 (RD 1).>pir|G64391|G6...    55   2e-06   Methanocaldococcus jannaschii
gb:AY392423_615966 Rhodococcus sp. P400 rubredoxin (rub1), putat...    54   3e-06   
gb:AE016936_361907 Bacteroides thetaiotaomicron VPI-5482, sectio...    54   3e-06   
sp|Q58150|RUB2_METJA|RUB2_METJA Probable rubredoxin 2 (RD 2).>pir|D64392|D6...    54   3e-06   Methanocaldococcus jannaschii
sp|P58993|RUB2_CHLTE|RUB2_CHLTE Rubredoxin 2 (Rd 2).>gb:AE012873_286576 Chl...    54   3e-06   Chlorobaculum tepidum
gb:PPU233397_159563 Pseudomonas putida P1 alkane degradation gen...    54   4e-06   
gb:CR628336_111607 Legionella pneumophila str. Paris complete ge...    54   4e-06   
pir|F87558|F87558 rubredoxin [imported] - Caulobacter crescentus...    54   4e-06   Caulobacter vibrioides
gb:BX572101_799507 Prochlorococcus marinus MIT9313 complete geno...    53   6e-06   
gb:AY581127_629860 Azorhizobium caulinodans strain ORS571 hydrog...    53   6e-06   
gb:AJ749949_531052 Francisella tularensis subsp. tularensis comp...    53   6e-06   
gb:AB110633_13530 Rhodococcus opacus plasmid pWK301 orf6, dodR1,...    53   6e-06   
gb:ARU9587_582584 Prauserella rugosa alkB gene for alkane-1 mono...    53   8e-06   
gb:AP008231_582132 Synechococcus elongatus PCC 6301 DNA, complet...    53   8e-06   
gb:AP006841_574865 Bacteroides fragilis YCH46 DNA, complete genome.    53   8e-06   
gb:ABO295164_18430 Alcanivorax borkumensis AP1 alk gene cluster ...    53   8e-06   
pir|H82976|H82976 rubredoxin PA5350 [imported] - Pseudomonas aer...    53   8e-06   Pseudomonas aeruginosa
pir|B32850|RUPSEO rubredoxin II - Pseudomonas oleovorans plasmid...    53   8e-06   
sp|P48344|RUBL_BRAJA|RUBL_BRAJA Probable rubredoxin hupI.>gb:RHBFRA_163678 ...    53   8e-06   Bradyrhizobium japonicum
sp|P00272|RUB2_PSEOL|RUB2_PSEOL Rubredoxin 2 (Two-iron rubredoxin).               53   8e-06   Pseudomonas oleovorans
gb:BX321861_773754 Nitrosomonas europaea ATCC 19718, complete ge...    52   1e-05   
sp|P42453|RUBR_ACICA|RUBR_ACICA Rubredoxin (Rd).>pir|I39520|I39520 rubredox...    52   1e-05   Acinetobacter calcoaceticus
gb:AB024936_4148 Rhodococcus sp. CIR2 naphthalene degradation ge...    52   1e-05   
sp|P31912|RUBR_ALCEU|RUBR_ALCEU Rubredoxin (Rd).>pir|I43255|I43255 rubredox...    52   1e-05   Cupriavidus necator
gb:AF082663_477603 Rhodococcus sp. NCIMB12038 naphthalene degrad...    51   2e-05   
gb:AY658315_2147325 Synthetic construct Peudomonas aeruginosa cl...    51   3e-05   
gb:AE015940_320508 Clostridium tetani E88, section 5 of 10 of th...    51   3e-05   
sp|P00271|RUBR_MEGEL|RUBR_MEGEL Rubredoxin (Rd).>pir|A00277|RUME rubredoxin...    51   3e-05   Megasphaera elsdenii
gb:AY458639_619403 Uncultured bacterium 442 clone EBAC000-63A02 ...    50   4e-05   
gb:AB049412_7346 Acinetobacter sp. M-1 lysS, rubA, rubB gene for...    50   4e-05   
sp|P00268|RUBR_CLOPA|RUBR_CLOPA Rubredoxin (Rd).>pir|S29120|RUCLEP rubredox...    50   4e-05   Clostridium pasteurianum
gb:BX640411_804763 Bordetella pertussis strain Tohama I, complet...    50   5e-05   
gb:AE012443_282494 Xanthomonas campestris pv. campestris str. AT...    50   5e-05   
gb:AE010647_265318 Fusobacterium nucleatum subsp. nucleatum ATCC...    50   5e-05   
gb:BX571965_792491 Burkholderia pseudomallei strain K96243, chro...    50   6e-05   
gb:AB112870_13766 Gordonia sp. TF6 alkB2, rubA3, rubA4 genes for...    50   6e-05   
gb:AE016794_334750 Pseudomonas putida KT2440 section 21 of 21 of...    49   8e-05   
pir|A82977|A82977 rubredoxin PA5351 [imported] - Pseudomonas aer...    49   8e-05   Pseudomonas aeruginosa
gb:AE013598_294825 Xanthomonas oryzae pv. oryzae KACC10331, comp...    49   1e-04   
sp|P48343|RUBR_AZOCH|RUBR_AZOCH Rubredoxin in uptake hydrogenase operon.>pi...    49   1e-04   Azotobacter chroococcum (strain mcd 1)
sp|Q9AE67|RUB3_RHOER|RUB3_RHOER Rubredoxin 3.>gb:RER297269_162898 Rhodococc...    49   1e-04   Rhodococcus erythropolis
gb:AL646060_545595 Ralstonia solanacearum GMI1000 chromosome, co...    49   1e-04   
gb:BX572596_800585 Rhodopseudomonas palustris CGA009 complete ge...    48   2e-04   
gb:AE011987_278328 Xanthomonas axonopodis pv. citri str. 306, se...    48   2e-04   
sp|O83956|RUBR_TREPA|RUBR_TREPA Rubredoxin (Rd).>pir|G71256|G71256 probable...    48   2e-04   Treponema pallidum
sp|P04170|RUB1_DESDE|RUB1_DESDE Rubredoxin 1 (Rd-1).>pir|A00276|RUDVD rubre...    48   2e-04   Desulfovibrio desulfuricans
gb:AP006618_561017 Nocardia farcinica IFM 10152 DNA, complete ge...    48   2e-04   
sp|Q8XMB2|RUB1_CLOPE|RUB1_CLOPE Rubredoxin 1 (Rd 1).>gb:BA000016_673817 Clo...    47   4e-04   Clostridium perfringens
gb:AE016875_354805 Pseudomonas syringae pv. tomato str. DC3000 s...    47   5e-04   
sp|Q46877|NORV_ECOLI|NORV_ECOLI Anaerobic nitric oxide reductase flavorubre...    47   5e-04   Escherichia coli [E. coli]
gb:AE000906_29124 Methanobacterium thermoautotrophicum from base...    46   0.001   
sp|P59405|NORV_SHIFL|NORV_SHIFL Anaerobic nitric oxide reductase flavorubre...    46   0.001   Shigella flexneri
sp|P59404|NORV_ECOL6|NORV_ECOL6 Anaerobic nitric oxide reductase flavorubre...    46   0.001   
sp|Q8X852|NORV_ECO57|NORV_ECO57 Anaerobic nitric oxide reductase flavorubre...    46   0.001   Escherichia coli O157:H7
gb:CP000026_77439 Salmonella enterica subsp. enterica serovar Pa...    45   0.001   
gb:AF388181_506498 Rhodococcus sp. Q15 putative alkane-1-monooxy...    45   0.002   
gb:RER9586_162928 Rhodococcus erythropolis putative TetR-regulat...    45   0.002   
gb:CR555306_105683 Azoarcus sp. EbN1 complete genome.                  45   0.002   
gb:AE000516_23461 Mycobacterium tuberculosis CDC1551, complete g...    45   0.002   
pir|E70593|E70593 probable rubA protein - Mycobacterium tubercul...    45   0.002   Mycobacterium tuberculosis
sp|Q8ZMJ7|NORV_SALTY|NORV_SALTY Anaerobic nitric oxide reductase flavorubre...    45   0.002   Salmonella enterica subsp. enterica serovar Typhimurium
gb:BX950851_839651 Erwinia carotovora subsp. atroseptica SCRI104...    45   0.002   
sp|Q8Z4C5|NORV_SALTI|NORV_SALTI Anaerobic nitric oxide reductase flavorubre...    45   0.002   Salmonella enterica subsp. enterica serovar Typhi
gb:BX957219_843556 Methanococcus maripaludis S2 complete genome;...    44   0.004   
gb:CR522870_101758 Desulfotalea psychrophila LSv54 chromosome.         44   0.004   
sp|P00267|RUBR_PEPAS|RUBR_PEPAS Rubredoxin (Rd).>pir|A00272|RUPE rubredoxin...    44   0.005   Peptoniphilus asaccharolyticus
gb:BX571965_790849 Burkholderia pseudomallei strain K96243, chro...    43   0.006   
gb:AE012559_285072 Xylella fastidiosa Temecula1, section 7 of 9 ...    43   0.006   
pir|B82814|B82814 rubredoxin XF0379 [imported] - Xylella fastidi...    43   0.006   Xylella fastidiosa
gb:CR378666_94532 Photobacterium profundum SS9; segment 4/12.          43   0.008   
gb:BX957220_843749 Methanococcus maripaludis S2 complete genome;...    42   0.013   
gb:CP000020_871958 Vibrio fischeri ES114 chromosome I, complete ...    42   0.018   
gb:PPU233397_159562 Pseudomonas putida P1 alkane degradation gen...    41   0.023   
sp|P12692|RUB1_PSEOL|RUB1_PSEOL Rubredoxin 1.>pir|A32850|RUPSO1 rubredoxin ...    40   0.039   Pseudomonas oleovorans
gb:AB017063_1513343 Arabidopsis thaliana genomic DNA, chromosome...    39   0.087   
gb:AF350429_503937 Nocardioides sp. CF8 alkane hydroxylase-rubre...    39   0.15    
gb:BA000038_724269 Vibrio vulnificus YJ016 DNA, chromosome II, c...    36   0.97    
gb:AE017165_395948 Prochlorococcus marinus subsp. marinus str. C...    36   0.97    
sp|Q8D4F8|NORV_VIBVU|NORV_VIBVU Anaerobic nitric oxide reductase flavorubre...    36   0.97    Vibrio vulnificus
gb:AF340222_2142682 Synthetic construct PhpA-79 (phpA-79) gene, ...    35   2.2     
gb:AF318954_499443 Streptococcus pneumoniae pneumococcal histidi...    35   2.2     
pir|B95136|B95136 conserved domain protein SP1174 [imported] - S...    35   2.2     Streptococcus pneumoniae
pir|D69162|D69162 pyruvate dehydrogenase / acetolactate synthase...    35   2.2     Methanothermobacter thermautotrophicus str. Delta H
gb:AE017332_445939 Mycoplasma hyopneumoniae 232, complete genome.      34   2.8     
pir|G75072|G75072 prolyl-tRNA synthetase (pros) PAB1724 - Pyroco...    34   2.8     Pyrococcus abyssi
gb:AY428796_1326006 Dictyostelium discoideum DIF insensitive mut...    34   3.7     
gb:CAJ10145_845052 Clostridium butyricum gene encoding rubredoxi...    34   3.7     
gb:BA000030_697995 Streptomyces avermitilis MA-4680 genomic DNA,...    34   3.7     
gb:AF083501_2191670 Macaca mulatta rhadinovirus 17577, complete ...    32   4.6     
gb:AK125814_1916071 Homo sapiens cDNA FLJ43826 fis, clone TESTI4...    33   4.8     
gb:AF332857S2_1897110 Homo sapiens acyl coenzyme A: cholesterol ...    33   4.8     
gb:AF099031_1882956 Homo sapiens acyl Co-A: cholesterol acyltran...    33   4.8     
gb:AE017343_1755856 Cryptococcus neoformans var. neoformans JEC2...    33   4.8     
gb:CR382132_1665859 Yarrowia lipolytica chromosome F of strain C...    33   4.8     
sp|O75908|SOA2_HUMAN|SOA2_HUMAN Sterol O-acyltransferase 2 (EC 2.3.1.26) (C...    33   4.8     Homo sapiens [man]
gb:BC066195_2105783 Mus musculus Sec23 interacting protein, mRNA...    33   6.3     
gb:CET12G3_1367662 Caenorhabditis elegans cosmid T12G3, complete...    33   6.3     
pir|T24869|T24869 hypothetical protein T12G3.1 - Caenorhabditis ...    33   6.3     Caenorhabditis elegans [roundworm]
gb:BC058055_2552244 Danio rerio ubiquitin-like, containing PHD a...    33   8.2     
gb:AJ629843_2278480 Chrysanthemum virus B cp gene for coat prote...    33   8.2     
gb:AY819760_1964925 Homo sapiens mucosal vascular addressin cell...    33   8.2     
gb:AE017342_1754943 Cryptococcus neoformans var. neoformans JEC2...    33   8.2     
gb:AC092387_1735287 Oryza sativa chromosome 10 BAC OJ1004_F02 ge...    33   8.2     
gb:CR548612_1375499 Paramecium tetraurelia macronuclear largest ...    33   8.2     
gb:BA000030_704115 Streptomyces avermitilis MA-4680 genomic DNA,...    33   8.2     
pir|A71093|A71093 proline-tRNA ligase (EC 6.1.1.15) - Pyrococcus...    33   8.2     Pyrococcus horikoshii
sp|O77759|SOA2_CERAE|SOA2_CERAE Sterol O-acyltransferase 2 (EC 2.3.1.26) (C...    33   8.2     Chlorocebus aethiops [African green monkey]
sp|Q13477|MACA_HUMAN|MACA_HUMAN Mucosal addressin cell adhesion molecule-1 ...    33   8.2     Homo sapiens [man]


>gb:AP005493_1852814 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OSJNBa0078D03.
          Length = 217

 Score =  188 bits (477), Expect = 1e-46
 Identities = 90/144 (62%), Positives = 109/144 (75%), Gaps = 11/144 (7%)
 Frame = -2

Query: 611 RSIDVSQEDKPISQQPISEQAVQEPSFS-PETSQDS----------LTEAENFDKRRLEE 465
           RS+DVS++DKP+     +      P+ + PET Q            L E    D RRLEE
Sbjct: 53  RSVDVSKDDKPLETATTTTPPTPAPAAAAPETEQAEAVASPELELELEEGPKVDPRRLEE 112

Query: 464 KFAVLNTGICECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSV 285
           KFAVLNTG+ ECRSCG++YD+AAGDPSYP+PPGLPF+++P+DWRCPTCGAA+SFF+SKSV
Sbjct: 113 KFAVLNTGVYECRSCGYRYDQAAGDPSYPVPPGLPFEQLPDDWRCPTCGAAQSFFESKSV 172

Query: 284 EIAGFAQNQQFGLGGNTLTSGQKA 213
           EIAGFAQNQQFGLGGN+LT  QKA
Sbjct: 173 EIAGFAQNQQFGLGGNSLTGDQKA 196



>pir|H96586|H96586 hypothetical protein F20D21.31 [imported] -
           Arabidopsis thaliana>gb:AE005173_893348 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC005287_1532404 Arabidopsis thaliana
           chromosome I BAC F20D21 genomic sequence, complete
           sequence.>gb:AY052747_1562907 Arabidopsis thaliana
           At1g54500/F20D21_31 mRNA, complete
           cds.>gb:AY085877_1570941 Arabidopsis thaliana clone
           19234 mRNA, complete sequence.>gb:AF370575_1792358
           Arabidopsis thaliana Unknown protein (F20D21.31) mRNA,
           complete cds.>gb:AF378897_1793482 Arabidopsis thaliana
           At1g54500/F20D21_31 mRNA, complete cds.
          Length = 195

 Score =  176 bits (446), Expect = 5e-43
 Identities = 82/115 (71%), Positives = 95/115 (82%), Gaps = 1/115 (0%)
 Frame = -2

Query: 557 EQAVQEPSFSPETSQDSLTEAEN-FDKRRLEEKFAVLNTGICECRSCGFKYDEAAGDPSY 381
           + A    S S +T +    E E+  +KRR+EEKFAVLNTGI ECRSCG+KYDE+AGDPSY
Sbjct: 59  DDAATPLSSSDQTQETETKEVEDTIEKRRMEEKFAVLNTGIYECRSCGYKYDESAGDPSY 118

Query: 380 PIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSVEIAGFAQNQQFGLGGNTLTSGQK 216
           PIPPG  FD++PEDWRCPTCGAA+SFF+SK VEIAGFAQNQQ+GLGGN LTSGQK
Sbjct: 119 PIPPGFQFDKLPEDWRCPTCGAAQSFFESKMVEIAGFAQNQQYGLGGNALTSGQK 173



>pir|G90103|G90103 rubredoxin [imported] - Guillardia theta
           nucleomorph>gb:GTAJ10592_1681048 Guillardia theta DNA
           for complete sequence of nucleomorph chromosome 2.
          Length = 159

 Score = 89.4 bits (220), Expect = 7e-17
 Identities = 41/84 (48%), Positives = 56/84 (66%)
 Frame = -2

Query: 467 EKFAVLNTGICECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKS 288
           EKF  ++ G  EC +CG+ Y+   GD    IPPG PF  + + + CP C + K+ F+S  
Sbjct: 54  EKFMEIDEGKYECEACGYIYEPEKGDKFAGIPPGTPFVDLSDSFMCPACRSPKNQFKSIK 113

Query: 287 VEIAGFAQNQQFGLGGNTLTSGQK 216
             IAGFA+NQ++GLGGN+LTSGQK
Sbjct: 114 KVIAGFAENQKYGLGGNSLTSGQK 137



>gb:AY123111_1579979 Griffithsia japonica rubredoxin mRNA, complete
           cds.
          Length = 187

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 44/139 (31%), Positives = 73/139 (52%), Gaps = 5/139 (3%)
 Frame = -2

Query: 614 PRSIDVSQEDKPISQQPISEQAVQEPSFSPET----SQDSLTEAEN-FDKRRLEEKFAVL 450
           P +   +  +   ++ P S+   ++ S SP +    ++D  +E +   D+ R  EKF  +
Sbjct: 27  PTTDATTSAESSTTKNPTSDPLARDDSLSPPSVEAIAKDPRSERQKEIDRLRAAEKFVTI 86

Query: 449 NTGICECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSVEIAGF 270
           + G  EC +CG+ Y+ + G+    I PG  F  + + + CP C   K  F ++   IAGF
Sbjct: 87  DEGKFECTACGYVYEPSKGELRSNIAPGTAFADLSDSFTCPQCRTPKRRFIARKKIIAGF 146

Query: 269 AQNQQFGLGGNTLTSGQKA 213
           A NQ +G GGN LT G+K+
Sbjct: 147 ADNQSYGFGGNGLTGGEKS 165



>gb:AP008231_580066 Synechococcus elongatus PCC 6301 DNA, complete
           genome.>gb:AY120853_590230 Synechococcus sp. PCC 7942
           processing protease-like protein gene, partial cds;
           phycocyanobilin:ferredoxin oxidoreductase-like protein,
           DevB (devB), DevC (devC), tRNA pseudoridine 55 synthase,
           CheY (cheY), 50S ribosomal protein L27, 50S ribosomal
           protein L21, KaiA (kaiA), KaiB (kaiB), KaiC (kaiC),
           glutathione peroxidase, virulence associated protein C,
           rRNA methylase-like protein, PhdD (phdD),
           indole-3-glycerol phosphate synthase-like protein, PdxJ
           (pdxJ), KguA (kguA), AmpA (ampA), MobA (mobA),
           transferrin variant A-like protein,
           6-pyruvoyl-tetrahydropterin synthase-like protein, NugC
           (nugC), NdhK (ndhK), Nu3C (nu3C), RubR (rubR), PsbE
           (psbE), PsbF (psbF), PsbL (psbL), PsbJ (psbJ),
           apolipoprotein N-acyltransferase-like protein, unknown
           protein, IspF (ispF), Ap-4-A phosphorylase II-like
           protein, PanC (panC), Kcy (kcy), and dTDP-glucose
           4-6-dehydratase-like protein genes, complete cds; and
           unknown genes.
          Length = 138

 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 36/76 (47%), Positives = 50/76 (65%), Gaps = 3/76 (3%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQS---KSVEIAGFAQ 264
           ECRSCG+ Y+   GDP   I  G  F+ +P +WRCP CG+ +S F++   K +  +GF++
Sbjct: 42  ECRSCGYIYEPNEGDPRRQIAAGTVFEEVPSNWRCPICGSPRSQFRNIGPKGIP-SGFSE 100

Query: 263 NQQFGLGGNTLTSGQK 216
           N  +GLG NTLT GQK
Sbjct: 101 NLGYGLGVNTLTPGQK 116



>sp|P73068|RUBR_SYNY3 Rubredoxin (Rd).>pir|S75176|S75176 rubredoxin
           - Synechocystis sp. (strain PCC 6803)>gb:BA000022_687869
           Synechocystis sp. PCC 6803 DNA, complete genome.
          Length = 115

 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 35/91 (38%), Positives = 54/91 (59%), Gaps = 2/91 (2%)
 Frame = -2

Query: 482 KRRLEEKFAVLNTGICECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSF 303
           +R  E+  A L +   ECR+CG+ Y  + GD    + PG PF+ +P +W+CP CGA +++
Sbjct: 3   ERPPEKTLAELASPNHECRACGYVYIPSQGDQKTSVSPGTPFEALPLNWKCPVCGAPRNY 62

Query: 302 FQSKSVEIA--GFAQNQQFGLGGNTLTSGQK 216
           F S     A  GFA+N  +G G N ++ G+K
Sbjct: 63  FISTGETDAPSGFAENLNYGFGFNRMSGGKK 93



>gb:BA000039_727480 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 111

 Score = 72.8 bits (177), Expect = 7e-12
 Identities = 34/75 (45%), Positives = 44/75 (58%), Gaps = 2/75 (2%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSV--EIAGFAQN 261
           ECR+CG+ Y+ A GD +  IPPG  F  +P +WRCP C A K  F +       +GF +N
Sbjct: 15  ECRACGYIYEPAKGDENRSIPPGTAFADLPLNWRCPVCSAPKKQFSNIGPVGSPSGFKEN 74

Query: 260 QQFGLGGNTLTSGQK 216
             +G G N LT GQK
Sbjct: 75  LNYGFGVNRLTPGQK 89



>sp|Q9XBL8|RUBR_ANAVA Rubredoxin (Rd).>gb:AVA012181_583518 Anabaena
           variabilis hoxR gene and ndhCKJ gene cluster.
          Length = 111

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 33/75 (44%), Positives = 44/75 (58%), Gaps = 2/75 (2%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQS--KSVEIAGFAQN 261
           ECRSCG+ Y+   GD  + I P  PF  +P +WRCP C A K+ F +   +   +GF +N
Sbjct: 15  ECRSCGYVYEPEKGDSKHDIAPETPFAELPINWRCPVCTAKKAAFSNIGPAGTASGFREN 74

Query: 260 QQFGLGGNTLTSGQK 216
             +GLG N LT  QK
Sbjct: 75  LGYGLGVNKLTPAQK 89



>sp|Q9WWN1|RUBR_ANASP Rubredoxin (Rd).>pir|AD2286|AD2286 rubredoxin
           [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_684832 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 111

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 33/75 (44%), Positives = 44/75 (58%), Gaps = 2/75 (2%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQS--KSVEIAGFAQN 261
           ECRSCG+ Y+   GD  + I P  PF  +P +WRCP C A K+ F +   +   +GF +N
Sbjct: 15  ECRSCGYVYEPEKGDNKHDIAPETPFAELPINWRCPVCTAKKAAFTNIGPAGTASGFREN 74

Query: 260 QQFGLGGNTLTSGQK 216
             +GLG N LT  QK
Sbjct: 75  LGYGLGVNKLTPAQK 89



>gb:APC012180_582234 Anabaena PCC7120 hoxR gene and ndhCKJ gene
           cluster.
          Length = 111

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 33/75 (44%), Positives = 44/75 (58%), Gaps = 2/75 (2%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQS--KSVEIAGFAQN 261
           ECRSCG+ Y+   GD  + I P  PF  +P +WRCP C A K+ F +   +   +GF +N
Sbjct: 15  ECRSCGYVYEPEKGDNKHDIAPETPFAELPINWRCPVCTAKKAAFTNIGPAGTGSGFREN 74

Query: 260 QQFGLGGNTLTSGQK 216
             +GLG N LT  QK
Sbjct: 75  LGYGLGVNKLTPAQK 89



>gb:BA000045_740929 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 111

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 3/76 (3%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQS---KSVEIAGFAQ 264
           ECR+CG+ Y+   GD +  +P G PF+ +  DWRCP C +A S F+S   K   +AGF +
Sbjct: 15  ECRTCGYIYEPTKGDAT--VPAGTPFEELAADWRCPICSSATSRFKSIGPKVGTVAGFEE 72

Query: 263 NQQFGLGGNTLTSGQK 216
           N  +G G N L +  K
Sbjct: 73  NAGYGWGVNVLNAQTK 88



>gb:AE013163_289741 Thermoanaerobacter tengcongensis MB4, section
           190 of 244 of the complete genome.>gb:AE008691_1111806
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 52

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 25/46 (54%), Positives = 31/46 (67%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           +C  CG+ YD   GDPS  IPPG PF+ +P+DW CP CGA K  F+
Sbjct: 5   QCTVCGYIYDPEKGDPSQGIPPGTPFEELPDDWVCPDCGAGKDLFE 50



>sp|Q9AE66|RUB4_RHOER Rubredoxin 4.>gb:RER297269_162899 Rhodococcus
           erythropolis ORF1 (partial), alkB2 gene, rubA3 gene,
           rubA4 gene and ORF2 (partial).>gb:AF388182_506505
           Rhodococcus sp. Q15 putative transporter,
           alkane-1-monooxygenase (alkB2), rubredoxin 3 (rubA3),
           rubredoxin 4 (rubA4), and putative regulator genes,
           complete cds.
          Length = 60

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 29/51 (56%), Positives = 33/51 (64%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSVE 282
           +C  CGF+YDEA G P   I PG  +D +PEDW CP CGAAKS F    VE
Sbjct: 8   QCAQCGFEYDEAVGWPEDGIEPGTRWDDIPEDWSCPDCGAAKSDFFMVEVE 58



>pir|AC1953|AC1953 rubrerythrin [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_682165 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 237

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 42/127 (33%), Positives = 56/127 (44%), Gaps = 20/127 (15%)
 Frame = -2

Query: 596 SQEDKPISQQPISEQAVQEPSFSPETSQDS------LTEAENFDKRRLEEKFAVLNTGIC 435
           S  D P +++ + +   QE S    T +++      L   EN+   R  E   VLN G  
Sbjct: 112 SDRDHPAAEEFLKQ--AQESSEHASTFREAAHRFGLLKFIENYHADRYTEALEVLNGGQP 169

Query: 434 E--------------CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
                          CR C   YD  AGDP   I PG PF+ +P DW+CP CGA K  F+
Sbjct: 170 VTRVAGEDPSTRKWICRQCSMIYDPVAGDPDSGIAPGTPFEDIPNDWQCPICGATKKTFK 229

Query: 296 SKSVEIA 276
               +IA
Sbjct: 230 LLEEKIA 236



>sp|O26258|RUBR_METTH Probable rubredoxin (RD).>pir|G69073|G69073
           rubredoxin - Methanobacterium thermoautotrophicum
           (strain Delta H)>gb:AE000804_27857 Methanobacterium
           thermoautotrophicum from bases 103200 to 114428 (section
           10 of 148) of the complete genome.>gb:AE000666_924939
           Methanobacterium thermoautotrophicum str. Delta H
           complete genome.
          Length = 63

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 24/46 (52%), Positives = 31/46 (67%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           +CR CG+ YD   G+P    PPG PF+ +PE WRCP+CGA K  F+
Sbjct: 15  KCRVCGYIYDPEKGEPRTDTPPGTPFEDLPETWRCPSCGAKKKMFK 60



>gb:AY548447_627425 Fremyella diplosiphon clone 3107H12 putative RND
           multidrug efflux transporter gene, partial cds; and
           putative rubrerythrin and hypothetical protein genes,
           complete cds.
          Length = 251

 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 33/87 (37%), Positives = 40/87 (45%), Gaps = 14/87 (16%)
 Frame = -2

Query: 494 ENFDKRRLEEKFAVLNTGICE--------------CRSCGFKYDEAAGDPSYPIPPGLPF 357
           EN+   R  E   VLN G                 CR C   YD  AGDP   I PG  F
Sbjct: 164 ENYHADRYAEALEVLNGGQAATRVAGEDPKTRKWICRQCSMIYDPVAGDPDSGIAPGTAF 223

Query: 356 DRMPEDWRCPTCGAAKSFFQSKSVEIA 276
           + +P+DWRCP CGA K  F+    ++A
Sbjct: 224 EDIPDDWRCPICGATKKTFKPLEEKLA 250



>gb:AE017282_428014 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 56

 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 24/46 (52%), Positives = 31/46 (67%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           +C +CG+ YDE  GDP   +PPG  F+ +PE W CP CG  KSFF+
Sbjct: 8   QCSACGYIYDETEGDPDAGLPPGTLFEDIPEGWGCPECGVDKSFFE 53



>sp|P58025|RUB3_CHLTE Rubredoxin 3 (Rd 3).>gb:AE012952_287483
           Chlorobium tepidum TLS section 173 of 194 of the
           complete genome.>gb:AE006470_934651 Chlorobium tepidum
           TLS complete genome.
          Length = 53

 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 26/48 (54%), Positives = 31/48 (64%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKS 288
           C  CG++YD A GDP   I PG  F+ +PEDW CP CG  KSFF+  S
Sbjct: 6   CVPCGYEYDPADGDPENGIEPGTAFEDLPEDWVCPVCGVDKSFFEPVS 53



>pir|T44570|RUPF rubredoxin [validated] - Pyrococcus
           furiosus>gb:AE010234_260849 Pyrococcus furiosus DSM
           3638, section 109 of 173 of the complete
           genome.>gb:AF156097_484056 Pyrococcus furiosus putative
           thiamine biosynthesis protein gene, partial cds;
           putative thiamine biosynthesis protein THII,
           hypothetical ATP-dependent transporter, ORF4, ORF5,
           ORF6, rubrerythrin, rubredoxin, superoxide reductase, QM
           homolog, and ORF11 genes, complete cds; and ORF12 gene,
           partial cds.>gb:AE009950_901630 Pyrococcus furiosus DSM
           3638, complete genome.
          Length = 54

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 25/45 (55%), Positives = 31/45 (68%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           C+ CG+ YDE AGDP   I PG  F+ +P+DW CP CGA KS F+
Sbjct: 6   CKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFE 50



>sp|P24297|RUBR_PYRFU Rubredoxin (Rd).
          Length = 53

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 25/45 (55%), Positives = 31/45 (68%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           C+ CG+ YDE AGDP   I PG  F+ +P+DW CP CGA KS F+
Sbjct: 5   CKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFE 49



>pir|D69418|D69418 rubredoxin (rd-2) homolog - Archaeoglobus
           fulgidus>gb:AE001011_30576 Archaeoglobus fulgidus DSM
           4304 section 96 of 172 of the complete
           genome.>gb:AE000782_975233 Archaeoglobus fulgidus DSM
           4304 complete genome.
          Length = 73

 Score = 63.2 bits (152), Expect = 6e-09
 Identities = 24/46 (52%), Positives = 32/46 (69%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           EC+ CG+ YDEA GDP   IP G  ++ +P+DW CP CGA+K  F+
Sbjct: 24  ECQVCGYVYDEAEGDPDNDIPAGTKWEDLPDDWVCPVCGASKDQFE 69



>sp|Q9AE63|RUB2_RHOER Rubredoxin 2.>gb:RER9586_162929 Rhodococcus
           erythropolis putative TetR-regulatory alkB1 gene, rubA1
           gene, rubA2 gene, rubB gene, ORF1, ORF2 and ORF3
           (partial).
          Length = 63

 Score = 63.2 bits (152), Expect = 6e-09
 Identities = 27/50 (54%), Positives = 32/50 (64%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSVE 282
           C  CGF+YDEA G P   I PG  +D +PEDW CP CGAAK  F+   V+
Sbjct: 13  CLQCGFEYDEAIGWPDDGIEPGTRWDEIPEDWSCPDCGAAKVDFEMVEVD 62



>gb:AY075046_587806 Synechococcus sp. PCC 7002 hypothetical protein
           gene, partial cds; rubredoxin (rubA) and HCF136-like
           protein genes, complete cds; psb operon, complete
           sequence; and hypothetical protein gene, partial cds.
          Length = 115

 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 32/90 (35%), Positives = 46/90 (51%), Gaps = 2/90 (2%)
 Frame = -2

Query: 479 RRLEEKFAVLNTGICECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           R +E+  A       EC SCG+ Y  A G+     PPG  F+ +P  W CP C   ++ F
Sbjct: 4   RPIEKTLAEKAPASYECPSCGYIYTPAKGESRTNTPPGTAFEDLPLIWNCPVCSVDRAQF 63

Query: 299 QSKSVEIA--GFAQNQQFGLGGNTLTSGQK 216
           ++     A  GF +N ++G G N L+S QK
Sbjct: 64  RNIGAADAPSGFEENLKYGFGVNNLSSNQK 93



>gb:AP006618_561016 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 60

 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 27/51 (52%), Positives = 33/51 (64%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSVE 282
           +C  CGF+YDEA G P   I PG  +D +P+DW CP CGAAKS F    +E
Sbjct: 8   QCVQCGFEYDEAEGWPEDGIAPGTRWDDIPDDWTCPDCGAAKSDFFMVEIE 58



>sp|P28151|RUBL_RHILV Probable rubredoxin hupI.>pir|S27340|S27340
           hupI protein - Rhizobium
           leguminosarum>gb:RLHUPGENE_164390 R.leguminosarum bv.
           viciae UPM791 hydrogenase cluster.>gb:RLHUPREG_164409
           R.leguminosarum hup region genes.
          Length = 70

 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 30/65 (46%), Positives = 35/65 (53%)
 Frame = -2

Query: 494 ENFDKRRLEEKFAVLNTGICECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGA 315
           ENF KR        ++    EC  C   YD A GDP + IPPG PF  + EDWRCP C A
Sbjct: 5   ENFGKRE------TVSDDRMECGICWHVYDPAEGDPVWQIPPGTPFSNLTEDWRCPNCDA 58

Query: 314 AKSFF 300
            +S F
Sbjct: 59  LQSKF 63



>gb:AF388181_506499 Rhodococcus sp. Q15 putative
           alkane-1-monooxygenase (alkB1), rubredoxin 1 (rubA1),
           rubredoxin 2 (rubA2), rubredoxin reductase (rubB), and
           putative regulator genes, complete cds.
          Length = 63

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 27/49 (55%), Positives = 31/49 (63%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSV 285
           C  CGF+YDEA G P   I PG  +D +PEDW CP CGAAK  F+   V
Sbjct: 13  CLQCGFEYDEAIGWPDDGIEPGTRWDEIPEDWSCPDCGAAKVDFEMVEV 61



>sp|P00270|RUBR_DESGI Rubredoxin (Rd).>pir|A00275|RUDVEG rubredoxin
           [validated] - Desulfovibrio gigas>gb:AF325447_500734
           Desulfovibrio gigas SDR-like protein, probable
           branched-chain amino acid transport protein AzlC, and
           rubredoxin (rd) genes, complete cds; and unknown gene.
          Length = 52

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 23/47 (48%), Positives = 31/47 (65%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSK 291
           C  CG++YD A GDP   I PG  F+ +P+DW CP CGA+K  F+ +
Sbjct: 6   CTVCGYEYDPAKGDPDSGIKPGTKFEDLPDDWACPVCGASKDAFEKQ 52



>gb:CBRUBRDOX_845462 C.butyricum gene encoding rubredoxin.
          Length = 53

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 24/47 (51%), Positives = 31/47 (65%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSK 291
           C  CG+ YDEAAGDP   + PG  F+ +P+DW CP CG  KS F+ +
Sbjct: 6   CTVCGYIYDEAAGDPDNGVAPGTKFEDIPDDWVCPLCGVPKSDFEKE 52



>gb:AE017180_401476 Geobacter sulfurreducens PCA, complete genome.
          Length = 52

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 23/45 (51%), Positives = 29/45 (64%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           C  C ++YD  AGDP   I PG PF+ +P+DW CP CGA K  F+
Sbjct: 6   CTICQYEYDPEAGDPENGIDPGTPFEELPDDWVCPICGAGKDLFE 50



>sp|P00269|RUBR_DESVH Rubredoxin (Rd).>pir|B33962|RUDV rubredoxin
           [validated] - Desulfovibrio vulgaris (strain
           Hildenborough)>gb:DVURBORUB_124434 Desulfovibrio
           vulgaris chemoreceptor protein A (dcrA), rubredoxin
           oxidoreductase (rbo), and rubredoxin (rub) genes,
           complete cds.>gb:DVURUB_124442 Desulfovibrio vulgaris
           rubredoxin gene, complete cds.>gb:DVURUBRBO_124444
           Desulfovibrio vulgaris (Hildenborough) rbo-rub operon
           encodon rubredoxin oxidoreductase (rbo) and
           oxidoreductase (rub) genes, complete
           cds.>gb:AE017320_441426 Desulfovibrio vulgaris subsp.
           vulgaris str. Hildenborough, section 12 of 12 of the
           complete genome.>gb:AE017285_1074587 Desulfovibrio
           vulgaris subsp. vulgaris str. Hildenborough, complete
           genome.
          Length = 52

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 24/46 (52%), Positives = 30/46 (65%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQS 294
           C  CG++YD A GDP   + PG  FD +P DW CP CGA KS F++
Sbjct: 6   CTVCGYEYDPAEGDPDNGVKPGTSFDDLPADWVCPVCGAPKSEFEA 51



>sp|P09947|RUBR_CHLLT Rubredoxin (Rd).>pir|A27537|A27537 rubredoxin
           - Chlorobium limicola f.sp. thiosulfatophilum
          Length = 53

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 24/48 (50%), Positives = 30/48 (62%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKS 288
           C  CG+ YD A G+P  PI PG  F+ +PEDW CP CG  K  F+ +S
Sbjct: 6   CSVCGYVYDPADGEPDDPIDPGTGFEDLPEDWVCPVCGVDKDLFEPES 53



>sp|Q9FDN6|HRB_MOOTH High molecular weight rubredoxin (Nitric oxide
           reductase NADH:FprA oxidoreductase).>gb:AF202316_488085
           Moorella thermoacetica rubredoxin Rd (rub), NAD+/-
           rubredoxin oxidoreductase Rbo (rbo), rubrerythrin (rbr),
           type a flavoprotein (fprA), and high molecular weight
           rubredoxin (hrb) genes, complete cds.
          Length = 229

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 28/67 (41%), Positives = 37/67 (55%)
 Frame = -2

Query: 497 AENFDKRRLEEKFAVLNTGICECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCG 318
           A  F   R ++K A+ +    +C  C + YD   GDP + I PG PF  +PEDW CP CG
Sbjct: 162 APTFTVGREKDKTALASPKY-QCTICNYVYDPVQGDPEHGIAPGTPFADLPEDWTCPICG 220

Query: 317 AAKSFFQ 297
           A K  F+
Sbjct: 221 AGKDAFE 227



>pir|H72348|H72348 rubredoxin - Thermotoga maritima (strain
           MSB8)>gb:AE001739_38571 Thermotoga maritima MSB8 section
           51 of 136 of the complete genome.>gb:AE000512_1113044
           Thermotoga maritima MSB8, complete genome.
          Length = 53

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 23/45 (51%), Positives = 30/45 (66%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           C+ CG+ YD   GDP   I PG PF+ +P+DW CP CGA+K  F+
Sbjct: 6   CKLCGYIYDPEQGDPDSGIEPGTPFEDLPDDWVCPLCGASKEDFE 50



>gb:BX569689_775108 Synechococcus sp. WH8102 complete genome;
           segment 1/7.
          Length = 138

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 41/133 (30%), Positives = 58/133 (43%), Gaps = 5/133 (3%)
 Frame = -2

Query: 599 VSQEDKPISQQPISEQ--AVQEPSFSPETSQDSLTEAENFDKRRLEEKFAVLNTGICECR 426
           +S E +P  Q P ++Q     E + + E   +S      F                 ECR
Sbjct: 1   MSDELQPAEQPPTTDQPPVADEANTAVEAPPESDPRTHRF-----------------ECR 43

Query: 425 SCGFKYDEAAGDPSYPIPPGLPFDRM-PEDWRCPTCGAAKSFFQ--SKSVEIAGFAQNQQ 255
           SCG+ YD   G     I  G  FD + P  +RCP C + K  F+      + +GF +N  
Sbjct: 44  SCGYVYDPEEGVKKVGIEAGTAFDDLDPAGFRCPVCRSRKPAFRDIGPRTKASGFEENLN 103

Query: 254 FGLGGNTLTSGQK 216
           FG+G N +T GQK
Sbjct: 104 FGIGVNRMTPGQK 116



>sp|Q9V099|RUBR_PYRAB Rubredoxin (Rd).>pir|E75136|E75136 rubredoxin
           PAB7224 [similarity] - Pyrococcus abyssi (strain
           Orsay)>gb:CNSPAX03_849655 Pyrococcus abyssi complete
           genome; segment 3/6.
          Length = 53

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 24/45 (53%), Positives = 30/45 (66%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           C+ CG+ YDE  GDP   I PG  F+ +P+DW CP CGA KS F+
Sbjct: 6   CKICGYIYDEDEGDPDNGISPGTKFEDLPDDWVCPLCGAPKSEFE 50



>pir|H69359|H69359 rubredoxin (rd-1) homolog - Archaeoglobus
           fulgidus>gb:AE001043_31020 Archaeoglobus fulgidus DSM
           4304 section 64 of 172 of the complete
           genome.>gb:AE000782_974770 Archaeoglobus fulgidus DSM
           4304 complete genome.
          Length = 53

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 22/46 (47%), Positives = 30/46 (65%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           +C  CG+ YDEA GDP   + PG  ++ +P+DW CP CGA K  F+
Sbjct: 5   QCTICGYVYDEAEGDPESDVSPGTKWEDLPDDWVCPVCGATKDQFE 50



>gb:AE017162_394837 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 2 of 6 of the complete
           genome.>gb:AE017126_1030506 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 60

 Score = 60.1 bits (144), Expect = 5e-08
 Identities = 22/46 (47%), Positives = 30/46 (65%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           +C+ C + YD   GDPS  +PPG+PFD +P  W CP C A+K  F+
Sbjct: 11  QCKDCIYSYDPKLGDPSQGVPPGVPFDDLPASWVCPLCKASKKRFK 56



>sp|P19500|RUBR_CLOTS Rubredoxin (Rd).>pir|A33173|A33173 rubredoxin
           [validated] - Clostridium thermosaccharolyticum
          Length = 52

 Score = 60.1 bits (144), Expect = 5e-08
 Identities = 22/46 (47%), Positives = 29/46 (63%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           +C  CG+ YD   GDP+  IPPG  F+ +P+DW CP CG  K  F+
Sbjct: 5   QCTVCGYIYDPEVGDPTQNIPPGTKFEDLPDDWVCPDCGVGKDQFE 50



>gb:AF321851_499760 Desulfovibrio desulfuricans bacterioferritin
           (bfr) and rubredoxin-2 (rd2) genes, complete cds.
          Length = 62

 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 24/52 (46%), Positives = 31/52 (59%)
 Frame = -2

Query: 437 CECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSVE 282
           C+  +CG+ YD   GD    +P G  F+ +PEDWRCP CGA K  F+  S E
Sbjct: 10  CQMVNCGYVYDPDRGDKRRKVPAGTKFEDLPEDWRCPVCGAGKKSFRRLSDE 61



>pir|D70593|D70593 probable rubB protein - Mycobacterium
           tuberculosis (strain H37RV)>gb:AE000516_23460
           Mycobacterium tuberculosis CDC1551, complete
           genome.>gb:BX248345_760635 Mycobacterium bovis subsp.
           bovis AF2122/97 complete genome; segment
           12/14.>gb:BX842582_821354 Mycobacterium tuberculosis
           H37Rv complete genome; segment 11/13.
          Length = 60

 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 28/52 (53%), Positives = 34/52 (65%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSVEIA 276
           C  CGF+YDEA G P   I  G  +D +P+DW CP CGAAKS F+   VE+A
Sbjct: 9   CIQCGFEYDEALGWPEDGIAAGTRWDDIPDDWSCPDCGAAKSDFE--MVEVA 58



>sp|Q93PP8|RUB2_DESDE Rubredoxin 2 (Rd-2).
          Length = 61

 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 24/52 (46%), Positives = 31/52 (59%)
 Frame = -2

Query: 437 CECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSVE 282
           C+  +CG+ YD   GD    +P G  F+ +PEDWRCP CGA K  F+  S E
Sbjct: 9   CQMVNCGYVYDPDRGDKRRKVPAGTKFEDLPEDWRCPVCGAGKKSFRRLSDE 60



>sp|P15412|RUBR_DESVM Rubredoxin (Rd).>pir|JX0241|JX0241 rubredoxin
           - Desulfovibrio vulgaris (strain
           Miyazaki)>gb:DVURBO_124431 Desulfovibrio vulgaris rbo
           gene for desulfoferrodoxin and rub gene for rubredoxin,
           complete cds.
          Length = 52

 Score = 59.3 bits (142), Expect = 8e-08
 Identities = 23/45 (51%), Positives = 29/45 (64%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           C  CG++YD A GDP   + PG  F+ +P DW CP CGA KS F+
Sbjct: 6   CTVCGYEYDPAEGDPDNGVKPGTAFEDVPADWVCPICGAPKSEFE 50



>gb:AP006878_575676 Thermococcus kodakaraensis strain KOD1 DNA,
           complete genome.
          Length = 53

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 23/46 (50%), Positives = 29/46 (63%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           +C  CG+ YDE  GDP   I PG  F+ +P+DW CP CGA K  F+
Sbjct: 5   KCIVCGYIYDEDEGDPDSGIAPGTKFEDLPDDWVCPLCGAPKDMFE 50



>gb:AE004969_60613 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 56

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           C  CG+ YDE  GDP + I PG  F+ +P+DW+CP CG  K  F
Sbjct: 6   CGPCGWIYDEELGDPEHGIAPGTKFEDIPDDWKCPECGVGKEDF 49



>gb:BX572100_799236 Prochlorococcus marinus MIT9313 complete genome;
           segment 6/7.
          Length = 142

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 39/102 (38%), Positives = 51/102 (50%), Gaps = 3/102 (2%)
 Frame = -2

Query: 512 DSLTEAENFDKRRLEEKFAVLNTGICECRSCGFKYDEAAGDPSYPIPPGLPF-DRMPEDW 336
           D++  AE+ D  +L  +F        ECRSCG+ YD   G     I  G  F D  P ++
Sbjct: 28  DTIASAES-DTDQLTHRF--------ECRSCGYVYDPEEGVKKLGITSGTAFKDLDPTNF 78

Query: 335 RCPTCGAAKSFFQSKSVEIA--GFAQNQQFGLGGNTLTSGQK 216
           RCP C A    F++     A  GF QN  +G+G N LT GQK
Sbjct: 79  RCPVCRARIDAFKNIGPRSAPSGFDQNLNYGIGVNRLTPGQK 120



>gb:TISHUPS_197737 Thiocapsa roseopersicina hydrogenase small
           subunit (hupS), hydrogenase large subunit (hupL), HupC
           (hupC), HupD (hupD), HupH (hupH), HupI (hupI), and
           response regulator of the NtrC family (hupR) genes,
           complete cds; and unknown gene.
          Length = 75

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 24/45 (53%), Positives = 29/45 (64%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           ECR C   YD AAGD    +PPG  FD +P+ WRCP C + KS+F
Sbjct: 27  ECRICWSIYDPAAGDSVGEVPPGTAFDGLPDAWRCPRCDSDKSYF 71



>gb:D86986_120934 Pseudomonas hydrogenovora hup genes, complete and
           partial cds.
          Length = 75

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 24/45 (53%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTC-GAAKSF 303
           EC+ C + YD A GDP + IPPG+PF  +P  WRCP C G A  F
Sbjct: 27  ECKICWWVYDPAVGDPVWQIPPGVPFSALPPHWRCPNCDGDADQF 71



>gb:AB112870_13767 Gordonia sp. TF6 alkB2, rubA3, rubA4 genes for
           alkane-1-monooxygenase, rubredoxin 3, rubredoxin 4,
           rubredoxin reductase, complete cds.
          Length = 59

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 27/59 (45%), Positives = 36/59 (61%)
 Frame = -2

Query: 452 LNTGICECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSVEIA 276
           +N  +  C  CGF+YDE  G P   I PG  +  +P+DW CP CGAAK+ F+   VE+A
Sbjct: 1   MNFKLFRCEVCGFEYDEELGWPEDGIEPGTRWADIPDDWSCPDCGAAKADFE--MVEVA 57



>pir|H81133|H81133 rubredoxin NMB0993 [imported] - Neisseria
           meningitidis  (strain MC58 serogroup B, strain Z2491
           serogroup A)>gb:AE002450_46438 Neisseria meningitidis
           serogroup B strain MC58 section 92 of 206 of the
           complete genome.>gb:NMA4Z2491_154118 Neisseria
           meningitidis serogroup A strain Z2491 complete genome;
           segment 4/7.>gb:AE002098_896551 Neisseria meningitidis
           serogroup B strain MC58 complete genome.
          Length = 56

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           C  CG+ YDE  GDP + I PG  F+ +P+DW+CP CG  K  F
Sbjct: 6   CGPCGWIYDEEHGDPEHGIAPGTKFEDIPDDWKCPECGVGKEDF 49



>sp|P30778|RUBR_AZOVI Rubredoxin (Rd).>pir|S22223|E44915 rubredoxin
           homolog hoxR - Azotobacter
           vinelandii>gb:AVIHOXHYP_583654 Azotobacter vinelandii
           hox and hyp operons, complete cds.>gb:AVIHOXMLOQ_583667
           Azotobacter vinelandii hydrogen oxidation protein (hoxM,
           hoxL, hoxO, hoxQ, hoxR, hoxT) genes, complete
           cds.>gb:AVRUBP_583808 A.vinelandii DNA for put.
           rubredoxin-like polypeptide (ORF1) and for ORF2.
          Length = 72

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 24/63 (38%), Positives = 34/63 (53%)
 Frame = -2

Query: 488 FDKRRLEEKFAVLNTGICECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAK 309
           F+   L +   + +  + EC+ C  +YD A GDP + IPPG PF  +P  WRCP C   +
Sbjct: 5   FEGSYLGDATRLADDAVLECKICWQRYDPAEGDPVWQIPPGTPFAALPAHWRCPRCDGDR 64

Query: 308 SFF 300
             F
Sbjct: 65  EQF 67



>gb:AF214145_488914 Rhodobacter sphaeroides hup gene cluster,
           partial sequence.
          Length = 252

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 25/47 (53%), Positives = 28/47 (59%)
 Frame = -2

Query: 440 ICECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           + EC+ C   YD A GD    I PG PF  +PEDW CP CGA KS F
Sbjct: 20  VMECKICWTPYDPAMGDDFRQILPGTPFTALPEDWSCPHCGAPKSQF 66



>gb:AE017180_399150 Geobacter sulfurreducens PCA, complete genome.
          Length = 52

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 21/44 (47%), Positives = 27/44 (61%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           C  C + YD   GDP   +PPG PF+ +P+ W CP CG AK+ F
Sbjct: 6   CTVCQYVYDPFVGDPLNGVPPGTPFEELPDGWVCPACGVAKNMF 49



>sp|P56263|RUBR_HELMO Rubredoxin (Rd).>pir|S65620|S65620 rubredoxin
           - Heliobacillus mobilis
          Length = 52

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 22/45 (48%), Positives = 28/45 (62%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           C  CG+ YD A GDP + I PG  F+ +P DW CP CG +K  F+
Sbjct: 6   CLVCGYVYDPAKGDPDHGIAPGTAFEDLPADWVCPLCGVSKDEFE 50



>gb:CCE238458_845537 Clostridium cellulolyticum rub gene for
           rubredoxin.
          Length = 52

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 22/47 (46%), Positives = 27/47 (57%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSK 291
           C  CG+ YD   GDP   I PG  F+ +PEDW CP CG  K  F+ +
Sbjct: 6   CTVCGYVYDPEEGDPDGGIAPGTAFEDIPEDWVCPLCGVGKDLFEKQ 52



>gb:AF202316_488081 Moorella thermoacetica rubredoxin Rd (rub),
           NAD+/- rubredoxin oxidoreductase Rbo (rbo), rubrerythrin
           (rbr), type a flavoprotein (fprA), and high molecular
           weight rubredoxin (hrb) genes, complete cds.
          Length = 53

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 23/48 (47%), Positives = 28/48 (58%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKS 288
           C  C + YD A GDP   I PG PF  +PEDW CP C A K  F+ ++
Sbjct: 6   CTVCDYVYDPAEGDPDNGIAPGTPFADLPEDWVCPLCSAGKEAFEPET 53



>gb:AE008766_243224 Salmonella typhimurium LT2, section 70 of 220 of
           the complete genome.>gb:AE006468_1000306 Salmonella
           typhimurium LT2, complete genome.
          Length = 353

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 22/45 (48%), Positives = 31/45 (68%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           EC+ C + YD A GD  + IPPG+PF+++P+ W CP C  +KS F
Sbjct: 297 ECKVCWWVYDPALGDDVWQIPPGVPFNQLPDYWCCPVCETSKSGF 341



>gb:DBRBORUB_124049 D.baarsii rbo & rub genes.
          Length = 53

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 21/48 (43%), Positives = 31/48 (64%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKS 288
           C  C ++YD A GDP   + PG  F+ +P DW CP CGA+K  F++++
Sbjct: 6   CGVCVYEYDPAKGDPDNGVAPGTAFEDLPADWSCPVCGASKDQFEAQA 53



>pir|AF0676|AF0676 hydrogenase-1 operon protein HyaF2 [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)>gb:AE016838_345560 Salmonella enterica
           subsp. enterica serovar Typhi Ty2, section 5 of 16 of
           the complete genome.>gb:AL627270_541725 Salmonella
           enterica serovar Typhi (Salmonella typhi) strain CT18,
           complete chromosome; segment 6/20.>gb:AE014613_982892
           Salmonella enterica subsp. enterica serovar Typhi Ty2,
           complete genome.
          Length = 353

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 22/45 (48%), Positives = 31/45 (68%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           EC+ C + YD A GD  + IPPG+PF+++P+ W CP C  +KS F
Sbjct: 297 ECKVCWWVYDPALGDDVWQIPPGVPFNQLPDYWCCPVCETSKSGF 341



>gb:BX572090_795921 Prochlorococcus marinus MED4 complete genome;
           segment 1/5.
          Length = 142

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 36/115 (31%), Positives = 54/115 (46%), Gaps = 6/115 (5%)
 Frame = -2

Query: 542 EPSFSPETSQDSLTEAENFDKR---RLEEKFAVLNTGICECRSCGFKYDEAAGDPSYPIP 372
           +PS       + LT  E+ +K    + +E    L     ECRSCG+ YD   G+    IP
Sbjct: 6   QPSSEENQIVEDLTNKESPEKLPEFKDKELITNLEQNRFECRSCGYIYDPIEGNKKLNIP 65

Query: 371 PGLPFDRMP-EDWRCPTCGAAKSFFQ--SKSVEIAGFAQNQQFGLGGNTLTSGQK 216
              PF  +    + CP C A K+ ++      + +GF +N  +G G N+L  GQK
Sbjct: 66  KNTPFSAIDGNTFACPVCRAGKNLYKDIGPREKPSGFEENLTYGFGFNSLPPGQK 120



>gb:BX569695_777271 Synechococcus sp. WH8102 complete genome;
           segment 7/7.
          Length = 237

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 22/44 (50%), Positives = 28/44 (63%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           C+ C   YD A GDP   I  G PF+ +P+DW+CP CGA K+ F
Sbjct: 183 CKVCSMIYDPAEGDPDSGIVAGTPFEAIPDDWQCPICGARKASF 226



>gb:AE017162_394784 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 2 of 6 of the complete
           genome.>gb:AE017126_1030453 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 143

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 43/132 (32%), Positives = 60/132 (45%), Gaps = 4/132 (3%)
 Frame = -2

Query: 599 VSQEDKPISQQPISEQAVQEPSFSPETSQDSLTEAENFDKRRLEEKFAVLNTGICECRSC 420
           +S E KP   Q  + +  Q P  + +TS   +T+        L+E    L+    EC  C
Sbjct: 1   MSDELKPALDQTEANKIGQSPINAEKTSDHEVTD--------LKED---LSLNRFECTDC 49

Query: 419 GFKYDEAAGDPSYPIPPGLPF-DRMPEDWRCPTCGAAKSFFQ---SKSVEIAGFAQNQQF 252
           G+ YD   G   Y I PG  F D     +RCP C +  S ++   +K     GF +N  +
Sbjct: 50  GYVYDPKEGLKKYKISPGTSFLDIDQTKFRCPVCRSKYSAYKDIGAKFKPSDGFEENVVY 109

Query: 251 GLGGNTLTSGQK 216
           G G NTL  GQK
Sbjct: 110 GFGFNTLPPGQK 121



>gb:CP000026_76152 Salmonella enterica subsp. enterica serovar
           Paratypi A str. ATCC 9150.
          Length = 353

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 22/45 (48%), Positives = 30/45 (66%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           EC+ C + YD A GD  + IPPG+PF ++P+ W CP C  +KS F
Sbjct: 297 ECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGF 341



>pir|A59199|A59199 hybrid cluster [4Fe-2S-3O] protein MTH1453
           [similarity] - Methanobacterium thermoautotrophicum
           (strain Delta H)
          Length = 491

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 22/51 (43%), Positives = 28/51 (54%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSVEI 279
           C+ C + YD   GDP   I PG PF+ +P+DW CP C   K  F+    EI
Sbjct: 5   CKVCDYIYDPEVGDPRSGIEPGTPFEELPDDWLCPVCNVGKDQFEPLRGEI 55



>sp|P14071|RUBR_BUTME Rubredoxin (Rd).>pir|JU0127|JU0127 rubredoxin
           - "Butyribacterium methylotrophicum"
          Length = 53

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 22/48 (45%), Positives = 28/48 (58%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKS 288
           C  CG+ YD A GDP   + PG  F  +PEDW CP CG +K  F  ++
Sbjct: 6   CDICGYVYDPAVGDPDNGVAPGTAFADLPEDWVCPECGVSKDEFSPEA 53



>sp|Q03009|HUPJ_RHOCA Probable rubredoxin hupJ.>pir|S32946|S25690
           hupJ protein - Rhodobacter capsulatus>gb:RCHUPXG_162661
           R.capsulatus hupD, hupF, hupG, hupH, hupJ and hupK
           genes.
          Length = 278

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 23/52 (44%), Positives = 30/52 (57%)
 Frame = -2

Query: 455 VLNTGICECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           + +  I EC+ C   YD A+GD    + PG PF  +PEDW CP C A K+ F
Sbjct: 20  ISDLAIMECKICWTPYDPASGDEFRQVLPGTPFTALPEDWHCPNCDAPKAQF 71



>sp|P23474|RUBR_CLOST Rubredoxin (Rd).>pir|A33182|A33182 rubredoxin
           - Clostridium sticklandii
          Length = 53

 Score = 56.2 bits (134), Expect = 7e-07
 Identities = 22/48 (45%), Positives = 27/48 (56%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKS 288
           C  CG+ YD   GDP   I PG  F  +PEDW CP CG  K  F+ ++
Sbjct: 6   CTVCGYVYDPEVGDPDNNINPGTSFQDIPEDWVCPLCGVGKDQFEEEA 53



>sp|P58992|RUB1_CHLTE Rubredoxin 1 (Rd 1).>gb:AE012873_286575
           Chlorobium tepidum TLS section 94 of 194 of the complete
           genome.>gb:AE006470_933743 Chlorobium tepidum TLS
           complete genome.
          Length = 69

 Score = 56.2 bits (134), Expect = 7e-07
 Identities = 21/44 (47%), Positives = 28/44 (63%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           C  CG+ YD A G+    I PG+PFD++P+DW CP C   K+ F
Sbjct: 19  CAECGYIYDPAEGNLETNIRPGMPFDKLPDDWSCPVCNHPKNQF 62



>gb:AE017249_416098 Treponema denticola ATCC 35405, section 4 of 10
           of the complete genome.>gb:AE017226_1069694 Treponema
           denticola ATCC 35405, complete genome.
          Length = 52

 Score = 55.8 bits (133), Expect = 9e-07
 Identities = 22/44 (50%), Positives = 26/44 (59%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           C  CG+ YD A GDP   I PG  F+ +P+DW CP CG  K  F
Sbjct: 6   CDLCGYVYDPALGDPDGGIAPGTAFEDIPDDWVCPLCGVGKESF 49



>gb:AB090267_12106 Desulfovibrio vulgaris orf-1, fur, rbr, rlp, glt,
           carA, kpsU, prfC, barA genes, partial and complete cds.
          Length = 75

 Score = 55.8 bits (133), Expect = 9e-07
 Identities = 20/47 (42%), Positives = 29/47 (61%)
 Frame = -2

Query: 437 CECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           C+  +CG+ YD   GD    +PPG+ F+ +P+ WRCP CG  K  F+
Sbjct: 10  CQTVNCGYVYDPDRGDRKGKVPPGVRFEDLPDTWRCPVCGGTKRCFR 56



>pir|AE2375|AE2375 rubredoxin [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_685546 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 54

 Score = 55.8 bits (133), Expect = 9e-07
 Identities = 21/45 (46%), Positives = 26/45 (57%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           C  CG++YD   GDP   I     F+ +PEDW CP CGA K  F+
Sbjct: 6   CTVCGYEYDPEVGDPDGGIAAATSFEEIPEDWVCPVCGATKDLFE 50



>gb:AE016794_334694 Pseudomonas putida KT2440 section 21 of 21 of
           the complete genome.>gb:AE015451_949771 Pseudomonas
           putida KT2440 complete genome.
          Length = 55

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSV 285
           +C  CG  YDEA G P   I PG  ++ +PEDW CP CG  KS F+  S+
Sbjct: 5   QCIVCGLIYDEAEGWPDDGIAPGTRWEDVPEDWLCPDCGVGKSDFEMISI 54



>pir|B69075|B69075 rubredoxin - Methanobacterium thermoautotrophicum
           (strain Delta H)>gb:AE000804_27858 Methanobacterium
           thermoautotrophicum from bases 103200 to 114428 (section
           10 of 148) of the complete genome.>gb:AE000666_924940
           Methanobacterium thermoautotrophicum str. Delta H
           complete genome.
          Length = 53

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 21/45 (46%), Positives = 27/45 (60%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           C+ CG+ YD   GDP   I  G PF+ +P+DW CP CG  K  F+
Sbjct: 6   CQMCGYIYDPEEGDPVSGIEAGTPFEDLPDDWVCPVCGVGKDQFK 50



>gb:AY658305_2147315 Synthetic construct Peudomonas aeruginosa clone
           FLH044007.01F PA5350 gene, partial cds.
          Length = 56

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 26/54 (48%), Positives = 32/54 (59%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSVEIAG 273
           +C  CGF YDEA G P   IP G  ++ +P DW CP CG  K  F+   +EIAG
Sbjct: 5   QCVVCGFIYDEALGLPEEGIPAGTRWEDIPADWVCPDCGVGKIDFE--MIEIAG 56



>gb:AE016966_369062 Coxiella burnetii strain RSA 493, section 7 of 7
           of the complete genome.>gb:AE016828_1009798 Coxiella
           burnetii strain RSA 493, complete genome.
          Length = 57

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 24/49 (48%), Positives = 29/49 (59%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSV 285
           C  CGF Y+E  G P   I PG  ++ +PEDW CP CGA KS F+   V
Sbjct: 8   CLLCGFIYEEEKGWPEDGIAPGTRWEEVPEDWLCPECGAMKSDFEMVEV 56



>pir|JU0074|JU0074 rubredoxin - Clostridium perfringens
          Length = 54

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 22/44 (50%), Positives = 26/44 (59%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           C  CG+ YD A GDP   + PG  F  +P+DW CP CG  KS F
Sbjct: 6   CDVCGYIYDPAVGDPDNGVEPGTEFKDIPDDWVCPLCGVDKSQF 49



>sp|Q9AL94|RUBR_CLOAB Rubredoxin (Rd).>pir|G97241|G97241 rubredoxin
           [imported] - Clostridium
           acetobutylicum>gb:AE007775_230083 Clostridium
           acetobutylicum ATCC 824 section 263 of 356 of the
           complete genome.>gb:AY026864_585150 Clostridium
           acetobutylicum rubredoxin (rd) gene, complete
           cds.>gb:AE001437_1093038 Clostridium acetobutylicum ATCC
           824, complete genome.
          Length = 54

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 21/45 (46%), Positives = 27/45 (60%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           C  CG+ YD A GDP   + PG  F+ +P+DW CP CG  K  F+
Sbjct: 6   CVVCGYIYDPAEGDPDNGVNPGTSFEDIPDDWVCPLCGVGKDQFE 50



>sp|P14072|RUB2_CLOPE Rubredoxin 2 (Rd 2).>gb:BA000016_673820
           Clostridium perfringens str. 13 DNA, complete genome.
          Length = 53

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 22/44 (50%), Positives = 26/44 (59%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           C  CG+ YD A GDP   + PG  F  +P+DW CP CG  KS F
Sbjct: 6   CDVCGYIYDPAVGDPDNGVEPGTEFKDIPDDWVCPLCGVDKSQF 49



>gb:AF082663_477606 Rhodococcus sp. NCIMB12038 naphthalene
           degradation gene cluster, complete sequence.
          Length = 80

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 26/58 (44%), Positives = 30/58 (51%)
 Frame = -2

Query: 470 EEKFAVLNTGICECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           EE  A   T +  C  C F YD   GDP   I PG  F  +P+DW CP CGA K  F+
Sbjct: 8   EETQADPATELWICEVCEFVYDPKLGDPDGDISPGTAFQDIPDDWVCPVCGARKKEFR 65



>gb:AE016910_355113 Chromobacterium violaceum ATCC 12472 section 1
           of 16 of the complete genome.>gb:AE016825_1040267
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 54

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 23/45 (51%), Positives = 27/45 (60%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           C  CGF YDE AG P   IPPG  ++ +P +W CP C A K  FQ
Sbjct: 6   CLICGFIYDEEAGRPEDGIPPGTRWEDLPPNWTCPDCDARKDDFQ 50



>gb:DVU82323_124384 Desulfovibrio vulgaris ferric uptake regulatory
           protein homolog (fur), rubrerythrin (rbr) and
           rubredoxin-like protein (rdl) genes, complete
           cds.>gb:AE017319_441336 Desulfovibrio vulgaris subsp.
           vulgaris str. Hildenborough, section 11 of 12 of the
           complete genome.>gb:AE017285_1074497 Desulfovibrio
           vulgaris subsp. vulgaris str. Hildenborough, complete
           genome.
          Length = 75

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 20/47 (42%), Positives = 29/47 (61%)
 Frame = -2

Query: 437 CECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           C+  +CG+ YD   GD    +PPG  F+ +P++WRCP C A K  F+
Sbjct: 10  CQTVNCGYVYDPDRGDKRGKVPPGTRFEDLPDEWRCPICKATKKCFR 56



>sp|Q58145|RUB1_METJA Probable rubredoxin 1 (RD
           1).>pir|G64391|G64391 rubredoxin - Methanococcus
           jannaschii>gb:U67520_206835 Methanocaldococcus
           jannaschii DSM 2661 section 62 of 150 of the complete
           genome.>gb:L77117_1099593 Methanocaldococcus jannaschii
           DSM 2661, complete genome.
          Length = 80

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 25/59 (42%), Positives = 31/59 (52%), Gaps = 8/59 (13%)
 Frame = -2

Query: 473 LEEKFAVLNTGICE--------CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTC 321
           +E K A    G CE        C+ CG+ YD   GDPS  IPP  PF+ +P+ W CP C
Sbjct: 2   VELKIACKLDGSCEKPRYRKYKCKVCGWVYDPLKGDPSQNIPPKTPFEELPDTWICPVC 60



>gb:AY392423_615966 Rhodococcus sp. P400 rubredoxin (rub1), putative
           naphthalene degradation regulator protein (narR1),
           putative naphthalene degradation regulator protein
           (narR2), hypothetical protein, naphthalene dioxygenase
           large subunit (narAa), naphthalene dioxygenase small
           subunit (narAb), cis-naphthalene dihydrodiol
           dehydrogenase (narB), putative aldolase (narC), and
           putative oxygenase gene (oxiA) genes, complete cds.
          Length = 86

 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 26/58 (44%), Positives = 30/58 (51%)
 Frame = -2

Query: 470 EEKFAVLNTGICECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           EE  A   T +  C  C   YD   GDP   IPPG  F  +P+DW CP CGA K  F+
Sbjct: 8   EETQADPATELWVCEVCEDVYDPQLGDPDGGIPPGTAFQDIPDDWVCPVCGARKKEFR 65



>gb:AE016936_361907 Bacteroides thetaiotaomicron VPI-5482, section
           11 of 21 of the complete genome.>gb:AE015928_988395
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 54

 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 21/45 (46%), Positives = 26/45 (57%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           C  C + YD A GDP   I PG  F+ +P+DW CP CG  K  F+
Sbjct: 6   CTVCEYIYDPAQGDPESGIEPGTAFEDIPDDWTCPLCGVGKEDFE 50



>sp|Q58150|RUB2_METJA Probable rubredoxin 2 (RD
           2).>pir|D64392|D64392 rubredoxin - Methanococcus
           jannaschii>gb:U67520_206840 Methanocaldococcus
           jannaschii DSM 2661 section 62 of 150 of the complete
           genome.>gb:L77117_1099598 Methanocaldococcus jannaschii
           DSM 2661, complete genome.
          Length = 55

 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 21/42 (50%), Positives = 29/42 (69%)
 Frame = -2

Query: 422 CGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           CG+ YDE  G+PS  IPPG  F+ +P+ +RCP CG  K+ F+
Sbjct: 11  CGWVYDEDKGEPSQNIPPGTKFEDLPDTFRCPQCGLGKNAFR 52



>sp|P58993|RUB2_CHLTE Rubredoxin 2 (Rd 2).>gb:AE012873_286576
           Chlorobium tepidum TLS section 94 of 194 of the complete
           genome.>gb:AE006470_933744 Chlorobium tepidum TLS
           complete genome.
          Length = 52

 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 20/45 (44%), Positives = 26/45 (57%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           +C  CG+ Y+   GDP   IP G  F+ +P+ W CP CGA K  F
Sbjct: 5   KCNICGYIYNPETGDPEGDIPAGTSFESLPDSWMCPVCGAGKEEF 49



>gb:PPU233397_159563 Pseudomonas putida P1 alkane degradation genes
           (alkBFGHJKL and alkST) and flanking DNA.
          Length = 175

 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 29/84 (34%), Positives = 41/84 (48%), Gaps = 4/84 (4%)
 Frame = -2

Query: 548 VQEPSFSPETSQDSLTEAENFDKRRLEEKFAVLNTGICE----CRSCGFKYDEAAGDPSY 381
           +   + S E + D  TE ++ + R+   +   L +G       C +CG  YDEA GD   
Sbjct: 83  ISNTTMSAEIALDVATEGQHLNGRK--PRVTNLQSGAAFLKWICITCGHIYDEALGDEVE 140

Query: 380 PIPPGLPFDRMPEDWRCPTCGAAK 309
              PG  F+ +P DW CP CGA K
Sbjct: 141 GFAPGTRFEDIPNDWCCPDCGATK 164



 Score = 41.2 bits (95), Expect = 0.023
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTC 321
           +C  C + YDE+ G+      P  P+  +PEDW CP C
Sbjct: 5   QCPDCQYVYDESKGEEHEGFAPNTPWIVIPEDWCCPDC 42



>gb:CR628336_111607 Legionella pneumophila str. Paris complete
           genome.>gb:CR628337_114695 Legionella pneumophila str.
           Lens complete genome.>gb:AE017354_459903 Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1,
           complete genome.
          Length = 58

 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 23/45 (51%), Positives = 28/45 (62%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           C  CGF YDEA G P   I PG  ++ +PE+W CP CGA K  F+
Sbjct: 9   CVICGFIYDEAEGWPEDGIEPGTRWEDVPENWFCPDCGAGKEDFE 53



>pir|F87558|F87558 rubredoxin [imported] - Caulobacter
           crescentus>gb:AE005918_213629 Caulobacter crescentus
           CB15 section 244 of 359 of the complete
           genome.>gb:AE005673_923528 Caulobacter crescentus CB15
           complete genome.
          Length = 59

 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 21/47 (44%), Positives = 28/47 (59%)
 Frame = -2

Query: 440 ICECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           + +CR+CG+ YDE  GDP   + PG  +  +P  W CP CG  KS F
Sbjct: 8   VWQCRTCGYIYDEEQGDPGEGLAPGTRWADIPAGWVCPLCGTPKSDF 54



>gb:BX572101_799507 Prochlorococcus marinus MIT9313 complete genome;
           segment 7/7.
          Length = 266

 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 23/49 (46%), Positives = 27/49 (55%)
 Frame = -2

Query: 446 TGICECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           TG   C+ C   YD A GDP   I  G  F+ +PEDW CP CG  K+ F
Sbjct: 206 TGKWICKVCSMIYDPAIGDPESGISAGTAFEAIPEDWVCPICGTRKANF 254



>gb:AY581127_629860 Azorhizobium caulinodans strain ORS571
           hydrogenase gene cluster, complete sequence.
          Length = 301

 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 20/45 (44%), Positives = 26/45 (57%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           EC+ C   YD A G   + +PPG PF  +P+ WRCP C  A+  F
Sbjct: 25  ECKICWHVYDPAEGCEVWQVPPGTPFTALPDHWRCPVCDGARDQF 69



>gb:AJ749949_531052 Francisella tularensis subsp. tularensis
           complete genome.
          Length = 56

 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 22/45 (48%), Positives = 27/45 (60%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           C  CG  YDEA G P   I PG  ++ +PEDW CP CG +K  F+
Sbjct: 8   CIVCGLIYDEAEGWPEDGIEPGTRWEDVPEDWECPDCGVSKDEFE 52



>gb:AB110633_13530 Rhodococcus opacus plasmid pWK301 orf6, dodR1,
           dodR2, orf7, dodA, dodB, dodC,orf8, genes for
           rubredoxin, transcriptional regulater GntR family
           protein, transcriptional activator protein,
           2,4-diacetylphloroglucinol biosynthetic protein,
           terminal dioxygenase large subunit, terminal dioxygenase
           small subunit, dihydrodiol dehydrogenase,
           hydratase-aldolase, complete cds.
          Length = 86

 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 22/45 (48%), Positives = 25/45 (55%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           C  C   YD   GDP   IPPG  F  +P+DW CP CGA K  F+
Sbjct: 21  CEVCEDVYDPQLGDPDGGIPPGTAFQDIPDDWVCPVCGARKKEFR 65



>gb:ARU9587_582584 Prauserella rugosa alkB gene for alkane-1
           monooxygenase, partial.
          Length = 490

 Score = 52.8 bits (125), Expect = 8e-06
 Identities = 19/38 (50%), Positives = 23/38 (60%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCG 318
           C  CG+ YDEA GDP    P G P+  +P+ W CP CG
Sbjct: 438 CPGCGYVYDEATGDPREGFPAGTPWSAIPDSWCCPDCG 475



>gb:AP008231_582132 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 238

 Score = 52.8 bits (125), Expect = 8e-06
 Identities = 22/44 (50%), Positives = 23/44 (52%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           C  C   YD A GD    I PG PF  +PEDW CP CG  K  F
Sbjct: 185 CLQCSVIYDPAEGDLDSGIAPGTPFAAIPEDWSCPICGVTKKSF 228



>gb:AP006841_574865 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 53

 Score = 52.8 bits (125), Expect = 8e-06
 Identities = 21/45 (46%), Positives = 25/45 (55%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           C  C F YD   GDP   I PG  F+ +P+DW CP CG  K  F+
Sbjct: 5   CTVCDFIYDPEIGDPEGGIEPGTQFEDIPDDWVCPLCGVGKEDFE 49



>gb:ABO295164_18430 Alcanivorax borkumensis AP1 alk gene cluster
           (alkS, alkB1GHJ) and flanking ORF1 and ORF2 DNA.
          Length = 174

 Score = 52.8 bits (125), Expect = 8e-06
 Identities = 32/107 (29%), Positives = 50/107 (46%), Gaps = 5/107 (4%)
 Frame = -2

Query: 614 PRSIDVSQEDKPISQQPISEQAVQEPS--FSPETSQDSLTEAENFDKRRLEEKFAVLNTG 441
           P S   + E +  +  P +E + Q+ +   +P T+  +  +A+    R    K +     
Sbjct: 60  PASAAATPEVRTATTPPKAEASPQKSTGASTPSTNNKAKAKAKAKPARAKSSKDSTSKET 119

Query: 440 ICE---CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAK 309
                 C +CG  YDEA GD +    PG  F+ +P+DW CP CGA K
Sbjct: 120 TFRKWICITCGHIYDEALGDETEGFAPGTLFEDIPDDWCCPDCGATK 166



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 17/38 (44%), Positives = 23/38 (60%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTC 321
           +C  C + YDE AG P    PPG  ++ +PE+W CP C
Sbjct: 5   QCPDCEYIYDEVAGHPHEGFPPGTSWETIPEEWACPDC 42



>pir|H82976|H82976 rubredoxin PA5350 [imported] - Pseudomonas
           aeruginosa  (strain PAO1)>gb:AE004947_59582 Pseudomonas
           aeruginosa PAO1, section 508 of 529 of the complete
           genome.>gb:AE004091_973682 Pseudomonas aeruginosa PAO1,
           complete genome.
          Length = 55

 Score = 52.8 bits (125), Expect = 8e-06
 Identities = 25/53 (47%), Positives = 31/53 (58%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSVEIA 276
           +C  CGF YDEA G P   IP G  ++ +P DW CP CG  K  F+   +EIA
Sbjct: 5   QCVVCGFIYDEALGLPEEGIPAGTRWEDIPADWVCPDCGVGKIDFE--MIEIA 55



>pir|B32850|RUPSEO rubredoxin II - Pseudomonas oleovorans plasmid
           OCT>gb:POL245436_159087 Pseudomonas putida OCT plasmid
           alk genes cluster (alkBFGHJKL, alkN and alkST genes) and
           flanking DNA, strain TF4-1L (GPo1), formerly annotated
           as Pseudomonas oleovorans.
          Length = 173

 Score = 52.8 bits (125), Expect = 8e-06
 Identities = 21/41 (51%), Positives = 26/41 (63%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAK 309
           C +CG  YDEA GD +    PG  F+ +P+DW CP CGA K
Sbjct: 124 CITCGHIYDEALGDEAEGFTPGTRFEDIPDDWCCPDCGATK 164



 Score = 46.2 bits (108), Expect = 7e-04
 Identities = 17/38 (44%), Positives = 23/38 (60%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTC 321
           +C  C + YDE+AG+      PG P+  +PEDW CP C
Sbjct: 5   KCPDCNYVYDESAGNVHEGFSPGTPWHLIPEDWCCPDC 42



>sp|P48344|RUBL_BRAJA Probable rubredoxin hupI.>gb:RHBFRA_163678
           Bradyrhizobium japonicum hydrogenase gene cluster,
           complete sequence; and HypA (hypA) gene, partial
           cds.>gb:BA000040_735195 Bradyrhizobium japonicum USDA
           110 DNA, complete genome.
          Length = 69

 Score = 52.8 bits (125), Expect = 8e-06
 Identities = 23/47 (48%), Positives = 26/47 (55%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQS 294
           EC  C   YD A GD    I PG PF  +PE+W CP C A KS F +
Sbjct: 20  ECGICWTVYDPADGDDVAQIAPGTPFAALPEEWHCPNCDAPKSKFMA 66



>sp|P00272|RUB2_PSEOL Rubredoxin 2 (Two-iron rubredoxin).
          Length = 172

 Score = 52.8 bits (125), Expect = 8e-06
 Identities = 21/41 (51%), Positives = 26/41 (63%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAK 309
           C +CG  YDEA GD +    PG  F+ +P+DW CP CGA K
Sbjct: 123 CITCGHIYDEALGDEAEGFTPGTRFEDIPDDWCCPDCGATK 163



 Score = 46.2 bits (108), Expect = 7e-04
 Identities = 17/38 (44%), Positives = 23/38 (60%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTC 321
           +C  C + YDE+AG+      PG P+  +PEDW CP C
Sbjct: 4   KCPDCNYVYDESAGNVHEGFSPGTPWHLIPEDWCCPDC 41



>gb:BX321861_773754 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 6/10.
          Length = 62

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 23/49 (46%), Positives = 28/49 (57%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSV 285
           C  CGF YDEA G P   IP G  ++ +P +W CP CGA K  F+   V
Sbjct: 14  CMICGFIYDEAEGWPQDGIPAGTRWEDVPMNWTCPECGARKEDFEMVKV 62



>sp|P42453|RUBR_ACICA Rubredoxin (Rd).>pir|I39520|I39520 rubredoxin
           - Acinetobacter calcoaceticus>gb:ACRBDOXN_18791
           Acinetobacter sp. cysD, cobQ, sodM, lysS, rubA, rubB,
           estB, oxyR, ppk, mtgA, ORF2 and ORF3
           genes.>gb:CR543861_103050 Acinetobacter sp. ADP1
           complete genome.
          Length = 54

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 21/46 (45%), Positives = 29/46 (63%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           +C  CG+ YDEA G P   I PG  ++ +P+DW CP CG +K  F+
Sbjct: 5   QCIVCGWIYDEAEGWPQDGIAPGTKWEDIPDDWTCPDCGVSKVDFE 50



>gb:AB024936_4148 Rhodococcus sp. CIR2 naphthalene degradation genes
           (rnoA1, rnoA2, rnoA3, rnoA4, rnoB), complete cds.
          Length = 86

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 26/61 (42%), Positives = 30/61 (49%)
 Frame = -2

Query: 470 EEKFAVLNTGICECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSK 291
           EE  A   T +  C  C   YD   GDP   I PG  F  +P+DW CP CGA K  F+  
Sbjct: 8   EETQADPATELWVCEVCEDVYDPRLGDPEGGISPGTAFQDIPDDWVCPVCGARKKEFRKL 67

Query: 290 S 288
           S
Sbjct: 68  S 68



>sp|P31912|RUBR_ALCEU Rubredoxin (Rd).>pir|I43255|I43255 rubredoxin
           homolog hoxR [similarity] - Alcaligenes
           eutrophus>gb:AFAHOXGA_521491 Alcaligenes eutrophus hoxK,
           hoxG, hoxZ, hoxM, hoxL, hoxO, hoxQ, hoxR, hoxT and hoxV
           genes, complete cds and promoter
           region.>gb:AY305378_607452 Ralstonia eutropha H16
           megaplasmid pHG1, complete sequence.
          Length = 78

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 21/45 (46%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTC-GAAKSF 303
           EC+ C ++YD   GDP + I PG  F  +P  WRCP C G A+ F
Sbjct: 27  ECKICWWEYDPEVGDPVWQIAPGTSFSALPAHWRCPNCDGEAEQF 71



>gb:AF082663_477603 Rhodococcus sp. NCIMB12038 naphthalene
           degradation gene cluster, complete
           sequence.>gb:AY392424_615975 Rhodococcus sp. P200
           rubredoxin (rub1), putative naphthalene degradation
           regulator protein (narR1), putative naphthalene
           degradation regulator protein (narR2), hypothetical
           protein, naphthalene dioxygenase large subunit (narAa),
           naphthalene dioxygenase small subunit (narAb),
           cis-naphthalene dihydrodiol dehydrogenase (narB), and
           putative aldolase (narC) genes, complete cds.
          Length = 86

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 25/58 (43%), Positives = 29/58 (50%)
 Frame = -2

Query: 470 EEKFAVLNTGICECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           EE  A   T +  C  C   YD   GDP   I PG  F  +P+DW CP CGA K  F+
Sbjct: 8   EETQADPATELWVCEVCEDVYDPRLGDPEGGISPGTAFQDIPDDWVCPVCGARKKEFR 65



>gb:AY658315_2147325 Synthetic construct Peudomonas aeruginosa clone
           FLH044023.01F PA5351 gene, partial cds.
          Length = 56

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 24/54 (44%), Positives = 30/54 (55%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSVEIAG 273
           +C  CG  YDEA G P   I  G  ++ +PEDW CP CG  K  F+   +EI G
Sbjct: 5   QCVVCGLIYDEAKGWPEEGIEAGTRWEDVPEDWLCPDCGVGKLDFE--MIEIGG 56



>gb:AE015940_320508 Clostridium tetani E88, section 5 of 10 of the
           complete genome.>gb:AE015927_963297 Clostridium tetani
           E88, complete genome.
          Length = 635

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 19/44 (43%), Positives = 24/44 (54%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           C  CG++YD   GD    I PG  F+ +P +W CP CG  K  F
Sbjct: 589 CNGCGYEYDPGEGDSEGEILPGTLFEDLPNEWTCPACGEEKDEF 632



>sp|P00271|RUBR_MEGEL Rubredoxin (Rd).>pir|A00277|RUME rubredoxin -
           Megasphaera elsdenii
          Length = 52

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 23/45 (51%), Positives = 26/45 (57%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           EC  CG+ YDEA GD    +  G  F  +P DW CPTCGA K  F
Sbjct: 5   ECSICGYIYDEAEGDDGN-VAAGTKFADLPADWVCPTCGADKDAF 48



>gb:AY458639_619403 Uncultured bacterium 442 clone EBAC000-63A02
           genomic sequence.
          Length = 461

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 21/46 (45%), Positives = 25/46 (54%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           EC  CG  YDE  G P   IP G  +  +P+DW CP CG  K  F+
Sbjct: 5   ECIVCGLIYDEKEGWPDDGIPAGTKWSDVPDDWLCPDCGVGKDDFE 50



>gb:AB049412_7346 Acinetobacter sp. M-1 lysS, rubA, rubB gene for
           lysyl-tRNA synthetase, rubredoxin, rubredoxin reductase,
           partial and complete cds.
          Length = 54

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 20/46 (43%), Positives = 29/46 (63%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           +C  CG+ YDEA G P   I  G  ++ +P+DW CP CG +K+ F+
Sbjct: 5   QCIVCGWIYDEAEGWPQDGIAAGTKWEDIPDDWTCPDCGVSKADFE 50



>sp|P00268|RUBR_CLOPA Rubredoxin (Rd).>pir|S29120|RUCLEP rubredoxin
           [validated] - Clostridium pasteurianum>gb:CLORUB_848696
           C.pasteurianum open reading frame A, B, C, and
           rubredoxin gene, complete cds.
          Length = 54

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 19/45 (42%), Positives = 25/45 (55%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           C  CG+ Y+   GDP   + PG  F  +P+DW CP CG  K  F+
Sbjct: 6   CTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFE 50



>gb:BX640411_804763 Bordetella pertussis strain Tohama I, complete
           genome; segment 1/12.>gb:BX640435_812168 Bordetella
           parapertussis strain 12822, complete genome; segment
           13/14.>gb:BX640450_817054 Bordetella bronchiseptica
           strain RB50, complete genome; segment 14/16.
          Length = 54

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 21/45 (46%), Positives = 27/45 (60%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           C  CG+ YDE AG P   I PG  ++ +P +W CP CGA K  F+
Sbjct: 6   CLICGWVYDEEAGLPDEGIAPGTRWEDVPPNWVCPECGARKEDFE 50



>gb:AE012443_282494 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 351 of 460 of the complete
           genome.>gb:AE008922_915776 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 51

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 20/50 (40%), Positives = 27/50 (54%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSVE 282
           C  CGF Y EA G P   I PG  ++ +P+ W CP CG  K  F+   ++
Sbjct: 2   CVVCGFLYHEADGIPEEGIAPGTRWEDVPDSWTCPDCGVTKDDFEMVEID 51



>gb:AE010647_265318 Fusobacterium nucleatum subsp. nucleatum ATCC
           25586, section 189 of 197 of the complete
           genome.>gb:AE009951_912486 Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586, complete genome.
          Length = 636

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 20/42 (47%), Positives = 23/42 (54%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKS 306
           C  CG +Y+   GD    I PG  F  +PEDW CP CG  KS
Sbjct: 589 CSGCGHEYNPEIGDEDSDIKPGTRFKDLPEDWTCPDCGDPKS 630



>gb:BX571965_792491 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.>gb:CP000010_866200
           Burkholderia mallei ATCC 23344 chromosome 1, complete
           sequence.
          Length = 56

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 21/45 (46%), Positives = 27/45 (60%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           C  CG+ YDE AG P   I PG  ++ +P +W CP CGA K  F+
Sbjct: 8   CLICGWIYDEEAGLPEEGIAPGTRWEDVPINWTCPECGARKEDFE 52



>gb:AB112870_13766 Gordonia sp. TF6 alkB2, rubA3, rubA4 genes for
           alkane-1-monooxygenase, rubredoxin 3, rubredoxin 4,
           rubredoxin reductase, complete cds.
          Length = 56

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 19/38 (50%), Positives = 23/38 (60%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCG 318
           C  C + YDEAAG P    PPG  +  +P+DW CP CG
Sbjct: 6   CPVCDYVYDEAAGAPREGFPPGTAWATIPDDWPCPDCG 43



>gb:AE016794_334750 Pseudomonas putida KT2440 section 21 of 21 of
           the complete genome.>gb:AE015451_949827 Pseudomonas
           putida KT2440 complete genome.
          Length = 461

 Score = 49.3 bits (116), Expect = 8e-05
 Identities = 21/45 (46%), Positives = 26/45 (57%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           C  CG  YDEA G P   I PG  ++ +PEDW CP C   K+ F+
Sbjct: 6   CIICGLIYDEAKGWPDDGIAPGTRWEDVPEDWLCPECKVGKADFE 50



>pir|A82977|A82977 rubredoxin PA5351 [imported] - Pseudomonas
           aeruginosa  (strain PAO1)>gb:AE004947_59583 Pseudomonas
           aeruginosa PAO1, section 508 of 529 of the complete
           genome.>gb:AE004091_973683 Pseudomonas aeruginosa PAO1,
           complete genome.
          Length = 55

 Score = 49.3 bits (116), Expect = 8e-05
 Identities = 21/46 (45%), Positives = 26/46 (56%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           +C  CG  YDEA G P   I  G  ++ +PEDW CP CG  K  F+
Sbjct: 5   QCVVCGLIYDEAKGWPEEGIEAGTRWEDVPEDWLCPDCGVGKLDFE 50



>gb:AE013598_294825 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 79

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 20/50 (40%), Positives = 26/50 (52%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSVE 282
           C  CGF Y EA G P   I PG  +  +P+ W CP CG  K  F+   ++
Sbjct: 30  CVVCGFLYHEADGIPEEGIAPGTRWQDVPDTWTCPDCGVTKEDFEMVEID 79



>sp|P48343|RUBR_AZOCH Rubredoxin in uptake hydrogenase
           operon.>pir|S53661|S53661 hydrogenase-related protein R
           - Azotobacter chroococcum>gb:AVIHUPZ_583681 Azotobacter
           chroococcum hydrogenase-related proteins (hupZMNOQRT)
           genes, complete cds's, hupL gene, 3' end, and hupA gene,
           5' end.
          Length = 72

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 21/63 (33%), Positives = 30/63 (47%)
 Frame = -2

Query: 488 FDKRRLEEKFAVLNTGICECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAK 309
           F+   L     + +  + EC+ C  +YD A GD  + I  G PF  +P  WRCP C   +
Sbjct: 5   FEGSYLGNAARLADDAVLECKICWHRYDPAVGDEVWQILAGTPFAALPAHWRCPQCDGDR 64

Query: 308 SFF 300
             F
Sbjct: 65  EQF 67



>sp|Q9AE67|RUB3_RHOER Rubredoxin 3.>gb:RER297269_162898 Rhodococcus
           erythropolis ORF1 (partial), alkB2 gene, rubA3 gene,
           rubA4 gene and ORF2 (partial).>gb:AF388182_506504
           Rhodococcus sp. Q15 putative transporter,
           alkane-1-monooxygenase (alkB2), rubredoxin 3 (rubA3),
           rubredoxin 4 (rubA4), and putative regulator genes,
           complete cds.
          Length = 61

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 18/38 (47%), Positives = 23/38 (60%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCG 318
           C  C + YDE+ G P    P G P+D +P+DW CP CG
Sbjct: 6   CPVCEYVYDESKGAPREGFPAGTPWDAVPDDWCCPDCG 43



>gb:AL646060_545595 Ralstonia solanacearum GMI1000 chromosome,
           complete sequence; segment 4/19.
          Length = 60

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 20/45 (44%), Positives = 26/45 (57%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           C  CG+ YDE  G P   I PG  ++ +P +W CP CGA K  F+
Sbjct: 12  CLICGWIYDEEQGAPDDGIAPGTKWEDVPINWTCPECGARKEDFE 56



>gb:BX572596_800585 Rhodopseudomonas palustris CGA009 complete
           genome; segment 4/16.
          Length = 70

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 21/40 (52%), Positives = 22/40 (55%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGA 315
           EC  C   YD A GDP     PG PF  +PE W CPTC A
Sbjct: 19  ECGVCWTVYDPAEGDPLGRAAPGTPFAALPEAWCCPTCDA 58



>gb:AE011987_278328 Xanthomonas axonopodis pv. citri str. 306,
           section 365 of 469 of the complete
           genome.>gb:AE008923_920103 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 51

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 20/45 (44%), Positives = 24/45 (53%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           C  CGF Y EA G P   I PG  +  +P+ W CP CG  K  F+
Sbjct: 2   CVVCGFLYHEADGIPEEGIAPGTRWQDVPDTWTCPDCGVTKEDFE 46



>sp|O83956|RUBR_TREPA Rubredoxin (Rd).>pir|G71256|G71256 probable
           rubredoxin - syphilis spirochete>gb:AE001266_33812
           Treponema pallidum subsp. pallidum str. Nichols section
           82 of 87 of the complete genome.>gb:AE000520_1050040
           Treponema pallidum subsp. pallidum str. Nichols complete
           genome.
          Length = 52

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 19/48 (39%), Positives = 25/48 (52%)
 Frame = -2

Query: 443 GICECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           G   C  CG+ Y+   GD    IP G  F+ +P+ W CP CG  K+ F
Sbjct: 2   GTYMCDLCGWGYNPEVGDADGGIPAGTAFENLPDHWECPLCGVDKTSF 49



>sp|P04170|RUB1_DESDE Rubredoxin 1 (Rd-1).>pir|A00276|RUDVD
           rubredoxin [validated] - Desulfovibrio desulfuricans
          Length = 45

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 19/44 (43%), Positives = 26/44 (59%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           C  CG++YD A  D        +PFD++P+DW CP CG +K  F
Sbjct: 6   CNVCGYEYDPAEHD-------NVPFDQLPDDWCCPVCGVSKDQF 42



>gb:AP006618_561017 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 57

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 17/38 (44%), Positives = 22/38 (57%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCG 318
           C  C + YDE  G+P    P G P+  +P+DW CP CG
Sbjct: 6   CPVCDYVYDETNGEPHEGFPAGTPWSAVPDDWCCPDCG 43



>sp|Q8XMB2|RUB1_CLOPE Rubredoxin 1 (Rd 1).>gb:BA000016_673817
           Clostridium perfringens str. 13 DNA, complete genome.
          Length = 53

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 18/44 (40%), Positives = 23/44 (52%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           C  CG+ YD   GDP   + PG  F  +P+ W CP C   K+ F
Sbjct: 6   CDVCGYIYDPVVGDPDNGVAPGTKFKDIPDTWVCPLCKLDKTHF 49



>gb:AE016875_354805 Pseudomonas syringae pv. tomato str. DC3000
           section 20 of 21 of the complete
           genome.>gb:AE016853_1039980 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 55

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 23/53 (43%), Positives = 29/53 (54%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSVEIA 276
           +C  CG  Y+EA G P   I  G  +  +PEDW CP CG  K  F+   +EIA
Sbjct: 5   QCIVCGLIYNEADGWPDDGIAAGTLWQDVPEDWLCPDCGVGKMDFE--MIEIA 55



>sp|Q46877|NORV_ECOLI Anaerobic nitric oxide reductase
           flavorubredoxin (FlRd) (FlavoRb).>pir|B65051|B65051
           hypothetical protein b2710 - Escherichia coli (strain
           K-12)>gb:ECU29579_133807 Escherichia coli K-12 genome;
           approximately 61 to 62 minutes.>gb:U00096_201736
           Escherichia coli K-12 MG1655 complete genome.
          Length = 479

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 17/51 (33%), Positives = 28/51 (54%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSVE 282
           +C  C + YD A G+P   + PG P+  +P+++ CP C   K  F+  + E
Sbjct: 427 QCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVFEELASE 477



>gb:AE000906_29124 Methanobacterium thermoautotrophicum from bases
           1305529 to 1316052 (section 112 of 148) of the complete
           genome.>gb:AE000666_926206 Methanobacterium
           thermoautotrophicum str. Delta H complete genome.
          Length = 476

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 18/39 (46%), Positives = 22/39 (56%)
 Frame = -2

Query: 395 GDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSVEI 279
           GDP   I PG PF+ +P+DW CP C   K  F+    EI
Sbjct: 2   GDPRSGIEPGTPFEELPDDWLCPVCNVGKDQFEPLRGEI 40



>sp|P59405|NORV_SHIFL Anaerobic nitric oxide reductase
           flavorubredoxin (FlRd) (FlavoRb).>gb:AE005674_72315
           Shigella flexneri 2a str. 301, complete
           genome.>gb:AE016987_372498 Shigella flexneri 2a str.
           2457T section 10 of 16 of the complete
           genome.>gb:AE014073_997248 Shigella flexneri 2a str.
           2457T complete genome.
          Length = 479

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 17/51 (33%), Positives = 27/51 (52%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSVE 282
           +C  C + YD A G+P   + PG P+  +P+++ CP C   K  F   + E
Sbjct: 427 QCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVFDELASE 477



>sp|P59404|NORV_ECOL6 Anaerobic nitric oxide reductase
           flavorubredoxin (FlRd) (FlavoRb).
          Length = 479

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 17/51 (33%), Positives = 27/51 (52%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSVE 282
           +C  C + YD A G+P   + PG P+  +P+++ CP C   K  F   + E
Sbjct: 427 QCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVFDELASE 477



>sp|Q8X852|NORV_ECO57 Anaerobic nitric oxide reductase
           flavorubredoxin homolog (FlRd homolog) (FlavoRb
           homolog).>pir|E85919|E85919 probable flavodoxin Z4018
           [imported] - Escherichia coli  (strain O157:H7,
           substrain EDL933)>pir|F91074|F91074 probable flavodoxin
           [imported] - Escherichia coli (strain O157:H7, substrain
           RIMD 0509952)>gb:AE005174_67816 Escherichia coli O157:H7
           EDL933, complete genome.>gb:BA000007_661578 Escherichia
           coli O157:H7 DNA, complete genome.
          Length = 411

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 17/51 (33%), Positives = 27/51 (52%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSVE 282
           +C  C + YD A G+P   + PG P+  +P+++ CP C   K  F   + E
Sbjct: 359 QCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVFDELASE 409



>gb:CP000026_77439 Salmonella enterica subsp. enterica serovar
           Paratypi A str. ATCC 9150.
          Length = 479

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 17/51 (33%), Positives = 27/51 (52%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSVE 282
           +C  C + YD A G+P   + PG P+  +P+++ CP C   K  F   + E
Sbjct: 427 QCSVCQWIYDPALGEPLQDVAPGTPWSEVPDNFLCPECSLGKDVFDVLATE 477



>gb:AF388181_506498 Rhodococcus sp. Q15 putative
           alkane-1-monooxygenase (alkB1), rubredoxin 1 (rubA1),
           rubredoxin 2 (rubA2), rubredoxin reductase (rubB), and
           putative regulator genes, complete cds.
          Length = 56

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 16/38 (42%), Positives = 21/38 (55%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCG 318
           C  C + Y E+ G      PPG P+  +P+DW CP CG
Sbjct: 6   CPICDYTYTESTGAAREGFPPGTPWSSIPDDWCCPDCG 43



>gb:RER9586_162928 Rhodococcus erythropolis putative TetR-regulatory
           alkB1 gene, rubA1 gene, rubA2 gene, rubB gene, ORF1,
           ORF2 and ORF3 (partial).
          Length = 56

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 16/38 (42%), Positives = 21/38 (55%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCG 318
           C  C + Y E+ G      PPG P+  +P+DW CP CG
Sbjct: 6   CPICDYTYTESTGAAREGFPPGTPWSSIPDDWCCPDCG 43



>gb:CR555306_105683 Azoarcus sp. EbN1 complete genome.
          Length = 887

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 18/49 (36%), Positives = 27/49 (55%)
 Frame = -2

Query: 443 GICECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           G   CR+CG+ YD A G+    +  G P+  +PE + CP C   K+ F+
Sbjct: 440 GSMRCRTCGWVYDPAKGESGQGVHAGTPWSEVPETFLCPECLLGKTEFE 488



>gb:AE000516_23461 Mycobacterium tuberculosis CDC1551, complete
           genome.
          Length = 56

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 17/37 (45%), Positives = 22/37 (59%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTC 321
           C  C + YDEA GD     P G  +D++P+DW CP C
Sbjct: 7   CPVCDYVYDEANGDAREGFPAGTGWDQIPDDWCCPDC 43



>pir|E70593|E70593 probable rubA protein - Mycobacterium
           tuberculosis (strain H37RV)>gb:BX248345_760636
           Mycobacterium bovis subsp. bovis AF2122/97 complete
           genome; segment 12/14.>gb:BX842582_821355 Mycobacterium
           tuberculosis H37Rv complete genome; segment 11/13.
          Length = 55

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 17/37 (45%), Positives = 22/37 (59%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTC 321
           C  C + YDEA GD     P G  +D++P+DW CP C
Sbjct: 6   CPVCDYVYDEANGDAREGFPAGTGWDQIPDDWCCPDC 42



>sp|Q8ZMJ7|NORV_SALTY Anaerobic nitric oxide reductase
           flavorubredoxin (FlRd) (FlavoRb).>gb:AE008829_244492
           Salmonella typhimurium LT2, section 133 of 220 of the
           complete genome.>gb:AE006468_1001574 Salmonella
           typhimurium LT2, complete genome.
          Length = 479

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 17/51 (33%), Positives = 28/51 (54%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSVE 282
           +C  C + YD A G+P   + PG P++ +P+++ CP C   K  F   + E
Sbjct: 427 QCSVCQWIYDPALGEPLQDVAPGTPWNDVPDNFLCPECSLGKDVFDVLATE 477



>gb:BX950851_839651 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 509

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 17/49 (34%), Positives = 26/49 (53%)
 Frame = -2

Query: 446 TGICECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           +G  +C  C + YD A G+P   + PG  +  +P+ + CP CG  K  F
Sbjct: 457 SGCMQCSVCQWIYDPALGEPMQDVTPGTMWSDVPDSFLCPECGLGKDVF 505



>sp|Q8Z4C5|NORV_SALTI Anaerobic nitric oxide reductase
           flavorubredoxin (FlRd) (FlavoRb).>pir|AD0845|AD0845
           probable flavoprotein STY2962 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain
           CT18)>gb:AE016843_346759 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, section 10 of 16 of the
           complete genome.>gb:AL627276_543076 Salmonella enterica
           serovar Typhi (Salmonella typhi) strain CT18, complete
           chromosome; segment 12/20.>gb:AE014613_984091 Salmonella
           enterica subsp. enterica serovar Typhi Ty2, complete
           genome.
          Length = 479

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 17/51 (33%), Positives = 27/51 (52%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSVE 282
           +C  C + YD A G+P   + PG P+  +P+++ CP C   K  F   + E
Sbjct: 427 QCSVCQWIYDPALGEPLQDVAPGTPWSDVPDNFLCPECSLGKDVFDVLATE 477



>gb:BX957219_843556 Methanococcus maripaludis S2 complete genome;
           segment 1/5.
          Length = 45

 Score = 43.9 bits (102), Expect = 0.004
 Identities = 19/47 (40%), Positives = 24/47 (51%)
 Frame = -2

Query: 440 ICECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           + +C  CG+ YDE           G  F  +P+DW CP CGA KS F
Sbjct: 3   VWKCTICGYVYDEEK--------EGKKFSELPDDWACPICGAKKSAF 41



>gb:CR522870_101758 Desulfotalea psychrophila LSv54 chromosome.
          Length = 56

 Score = 43.9 bits (102), Expect = 0.004
 Identities = 18/45 (40%), Positives = 25/45 (55%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           EC  CG+ YD   GD    + P   ++ +P+DW CP CGA +  F
Sbjct: 9   EC-PCGYIYDPEEGDYDNGVEPKTAWEDLPDDWTCPLCGAEQDAF 52



>sp|P00267|RUBR_PEPAS Rubredoxin (Rd).>pir|A00272|RUPE rubredoxin -
           Peptostreptococcus asaccharolyticus
          Length = 53

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 20/46 (43%), Positives = 25/46 (54%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           EC  CG+ YD A   P  P   G  F+ + E+W CP CGA K  F+
Sbjct: 5   ECTLCGYIYDPALVGPDTPDQDGA-FEDVSENWVCPLCGAGKEDFE 49



>gb:BX571965_790849 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.>gb:CP000010_866384
           Burkholderia mallei ATCC 23344 chromosome 1, complete
           sequence.
          Length = 60

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 19/44 (43%), Positives = 22/44 (50%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           C  CG+ Y+EA G P   I  G  F  +P  WRCP C   K  F
Sbjct: 12  CLICGWIYNEAEGLPDEGIAAGTRFADIPHGWRCPLCDVGKEDF 55



>gb:AE012559_285072 Xylella fastidiosa Temecula1, section 7 of 9 of
           the complete genome.>gb:AE009442_961648 Xylella
           fastidiosa Temecula1, complete genome.
          Length = 56

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 18/45 (40%), Positives = 24/45 (53%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           C  CGF Y E  G P   I  G  ++ + E+W CP CG  K+ F+
Sbjct: 7   CTVCGFLYREEEGFPEEGIAAGTRWEDVSEEWVCPDCGIGKADFE 51



>pir|B82814|B82814 rubredoxin XF0379 [imported] - Xylella fastidiosa
           (strain 9a5c)>gb:AE003889_48018 Xylella fastidiosa 9a5c,
           section 35 of 229 of the complete
           genome.>gb:AE003849_1115228 Xylella fastidiosa 9a5c,
           complete genome.
          Length = 57

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 18/45 (40%), Positives = 24/45 (53%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
           C  CGF Y E  G P   I  G  ++ + E+W CP CG  K+ F+
Sbjct: 8   CTVCGFLYREEEGFPEEGIAAGTRWEDVSEEWVCPDCGIGKADFE 52



>gb:CR378666_94532 Photobacterium profundum SS9; segment 4/12.
          Length = 514

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 26/108 (24%), Positives = 49/108 (45%), Gaps = 2/108 (1%)
 Frame = -2

Query: 614 PRSIDVSQEDKPISQQPISEQAVQEPSFSPETSQD--SLTEAENFDKRRLEEKFAVLNTG 441
           PRS+  SQ    ++ QP+ E      + +    Q+  S T A + D+++ +         
Sbjct: 417 PRSVVASQS--VVTPQPVVETVTPATNEAAVVQQEVTSTTTASSTDQKQKQI-------- 466

Query: 440 ICECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQ 297
              C  C + Y+   G+P+  + P   ++ +P+ + CP CG  K  F+
Sbjct: 467 ---CTVCQWIYNPELGEPNQGVEPKTAWEEVPDSFLCPECGIGKQVFE 511



>gb:BX957220_843749 Methanococcus maripaludis S2 complete genome;
           segment 2/5.
          Length = 494

 Score = 42.0 bits (97), Expect = 0.013
 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 1/40 (2%)
 Frame = -2

Query: 431 CRSCG-FKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGA 315
           C  C  F+YDE+ GD    I PG      P +W+CP CG+
Sbjct: 6   CNVCNVFEYDESRGDSVTNIKPGTKIKDFPNNWKCPICGS 45



>gb:CP000020_871958 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 496

 Score = 41.6 bits (96), Expect = 0.018
 Identities = 15/44 (34%), Positives = 22/44 (50%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           C  C + YD   G+P+  + P  P+  +P D+ CP C   K  F
Sbjct: 449 CSVCNWVYDPEIGEPNQGVEPNTPWSSVPNDFLCPECHLGKDVF 492



>gb:PPU233397_159562 Pseudomonas putida P1 alkane degradation genes
           (alkBFGHJKL and alkST) and flanking DNA.
          Length = 134

 Score = 41.2 bits (95), Expect = 0.023
 Identities = 14/38 (36%), Positives = 20/38 (52%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTC 321
           +C  C + YDE  G+P     P   +  +PE+W CP C
Sbjct: 5   QCPDCQYIYDECKGEPHEGFQPNTNWGEIPEEWACPDC 42



>sp|P12692|RUB1_PSEOL Rubredoxin 1.>pir|A32850|RUPSO1 rubredoxin I -
           Pseudomonas oleovorans plasmid OCT>gb:POL245436_159086
           Pseudomonas putida OCT plasmid alk genes cluster
           (alkBFGHJKL, alkN and alkST genes) and flanking DNA,
           strain TF4-1L (GPo1), formerly annotated as Pseudomonas
           oleovorans.
          Length = 132

 Score = 40.4 bits (93), Expect = 0.039
 Identities = 14/38 (36%), Positives = 21/38 (55%)
 Frame = -2

Query: 434 ECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTC 321
           +C  C + YDE  G+P     P   ++ +P+DW CP C
Sbjct: 5   QCPDCQYIYDENKGEPHEGFHPNTSWNDIPKDWACPDC 42



>gb:AB017063_1513343 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K3K7.>gb:AY050768_1562278 Arabidopsis thaliana
           unknown protein (At5g51010) mRNA, complete
           cds.>gb:AY079348_1568238 Arabidopsis thaliana unknown
           protein (At5g51010) mRNA, complete
           cds.>gb:AY086803_1571846 Arabidopsis thaliana clone
           27885 mRNA, complete sequence.
          Length = 154

 Score = 39.3 bits (90), Expect = 0.087
 Identities = 24/98 (24%), Positives = 42/98 (42%), Gaps = 1/98 (1%)
 Frame = -2

Query: 566 PISEQAVQEPSFSPETSQDSLTEAENFDKRRLEE-KFAVLNTGICECRSCGFKYDEAAGD 390
           P +   +Q  SF P  S   L   ++  K         V +     CR CG+ Y++    
Sbjct: 20  PPTTPTLQRSSFLPYYSMRLLGNKKSLSKSSAPRFSMRVSSKQAYICRDCGYIYNDRT-- 77

Query: 389 PSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSVEIA 276
                    PFD++P+++ CP C A K  F++   +++
Sbjct: 78  ---------PFDKLPDNYFCPVCAAPKRRFRAYMPDVS 106



>gb:AF350429_503937 Nocardioides sp. CF8 alkane
           hydroxylase-rubredoxin (alkB) and putative ferredoxin
           genes, complete cds.
          Length = 483

 Score = 38.5 bits (88), Expect = 0.15
 Identities = 14/38 (36%), Positives = 20/38 (52%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCG 318
           C  CG+ Y+ A+GD       G  +  +P+ W CP CG
Sbjct: 427 CPGCGYVYEVASGDEREGFAAGTAWADIPDSWFCPDCG 464



>gb:BA000038_724269 Vibrio vulnificus YJ016 DNA, chromosome II,
           complete sequence.
          Length = 494

 Score = 35.8 bits (81), Expect = 0.97
 Identities = 15/44 (34%), Positives = 22/44 (50%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           C  C + YD A G+P+  I  G  +  +P+ + CP C   K  F
Sbjct: 446 CTVCNWVYDPAKGEPNQGIEVGTTWADVPDYFLCPECHLGKDVF 489



>gb:AE017165_395948 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 5 of 6 of the complete
           genome.>gb:AE017126_1031617 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 202

 Score = 35.8 bits (81), Expect = 0.97
 Identities = 33/95 (34%), Positives = 42/95 (44%), Gaps = 14/95 (14%)
 Frame = -2

Query: 614 PRSIDVSQEDKPISQQPISE------QAVQEPSFSPETSQDSLTEAENFDK----RRLEE 465
           P S + + E  PIS Q  S       +A    S  PET  DSLTE EN  K    + LE+
Sbjct: 9   PNSQETAGEGDPISSQAKSSSIKAAYEATSIESNHPETQNDSLTETENSSKAEASKVLEK 68

Query: 464 KFAVL----NTGICECRSCGFKYDEAAGDPSYPIP 372
           K  VL    N  I      GF   E+  + ++P P
Sbjct: 69  KPIVLKEINNQDIFTSIEKGFPKQESKIEYAFPHP 103



>sp|Q8D4F8|NORV_VIBVU Anaerobic nitric oxide reductase
           flavorubredoxin (FlRd) (FlavoRb).>gb:AE016812_339020
           Vibrio vulnificus CMCP6 chromosome II section 5 of 6 of
           the complete sequence.>gb:AE016796_1048744 Vibrio
           vulnificus CMCP6 chromosome II complete sequence.
          Length = 494

 Score = 35.8 bits (81), Expect = 0.97
 Identities = 15/44 (34%), Positives = 22/44 (50%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           C  C + YD A G+P+  I  G  +  +P+ + CP C   K  F
Sbjct: 446 CTVCNWVYDPAKGEPNQGIEVGTTWADVPDYFLCPECHLGKDVF 489



>gb:AF340222_2142682 Synthetic construct PhpA-79 (phpA-79) gene,
           complete cds.
          Length = 721

 Score = 34.7 bits (78), Expect = 2.2
 Identities = 15/45 (33%), Positives = 27/45 (60%)
 Frame = -2

Query: 602 DVSQEDKPISQQPISEQAVQEPSFSPETSQDSLTEAENFDKRRLE 468
           +  +E+KP S++P S +  +EP  SPE S++   E E  +++  E
Sbjct: 624 ETPREEKPQSEKPESPKPTEEPEESPEESEEPQVETEKVEEKLRE 668



>gb:AF318954_499443 Streptococcus pneumoniae pneumococcal histidine
           triad protein B precursor (phtB) gene, partial cds.
          Length = 819

 Score = 34.7 bits (78), Expect = 2.2
 Identities = 15/45 (33%), Positives = 27/45 (60%)
 Frame = -2

Query: 602 DVSQEDKPISQQPISEQAVQEPSFSPETSQDSLTEAENFDKRRLE 468
           +  +E+KP S++P S +  +EP  SPE S++   E E  +++  E
Sbjct: 722 ETPREEKPQSEKPESPKPTEEPEESPEESEEPQVETEKVEEKLRE 766



>pir|B95136|B95136 conserved domain protein SP1174 [imported] -
           Streptococcus pneumoniae (strain
           TIGR4)>gb:AE007418_226344 Streptococcus pneumoniae TIGR4
           section 101 of 194 of the complete
           genome.>gb:AE005672_1104112 Streptococcus pneumoniae
           TIGR4, complete genome.
          Length = 819

 Score = 34.7 bits (78), Expect = 2.2
 Identities = 15/45 (33%), Positives = 27/45 (60%)
 Frame = -2

Query: 602 DVSQEDKPISQQPISEQAVQEPSFSPETSQDSLTEAENFDKRRLE 468
           +  +E+KP S++P S +  +EP  SPE S++   E E  +++  E
Sbjct: 722 ETPREEKPQSEKPESPKPTEEPEESPEESEEPQVETEKVEEKLRE 766



>pir|D69162|D69162 pyruvate dehydrogenase / acetolactate synthase -
           Methanobacterium thermoautotrophicum (strain Delta
           H)>gb:AE000832_28178 Methanobacterium
           thermoautotrophicum from bases 415525 to 429249 (section
           38 of 148) of the complete genome.>gb:AE000666_925260
           Methanobacterium thermoautotrophicum str. Delta H
           complete genome.
          Length = 553

 Score = 34.7 bits (78), Expect = 2.2
 Identities = 15/44 (34%), Positives = 20/44 (45%)
 Frame = -2

Query: 431 CRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFF 300
           C  C + + E A            FD +P DWRCP C A ++ F
Sbjct: 6   CTVCNYIFHEEADGE---------FDSLPADWRCPVCNAPRTAF 40



>gb:AE017332_445939 Mycoplasma hyopneumoniae 232, complete genome.
          Length = 1317

 Score = 34.3 bits (77), Expect = 2.8
 Identities = 32/118 (27%), Positives = 47/118 (39%), Gaps = 9/118 (7%)
 Frame = -3

Query: 766 HQQQLELPSHSTSPRPNSPPLQNPNPTSPTPIXXXXXXXXXXXXXPDTQSLQDP*MSP-- 593
           HQQQ   P     P+P S P   P P + T               P  Q+   P  +P  
Sbjct: 419 HQQQQPQPQSQPQPQPQSQPQSQPQPNAQT--------------QPKAQAQSSP-KAPVQ 463

Query: 592 KKTSPFPSNQFQNRLFKNQAFLQ-------KPLKIHSQRLRISIRGDWRRNSLC*TLG 440
           K  +P PS  F+ R  + + FL+       +  K+ SQ+L   I  ++  N +   LG
Sbjct: 464 KPATPDPSKSFKIRTKRARDFLKEFNKTFYRSNKLKSQKLEEKINSEYLSNKIGIDLG 521



>pir|G75072|G75072 prolyl-tRNA synthetase (pros) PAB1724 -
           Pyrococcus abyssi  (strain Orsay)>gb:CNSPAX04_849733
           Pyrococcus abyssi complete genome; segment 4/6.
          Length = 480

 Score = 34.3 bits (77), Expect = 2.8
 Identities = 18/60 (30%), Positives = 25/60 (41%)
 Frame = -2

Query: 482 KRRLEEKFAVLNTGICECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSF 303
           K+  E++  ++    C   SCG K +E        IP      + PE  RCP CG    F
Sbjct: 413 KKAFEDRRGIVEIPWCGEESCGLKMEEELDAKMLGIPYPEEKAKAPEGSRCPVCGRDAKF 472



>gb:AY428796_1326006 Dictyostelium discoideum DIF insensitive mutant
           A (dimA) gene, complete cds.
          Length = 1227

 Score = 33.9 bits (76), Expect = 3.7
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 6/36 (16%)
 Frame = -3

Query: 766 HQQQLELPS------HSTSPRPNSPPLQNPNPTSPT 677
           +QQQL+LP        ST P  N+PP+++P P +PT
Sbjct: 433 NQQQLQLPQPQQQQHKSTPPTQNTPPVKSPAPQTPT 468



>gb:CAJ10145_845052 Clostridium butyricum gene encoding rubredoxin,
           strain DSM 5431, partial.
          Length = 26

 Score = 33.9 bits (76), Expect = 3.7
 Identities = 13/24 (54%), Positives = 17/24 (70%)
 Frame = -2

Query: 410 YDEAAGDPSYPIPPGLPFDRMPED 339
           YDEAAGDP   + PG  F+ +P+D
Sbjct: 3   YDEAAGDPDNGVAPGTKFEDIPDD 26



>gb:BA000030_697995 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 844

 Score = 33.9 bits (76), Expect = 3.7
 Identities = 21/69 (30%), Positives = 27/69 (39%), Gaps = 10/69 (14%)
 Frame = -3

Query: 745 PSHSTSPRPNSPPLQNPNP----------TSPTPIXXXXXXXXXXXXXPDTQSLQDP*MS 596
           P H+ +P PNSPP  +P P          +SPTP                T S   P  S
Sbjct: 726 PKHANTPPPNSPPGTSPTPPSPPNSSSANSSPTPSATATHPSNSASSTTTTPS---PPKS 782

Query: 595 PKKTSPFPS 569
           P   +P P+
Sbjct: 783 PTPATPPPT 791



>gb:AF083501_2191670 Macaca mulatta rhadinovirus 17577, complete
           genome.
          Length = 448

 Score = 31.6 bits (70), Expect(2) = 4.6
 Identities = 13/24 (54%), Positives = 13/24 (54%)
 Frame = -3

Query: 745 PSHSTSPRPNSPPLQNPNPTSPTP 674
           PSH  SP P  PP   P P SP P
Sbjct: 170 PSHHDSPEPPEPPTSLPPPDSPGP 193



 Score = 20.8 bits (42), Expect(2) = 4.6
 Identities = 9/22 (40%), Positives = 12/22 (54%)
 Frame = -2

Query: 623 PKPPRSIDVSQEDKPISQQPIS 558
           P PP+S    Q   P +QQ +S
Sbjct: 212 PGPPQSPTPQQAPSPNTQQAVS 233



>gb:AK125814_1916071 Homo sapiens cDNA FLJ43826 fis, clone
           TESTI4002703.
          Length = 317

 Score = 33.5 bits (75), Expect = 4.8
 Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 12/81 (14%)
 Frame = -2

Query: 623 PKPPRSIDVSQE-DKPISQQPISEQA-------VQEPSFSPETSQDSLTEAENFDKRRL- 471
           P+P   I  S   +K I+ +P   Q        V  P    E +QDSL ++EN+ + +  
Sbjct: 221 PEPTTEIGYSTALEKTIAPRPDQVQTQHRNLTEVTGPPTELEPTQDSLVQSENYAQNKAL 280

Query: 470 ---EEKFAVLNTGICECRSCG 417
              EE+ A  +T IC+  +CG
Sbjct: 281 TAPEEQKASTSTNICDLCTCG 301



>gb:AF332857S2_1897110 Homo sapiens acyl coenzyme A: cholesterol
           acyltransferase-2 gene, exons 6 through 15 and complete
           cds.
          Length = 522

 Score = 33.5 bits (75), Expect = 4.8
 Identities = 14/41 (34%), Positives = 27/41 (65%)
 Frame = -1

Query: 243 W*YSHLWPEGSPYLWWFVLGIRVLLVWLLSAIAEDFMFCSI 121
           W YS+++ +G   L     G+ +L V+L+SA+A +++FC +
Sbjct: 401 WLYSYVYQDGLRLLGARARGVAMLGVFLVSAVAHEYIFCFV 441



>gb:AF099031_1882956 Homo sapiens acyl Co-A: cholesterol
           acyltransferase-2 (ACAT2) mRNA, complete cds.
          Length = 522

 Score = 33.5 bits (75), Expect = 4.8
 Identities = 14/41 (34%), Positives = 27/41 (65%)
 Frame = -1

Query: 243 W*YSHLWPEGSPYLWWFVLGIRVLLVWLLSAIAEDFMFCSI 121
           W YS+++ +G   L     G+ +L V+L+SA+A +++FC +
Sbjct: 401 WLYSYVYQDGLRLLGARARGVAMLGVFLVSAVAHEYIFCFV 441



>gb:AE017343_1755856 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 1041

 Score = 33.5 bits (75), Expect = 4.8
 Identities = 18/55 (32%), Positives = 22/55 (40%)
 Frame = -3

Query: 334 GALLVGRPRVSSRARAWRLPVLPRISNLDWVVILSPLARRLSLSMVVCSWDSCSS 170
           G L + +P+V    R W         NLDW  IL        L   VC W + SS
Sbjct: 257 GPLFLTKPQVGKTHREWGEEEFQFFENLDWAKILPQAFHLYQLQECVCLWGARSS 311



>gb:CR382132_1665859 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 482

 Score = 33.5 bits (75), Expect = 4.8
 Identities = 26/77 (33%), Positives = 33/77 (42%)
 Frame = -2

Query: 452 LNTGICECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWRCPTCGAAKSFFQSKSVEIAG 273
           LN  + E      +  E A D   P PP     R P DW C  CG   S FQ ++   A 
Sbjct: 279 LNDKVVEVSPSSEQVIERAQDLLTPFPPSKNRPR-PGDWTCQVCGF--SNFQRRT---AC 332

Query: 272 FAQNQQFGLGGNTLTSG 222
           F  N+  G+GG+    G
Sbjct: 333 FRCNEAIGVGGHNGNMG 349



>sp|O75908|SOA2_HUMAN Sterol O-acyltransferase 2 (EC 2.3.1.26)
           (Cholesterol acyltransferase 2) (Acyl coenzyme
           A:cholesterol acyltransferase 2)
           (ACAT-2).>gb:AF059203_1879736 Homo sapiens acyl coenzyme
           A:cholesterol acyltransferase 2 mRNA, complete
           cds.>gb:F331502S15_1995718 Homo sapiens
           acyl-CoA:cholesterol acyltransferase-2 (SOAT2) gene,
           exon 15 and complete cds.
          Length = 522

 Score = 33.5 bits (75), Expect = 4.8
 Identities = 14/41 (34%), Positives = 27/41 (65%)
 Frame = -1

Query: 243 W*YSHLWPEGSPYLWWFVLGIRVLLVWLLSAIAEDFMFCSI 121
           W YS+++ +G   L     G+ +L V+L+SA+A +++FC +
Sbjct: 401 WLYSYVYQDGLRLLGARARGVAMLGVFLVSAVAHEYIFCFV 441



>gb:BC066195_2105783 Mus musculus Sec23 interacting protein, mRNA
           (cDNA clone IMAGE:30065851), partial cds.
          Length = 849

 Score = 33.1 bits (74), Expect = 6.3
 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 4/33 (12%)
 Frame = -3

Query: 760 QQLELPSHSTSPRPNSPPLQN----PNPTSPTP 674
           QQ ++P HS+ P P+ PP+Q     P P  P P
Sbjct: 125 QQCQMPGHSSYPPPSGPPVQTYQMPPGPLPPLP 157



>gb:CET12G3_1367662 Caenorhabditis elegans cosmid T12G3, complete
           sequence.
          Length = 693

 Score = 33.1 bits (74), Expect = 6.3
 Identities = 20/67 (29%), Positives = 28/67 (41%), Gaps = 2/67 (2%)
 Frame = -3

Query: 748 LPSHSTSPRP--NSPPLQNPNPTSPTPIXXXXXXXXXXXXXPDTQSLQDP*MSPKKTSPF 575
           +PSH  +P P   +PP+  P P  P+P                 +  Q+P + P  TS  
Sbjct: 271 VPSHQVNPAPMPQAPPVSTPVPFPPSPTIGNGAV---------PKPAQEPRIPPSPTSAL 321

Query: 574 PSNQFQN 554
           P  QF N
Sbjct: 322 PPPQFFN 328



>pir|T24869|T24869 hypothetical protein T12G3.1 - Caenorhabditis
           elegans
          Length = 753

 Score = 33.1 bits (74), Expect = 6.3
 Identities = 20/67 (29%), Positives = 28/67 (41%), Gaps = 2/67 (2%)
 Frame = -3

Query: 748 LPSHSTSPRP--NSPPLQNPNPTSPTPIXXXXXXXXXXXXXPDTQSLQDP*MSPKKTSPF 575
           +PSH  +P P   +PP+  P P  P+P                 +  Q+P + P  TS  
Sbjct: 331 VPSHQVNPAPMPQAPPVSTPVPFPPSPTIGNGAV---------PKPAQEPRIPPSPTSAL 381

Query: 574 PSNQFQN 554
           P  QF N
Sbjct: 382 PPPQFFN 388



>gb:BC058055_2552244 Danio rerio ubiquitin-like, containing PHD and
           RING finger domains, 1, mRNA (cDNA clone MGC:63539
           IMAGE:3815965), complete cds.
          Length = 775

 Score = 32.7 bits (73), Expect = 8.2
 Identities = 23/87 (26%), Positives = 34/87 (39%), Gaps = 11/87 (12%)
 Frame = -2

Query: 548 VQEPSFS--PETSQDSLTEAENFDKRRLEEKFAVLNTGICECRSCGFKYDE--------- 402
           ++EP  +  P  S DS  +  N  + ++ +     N  +C C  CG K D          
Sbjct: 274 IEEPGSAEGPGASSDSPLKRSNGPECKVCKDDPKKNCRVCNCHVCGIKQDPDKQLLCDEC 333

Query: 401 AAGDPSYPIPPGLPFDRMPEDWRCPTC 321
                +Y + P L      EDW CP C
Sbjct: 334 DMAFHTYCLNPPLTTIPDDEDWYCPDC 360



>gb:AJ629843_2278480 Chrysanthemum virus B cp gene for coat protein,
           genomic RNA, isolate Haryana.
          Length = 315

 Score = 32.7 bits (73), Expect = 8.2
 Identities = 19/68 (27%), Positives = 32/68 (47%)
 Frame = +3

Query: 144 QLLQKVTRQEEHESQEQTTIDKESLLARGESITTQSKLLILGKTGNLHALALEETLGRPT 323
           +L +    +E  +S E+   D  +  AR  S  TQ   L+  +  N+H   +   +GRP 
Sbjct: 36  RLAEMEREREREQSLEEMNFDTPAEDARNISRLTQLAALLRKEQTNVHVTNMALEIGRPA 95

Query: 324 SRAPPILR 347
            + PP +R
Sbjct: 96  LQPPPNMR 103



>gb:AY819760_1964925 Homo sapiens mucosal vascular addressin cell
           adhesion molecule 1 (MADCAM1) mRNA, complete cds,
           alternatively spliced.
          Length = 390

 Score = 32.7 bits (73), Expect = 8.2
 Identities = 27/85 (31%), Positives = 41/85 (48%), Gaps = 5/85 (5%)
 Frame = -3

Query: 802 IDLNNKQAL*WLHQQQLELPSHSTSPR-PNSPPLQNPNPTSPTPIXXXXXXXXXXXXXPD 626
           ++L+++QA+  LH      P  +TSP  PN+   ++P+ TSP                PD
Sbjct: 213 LELSHRQAIPVLHSPTSPEPPDTTSPEPPNTTSPESPDTTSP--------------ESPD 258

Query: 625 TQSLQDP*MS----PKKTSPFPSNQ 563
           T S + P  +    P KTSP P+ Q
Sbjct: 259 TTSQEPPDTTSPEPPDKTSPEPAPQ 283



>gb:AE017342_1754943 Cryptococcus neoformans var. neoformans JEC21
           chromosome 2, complete sequence.
          Length = 450

 Score = 32.7 bits (73), Expect = 8.2
 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%)
 Frame = -2

Query: 623 PKPPRSIDVSQEDKPISQQPIS-EQAVQEPSFSPET 519
           P+PP  +D+  ED  +  QPIS  Q  Q+P F   T
Sbjct: 265 PQPPGMMDIEMEDSAVYSQPISMSQIQQQPQFGVRT 300



>gb:AC092387_1735287 Oryza sativa chromosome 10 BAC OJ1004_F02
           genomic sequence, complete sequence.
          Length = 207

 Score = 32.7 bits (73), Expect = 8.2
 Identities = 25/81 (30%), Positives = 34/81 (41%), Gaps = 5/81 (6%)
 Frame = +2

Query: 110 ENHQIEQ-NIKSSAIAESNQTRRTRIPRTNHHR*GEPSGQR*EYYHPIQIADS----GQN 274
           E H IE  N    A   S   RR+R P  +H R G PS        P  +A +    G +
Sbjct: 81  EGHYIEHWNDDGRAATTSTCDRRSRSPPASHRRHGSPSSMARRSLPPPAVAAADLRPGTS 140

Query: 275 RQSPRSCSGRNSWPPHK*GTS 337
              PR+ +G +  PP    T+
Sbjct: 141 ALPPRATAGVDPLPPRPAATA 161



>gb:CR548612_1375499 Paramecium tetraurelia macronuclear largest
           chromosome, complete sequence.
          Length = 422

 Score = 32.7 bits (73), Expect = 8.2
 Identities = 15/41 (36%), Positives = 26/41 (63%)
 Frame = +3

Query: 183 SQEQTTIDKESLLARGESITTQSKLLILGKTGNLHALALEE 305
           + +Q +I+K +LL +G+SI   +K + LG   N H L L++
Sbjct: 233 NSQQYSIEKFNLLEQGQSINFNAKFISLGSEYNFHILELKQ 273



>gb:BA000030_704115 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 569

 Score = 32.7 bits (73), Expect = 8.2
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = -3

Query: 736 STSPRPNSPPLQNPNPTSPTP 674
           STSP P+ PP   P P SPTP
Sbjct: 313 STSPSPSPPPPSTPKPPSPTP 333



>pir|A71093|A71093 proline-tRNA ligase (EC 6.1.1.15) - Pyrococcus
           horikoshii>gb:BA000001_649665 Pyrococcus horikoshii OT3
           DNA, complete genome.
          Length = 480

 Score = 32.7 bits (73), Expect = 8.2
 Identities = 21/70 (30%), Positives = 29/70 (41%)
 Frame = -2

Query: 512 DSLTEAENFDKRRLEEKFAVLNTGICECRSCGFKYDEAAGDPSYPIPPGLPFDRMPEDWR 333
           D+L EA    K   E++  ++    C   SCG K +E        IP      + PE  +
Sbjct: 407 DTLEEA----KAVFEDRRGIVEIPWCGEESCGLKMEEELEAKMLGIPYPEEKAKAPEGSK 462

Query: 332 CPTCGAAKSF 303
           CP CG    F
Sbjct: 463 CPVCGREAKF 472



>sp|O77759|SOA2_CERAE Sterol O-acyltransferase 2 (EC 2.3.1.26)
           (Cholesterol acyltransferase 2) (Acyl coenzyme
           A:cholesterol acyltransferase 2)
           (ACAT-2).>gb:AF053234_1879347 Chlorocebus aethiops
           acyl-CoA:cholesterol acyltransferase 2 (ACAT2) mRNA,
           complete cds.
          Length = 526

 Score = 32.7 bits (73), Expect = 8.2
 Identities = 14/41 (34%), Positives = 27/41 (65%)
 Frame = -1

Query: 243 W*YSHLWPEGSPYLWWFVLGIRVLLVWLLSAIAEDFMFCSI 121
           W YS+++ +G   L     G+ +L V+L+SA+A +++FC +
Sbjct: 405 WLYSYVYQDGLWLLGAQARGVAMLGVFLVSAVAHEYIFCFV 445



>sp|Q13477|MACA_HUMAN Mucosal addressin cell adhesion molecule-1
           precursor (MAdCAM-1) (hMAdCAM-1).>gb:HSMADCAM5_2018620
           Human mucosal addressin cell adhesion molecule-1
           (MAdCAM-1) gene, exon 5 and complete
           cds.>gb:HSU43628_2024291 Human mucosal addressin cell
           adhesion molecule-1 (MAdCAM-1) mRNA, complete cds.
          Length = 406

 Score = 32.7 bits (73), Expect = 8.2
 Identities = 27/87 (31%), Positives = 41/87 (47%), Gaps = 7/87 (8%)
 Frame = -3

Query: 802 IDLNNKQAL*WLHQQQLELPSHSTSPR-PNSPPLQNPNPTSPTPIXXXXXX--XXXXXXX 632
           ++L+++QA+  LH      P  +TSP  PN+   ++P+ TSP                  
Sbjct: 213 LELSHRQAIPVLHSPTSPEPPDTTSPEPPNTTSPESPDTTSPESPDTTSQEPPDTTSQEP 272

Query: 631 PDTQSLQDP*MS----PKKTSPFPSNQ 563
           PDT S + P  +    P KTSP P+ Q
Sbjct: 273 PDTTSQEPPDTTSPEPPDKTSPEPAPQ 299


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 833,847,090
Number of Sequences: 1806583
Number of extensions: 18612000
Number of successful extensions: 103717
Number of sequences better than 10.0: 188
Number of HSP's better than 10.0 without gapping: 85779
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 101948
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 52419653105
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)