BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig9913
         (841 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP005869_1859334 Oryza sativa (japonica cultivar-group) genom...   150   3e-35   
gb:AY088598_1573614 Arabidopsis thaliana clone 8256 mRNA, comple...   146   5e-34   
pir|T01006|T01006 hypothetical protein At2g39760 [imported] - Ar...   144   2e-33   Arabidopsis thaliana [mouse-ear cress]
gb:AY136451_1581951 Arabidopsis thaliana putative protein (At5g1...   132   6e-30   
gb:AP005182_1848936 Oryza sativa (japonica cultivar-group) genom...   132   1e-29   
gb:ATAC018907_1543707 Arabidopsis thaliana chromosome III BAC F2...   122   8e-27   
gb:AP003633_1831840 Oryza sativa (japonica cultivar-group) genom...   111   1e-23   
gb:AP005107_1847957 Oryza sativa (japonica cultivar-group) genom...   109   6e-23   
gb:OSJN00079_1694507 Oryza sativa genomic DNA, chromosome 4, BAC...   109   7e-23   
gb:AP004183_1838657 Oryza sativa (japonica cultivar-group) genom...   107   2e-22   
gb:AP004183_1838658 Oryza sativa (japonica cultivar-group) genom...   104   2e-21   
gb:AE016959_1022686 Oryza sativa (japonica cultivar-group) chrom...   103   4e-21   
gb:AP004183_1838659 Oryza sativa (japonica cultivar-group) genom...   103   5e-21   
gb:AE016959_1022692 Oryza sativa (japonica cultivar-group) chrom...   100   3e-20   
gb:AP004591_1842005 Oryza sativa (japonica cultivar-group) genom...    99   8e-20   
gb:AP005476_1852574 Oryza sativa (japonica cultivar-group) genom...    99   1e-19   
gb:OSJN00079_1694506 Oryza sativa genomic DNA, chromosome 4, BAC...    99   1e-19   
gb:AP005607_1854809 Oryza sativa (japonica cultivar-group) genom...    99   1e-19   
gb:AP004183_1838652 Oryza sativa (japonica cultivar-group) genom...    98   2e-19   
gb:AP003842_1834088 Oryza sativa (japonica cultivar-group) genom...    98   2e-19   
gb:AE016959_1022691 Oryza sativa (japonica cultivar-group) chrom...    98   2e-19   
gb:AC090871_1734503 Oryza sativa chromosome 3 BAC OSJNBb0060J21 ...    97   4e-19   
gb:AP004183_1838648 Oryza sativa (japonica cultivar-group) genom...    97   5e-19   
gb:AF128457_1770619 Oryza sativa subsp. indica BAC clone 16F19 p...    97   5e-19   
gb:AF119222_1769707 Oryza sativa BAC clone 1.H19, complete seque...    97   5e-19   
gb:AE016959_1022658 Oryza sativa (japonica cultivar-group) chrom...    96   1e-18   
gb:AF128457_1770618 Oryza sativa subsp. indica BAC clone 16F19 p...    95   1e-18   
gb:AF119222_1769706 Oryza sativa BAC clone 1.H19, complete seque...    95   1e-18   
gb:AE016959_1022672 Oryza sativa (japonica cultivar-group) chrom...    95   2e-18   
gb:AF527809_1808457 Sorghum bicolor clone BAC SB_BBc0234M12 php2...    94   2e-18   
gb:AE016959_1022643 Oryza sativa (japonica cultivar-group) chrom...    94   2e-18   
gb:AP003865_1834529 Oryza sativa (japonica cultivar-group) genom...    93   5e-18   
gb:AP003865_1834518 Oryza sativa (japonica cultivar-group) genom...    93   5e-18   
gb:AY084611_1569699 Arabidopsis thaliana clone 113260 mRNA, comp...    93   5e-18   
gb:AY042879_1560944 Arabidopsis thaliana Unknown protein mRNA, c...    93   5e-18   
gb:AE016959_1022711 Oryza sativa (japonica cultivar-group) chrom...    93   5e-18   
gb:AE016959_1022699 Oryza sativa (japonica cultivar-group) chrom...    93   7e-18   
gb:AE016959_1022679 Oryza sativa (japonica cultivar-group) chrom...    93   7e-18   
gb:AE016959_1022665 Oryza sativa (japonica cultivar-group) chrom...    93   7e-18   
gb:AE016959_1022689 Oryza sativa (japonica cultivar-group) chrom...    92   9e-18   
gb:AE016959_1022682 Oryza sativa (japonica cultivar-group) chrom...    92   9e-18   
gb:AE016959_1022671 Oryza sativa (japonica cultivar-group) chrom...    92   9e-18   
gb:AE016959_1022642 Oryza sativa (japonica cultivar-group) chrom...    92   9e-18   
gb:AP005410_1851305 Oryza sativa (japonica cultivar-group) genom...    92   1e-17   
gb:AE016959_1022678 Oryza sativa (japonica cultivar-group) chrom...    92   1e-17   
gb:AE016959_1022670 Oryza sativa (japonica cultivar-group) chrom...    92   1e-17   
gb:AP003865_1834520 Oryza sativa (japonica cultivar-group) genom...    92   2e-17   
gb:AY224567_1590764 Oryza sativa (japonica cultivar-group) isola...    92   2e-17   
gb:AP005607_1854804 Oryza sativa (japonica cultivar-group) genom...    91   2e-17   
gb:AY084246_1569338 Arabidopsis thaliana clone 101153 mRNA, comp...    91   3e-17   
gb:ATAC009540_1542994 Arabidopsis thaliana chromosome III BAC F2...    91   3e-17   
gb:AE016959_1022694 Oryza sativa (japonica cultivar-group) chrom...    91   3e-17   
gb:AP004761_1844592 Oryza sativa (japonica cultivar-group) genom...    91   4e-17   
gb:AP004591_1842002 Oryza sativa (japonica cultivar-group) genom...    91   4e-17   
gb:AE016959_1022683 Oryza sativa (japonica cultivar-group) chrom...    90   5e-17   
gb:AE016959_1022693 Oryza sativa (japonica cultivar-group) chrom...    90   6e-17   
gb:AE016959_1022675 Oryza sativa (japonica cultivar-group) chrom...    90   6e-17   
gb:AF527809_1808460 Sorghum bicolor clone BAC SB_BBc0234M12 php2...    89   8e-17   
gb:AE016959_1022644 Oryza sativa (japonica cultivar-group) chrom...    89   8e-17   
gb:AP003865_1834526 Oryza sativa (japonica cultivar-group) genom...    89   1e-16   
gb:AP003865_1834523 Oryza sativa (japonica cultivar-group) genom...    89   1e-16   
gb:OSJN00106_1695016 Oryza sativa genomic DNA, chromosome 4, BAC...    89   1e-16   
gb:OSJN00079_1694505 Oryza sativa genomic DNA, chromosome 4, BAC...    89   1e-16   
gb:AE016959_1022659 Oryza sativa (japonica cultivar-group) chrom...    89   1e-16   
gb:AP004691_1843472 Oryza sativa (japonica cultivar-group) genom...    88   2e-16   
gb:AF488415_1804403 Triticum monococcum chromosome 7Am BAC 5K14 ...    88   2e-16   
gb:AE016959_1022726 Oryza sativa (japonica cultivar-group) chrom...    87   5e-16   
gb:AE016959_1022641 Oryza sativa (japonica cultivar-group) chrom...    86   7e-16   
gb:AF527809_1808454 Sorghum bicolor clone BAC SB_BBc0234M12 php2...    86   9e-16   
pir|T47406|T47406 hypothetical protein F23N14.80 - Arabidopsis t...    86   9e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AP003865_1834525 Oryza sativa (japonica cultivar-group) genom...    86   1e-15   
gb:AE016959_1022739 Oryza sativa (japonica cultivar-group) chrom...    85   1e-15   
gb:AE016959_1022730 Oryza sativa (japonica cultivar-group) chrom...    85   1e-15   
gb:BC071613_1988687 Homo sapiens hypothetical protein LOC339745,...    84   3e-15   
gb:AX881689_1478700 Sequence 16594 from Patent EP1074617.>gb:AK0...    84   3e-15   
gb:AE016959_1022734 Oryza sativa (japonica cultivar-group) chrom...    84   4e-15   
gb:AE016959_1022725 Oryza sativa (japonica cultivar-group) chrom...    84   4e-15   
gb:AE016959_1022698 Oryza sativa (japonica cultivar-group) chrom...    84   4e-15   
gb:AP003633_1831839 Oryza sativa (japonica cultivar-group) genom...    83   7e-15   
gb:AE016959_1022729 Oryza sativa (japonica cultivar-group) chrom...    83   7e-15   
gb:AP004591_1842003 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
gb:AP003865_1834532 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
gb:AE016959_1022748 Oryza sativa (japonica cultivar-group) chrom...    82   1e-14   
gb:AE016959_1022733 Oryza sativa (japonica cultivar-group) chrom...    82   1e-14   
gb:AE016959_1022657 Oryza sativa (japonica cultivar-group) chrom...    82   1e-14   
gb:AE016959_1022773 Oryza sativa (japonica cultivar-group) chrom...    82   2e-14   
gb:AP005554_1853984 Oryza sativa (japonica cultivar-group) genom...    81   2e-14   
gb:AP004691_1843473 Oryza sativa (japonica cultivar-group) genom...    81   2e-14   
gb:AE016959_1022741 Oryza sativa (japonica cultivar-group) chrom...    81   2e-14   
gb:AB071989_2047434 Mus musculus mRNA for Spop, partial cds.           80   4e-14   
gb:CR861145_1185159 Pongo pygmaeus mRNA; cDNA DKFZp459J1214 (fro...    80   4e-14   
gb:AK004669_1152496 Mus musculus adult male lung cDNA, RIKEN ful...    80   4e-14   
sp|O43791|SPOP_HUMAN|SPOP_HUMAN Speckle-type POZ protein.>gb:AK028201_11608...    80   4e-14   Homo sapiens [man]
gb:OSJN00079_1694508 Oryza sativa genomic DNA, chromosome 4, BAC...    80   6e-14   
gb:AE016959_1022662 Oryza sativa (japonica cultivar-group) chrom...    79   8e-14   
gb:AY159314_2077188 Mus musculus TDPOZ4 gene, complete cds.            79   1e-13   
gb:AE016959_1022704 Oryza sativa (japonica cultivar-group) chrom...    79   1e-13   
gb:AY159315_2077189 Mus musculus TDPOZ5 gene, complete cds.            79   1e-13   
gb:AP004761_1844591 Oryza sativa (japonica cultivar-group) genom...    79   1e-13   
gb:BC046272_2549618 Xenopus laevis speckle-type POZ protein, mRN...    78   2e-13   
gb:AE016959_1022772 Oryza sativa (japonica cultivar-group) chrom...    78   2e-13   
gb:AP003865_1834533 Oryza sativa (japonica cultivar-group) genom...    78   2e-13   
gb:CR860120_1184210 Pongo pygmaeus mRNA; cDNA DKFZp459K1011 (fro...    78   2e-13   
gb:BC071125_2555987 Xenopus laevis MGC81433 protein, mRNA (cDNA ...    77   4e-13   
gb:BC053276_2550667 Danio rerio speckle-type POZ protein, mRNA (...    77   4e-13   
gb:OSJN00050_1693899 Oryza sativa genomic DNA, chromosome 4, BAC...    77   4e-13   
gb:AE016959_1022645 Oryza sativa (japonica cultivar-group) chrom...    76   7e-13   
gb:AE014297_1139472 Drosophila melanogaster chromosome 3R, compl...    75   2e-12   
gb:AE014297_1139471 Drosophila melanogaster chromosome 3R, compl...    75   2e-12   
gb:AE014297_1139469 Drosophila melanogaster chromosome 3R, compl...    75   2e-12   
gb:AF545858_2067959 Mus musculus TDPOZ1 (Tdpoz1) and TDPOZ2 (Tdp...    74   4e-12   
gb:AP005892_1859753 Oryza sativa (japonica cultivar-group) genom...    74   4e-12   
gb:AP005410_1851312 Oryza sativa (japonica cultivar-group) genom...    73   6e-12   
pir|S42384|S42384 Kruppel-like protein - Caenorhabditis elegans        73   8e-12   Caenorhabditis elegans [roundworm]
sp|P34568|YNV5_CAEEL|YNV5_CAEEL Hypothetical protein T16H12.5 in chromosome...    73   8e-12   Caenorhabditis elegans [roundworm]
gb:AE016959_1022648 Oryza sativa (japonica cultivar-group) chrom...    72   1e-11   
gb:OSJN00005_1693161 Oryza sativa genomic DNA, chromosome 4, BAC...    71   2e-11   
gb:AP004761_1844589 Oryza sativa (japonica cultivar-group) genom...    71   3e-11   
gb:AP004591_1841999 Oryza sativa (japonica cultivar-group) genom...    69   8e-11   
gb:AE016959_1022701 Oryza sativa (japonica cultivar-group) chrom...    69   8e-11   
gb:AE016959_1022697 Oryza sativa (japonica cultivar-group) chrom...    69   8e-11   
gb:AF545858_2067958 Mus musculus TDPOZ1 (Tdpoz1) and TDPOZ2 (Tdp...    69   1e-10   
gb:AF290198_2061696 Mus musculus TDPOZ1 (Tdpoz1) mRNA, complete ...    69   1e-10   
gb:AK033449_1163340 Mus musculus adult male colon cDNA, RIKEN fu...    67   5e-10   
gb:AE016959_1022696 Oryza sativa (japonica cultivar-group) chrom...    67   5e-10   
gb:AF506823_2067193 Mus musculus MAPP2 gene, complete cds.             66   9e-10   
gb:AX886908_1482361 Sequence 2771 from Patent EP1033401.               65   1e-09   
gb:AP004553_1841465 Oryza sativa (japonica cultivar-group) genom...    65   2e-09   
gb:AE016959_1022676 Oryza sativa (japonica cultivar-group) chrom...    65   2e-09   
gb:AF545857_2067957 Mus musculus TDPOZ3 (Tdpoz3) gene, complete ...    64   4e-09   
gb:AP005554_1853983 Oryza sativa (japonica cultivar-group) genom...    64   5e-09   
gb:AP005517_1853298 Oryza sativa (japonica cultivar-group) genom...    64   5e-09   
gb:AE016959_1022702 Oryza sativa (japonica cultivar-group) chrom...    64   5e-09   
gb:AE016959_1022731 Oryza sativa (japonica cultivar-group) chrom...    61   3e-08   
gb:OSJN00056_1694017 Oryza sativa genomic DNA, chromosome 4, BAC...    60   4e-08   
gb:AC132492_1741209 Oryza sativa (japonica cultivar-group) chrom...    56   1e-06   
gb:AY074524_1567570 Arabidopsis thaliana unknown protein (At5g13...    56   1e-06   
gb:ATT19L5_1554837 Arabidopsis thaliana DNA chromosome 5, BAC cl...    56   1e-06   
gb:BT010306_1357597 Drosophila melanogaster GH01369 full insert ...    53   6e-06   
gb:AE014298_1126353 Drosophila melanogaster chromosome X, comple...    53   6e-06   
gb:AF527809_1808459 Sorghum bicolor clone BAC SB_BBc0234M12 php2...    53   8e-06   
gb:AF527809_1808463 Sorghum bicolor clone BAC SB_BBc0234M12 php2...    52   1e-05   
gb:BC070653_2555628 Xenopus laevis hypothetical protein MGC82217...    52   2e-05   
gb:HSDJ93K22_2012563 Human DNA sequence from clone RP1-93K22 on ...    52   2e-05   
gb:HSDJ93K22_2012562 Human DNA sequence from clone RP1-93K22 on ...    52   2e-05   
gb:AB037838_1866629 Homo sapiens mRNA for KIAA1417 protein, part...    52   2e-05   
gb:AP004183_1838647 Oryza sativa (japonica cultivar-group) genom...    52   2e-05   
gb:AK129353_2069584 Mus musculus mRNA for mKIAA1417 protein.           51   3e-05   
gb:AP003865_1834522 Oryza sativa (japonica cultivar-group) genom...    51   3e-05   
gb:BC068656_2555160 Xenopus laevis hypothetical protein MGC81035...    49   9e-05   
gb:AP004591_1842000 Oryza sativa (japonica cultivar-group) genom...    49   9e-05   
gb:AP003633_1831842 Oryza sativa (japonica cultivar-group) genom...    48   3e-04   
gb:AY085216_1570289 Arabidopsis thaliana clone 1391 mRNA, comple...    47   4e-04   
pir|D84710|D84710 hypothetical protein At2g30600 [imported] - Ar...    47   4e-04   Arabidopsis thaliana [mouse-ear cress]
gb:YLI575660_1727987 Yarrowia lipolytica iah1, mts1, stl1, sip3,...    47   6e-04   
gb:CR382127_1659907 Yarrowia lipolytica chromosome A of strain C...    47   6e-04   
gb:BC084809_2564054 Xenopus laevis hypothetical LOC495346, mRNA ...    45   0.002   
gb:BC068834_2555332 Xenopus laevis hypothetical protein LOC39846...    45   0.002   
gb:BC043960_2548372 Xenopus laevis hypothetical protein LOC39846...    43   0.006   
gb:BC045877_2549395 Danio rerio zgc:56037, mRNA (cDNA clone MGC:...    42   0.011   
gb:BC044119_2548511 Xenopus laevis chromosome condensation 1-lik...    42   0.011   
gb:U13072_1401819 Caenorhabditis elegans cosmid C07D10, complete...    42   0.011   
gb:U13072_1401818 Caenorhabditis elegans cosmid C07D10, complete...    42   0.011   
gb:AC116956_1206565 Dictyostelium discoideum chromosome 2 map 14...    42   0.011   
pir|T15442|T15442 hypothetical protein C07D10.2 - Caenorhabditis...    42   0.011   Caenorhabditis elegans [roundworm]
gb:BC067005_2105900 Mus musculus regulator of chromosome condens...    42   0.014   
gb:AF334406_1897199 Homo sapiens CLLL7 protein (CLLD7) mRNA, com...    42   0.014   
gb:AX877033_1476805 Sequence 11938 from Patent EP1074617.>gb:AK0...    42   0.014   
gb:HSM805096_1187323 Homo sapiens mRNA; cDNA DKFZp586K0319 (from...    42   0.014   
gb:AK089923_1176048 Mus musculus B lymphocyte B cells CRL-1669 B...    42   0.014   
gb:AK088299_1175319 Mus musculus 2 days neonate thymus thymic ce...    42   0.014   
gb:AK033501_1163369 Mus musculus adult male colon cDNA, RIKEN fu...    42   0.014   
gb:AP003865_1834531 Oryza sativa (japonica cultivar-group) genom...    42   0.019   
gb:AK031248_1162362 Mus musculus 13 days embryo forelimb cDNA, R...    42   0.019   
gb:AK031242_1162359 Mus musculus 13 days embryo forelimb cDNA, R...    42   0.019   
gb:BC061766_2104627 Rattus norvegicus chromosome condensation 1-...    41   0.025   
gb:AP004691_1843477 Oryza sativa (japonica cultivar-group) genom...    41   0.032   
pir|T47740|T47740 hypothetical protein F18O21.190 - Arabidopsis ...    41   0.032   Arabidopsis thaliana [mouse-ear cress]
gb:BC075441_2558544 Xenopus tropicalis MGC89218 protein, mRNA (c...    40   0.042   
gb:AL663082_2072393 Mouse DNA sequence from clone RP23-327G1 on ...    40   0.042   
gb:AX880033_1478097 Sequence 14938 from Patent EP1074617.              40   0.042   
gb:CR859763_1183866 Pongo pygmaeus mRNA; cDNA DKFZp469L0426 (fro...    40   0.042   
gb:CR857643_1181865 Pongo pygmaeus mRNA; cDNA DKFZp469P1529 (fro...    40   0.042   
gb:AE014134_1129000 Drosophila melanogaster chromosome 2L, compl...    40   0.042   
pir|T50663|T50663 RCC1-like G exchanging factor RLG [imported] -...    40   0.042   Homo sapiens [man]
gb:BC084332_2563716 Xenopus laevis hypothetical LOC495136, mRNA ...    40   0.055   
gb:BC063745_2553596 Danio rerio zgc:63520, mRNA (cDNA clone MGC:...    40   0.055   
gb:CR376850_2570112 Zebrafish DNA sequence from clone DKEY-246K9...    40   0.072   
gb:BC066537_2554422 Danio rerio zgc:76933, mRNA (cDNA clone MGC:...    40   0.072   
gb:AC117176_1208028 Dictyostelium discoideum chromosome 2 map 50...    40   0.072   
gb:CR860715_1184769 Pongo pygmaeus mRNA; cDNA DKFZp459O0927 (fro...    40   0.072   
sp|P34371|YLJ8_CAEEL|YLJ8_CAEEL Hypothetical protein C50C3.8 in chromosome ...    40   0.072   Caenorhabditis elegans [roundworm]
gb:BC075364_2558467 Xenopus tropicalis MGC89072 protein, mRNA (c...    39   0.094   
gb:BC070768_2555738 Xenopus laevis hypothetical protein MGC83797...    39   0.094   
gb:BC083903_2108959 Rattus norvegicus kelch-like 7 (Drosophila) ...    39   0.094   
gb:AK090653_1913313 Homo sapiens cDNA FLJ33334 fis, clone BRACE2...    39   0.094   
gb:CR858210_1182396 Pongo pygmaeus mRNA; cDNA DKFZp459L0551 (fro...    39   0.094   
gb:BC087456_2565297 Xenopus laevis hypothetical LOC496053, mRNA ...    39   0.12    
gb:AJ720951_2503138 Gallus gallus mRNA for hypothetical protein,...    39   0.12    
gb:BC055704_2102103 Mus musculus BTB (POZ) domain containing 2, ...    39   0.12    
gb:BC029154_2096497 Mus musculus kelch-like 7 (Drosophila), mRNA...    39   0.12    
gb:AY028802_1934436 Homo sapiens kelch/BTB protein mRNA, complet...    39   0.12    
gb:AK056390_1911726 Homo sapiens cDNA FLJ31828 fis, clone NT2RP6...    39   0.12    
gb:HSM801571_1186265 Homo sapiens mRNA; cDNA DKFZp564C1616 (from...    39   0.12    
gb:AK083358_1173934 Mus musculus 2 days neonate thymus thymic ce...    39   0.12    
gb:AK012326_1156891 Mus musculus 11 days embryo whole body cDNA,...    39   0.12    
sp|Q9BX70|BTB2_HUMAN|BTB2_HUMAN BTB/POZ domain containing protein 2.>gb:AF3...    39   0.12    Homo sapiens [man]
gb:BC062968_2105109 Mus musculus BTB (POZ) domain containing 3, ...    39   0.16    
gb:AB093275_2048060 Mus musculus mRNA for mKIAA0952 protein.           39   0.16    
gb:HS742J24_1999415 Human DNA sequence from clone RP4-742J24 on ...    39   0.16    
gb:BC052308_1984807 Homo sapiens ankyrin repeat and FYVE domain ...    39   0.16    
gb:AK095632_1914407 Homo sapiens cDNA FLJ38313 fis, clone FCBBF3...    39   0.16    
gb:AK091560_1913513 Homo sapiens cDNA FLJ34241 fis, clone FCBBF3...    39   0.16    
gb:AB033081_1866261 Homo sapiens mRNA for KIAA1255 protein, part...    39   0.16    
gb:AB023169_1865491 Homo sapiens mRNA for KIAA0952 protein, part...    39   0.16    
gb:HSM806953_1187784 Homo sapiens mRNA; cDNA DKFZp686L21216 (fro...    39   0.16    
gb:CR860153_1184241 Pongo pygmaeus mRNA; cDNA DKFZp459C1423 (fro...    39   0.16    
pir|T21980|T21980 hypothetical protein F38H4.7 - Caenorhabditis ...    39   0.16    Caenorhabditis elegans [roundworm]
sp|P34147|RACA_DICDI|RACA_DICDI RAS-related protein racA.>gb:AF310886_12613...    39   0.16    Dictyostelium discoideum
sp|P58545|BTB3_MOUSE|BTB3_MOUSE BTB/POZ domain containing protein 3.>gb:BC0...    39   0.16    Mus musculus [mouse]
sp|Q9Y2F9|BTB3_HUMAN|BTB3_HUMAN BTB/POZ domain containing protein 3.>gb:HS7...    39   0.16    Homo sapiens [man]
sp|Q9P2R3|AFY1_HUMAN|AFY1_HUMAN Ankyrin repeats- and FYVE domain-containing...    39   0.16    Homo sapiens [man]
gb:BC072626_2106602 Mus musculus RIKEN cDNA C130068N17 gene, mRN...    38   0.21    
gb:AB037360_1866450 Homo sapiens mRNA for ANKHZN, complete cds.        38   0.21    
gb:AK048518_1168403 Mus musculus 16 days embryo head cDNA, RIKEN...    38   0.21    
gb:BC084274_2563661 Xenopus laevis hypothetical LOC495101, mRNA ...    38   0.27    
gb:AB098135S2_2048244 Mus musculus Ankhzn gene for ankyrin repea...    38   0.27    
gb:AB011370_2043651 Mus musculus Ankhzn mRNA, complete cds.>gb:A...    38   0.27    
gb:BC039585_1982579 Homo sapiens kelch-like 7 (Drosophila), mRNA...    38   0.27    
sp|Q810B6|AFY1_MOUSE|AFY1_MOUSE Ankyrin repeats- and FYVE domain-containing...    38   0.27    Mus musculus [mouse]
gb:BC087937_2110266 Mus musculus cDNA clone MGC:107314 IMAGE:670...    37   0.36    
gb:BC072618_2106597 Mus musculus BTB (POZ) domain containing 1, ...    37   0.36    
gb:BC060183_2103911 Mus musculus kelch-like 20 (Drosophila), mRN...    37   0.36    
gb:BC005253_1969718 Homo sapiens kelch-like 20 (Drosophila), mRN...    37   0.36    
gb:AK130594_1917649 Homo sapiens cDNA FLJ27084 fis, clone SPL036...    37   0.36    
gb:AK000731_1908092 Homo sapiens cDNA FLJ20724 fis, clone HEP15061.    37   0.36    
gb:AJ844466_1907447 Homo sapiens partial mRNA for KLEIP (kelch-l...    37   0.36    
gb:AF355402_1898814 Homo sapiens BTBD1 protein mRNA, complete cds.     37   0.36    
gb:AB053326_1868215 Homo sapiens mRNA for BPOZ splice variant ty...    37   0.36    
gb:AB053324_1868213 Homo sapiens mRNA for BPOZ splicing variant ...    37   0.36    
gb:AX876729_1476666 Sequence 11634 from Patent EP1074617.              37   0.36    
gb:CR860200_1184287 Pongo pygmaeus mRNA; cDNA DKFZp469C0719 (fro...    37   0.36    
gb:AK088345_1175347 Mus musculus 2 days neonate thymus thymic ce...    37   0.36    
gb:AK053371_1170414 Mus musculus 0 day neonate eyeball cDNA, RIK...    37   0.36    
gb:AK053102_1170314 Mus musculus 15 days embryo head cDNA, RIKEN...    37   0.36    
gb:AF447886_1150982 Homo sapiens PP2259 mRNA, complete cds.            37   0.36    
pir|JC7326|JC7326 ankyrin repeat and BTB/POZ domain protein 1 - ...    37   0.36    Homo sapiens [man]
sp|Q9Y2M5|KHLX_HUMAN|KHLX_HUMAN Kelch-like protein X.>gb:AB026190_1865686 H...    37   0.36    Homo sapiens [man]
sp|P58544|BTB1_MOUSE|BTB1_MOUSE BTB/POZ domain containing protein 1 (Glucos...    37   0.36    Mus musculus [mouse]
sp|Q9H0C5|BTB1_HUMAN|BTB1_HUMAN BTB/POZ domain containing protein 1 (Hepati...    37   0.36    Homo sapiens [man]
gb:BC076782_2559526 Xenopus laevis MGC83688 protein, mRNA (cDNA ...    37   0.46    
gb:BC089532_2110881 Mus musculus RIKEN cDNA 1700017G21 gene, mRN...    37   0.46    
gb:BC085850_2109409 Rattus norvegicus BTB (POZ) domain containin...    37   0.46    
gb:AB055855_2046460 Mus musculus mgclh mRNA, Type 2, complete cds.     37   0.46    
gb:AC004678_1874648 Homo sapiens chromosome 19, cosmid R34094, c...    37   0.46    
gb:AK006065_1153380 Mus musculus adult male testis cDNA, RIKEN f...    37   0.46    
gb:AE014297_1139985 Drosophila melanogaster chromosome 3R, compl...    37   0.46    
gb:AE014297_1139984 Drosophila melanogaster chromosome 3R, compl...    37   0.46    
gb:AE014298_1126573 Drosophila melanogaster chromosome X, comple...    37   0.46    
sp|Q99N64|GML2_MOUSE|GML2_MOUSE Germ cell-less protein-like 2 (mGclh).>gb:A...    37   0.46    Mus musculus [mouse]
gb:BC070638_2555614 Xenopus laevis hypothetical protein MGC81491...    37   0.61    
gb:AC092779_1735708 Oryza sativa chromosome 3 BAC OSJNBb0024N19 ...    37   0.61    
gb:BC034400_2097659 Mus musculus leucine-zipper-like transcripti...    36   0.79    
gb:AB055854_2046459 Mus musculus mgclh mRNA, complete cds.             36   0.79    
gb:BC009555_1972094 Homo sapiens kelch-like 7 (Drosophila), mRNA...    36   0.79    
gb:AK127080_1916584 Homo sapiens cDNA FLJ45137 fis, clone BRAWH3...    36   0.79    
gb:AC006039_1875092 Homo sapiens BAC clone RP11-319F3 from 7, co...    36   0.79    
gb:CR861188_1185198 Pongo pygmaeus mRNA; cDNA DKFZp459B233 (from...    36   0.79    
gb:AK088938_1175713 Mus musculus 2 days neonate thymus thymic ce...    36   0.79    
pir|I54388|I54388 LZTR-1 - human>gb:HUMLZTR1_2034139 Human mRNA ...    36   0.79    Homo sapiens [man]
sp|Q9CQ33|LZTR_MOUSE|LZTR_MOUSE Leucine-zipper-like transcriptional regulat...    36   0.79    Mus musculus [mouse]
sp|Q8N653|LZTR_HUMAN|LZTR_HUMAN Leucine-zipper-like transcriptional regulat...    36   0.79    Homo sapiens [man]
gb:AL591589_2504004 Zebrafish DNA sequence from clone BUSM1-198M...    36   1.0     
gb:AK095131_1914302 Homo sapiens cDNA FLJ37812 fis, clone BRSSN2...    36   1.0     
gb:BC064867_2553908 Xenopus tropicalis hypothetical protein MGC7...    35   1.4     
gb:BC057137_2102627 Mus musculus kelch-like 4 (Drosophila), mRNA...    35   1.4     
gb:AK083411_1173956 Mus musculus 9 days embryo whole body cDNA, ...    35   1.4     
gb:AK081937_1173427 Mus musculus 16 days embryo head cDNA, RIKEN...    35   1.4     
gb:AK044930_1167194 Mus musculus 9.5 days embryo parthenogenote ...    35   1.4     
gb:AJ720664_2502851 Gallus gallus mRNA for hypothetical protein,...    35   1.8     
gb:AJ720145_2502332 Gallus gallus mRNA for hypothetical protein,...    35   1.8     
gb:AP004654_1842737 Oryza sativa (japonica cultivar-group) genom...    35   1.8     
gb:AK077202_1171730 Mus musculus adult male testis cDNA, RIKEN f...    35   1.8     
pir|T28056|T28056 hypothetical protein ZK858.4 - Caenorhabditis ...    35   1.8     
gb:AF221547_1252468 Drosophila melanogaster RhoGTPase mRNA, comp...    35   2.3     
gb:AE014296_1137171 Drosophila melanogaster chromosome 3L, compl...    35   2.3     
gb:AE005173_893455 Arabidopsis thaliana chromosome 1, bottom arm...    35   2.3     
sp|O61366|GPRS_DROME|GPRS_DROME Serine-enriched protein.>gb:AE013599_113226...    35   2.3     
gb:BC064049_2105302 Mus musculus cDNA clone MGC:73573 IMAGE:6391...    34   3.0     
gb:AY495338_2085606 Rattus norvegicus KLHL10 (Klhl10) mRNA, comp...    34   3.0     
gb:CR457270_1993477 Homo sapiens full open reading frame cDNA cl...    34   3.0     
gb:BC067753_1987461 Homo sapiens kelch-like 10 (Drosophila), mRN...    34   3.0     
gb:AY495339_1954816 Homo sapiens KLHL10 (KLHL10) mRNA, complete ...    34   3.0     
gb:AK057224_1911938 Homo sapiens cDNA FLJ32662 fis, clone TESTI1...    34   3.0     
gb:AB046637_1867373 Macaca fascicularis brain cDNA, clone QccE-1...    34   3.0     
gb:AC134927_1741882 Oryza sativa (japonica cultivar-group) chrom...    34   3.0     
gb:AX876471_1476546 Sequence 11376 from Patent EP1074617.>gb:AK0...    34   3.0     
gb:CEU67737_1368617 Caenorhabditis elegans maternal-effect letha...    34   3.0     
gb:BT006029_1357285 Drosophila melanogaster LD01876 full insert ...    34   3.0     
gb:AC006629_1203436 Caenorhabditis elegans cosmid F12E12, comple...    34   3.0     
gb:HSM803114_1186910 Homo sapiens mRNA; cDNA DKFZp667J1110 (from...    34   3.0     
gb:CR861168_1185179 Pongo pygmaeus mRNA; cDNA DKFZp459L2116 (fro...    34   3.0     
gb:CR857744_1181959 Pongo pygmaeus mRNA; cDNA DKFZp469D1435 (fro...    34   3.0     
gb:AK014906_1158188 Mus musculus adult male testis cDNA, RIKEN f...    34   3.0     
gb:AK006288_1153491 Mus musculus adult male testis cDNA, RIKEN f...    34   3.0     
gb:AE014297_1140019 Drosophila melanogaster chromosome 3R, compl...    34   3.0     
sp|Q9NVX7|KBT4_HUMAN|KBT4_HUMAN Kelch repeat and BTB domain containing prot...    34   3.0     
gb:BX957305_2568135 Zebrafish DNA sequence from clone DKEYP-11G8...    34   3.9     
gb:BC066513_2554400 Danio rerio influenza virus NS1A binding pro...    34   3.9     
gb:BC046068_2549574 Danio rerio influenza virus NS1A binding pro...    34   3.9     
gb:AE013599_1133264 Drosophila melanogaster chromosome 2R, compl...    34   3.9     
pir|T22519|T22519 hypothetical protein F52H3.3 - Caenorhabditis ...    34   3.9     
gb:FRNINE1_2572046 Fugu rubripes U2 small nuclear ribonucleoprot...    33   5.1     
gb:AY163816_1937465 Homo sapiens FRBZ1 (FRBZ1) mRNA, partial cds.      33   5.1     
gb:AL356315_1924416 Human DNA sequence from clone RP11-332F5 on ...    33   5.1     
gb:AK128549_1917264 Homo sapiens cDNA FLJ46708 fis, clone TRACH3...    33   5.1     
gb:AP004159_1838385 Oryza sativa (japonica cultivar-group) genom...    33   5.1     
gb:AK010998_1156120 Mus musculus 13 days embryo liver cDNA, RIKE...    33   5.1     
sp|Q8R179|KBT4_MOUSE|KBT4_MOUSE Kelch repeat and BTB domain containing prot...    33   5.1     
gb:D50922_1994787 Homo sapiens mRNA for KIAA0132 gene, partial cds.    33   6.7     
gb:AF361886_1898980 Homo sapiens cytosolic inhibitor of NRF2 (IN...    33   6.7     
gb:CR860244_1184331 Pongo pygmaeus mRNA; cDNA DKFZp469D1319 (fro...    33   6.7     
pir|T33099|T33099 hypothetical protein R12E2.1 - Caenorhabditis ...    33   6.7     
pir|E86351|E86351 hypothetical protein F8K7.22 - Arabidopsis tha...    33   6.7     
sp|Q14145|KEAP_HUMAN|KEAP_HUMAN Kelch-like ECH-associated protein 1 (Cytoso...    33   6.7     
gb:AF237711_1253775 Drosophila melanogaster Diablo (dbo) mRNA, c...    33   8.8     
gb:AE014296_1136439 Drosophila melanogaster chromosome 3L, compl...    33   8.8     


>gb:AP005869_1859334 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:B1026C12.
          Length = 395

 Score =  150 bits (379), Expect = 3e-35
 Identities = 71/120 (59%), Positives = 92/120 (76%), Gaps = 2/120 (1%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           FKAQFFG IGNP+   V +ED+EP +FKAM+ F+Y+D+LP++HE           +++QH
Sbjct: 211 FKAQFFGPIGNPDLHTVIVEDVEPLVFKAMVNFIYSDELPSIHELAGSVSTWTSTVVVQH 270

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAAT--NLG 486
           LLAAADR+GLDRL+ LCE KLC+E+T +TVATTL+LA+QH C QLK+ CLKF A   NLG
Sbjct: 271 LLAAADRYGLDRLRLLCEEKLCDELTAETVATTLALAEQHHCTQLKSACLKFTAVRENLG 330



>gb:AY088598_1573614 Arabidopsis thaliana clone 8256 mRNA, complete
           sequence.
          Length = 408

 Score =  146 bits (368), Expect = 5e-34
 Identities = 73/120 (60%), Positives = 88/120 (73%), Gaps = 2/120 (1%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+AQFFG IGN N D++ ++DIEPSIFKAML F+YTD LPN+HE            M+QH
Sbjct: 219 FRAQFFGPIGNNNVDRIVIDDIEPSIFKAMLSFIYTDVLPNVHEITGSTSASSFTNMIQH 278

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAAT--NLG 486
           LLAAAD + L RLK LCE  LCE++ VD VATTL+LA+QH+ LQLK  CLKF A+  NLG
Sbjct: 279 LLAAADLYDLARLKILCEVLLCEKLDVDNVATTLALAEQHQFLQLKAFCLKFVASPANLG 338



>pir|T01006|T01006 hypothetical protein At2g39760 [imported] -
           Arabidopsis thaliana>gb:AC003000_1530920 Arabidopsis
           thaliana chromosome 2 clone T5I7 map CIC10A06, complete
           sequence.>gb:AY128315_1580614 Arabidopsis thaliana
           unknown protein (At2g39760) mRNA, complete
           cds.>gb:BT000044_1634322 Arabidopsis thaliana unknown
           protein (At2g39760) mRNA, complete cds.
          Length = 408

 Score =  144 bits (364), Expect = 2e-33
 Identities = 72/120 (60%), Positives = 88/120 (73%), Gaps = 2/120 (1%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+AQFFG IGN N D++ ++DIEPSIFKAML F+YTD LPN+HE            M+QH
Sbjct: 219 FRAQFFGPIGNNNVDRIVIDDIEPSIFKAMLSFIYTDVLPNVHEITGSTSASSFTNMIQH 278

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAAT--NLG 486
           LLAAAD + L RLK LCE  LCE++ VD VATTL+LA+QH+ LQLK  CL+F A+  NLG
Sbjct: 279 LLAAADLYDLARLKILCEVLLCEKLDVDNVATTLALAEQHQFLQLKAFCLEFVASPANLG 338



>gb:AY136451_1581951 Arabidopsis thaliana putative protein
           (At5g19000) mRNA, complete cds.>gb:BT002593_1636196
           Arabidopsis thaliana putative protein (At5g19000) mRNA,
           complete cds.
          Length = 407

 Score =  132 bits (333), Expect = 6e-30
 Identities = 61/114 (53%), Positives = 82/114 (71%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F AQ FG +G+ NT  + +ED+E  IFK +L F+Y D+LP++ E           ++ QH
Sbjct: 228 FNAQLFGPLGDRNTKCITIEDMEAPIFKVLLHFIYWDELPDMQELIGTDSTLASTLVAQH 287

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAA 498
           LLAAADR+ L+RLK +CE+KLCE V ++TVATTL+LA+QH CLQLK +CLKF A
Sbjct: 288 LLAAADRYALERLKAICESKLCEGVAINTVATTLALAEQHHCLQLKAVCLKFVA 341



>gb:AP005182_1848936 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0018C07.
          Length = 434

 Score =  132 bits (331), Expect = 1e-29
 Identities = 60/114 (52%), Positives = 83/114 (72%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+AQ FG + + N  ++ +ED+E S+FKA+L F+Y D+LP++ E           +M QH
Sbjct: 257 FRAQLFGPMKDKNMKRITIEDMEASVFKALLHFMYWDELPDIEELTGLNTTWVSTLMAQH 316

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAA 498
           LLAAADR+ L+RLK LCE KLCE+V ++TVA TL+LA+QH C QLKT+CL+F A
Sbjct: 317 LLAAADRYALERLKLLCELKLCEDVAINTVANTLALAEQHHCYQLKTVCLRFVA 370



>gb:ATAC018907_1543707 Arabidopsis thaliana chromosome III BAC F28L1
           genomic sequence, complete sequence.>gb:AY045891_1561398
           Arabidopsis thaliana unknown protein (At3g06190) mRNA,
           complete cds.>gb:AY091449_1574649 Arabidopsis thaliana
           unknown protein (At3g06190) mRNA, complete cds.
          Length = 406

 Score =  122 bits (306), Expect = 8e-27
 Identities = 54/114 (47%), Positives = 82/114 (71%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+AQ FG + + NT+ + +ED++  IFK +L F+Y D++P++ +           ++ QH
Sbjct: 227 FRAQLFGPLRSENTNCIIIEDVQAPIFKMLLHFIYWDEMPDMQDLIGTDLKWASTLVAQH 286

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAA 498
           LLAAADR+ L+RL+ +CE+KLCE ++++TVATTL+LA+QH C QLK  CLKF A
Sbjct: 287 LLAAADRYALERLRTICESKLCEGISINTVATTLALAEQHHCFQLKAACLKFIA 340



>gb:AP003633_1831840 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0637D03.>gb:AP003635_1831889 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0686E06.
          Length = 364

 Score =  111 bits (278), Expect = 1e-23
 Identities = 54/116 (46%), Positives = 77/116 (66%), Gaps = 2/116 (1%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNL--HEXXXXXXXXXXXIMM 666
           F A+ FG +    +++VE++D+E  +FKA+L F+YTD +P L   +            M 
Sbjct: 210 FMAELFGAMKVKASERVEVKDMEAPVFKAILHFVYTDTVPELDHRDGEETEAASTATAMA 269

Query: 665 QHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAA 498
           QHLLA ADR+GL+RLK +CE+KL E + VDTV+TTL+LA+QH C  LK  C++F A
Sbjct: 270 QHLLAGADRYGLERLKLICESKLAERIDVDTVSTTLALAEQHDCSHLKAKCVEFIA 325



>gb:AP005107_1847957 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0431E05.
          Length = 352

 Score =  109 bits (273), Expect = 6e-23
 Identities = 54/113 (47%), Positives = 75/113 (66%), Gaps = 1/113 (0%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNL-HEXXXXXXXXXXXIMMQ 663
           F A+FFG +   ++  VE++DIE S+FKAML F+YT   P L  +            M Q
Sbjct: 202 FMAEFFGPMKESSSQCVEIKDIEASVFKAMLHFIYTGTSPELDQQHVVSDSEQDITTMTQ 261

Query: 662 HLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           HLL AADR+GLDRLK +C+ +L +++ V+TVATTL+ A+QH C QLK  C++F
Sbjct: 262 HLLVAADRYGLDRLKLICQDRLHDDINVETVATTLAFAEQHSCTQLKDRCIEF 314



>gb:OSJN00079_1694507 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0053K19, complete
           sequence.>gb:OSJN00106_1695018 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBb0060E08, complete
           sequence.
          Length = 366

 Score =  109 bits (272), Expect = 7e-23
 Identities = 52/115 (45%), Positives = 76/115 (66%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           FKA+ FG +    T  ++++D+EP +F+A+L F+YTD+LP+                MQH
Sbjct: 219 FKAELFGPMKENGTQCIKIDDMEPEVFEALLHFIYTDRLPD-------SCRDGKAAAMQH 271

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAAT 495
           LL AADR+G+DRL+ +CE +L E + V+TVATTL LA+QH C QL+  C+ F A+
Sbjct: 272 LLVAADRYGVDRLRLICERRLSETIDVETVATTLVLAEQHHCSQLRQACIGFVAS 326



>gb:AP004183_1838657 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1221_H04.
          Length = 386

 Score =  107 bits (268), Expect = 2e-22
 Identities = 51/112 (45%), Positives = 74/112 (66%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           FKA+  GL+  P T  + + D++P++F+A+LQF+YTDQ P                M++H
Sbjct: 226 FKAELCGLLREPGTQPITIVDMQPAVFRALLQFIYTDQFP----VTRGFERRDNCEMIRH 281

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           LL AADR+ +DRLK LC+  LC+ + V  VATTL+LADQH+C +LK  C++F
Sbjct: 282 LLVAADRYAVDRLKLLCQGILCKNLNVHNVATTLALADQHQCDKLKDACIEF 333



>gb:AP004183_1838658 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1221_H04.
          Length = 355

 Score =  104 bits (260), Expect = 2e-21
 Identities = 50/112 (44%), Positives = 74/112 (66%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           FKA+  G +    T+ + + D++P +FKA+LQF+YTD LP++ +            M++H
Sbjct: 220 FKAELCGPMRESGTEPISIVDMQPVVFKALLQFIYTDWLPSIRDLEGDDNSE----MIRH 275

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           LL AADR+ +DRLK LC++ LC+ + V  VATTL+LADQH C  LK  C++F
Sbjct: 276 LLVAADRYAVDRLKLLCQSILCKNLRVGNVATTLALADQHHCGMLKDACIEF 327



>gb:AE016959_1022686 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752505
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 300

 Score =  103 bits (257), Expect = 4e-21
 Identities = 54/114 (47%), Positives = 68/114 (59%), Gaps = 2/114 (1%)
 Frame = -3

Query: 839 FKAQFFGLI--GNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMM 666
           FKA+ +GL+  G      V +EDIEP +FK +L+F+YTD LP + E            M 
Sbjct: 155 FKAELYGLMKEGGTAAGAVHIEDIEPRVFKVLLRFMYTDSLPEMEEEDV---------MC 205

Query: 665 QHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           QHLL AADR+ L+RLK +CE KLC  ++V TV   L LADQH C  LK  C  F
Sbjct: 206 QHLLVAADRYNLERLKLICEEKLCRHISVGTVWNILPLADQHHCDGLKKACFDF 259



>gb:AP004183_1838659 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1221_H04.>gb:AP005517_1853294 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBb0090H20.
          Length = 290

 Score =  103 bits (256), Expect = 5e-21
 Identities = 48/116 (41%), Positives = 74/116 (63%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           FKA+ FG +       + ++DI+P +FKA+L F+YTD L  + +            M++H
Sbjct: 144 FKAELFGPMREAGAQVLPIKDIQPDVFKALLHFIYTDSLSIIDDLVGDDRGE----MIRH 199

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           LL AADR+ ++RLK +CE+ LCE + V TVA TL+LADQH C  L+  C++F +++
Sbjct: 200 LLVAADRYAMERLKLICESDLCENLNVQTVAATLALADQHHCASLRDACIEFMSSS 255



>gb:AE016959_1022692 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752511
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 343

 Score =  100 bits (250), Expect = 3e-20
 Identities = 52/113 (46%), Positives = 72/113 (63%), Gaps = 1/113 (0%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNT-DKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQ 663
           F+A+ +GL+   +T   V +E++E  +FK +L+FLYTD LP + E            M Q
Sbjct: 199 FRAELYGLMKEGDTAGVVRVEEMEAQVFKVLLRFLYTDSLPEMKEEDV---------MCQ 249

Query: 662 HLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           HLL AADR+ L+RLK +CE KLC+ ++V TV+  L+LADQHRC  LK  C  F
Sbjct: 250 HLLVAADRYNLERLKLICEEKLCKYISVGTVSNILALADQHRCDGLKKACFNF 302



>gb:AP004591_1842005 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0582D05.
          Length = 382

 Score = 99.4 bits (246), Expect = 8e-20
 Identities = 48/119 (40%), Positives = 75/119 (63%), Gaps = 3/119 (2%)
 Frame = -3

Query: 839 FKAQFFGLIG---NPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIM 669
           FKA  +G +    + N  +V ++ +EP++F+A+L F+YTD    + +            M
Sbjct: 217 FKAALYGPMKESTDANAGRVAIDSVEPAVFRALLHFIYTDTTAAMDDLDDDDDDKAQ--M 274

Query: 668 MQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           + HLL AADR+ ++RLK +CE  LC+ + VDTVA TL++ADQH C +LK  C++F AT+
Sbjct: 275 IMHLLEAADRYDVERLKLICELMLCKSIAVDTVAATLAMADQHHCQKLKEACIEFLATS 333



>gb:AP005476_1852574 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBb0026D20.
          Length = 353

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 50/124 (40%), Positives = 74/124 (59%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+A+FFG +       +++EDIE  +F+A+L F+YTD LP   +            M QH
Sbjct: 211 FRAEFFGAMSAKARRTIKIEDIEAGVFRALLHFIYTDSLPETAQNIV---------MAQH 261

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNLGV* 480
           L+ AADR+ + RLK +CE KL + +  + VATTL+LA+QH C  LK  C +F A+   + 
Sbjct: 262 LVVAADRYNVGRLKLICEEKLSKHIDSNMVATTLALAEQHSCYGLKEACFEFLASRSNLE 321

Query: 479 RVQA 468
           R+ A
Sbjct: 322 RMMA 325



>gb:OSJN00079_1694506 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0053K19, complete
           sequence.>gb:OSJN00106_1695017 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBb0060E08, complete
           sequence.
          Length = 375

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 55/114 (48%), Positives = 71/114 (62%), Gaps = 2/114 (1%)
 Frame = -3

Query: 839 FKAQFFG--LIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMM 666
           F+A+ FG   +    T  V ++D+EPSIF A L F+YTD LP   E           + M
Sbjct: 225 FRAELFGGGHMRERRTSCVVVDDMEPSIFSAFLHFIYTDSLP---ENPDTPGDDQDCMAM 281

Query: 665 QHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           QHL+ AADR+GLDRL  +CE KLC  + V TVATTL+LA+QH+ + LK  CL F
Sbjct: 282 QHLMVAADRYGLDRLVLICEEKLCRGIDVQTVATTLALAEQHQRVALKDACLGF 335



>gb:AP005607_1854809 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ9003_D08.
          Length = 465

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 47/118 (39%), Positives = 71/118 (60%), Gaps = 3/118 (2%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNL---HEXXXXXXXXXXXIM 669
           FKA+  G +       ++++D+EP +FK++L F+YTD L  +    +           +M
Sbjct: 300 FKAELLGTMKEKADGAIQVDDMEPGVFKSLLHFIYTDSLDTMAQEDQSRDEASEEEDLVM 359

Query: 668 MQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAAT 495
            QHLL AADR+ ++RLK +CE KLCE +    VAT+L+LA+QH C  LK  C +F A+
Sbjct: 360 AQHLLVAADRYNVERLKLICEEKLCESIDSSMVATSLALAEQHNCNGLKEACFEFLAS 417



>gb:AP004183_1838652 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1221_H04.
          Length = 384

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 47/112 (41%), Positives = 72/112 (64%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           FKA+ +G +      +V +ED++P +F+ +L F+YTD LP++ +            M++ 
Sbjct: 216 FKAELYGQMKEKRARRVTVEDMQPDVFRGLLHFIYTDSLPDMDDLSDDDYYE----MIRL 271

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           LL AADR+ +DR+K  CE+ L E + V TVATTL+LADQH C  LK +C++F
Sbjct: 272 LLVAADRYAMDRMKLQCESILGEHLDVQTVATTLALADQHNCNGLKDVCIEF 323



>gb:AP003842_1834088 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1641_C04.
          Length = 424

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 48/108 (44%), Positives = 72/108 (66%), Gaps = 1/108 (0%)
 Frame = -3

Query: 809 NPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXX-IMMQHLLAAADRFG 633
           N +  ++ ++D+EP +FKAML F+Y D L + +E             +   LLAAAD++ 
Sbjct: 255 NDDVQEIVIDDMEPKVFKAMLHFIYRDTLVDDNELGGSSSEGSIFDTLAAKLLAAADKYD 314

Query: 632 LDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNL 489
           L RL+ LCE+ LC+ ++V TVA+TL+LAD+H  ++LK +CLKFAA NL
Sbjct: 315 LARLRLLCESYLCKAISVATVASTLALADRHHAMELKAVCLKFAAENL 362



>gb:AE016959_1022691 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752510
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 363

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 51/113 (45%), Positives = 71/113 (62%), Gaps = 1/113 (0%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVE-LEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQ 663
           F+A+ +GL+   +T  V  +E++E  +FK +L+FLYTD LP + E            M Q
Sbjct: 219 FRAELYGLMKEGDTAGVVCIEEMEAQVFKVLLRFLYTDSLPEMKEEEDV--------MCQ 270

Query: 662 HLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           HLL AADR+ L+RLK +CE KLC+ ++V TV+  L+LADQH C  LK  C  F
Sbjct: 271 HLLVAADRYNLERLKLICEEKLCKYISVGTVSNILALADQHHCDGLKKACFNF 323



>gb:AC090871_1734503 Oryza sativa chromosome 3 BAC OSJNBb0060J21
           genomic sequence, complete sequence.
          Length = 430

 Score = 97.1 bits (240), Expect = 4e-19
 Identities = 47/103 (45%), Positives = 70/103 (67%), Gaps = 1/103 (0%)
 Frame = -3

Query: 794 KVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXX-XXXXIMMQHLLAAADRFGLDRLK 618
           ++ ++D+EP +FKA+L F+Y D L    E             +   LLAAADR+ L RL+
Sbjct: 266 EIVIDDMEPKVFKAVLHFMYRDNLVGDDELSASSSDCSIFDTLAGKLLAAADRYELPRLR 325

Query: 617 QLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNL 489
            LCE+ LC+ ++V++VATTL+LAD+H  ++LK++CLKFAA NL
Sbjct: 326 LLCESYLCKHISVNSVATTLALADRHHAMELKSVCLKFAAENL 368



>gb:AP004183_1838648 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1221_H04.>gb:AP004751_1844380 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0494D11.
          Length = 365

 Score = 96.7 bits (239), Expect = 5e-19
 Identities = 46/112 (41%), Positives = 74/112 (66%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           FKA+F+G +    T  ++++D++PS+F+A+L F+YTD LP                 ++H
Sbjct: 217 FKAEFYGEMIERGTFSIDIKDMQPSVFRALLHFIYTDVLP---ADIGDLEGDDYVEFIRH 273

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           L+ AADR+ +DRLK +C++ L + V V  VATTL+LADQH C +LK +C+++
Sbjct: 274 LVVAADRYAMDRLKLMCQSILGKYVDVKNVATTLALADQHNCDKLKDVCIQY 325



>gb:AF128457_1770619 Oryza sativa subsp. indica BAC clone 16F19
           php20725 region, complete sequence.
          Length = 445

 Score = 96.7 bits (239), Expect = 5e-19
 Identities = 52/117 (44%), Positives = 71/117 (60%), Gaps = 2/117 (1%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDK--VELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMM 666
           F A+  G +   +T+   V + D++   FKAML F+YTD LPN+ +            M 
Sbjct: 302 FMAELLGPMKEEDTESHVVAIRDMDARAFKAMLHFIYTDSLPNVDDGGEAAA------MA 355

Query: 665 QHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAAT 495
           QHLLAAADR+ ++RLK +CE KL   V   T ATTL+LA+QH C +LK  CL+F A+
Sbjct: 356 QHLLAAADRYDIERLKLICEDKLSGGVDATTAATTLALAEQHGCCRLKEACLRFMAS 412



>gb:AF119222_1769707 Oryza sativa BAC clone 1.H19, complete
           sequence.
          Length = 490

 Score = 96.7 bits (239), Expect = 5e-19
 Identities = 52/117 (44%), Positives = 71/117 (60%), Gaps = 2/117 (1%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDK--VELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMM 666
           F A+  G +   +T+   V + D++   FKAML F+YTD LPN+ +            M 
Sbjct: 347 FMAELLGPMKEEDTESHVVAIRDMDARAFKAMLHFIYTDSLPNVDDGGEAAA------MA 400

Query: 665 QHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAAT 495
           QHLLAAADR+ ++RLK +CE KL   V   T ATTL+LA+QH C +LK  CL+F A+
Sbjct: 401 QHLLAAADRYDIERLKLICEDKLSGGVDATTAATTLALAEQHGCCRLKEACLRFMAS 457



>gb:AE016959_1022658 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752477
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 208

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 49/114 (42%), Positives = 66/114 (57%), Gaps = 2/114 (1%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTD--KVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMM 666
           F+A+ FG +        K  ++ +E   FKA+L F+YTD  P L              M 
Sbjct: 62  FRAELFGAMKESTAGGGKARVDGVEARAFKALLHFIYTDAAPELD----GKDQDETSSMA 117

Query: 665 QHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           QHLL AADR+ L+RLK +CE KLC+ + V + ATTL+LA+QHRC  LK  C+ F
Sbjct: 118 QHLLVAADRYNLERLKLICEDKLCKRIDVSSAATTLALAEQHRCPSLKKACMDF 171



>gb:AF128457_1770618 Oryza sativa subsp. indica BAC clone 16F19
           php20725 region, complete sequence.
          Length = 717

 Score = 95.1 bits (235), Expect = 1e-18
 Identities = 53/135 (39%), Positives = 72/135 (53%), Gaps = 3/135 (2%)
 Frame = -3

Query: 839 FKAQFFGLIG---NPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIM 669
           F A+ FG +    + N + + + D+EP +F+AML F+Y D LP + +            M
Sbjct: 572 FMAELFGPMAMSRHNNEETIRVHDMEPRVFEAMLHFIYNDSLPEVDDDDDGEVAA----M 627

Query: 668 MQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNL 489
            QHLL AADR+ + RLK +CE  LC  V   T AT L+LA+QH C +LK  C KF     
Sbjct: 628 AQHLLVAADRYDMGRLKLICEDTLCSHVDASTAATALTLAEQHHCERLKEACFKFMENPS 687

Query: 488 GV*RVQALGRELPLT 444
            +  V A    L LT
Sbjct: 688 NLKAVMASDDFLHLT 702



>gb:AF119222_1769706 Oryza sativa BAC clone 1.H19, complete
           sequence.
          Length = 486

 Score = 95.1 bits (235), Expect = 1e-18
 Identities = 53/135 (39%), Positives = 72/135 (53%), Gaps = 3/135 (2%)
 Frame = -3

Query: 839 FKAQFFGLIG---NPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIM 669
           F A+ FG +    + N + + + D+EP +F+AML F+Y D LP + +            M
Sbjct: 341 FMAELFGPMAMSRHNNEETIRVHDMEPRVFEAMLHFIYNDSLPEVDDDDDGEVAA----M 396

Query: 668 MQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNL 489
            QHLL AADR+ + RLK +CE  LC  V   T AT L+LA+QH C +LK  C KF     
Sbjct: 397 AQHLLVAADRYDMGRLKLICEDTLCSHVDASTAATALTLAEQHHCERLKEACFKFMENPS 456

Query: 488 GV*RVQALGRELPLT 444
            +  V A    L LT
Sbjct: 457 NLKAVMASDDFLHLT 471



>gb:AE016959_1022672 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752491
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 284

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 50/113 (44%), Positives = 67/113 (59%), Gaps = 1/113 (0%)
 Frame = -3

Query: 839 FKAQFFG-LIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQ 663
           F A+ FG +  +     V ++D+E  +FKA+L+F+YTD LP + E            M Q
Sbjct: 136 FSAELFGPMKDSDRAGVVRIDDMEAQVFKALLRFMYTDSLPEMEEEEDT--------MCQ 187

Query: 662 HLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           HLL AADR+ L+RLK +CE +LC+ V V TV   L+LA QH C  LK  CL F
Sbjct: 188 HLLVAADRYNLERLKLICEDRLCKHVGVGTVVNILTLAGQHHCDGLKKACLHF 240



>gb:AF527809_1808457 Sorghum bicolor clone BAC SB_BBc0234M12
           php200725 orthologous region.
          Length = 368

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 45/110 (40%), Positives = 66/110 (60%)
 Frame = -3

Query: 833 AQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLL 654
           A+ FG +       ++++D+EP +F+A+L F+YTD LP +              M QHLL
Sbjct: 230 AELFGPMKENTMSSIQIDDVEPRVFRALLHFIYTDSLPEID-------GEDEPGMAQHLL 282

Query: 653 AAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
            AAD++G+ RLK +CEA L + +    +ATTL+LA+QH C  LK  C KF
Sbjct: 283 VAADKYGMQRLKLMCEAMLLKHIDTSVLATTLTLAEQHDCQGLKDGCFKF 332



>gb:AE016959_1022643 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752462
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 373

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 48/116 (41%), Positives = 70/116 (60%), Gaps = 4/116 (3%)
 Frame = -3

Query: 839 FKAQFFGL----IGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXI 672
           F+A+ FG     +   +   VE++D+E  +F+A+L F+YTD+LP               +
Sbjct: 223 FRAELFGAMKESVSGGSNAVVEVDDMEADVFRALLAFVYTDELPETE-------TKQQVV 275

Query: 671 MMQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           M QHLL AADR+G+ RL +LCE KLC  V + + AT ++LA+QH C  LK  CL+F
Sbjct: 276 MAQHLLVAADRYGMQRLMRLCEEKLCGRVELGSAATLMALAEQHHCRGLKEACLRF 331



>gb:AP003865_1834529 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1081_B12.>gb:AP003887_1834858 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1186_G01.
          Length = 304

 Score = 93.2 bits (230), Expect = 5e-18
 Identities = 50/113 (44%), Positives = 67/113 (59%), Gaps = 1/113 (0%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLP-NLHEXXXXXXXXXXXIMMQ 663
           F+A+  G +       + L DIEP  F+A+L+F+YTD+LP +               + Q
Sbjct: 153 FRAELLGSMAESKMSSITLHDIEPLTFRALLRFIYTDKLPADDGGDQLKMAAMATDELFQ 212

Query: 662 HLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
            LLAAADR+ L RLK +C  KL E V+VDTVATTL  A+ H C +LK+ CL F
Sbjct: 213 KLLAAADRYDLSRLKLMCAQKLWEAVSVDTVATTLIHAEMHGCPELKSSCLDF 265



>gb:AP003865_1834518 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1081_B12.>gb:AP003887_1834847 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1186_G01.
          Length = 341

 Score = 93.2 bits (230), Expect = 5e-18
 Identities = 48/112 (42%), Positives = 65/112 (58%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           FKA+  G +       V L DI+P+ FKA+L F+YTD LP+                 + 
Sbjct: 196 FKAELLGSMAEAAMPCVTLHDIDPATFKALLHFVYTDALPS--PSTSSSSSSTTTGFFES 253

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           LL AADR+ L+RLK +C  KL E V+V+TVATTL  A+ + C +LK+ CL F
Sbjct: 254 LLVAADRYALERLKLMCAQKLWESVSVETVATTLGYAETYHCPELKSKCLNF 305



>gb:AY084611_1569699 Arabidopsis thaliana clone 113260 mRNA,
           complete sequence.
          Length = 410

 Score = 93.2 bits (230), Expect = 5e-18
 Identities = 50/123 (40%), Positives = 74/123 (60%), Gaps = 6/123 (4%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPN------LHEXXXXXXXXXX 678
           FK++FF      NT+ V + D+EP +FKA+LQF+Y D LP        H           
Sbjct: 223 FKSKFFSEFEANNTE-VTINDLEPKVFKALLQFMYKDSLPEDVEPATAHTFERLKLSEIY 281

Query: 677 XIMMQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAA 498
             ++  +LAAAD++ L RL+ LCE+ +C+ V+V +VA  L+LAD++   +LK +CLKF A
Sbjct: 282 ETLIVKVLAAADKYDLIRLRLLCESHICKGVSVKSVAKILALADRYNAKELKGVCLKFTA 341

Query: 497 TNL 489
            NL
Sbjct: 342 ENL 344



>gb:AY042879_1560944 Arabidopsis thaliana Unknown protein mRNA,
           complete cds.
          Length = 429

 Score = 93.2 bits (230), Expect = 5e-18
 Identities = 50/123 (40%), Positives = 74/123 (60%), Gaps = 6/123 (4%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPN------LHEXXXXXXXXXX 678
           FK++FF      NT+ V + D+EP +FKA+LQF+Y D LP        H           
Sbjct: 223 FKSKFFSEFEANNTE-VTINDLEPKVFKALLQFMYKDSLPEDVEPATAHTFERLKLSEIY 281

Query: 677 XIMMQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAA 498
             ++  +LAAAD++ L RL+ LCE+ +C+ V+V +VA  L+LAD++   +LK +CLKF A
Sbjct: 282 ETLIVKVLAAADKYDLIRLRLLCESHICKGVSVKSVAKILALADRYNAKELKGVCLKFTA 341

Query: 497 TNL 489
            NL
Sbjct: 342 ENL 344



>gb:AE016959_1022711 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017097_1752530
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 51 of 77 of the complete sequence.
          Length = 718

 Score = 93.2 bits (230), Expect = 5e-18
 Identities = 44/96 (45%), Positives = 65/96 (67%)
 Frame = -3

Query: 791 VELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQL 612
           ++++D++P +FKA+L++ YTD LP   +            M QHLLAAADR+G++RL+ L
Sbjct: 226 IKIDDMDPLVFKALLRYAYTDSLPP--QMQQGELEEEGRAMAQHLLAAADRYGMERLRLL 283

Query: 611 CEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           CEA+LC+ + V +VA+ L LADQH C  LK  C +F
Sbjct: 284 CEAQLCKHIEVASVASILILADQHGCSGLKNACFEF 319



>gb:AE016959_1022699 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752518
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 326

 Score = 92.8 bits (229), Expect = 7e-18
 Identities = 51/120 (42%), Positives = 70/120 (58%), Gaps = 3/120 (2%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNT-DKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQ 663
           F A+ FG +   +    V ++D+E  +FKA+L+F+YTD LP   E            M Q
Sbjct: 182 FSAELFGSMKESDAAGVVRIDDMEAQVFKALLRFVYTDSLPETEEEEQDT-------MAQ 234

Query: 662 HLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF--AATNL 489
           HLL AADR+ ++RLK +CE  LC+ + V TV T L+LA+QH C  LK  C  F  +A NL
Sbjct: 235 HLLVAADRYAMERLKLICEDMLCKYIDVGTVTTILTLAEQHHCEGLKKACFDFLSSAVNL 294



>gb:AE016959_1022679 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752498
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 271

 Score = 92.8 bits (229), Expect = 7e-18
 Identities = 48/117 (41%), Positives = 69/117 (58%), Gaps = 1/117 (0%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVE-LEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQ 663
           F A+ +GL+   +   V  +ED+E  +FK +L+F+YTD LP +              M Q
Sbjct: 137 FGAELYGLMKEGDAAVVVCIEDMEARVFKLLLRFMYTDSLPEMKNKDAGV-------MCQ 189

Query: 662 HLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           HLL AADR+ L+RLK +CE KLC+ +++ TV+  L LADQH C  LK  C  F  ++
Sbjct: 190 HLLVAADRYNLERLKLICEEKLCKHISMGTVSNMLVLADQHHCAGLKKTCCNFLGSS 246



>gb:AE016959_1022665 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752484
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 362

 Score = 92.8 bits (229), Expect = 7e-18
 Identities = 47/113 (41%), Positives = 66/113 (58%), Gaps = 1/113 (0%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNT-DKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQ 663
           FKAQ +G +    T   + ++D+E  +F+AML F+YTD LP + +            M Q
Sbjct: 220 FKAQLYGRMRESTTRGAIRIDDMEEEVFRAMLTFVYTDDLPEMKQQDEAA-------MAQ 272

Query: 662 HLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           HLL AADR+ L+R+K +CE  L + +  D+V   L LA+QH C  LK  CLKF
Sbjct: 273 HLLVAADRYNLERMKLICEHNLSKHIDTDSVVNILVLAEQHSCHMLKEACLKF 325



>gb:AE016959_1022689 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752508
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 363

 Score = 92.4 bits (228), Expect = 9e-18
 Identities = 49/113 (43%), Positives = 68/113 (60%), Gaps = 1/113 (0%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNT-DKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQ 663
           F A+ +GL+   +T   V +ED+E  +FK +L+F+YTD LP +             +M Q
Sbjct: 218 FGAELYGLMKEGDTAGVVRIEDMEAQVFKMLLRFVYTDSLPEME--------AEEDVMCQ 269

Query: 662 HLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           HL+ AADR+ L RLK +CE KLC+ + V TV+  L+LADQH C  LK  C  F
Sbjct: 270 HLIVAADRYDLQRLKLICEEKLCKYIGVCTVSNILALADQHHCDGLKKACFSF 322



>gb:AE016959_1022682 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752501
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 404

 Score = 92.4 bits (228), Expect = 9e-18
 Identities = 48/117 (41%), Positives = 69/117 (58%), Gaps = 1/117 (0%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKV-ELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQ 663
           F A+ +GL+   N   V  +ED+E  +FK +L+F+YTD LP + +            M Q
Sbjct: 222 FGAELYGLMKEGNAAVVVRVEDMEARVFKLLLRFVYTDSLPEMKKKDEGI-------MCQ 274

Query: 662 HLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           HLL AADR+ L+RLK +CE KLC+ ++  TV+  L LADQH C  L+  C  F  ++
Sbjct: 275 HLLVAADRYNLERLKLICEEKLCKHISTGTVSNMLLLADQHHCSGLQKACCNFLGSS 331



>gb:AE016959_1022671 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752490
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 409

 Score = 92.4 bits (228), Expect = 9e-18
 Identities = 45/99 (45%), Positives = 62/99 (62%)
 Frame = -3

Query: 791 VELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQL 612
           V + D+E  +FKA+L+F YTD LP + E            M QHLL AADR+ ++RLK +
Sbjct: 267 VRVVDMEAQVFKALLRFAYTDSLPEMKEKDEGA-------MCQHLLVAADRYAMERLKLV 319

Query: 611 CEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAAT 495
           CE KLCE + V +VAT L+LA+QH C  L+  C  F ++
Sbjct: 320 CEEKLCERIDVSSVATVLALAEQHHCDGLRNACFDFLSS 358



>gb:AE016959_1022642 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752461
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 435

 Score = 92.4 bits (228), Expect = 9e-18
 Identities = 47/114 (41%), Positives = 71/114 (62%), Gaps = 2/114 (1%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDK--VELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMM 666
           FKA+ FG +   ++    V+++D+E  +F+A+L F+YTD LP   E           ++ 
Sbjct: 285 FKAELFGQMKESSSSNTIVKVDDMEAEVFRALLAFIYTDALP---ETKTKANQEDELVIA 341

Query: 665 QHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           QHLL AADR+G++RLK LCE K+ E +   +VAT ++LA+QH C  LK  C +F
Sbjct: 342 QHLLVAADRYGMERLKLLCEEKVVEYIDRGSVATLMALAEQHHCQALKEACFRF 395



>gb:AP005410_1851305 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OSJNBa0038P10.>gb:AP005517_1853300 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBb0090H20.
          Length = 384

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 44/117 (37%), Positives = 74/117 (63%), Gaps = 1/117 (0%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQL-PNLHEXXXXXXXXXXXIMMQ 663
           F A+ +G +     +++ ++D++P +FKA+L F+YTD   P +++            + +
Sbjct: 234 FMAELYGPMRAKRGERIAIQDMQPVVFKALLHFMYTDSFSPAINDDLSRDERQE---LAK 290

Query: 662 HLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           HLL AADR+ ++ LK +CE  LC  ++VD VAT ++LADQH C +LK  C+KF A++
Sbjct: 291 HLLVAADRYAVEGLKTICEKALCMSLSVDNVATIVALADQHNCGRLKEACVKFIASS 347



>gb:AE016959_1022678 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752497
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 500

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 50/113 (44%), Positives = 64/113 (56%), Gaps = 1/113 (0%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNT-DKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQ 663
           F A+ +GL+   +T   V +ED+E  +FK +L+F+YTD LP + E            M Q
Sbjct: 225 FSAELYGLMKEGDTAGVVRIEDMEAQVFKLLLRFMYTDSLPKMEEEDV---------MWQ 275

Query: 662 HLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           HLL AADR  L RLK +CE +LC  + V TV   L LADQH C  LK  C  F
Sbjct: 276 HLLVAADRHDLQRLKLICEDRLCNYIGVSTVLNILVLADQHHCDGLKKACFSF 328



>gb:AE016959_1022670 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752489
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 369

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 47/115 (40%), Positives = 67/115 (58%), Gaps = 3/115 (2%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNT---DKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIM 669
           F A+ FG++   +T   D +++ D+   +FKA+L F+YTD LP   E            M
Sbjct: 220 FNAELFGMMMESDTTTNDAIQIGDMAAPVFKALLHFVYTDSLPETMEEREDT-------M 272

Query: 668 MQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
            +HLL AADR+ L+RLK +CE +LC+ + + TV   L+LADQH C  LK  C  F
Sbjct: 273 CEHLLVAADRYNLERLKLICEERLCKYIGIGTVMDILALADQHHCKGLKKACFDF 327



>gb:AP003865_1834520 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1081_B12.>gb:AP003887_1834849 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1186_G01.
          Length = 359

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 48/114 (42%), Positives = 64/114 (56%), Gaps = 2/114 (1%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+ +  G         V L DIEP+ F+A+L F+YTD L  +              ++ H
Sbjct: 206 FRVELLGSTAEATMPCVTLHDIEPTTFRALLHFVYTDVLQIIEGSSSSTTASTSDHLLHH 265

Query: 659 --LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
             LLAAADR+ LD LK +C  KL E V+V+TVATTL  A+ H C +LK+ CL F
Sbjct: 266 QRLLAAADRYALDGLKLMCAQKLWESVSVETVATTLGCAEMHGCPELKSKCLDF 319



>gb:AY224567_1590764 Oryza sativa (japonica cultivar-group) isolate
           29942 zinc finger POZ domain protein mRNA, partial cds.
          Length = 183

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 45/103 (43%), Positives = 68/103 (66%), Gaps = 1/103 (0%)
 Frame = -3

Query: 794 KVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXX-XXXXIMMQHLLAAADRFGLDRLK 618
           ++ ++D+EP +F+A   F+Y D L    E             +   LLAAADR+ L RL+
Sbjct: 19  EIVIDDMEPKVFQAGFLFMYRDNLVGDDELSASSSDCSIFDTLAGKLLAAADRYELPRLR 78

Query: 617 QLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNL 489
            LCE+ LC+ ++V++VATTL+LAD+H  ++LK++CLKFAA NL
Sbjct: 79  LLCESYLCKHISVNSVATTLALADRHHAMELKSVCLKFAAENL 121



>gb:AP005607_1854804 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ9003_D08.
          Length = 323

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 47/115 (40%), Positives = 67/115 (58%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+A FFG +       +E+ED+E  +F+ +L F+Y D LP               +M QH
Sbjct: 213 FRALFFGAMIAETPRTIEIEDMEAGVFRLLLHFMYNDSLPE--------TWSQDAMMAQH 264

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAAT 495
           LL AAD + + RLK +CE KL + +  + VATTL+LA+QH C  LK  CL+F A+
Sbjct: 265 LLVAADWYNVGRLKLICEEKLAKHIDCNMVATTLALAEQHSCQGLKEACLEFLAS 319



>gb:AY084246_1569338 Arabidopsis thaliana clone 101153 mRNA,
           complete sequence.
          Length = 436

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 46/121 (38%), Positives = 73/121 (60%), Gaps = 4/121 (3%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXX----XXXI 672
           F+++F  + G  + D +E+ D+EP +FKA+L ++Y D L    E                
Sbjct: 212 FESEFLDVTGEEDRD-IEVTDMEPKVFKALLHYIYKDALIEDAESSSSSGSSVGPSASDT 270

Query: 671 MMQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           +   LL AAD++ L RL  +CE+ LC++++VD+VA  L+LAD++    LK++CLKFAA N
Sbjct: 271 LAAKLLGAADKYKLPRLSLMCESVLCKDISVDSVANILALADRYNASALKSVCLKFAAEN 330

Query: 491 L 489
           L
Sbjct: 331 L 331



>gb:ATAC009540_1542994 Arabidopsis thaliana chromosome III BAC
           F20H23 genomic sequence, complete
           sequence.>gb:AY059150_1564513 Arabidopsis thaliana
           AT3g03740/F20H23_23 mRNA, complete
           cds.>gb:AF367309_1791761 Arabidopsis thaliana
           AT3g03740/F20H23_23 mRNA, complete cds.
          Length = 465

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 46/121 (38%), Positives = 73/121 (60%), Gaps = 4/121 (3%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXX----XXXI 672
           F+++F  + G  + D +E+ D+EP +FKA+L ++Y D L    E                
Sbjct: 241 FESEFLDVTGEEDRD-IEVTDMEPKVFKALLHYIYKDALIEDAESSSSSGSSVGPSASDT 299

Query: 671 MMQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           +   LL AAD++ L RL  +CE+ LC++++VD+VA  L+LAD++    LK++CLKFAA N
Sbjct: 300 LAAKLLGAADKYKLPRLSLMCESVLCKDISVDSVANILALADRYNASALKSVCLKFAAEN 359

Query: 491 L 489
           L
Sbjct: 360 L 360



>gb:AE016959_1022694 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752513
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 291

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 46/100 (46%), Positives = 62/100 (62%)
 Frame = -3

Query: 791 VELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQL 612
           V +E++E  +FK +L+F+YTD LP + E            M QHLL AADR+ L RLK +
Sbjct: 192 VRIEEMEAQVFKLLLRFVYTDSLPKMKEEDV---------MCQHLLVAADRYNLKRLKLI 242

Query: 611 CEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           CE KLC+ + V TVA+ L+LADQH C  LK  C  F  ++
Sbjct: 243 CEKKLCKYIGVGTVASILALADQHYCDGLKKACFNFLGSS 282



>gb:AP004761_1844592 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0686C03.
          Length = 282

 Score = 90.5 bits (223), Expect = 4e-17
 Identities = 50/112 (44%), Positives = 63/112 (56%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A+  G +       V L DIEP+ F+A+L F+YTD LP                  + 
Sbjct: 143 FSAELLGSMAEGTMPCVTLHDIEPATFRALLHFVYTDALPP--------RDILSPSFFKK 194

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           L AAADRF LDRLK +C  KL E VTV+TVA TL+ A+ H C +LK+ CL F
Sbjct: 195 LFAAADRFALDRLKLMCAQKLWESVTVETVAETLACAEMHSCPELKSRCLDF 246



>gb:AP004591_1842002 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0582D05.
          Length = 391

 Score = 90.5 bits (223), Expect = 4e-17
 Identities = 45/114 (39%), Positives = 71/114 (62%), Gaps = 2/114 (1%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKV-ELEDIEPSIFKAMLQFLYTDQLP-NLHEXXXXXXXXXXXIMM 666
           FKA+ +G +   + D V  + D++P++FKA+L F+YTD +P +L              M 
Sbjct: 217 FKAELYGAMKEKDADHVIAIVDVQPAVFKALLHFIYTDDMPPDLGLAAADDDDTDRIDMA 276

Query: 665 QHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           +HLL AADR+ ++RL+ +CE  L   + V+TV  T++LA+QH C +LK  CL+F
Sbjct: 277 RHLLVAADRYAVERLRVICERVLRRSLGVETVIDTMALAEQHSCGELKEACLEF 330



>gb:AE016959_1022683 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752502
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 369

 Score = 90.1 bits (222), Expect = 5e-17
 Identities = 47/113 (41%), Positives = 67/113 (59%), Gaps = 1/113 (0%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKV-ELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQ 663
           F+A  +G +   +TD V  +ED+E  +FK +L+F+YTD LP +             ++ Q
Sbjct: 224 FRAALYGSMKEGDTDGVVHIEDMEAQVFKLLLRFVYTDSLPEME--------TEEDVVCQ 275

Query: 662 HLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           HLL  ADR+ L RLK +CE +LC+ + V TV+  L+LADQH C  LK  C  F
Sbjct: 276 HLLVTADRYDLHRLKLMCENRLCKYIGVSTVSNILALADQHHCDGLKKACFSF 328



>gb:AE016959_1022693 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752512
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 359

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 48/116 (41%), Positives = 68/116 (58%), Gaps = 1/116 (0%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNT-DKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQ 663
           F+A+ +  +   +T   V +ED+E  +FK +L+F+YTD LP +              M Q
Sbjct: 210 FRAELYSSMKEGDTAGVVRIEDMEAQVFKLLLRFVYTDSLPEMGNDDEDV-------MCQ 262

Query: 662 HLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAAT 495
           HLL AADR+ L+RLK + E KLC  ++VD V+  L+LADQH C  LK  C  F A+
Sbjct: 263 HLLVAADRYNLERLKLIYEEKLCSYISVDAVSNILALADQHHCDGLKKACFHFLAS 318



>gb:AE016959_1022675 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752494
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 395

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 47/116 (40%), Positives = 67/116 (57%), Gaps = 1/116 (0%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKV-ELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQ 663
           F A+ FG +   +T  V  ++D+E  +F+A+L F+YTD LP   +            M Q
Sbjct: 251 FSAELFGSMKESDTTVVIRIDDMEAQVFRALLFFVYTDSLPETKKEDEYA-------MCQ 303

Query: 662 HLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAAT 495
           HLL AADR+ ++RLK +CE +LC  + V TV T L LA+QH C  LK  C  F ++
Sbjct: 304 HLLVAADRYNMERLKLMCEERLCSYIGVGTVTTILELAEQHNCDGLKKACFDFLSS 359



>gb:AF527809_1808460 Sorghum bicolor clone BAC SB_BBc0234M12
           php200725 orthologous region.
          Length = 333

 Score = 89.4 bits (220), Expect = 8e-17
 Identities = 51/115 (44%), Positives = 66/115 (57%), Gaps = 4/115 (3%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTD----KVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXI 672
           F A+FFG    P+ +    +V +  IEPS+FKA+L F+YTD LP++              
Sbjct: 195 FMAEFFG---GPHKEQVAGRVSIHGIEPSVFKALLHFIYTDSLPDID-------GGDMTA 244

Query: 671 MMQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLK 507
           M QHLL AADR+G+ RLK +CE  L   V    V TTL LA++H C QLK  C K
Sbjct: 245 MAQHLLVAADRYGIQRLKSICEYLLRTFVDRSAVVTTLVLAERHGCHQLKEACFK 299



>gb:AE016959_1022644 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752463
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 395

 Score = 89.4 bits (220), Expect = 8e-17
 Identities = 46/127 (36%), Positives = 74/127 (58%), Gaps = 12/127 (9%)
 Frame = -3

Query: 839 FKAQFFG-LIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLH-----------EXXXX 696
           F+A+ FG +  +  T  + ++DIEP +F+ +L F+YTD LP  +           +    
Sbjct: 224 FRAELFGPMKESAATAVITVDDIEPDVFRNLLTFMYTDTLPETNPQELEEEEEDDDDDYE 283

Query: 695 XXXXXXXIMMQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTI 516
                   M++HLL AADR+ L+RLK +CE +LC+ +  ++VAT L+LA+QH C  LK  
Sbjct: 284 DDQAQAAAMVEHLLIAADRYNLERLKLICEDRLCKHIDGESVATILALAEQHSCDGLKEA 343

Query: 515 CLKFAAT 495
           C +F ++
Sbjct: 344 CFQFLSS 350



>gb:AP003865_1834526 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1081_B12.>gb:AP003887_1834855 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1186_G01.
          Length = 203

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 43/114 (37%), Positives = 66/114 (57%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+A+ FG++    +  + L+DI+ + F+A+L+F+YTD LP                  QH
Sbjct: 55  FRAELFGVMSESTSSCITLKDIDAATFRALLRFIYTDDLPAADAGKLNHQGSSMGAFFQH 114

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAA 498
           LLA ADR+ LDRLK +C  +L   +T D+VA  L+ A+ + C +LK  C+ F A
Sbjct: 115 LLAMADRYALDRLKLMCGQRLLHSMTSDSVAGILACAETYDCPELKNKCIDFFA 168



>gb:AP003865_1834523 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1081_B12.>gb:AP003887_1834852 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1186_G01.
          Length = 321

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 47/115 (40%), Positives = 63/115 (54%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+A+  G +       V L DIEP+ F+A+L F+YTD L                 ++Q 
Sbjct: 179 FRAELLGSMAEATMPCVTLRDIEPATFRALLHFVYTDVLQ-----IEGSSSTSTTDLLQR 233

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAAT 495
           LLAAADRF L+RLK +C  KL E V+V+TV  TL  A+ H C +LK  C+    T
Sbjct: 234 LLAAADRFALERLKLMCAQKLWESVSVETVIATLCCAEMHSCPELKNRCIDLVVT 288



>gb:OSJN00106_1695016 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0060E08, complete sequence.
          Length = 307

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 46/115 (40%), Positives = 66/115 (57%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+A+  G     +    + +D+EP+ FKA+L F+YTD LPN               M + 
Sbjct: 165 FRAELLGPAAARSIKIDDDDDMEPATFKALLHFIYTDHLPN------DSGFGKDAAMQRR 218

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAAT 495
           LL AADR+G+DRL+ +C  KL + V+V TV  +L  A++H C QLK  CL F A+
Sbjct: 219 LLVAADRYGVDRLRAMCGVKLYKSVSVGTVVDSLEFAEKHHCAQLKDACLGFMAS 273



>gb:OSJN00079_1694505 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0053K19, complete sequence.
          Length = 338

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 46/115 (40%), Positives = 66/115 (57%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+A+  G     +    + +D+EP+ FKA+L F+YTD LPN               M + 
Sbjct: 196 FRAELLGPAAARSIKIDDDDDMEPATFKALLHFIYTDHLPN------DSGFGKDAAMQRR 249

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAAT 495
           LL AADR+G+DRL+ +C  KL + V+V TV  +L  A++H C QLK  CL F A+
Sbjct: 250 LLVAADRYGVDRLRAMCGVKLYKSVSVGTVVDSLEFAEKHHCAQLKDACLGFMAS 304



>gb:AE016959_1022659 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752478
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 1438

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 45/117 (38%), Positives = 67/117 (57%), Gaps = 1/117 (0%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDK-VELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQ 663
           FKA+ +G +    T   + ++D+E  +F+AML F+YTD LP +              M Q
Sbjct: 216 FKAELYGRMKESTTKSAIAIDDMEEEVFEAMLTFIYTDSLPKMKRRDEAA-------MAQ 268

Query: 662 HLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           HLL AADR+ L+RLK +CE KL + +   ++A  L LA++H C  LK  C +F  T+
Sbjct: 269 HLLVAADRYNLERLKLICEDKLSKNIDTGSIANILLLAEKHSCHALKEACFEFLRTS 325



>gb:AP004691_1843472 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0453D01.
          Length = 392

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 50/142 (35%), Positives = 73/142 (51%), Gaps = 27/142 (19%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDK-------VELEDIEPSIFKAMLQFLYTDQLP------------- 720
           F+AQFFG +   N          V + D+ P+ F+A+L F+YTD LP             
Sbjct: 214 FRAQFFGPMAAANRRASGGGGRCVRVHDMRPAAFEAVLHFVYTDTLPPVKEEEGFLTNNS 273

Query: 719 -------NLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATT 561
                  NL +           +M++  LAAADRFGL+R++ LCE  LCE + V   A T
Sbjct: 274 ASRRHLVNLRDAAAGCSKGEVRVMVREWLAAADRFGLERMRLLCEDALCESIGVANAAAT 333

Query: 560 LSLADQHRCLQLKTICLKFAAT 495
           L LAD+H C  L+ +C+++ A+
Sbjct: 334 LRLADRHHCALLRALCMEYIAS 355



>gb:AF488415_1804403 Triticum monococcum chromosome 7Am BAC 5K14
           complete sequence.
          Length = 369

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 47/114 (41%), Positives = 68/114 (59%), Gaps = 3/114 (2%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDK---VELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIM 669
           F+AQ FG +    T     + +ED++ ++++AML F+YTD LP + +             
Sbjct: 216 FRAQLFGPMKEGATTMPGAIVIEDMKANVYRAMLSFIYTDTLPTMEKAEEDEEGVM---W 272

Query: 668 MQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLK 507
           +Q LL AADR+ L RLK LCE KL E + V TVA+TL+LA++H C  LK  C +
Sbjct: 273 LQDLLVAADRYDLQRLKFLCEEKLSEHIRVSTVASTLALAERHHCRMLKEACFQ 326



>gb:AE016959_1022726 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017097_1752545
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 51 of 77 of the complete sequence.
          Length = 422

 Score = 86.7 bits (213), Expect = 5e-16
 Identities = 42/116 (36%), Positives = 69/116 (59%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           FKA+ F  +    TD +++++++  +FKA+L F+YTD  P + +            M+Q 
Sbjct: 274 FKAELFKPMEEGTTDVIKIDNMDAQVFKALLVFIYTDTWPEIGQDETT--------MVQQ 325

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           LL AA+++ L RLK +CE KLC  +   +V T L LAD+++C  LK +C  F A++
Sbjct: 326 LLVAANKYSLSRLKIMCEDKLCSYIDTSSVVTMLMLADKYQCHGLKKVCFNFLASS 381



>gb:AE016959_1022641 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752460
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 382

 Score = 86.3 bits (212), Expect = 7e-16
 Identities = 44/114 (38%), Positives = 68/114 (59%), Gaps = 2/114 (1%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDK--VELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMM 666
           FKA+ FG +   ++    V ++D+E  +F+A+L F+YT+ LP   E           ++ 
Sbjct: 225 FKAELFGQMKESSSSNTVVNVDDMEAEVFRALLVFIYTNALP---ETKTKANQEDELVIA 281

Query: 665 QHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           QHLL AADR+G++RLK LCE KL E +   +    ++LA+QH C  LK +C +F
Sbjct: 282 QHLLVAADRYGMERLKLLCEEKLVEYIDRGSAVMLMALAEQHHCHGLKEVCFRF 335



>gb:AF527809_1808454 Sorghum bicolor clone BAC SB_BBc0234M12
           php200725 orthologous region.
          Length = 518

 Score = 85.9 bits (211), Expect = 9e-16
 Identities = 49/115 (42%), Positives = 67/115 (58%), Gaps = 4/115 (3%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTD---KVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIM 669
           F A+FFG  G  ++    +V+++D+EP +FKA+L F+YTD LP LHE           +M
Sbjct: 399 FMAEFFGPAGKGSSTTVTRVQIDDMEPRVFKALLHFIYTDTLPELHE------DDDKIVM 452

Query: 668 MQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVA-TTLSLADQHRCLQLKTICLK 507
            Q LL AADR+ + RLK +C   LC  V     A   L LAD+H C +LK  C+K
Sbjct: 453 AQDLLVAADRYDMGRLKLICADMLCNYVNDARAAFAMLELADKHCCRRLKVKCMK 507



>pir|T47406|T47406 hypothetical protein F23N14.80 - Arabidopsis
           thaliana>gb:ATF23N14_1549795 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F23N14.
          Length = 411

 Score = 85.9 bits (211), Expect = 9e-16
 Identities = 42/123 (34%), Positives = 72/123 (58%), Gaps = 6/123 (4%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPN------LHEXXXXXXXXXX 678
           F++ F+  +   N+D V + D+EP +FKA+L F+Y D LP        H           
Sbjct: 226 FRSMFYNTLAENNSDVV-ISDLEPKVFKALLHFMYKDSLPGDVEPLTAHSFDLLRPSEID 284

Query: 677 XIMMQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAA 498
             ++  LLAAA+ + L RL+ LCE+ +C+ +++ +V+  L+L+D++   +LK++ LKF A
Sbjct: 285 DTLIVKLLAAAEMYNLSRLRLLCESHICKGISISSVSKILALSDKYNASELKSVSLKFTA 344

Query: 497 TNL 489
            NL
Sbjct: 345 ENL 347



>gb:AP003865_1834525 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1081_B12.>gb:AP003887_1834854 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1186_G01.
          Length = 361

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 46/121 (38%), Positives = 71/121 (58%), Gaps = 7/121 (5%)
 Frame = -3

Query: 839 FKAQFFGLIG---NPNTDKVELEDIEPSIFKAMLQFLYTDQLP----NLHEXXXXXXXXX 681
           F+ + FG      +P++  + L+ IEP+IF+A+L+F+YTD+LP     LH+         
Sbjct: 211 FRTELFGCKSESTSPSSSCITLQGIEPAIFRALLRFIYTDELPADAGKLHQGSSSTNV-- 268

Query: 680 XXIMMQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFA 501
                +HLLA ADR+ LDRLK +C  +L + +T D+VA  L  A+ + C +LK  C+ F 
Sbjct: 269 ---FFKHLLAMADRYALDRLKIMCGQRLLDNMTPDSVAAILVCAEMYNCPELKNKCIDFF 325

Query: 500 A 498
           A
Sbjct: 326 A 326



>gb:AE016959_1022739 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017097_1752558
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 51 of 77 of the complete sequence.
          Length = 371

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 45/114 (39%), Positives = 65/114 (57%), Gaps = 2/114 (1%)
 Frame = -3

Query: 839 FKAQFFGLI--GNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMM 666
           F A+ FG +  G    D +E+ D++  +FKA+L F+YTD L  + +            M 
Sbjct: 192 FVAEHFGPMKEGVNVNDVIEINDMDAQVFKALLNFIYTDTLLEMDQEEDAT-------MA 244

Query: 665 QHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           QHLL AAD++GL+RLK  CE +L   +  D+VAT L L D+H C  L   C++F
Sbjct: 245 QHLLVAADKYGLERLKVKCEERLSNHIDADSVATLLVLTDKHNCRGLNKACIEF 298



>gb:AE016959_1022730 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017097_1752549
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 51 of 77 of the complete sequence.
          Length = 518

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 45/114 (39%), Positives = 65/114 (57%), Gaps = 2/114 (1%)
 Frame = -3

Query: 839 FKAQFFGLI--GNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMM 666
           F A+ FG +  G    D +E+ D++  +FKA+L F+YTD L  + +            M 
Sbjct: 220 FVAEHFGPMKEGVNVNDVIEINDMDAQVFKALLNFIYTDTLLEMDQEEDAT-------MA 272

Query: 665 QHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           QHLL AAD++GL+RLK  CE +L   +  D+VAT L L D+H C  L   C++F
Sbjct: 273 QHLLVAADKYGLERLKVKCEERLSNHIDADSVATLLVLTDKHNCRGLNKACIEF 326



>gb:BC071613_1988687 Homo sapiens hypothetical protein LOC339745,
           mRNA (cDNA clone MGC:87667 IMAGE:5275316), complete cds.
          Length = 392

 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 44/112 (39%), Positives = 65/112 (58%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F   +     ++VE+ D++P +FK M++F+YT + PNL +            M  +
Sbjct: 225 FNAMFEHEMEESKKNRVEINDLDPEVFKEMMRFIYTGRAPNLDK------------MADN 272

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           LLAAAD++ L+RLK +CE  LC  ++V+ VA TL LAD H   QLK   + F
Sbjct: 273 LLAAADKYALERLKVMCEEALCSNLSVENVADTLVLADLHSAEQLKAQAIDF 324



>gb:AX881689_1478700 Sequence 16594 from Patent
           EP1074617.>gb:AK021919_1909004 Homo sapiens cDNA
           FLJ11857 fis, clone HEMBA1006807, moderately similar to
           Homo sapiens mRNA for SPOP.
          Length = 391

 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 44/112 (39%), Positives = 65/112 (58%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F   +     ++VE+ D++P +FK M++F+YT + PNL +            M  +
Sbjct: 225 FNAMFEHEMEESKKNRVEINDLDPEVFKEMMRFIYTGRAPNLDK------------MADN 272

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           LLAAAD++ L+RLK +CE  LC  ++V+ VA TL LAD H   QLK   + F
Sbjct: 273 LLAAADKYALERLKVMCEEALCSNLSVENVADTLVLADLHSAEQLKAQAIDF 324



>gb:AE016959_1022734 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017097_1752553
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 51 of 77 of the complete sequence.
          Length = 355

 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 44/112 (39%), Positives = 64/112 (57%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           FKA+ FG       D ++++++E  +FKA+L+F+YTD    +              M Q 
Sbjct: 200 FKAELFGPTKKGTIDAIQIDNMEARVFKALLEFIYTDIWSEIGHGKDNVA------MAQQ 253

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           LLAAADR+GL RLK + E KLC  +   +V+T L LA++H C +LK  C  F
Sbjct: 254 LLAAADRYGLQRLKFVYEDKLCNHIDTCSVSTMLVLAEKHHCCKLKEACSTF 305



>gb:AE016959_1022725 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017097_1752544
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 51 of 77 of the complete sequence.
          Length = 614

 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 43/115 (37%), Positives = 64/115 (55%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           FKA+ FG       D ++++++E  +FKA+L F+YTD  P +              M Q 
Sbjct: 215 FKAELFGPTKKGTIDVIQIDNMEARVFKALLDFIYTDIWPEIGHGEDNVA------MAQR 268

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAAT 495
           LLAAAD +GL RLK + E KLC  +   + +T L LA++H C +LK  C  F ++
Sbjct: 269 LLAAADMYGLQRLKFVYEDKLCNHIDTGSASTMLVLAEKHHCCKLKEACFTFLSS 323



>gb:AE016959_1022698 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752517
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 373

 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 48/116 (41%), Positives = 61/116 (52%), Gaps = 1/116 (0%)
 Frame = -3

Query: 839 FKAQFFG-LIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQ 663
           F  + FG +     T  V + ++ P  FKAML F+Y D  P   E            M Q
Sbjct: 221 FMVELFGPMKEGATTASVHISEMVPEAFKAMLAFIYNDTPPPETEEDEDGKVA----MWQ 276

Query: 662 HLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAAT 495
           HLL AADR+ L RLK +CE KLC  + V T  T L LAD+H C  LK  CL+F ++
Sbjct: 277 HLLVAADRYDLPRLKLICEEKLCGHIGVGTATTILLLADKHHCRGLKEACLEFLSS 332



>gb:AP003633_1831839 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0637D03.>gb:AP003635_1831888 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0686E06.
          Length = 345

 Score = 82.8 bits (203), Expect = 7e-15
 Identities = 40/112 (35%), Positives = 66/112 (58%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A+ FG +   ++  +E++D+E  +F+ +L F+YTD LP   +            M   
Sbjct: 195 FMAELFGDMKEKDSQSIEIKDMEAEVFRTLLHFIYTDTLPEQDDDDVEAET-----MAYG 249

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           LL AADR+G++RL  +C  K+   ++VDT A  L+LA++H C +LK  C++F
Sbjct: 250 LLEAADRYGVERLMLICAEKVHAGISVDTAAMALALAERHGCTKLKARCIEF 301



>gb:AE016959_1022729 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017097_1752548
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 51 of 77 of the complete sequence.
          Length = 395

 Score = 82.8 bits (203), Expect = 7e-15
 Identities = 43/113 (38%), Positives = 65/113 (57%), Gaps = 1/113 (0%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNT-DKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQ 663
           F  + FG +    T +K+ + D+E  +F+A+L+F+YTD LP + +            M+Q
Sbjct: 224 FMVELFGPMKEGTTVNKIHIFDMEAQVFRALLKFIYTDMLPEMDQEDETA-------MVQ 276

Query: 662 HLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           HLL AAD++GL RLK +C   L   +   +VAT L LA++H C  LK  C +F
Sbjct: 277 HLLVAADKYGLHRLKMICVEILSNHIDAYSVATILVLAEKHYCYGLKEACFEF 329



>gb:AP004591_1842003 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0582D05.
          Length = 377

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 41/112 (36%), Positives = 66/112 (58%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A+ FG + N     +++ D++P++FK +L F+YTD L  + +            + +H
Sbjct: 229 FAAELFGPMRNNAGGAIKVGDMQPAVFKVLLGFIYTDTLAAMDDLDADEDDRRE--LARH 286

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           LL AADR+ + RLK +C   L   +T  TVA+TL+LAD+H C  L+  C++F
Sbjct: 287 LLVAADRYDMGRLKLICADMLARSLTAQTVASTLALADRHGCRGLREACVEF 338



>gb:AP003865_1834532 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1081_B12.>gb:AP003887_1834861 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1186_G01.
          Length = 140

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 41/97 (42%), Positives = 60/97 (61%)
 Frame = -3

Query: 794 KVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQ 615
           ++ + D+EP  F+AML+F+YTD+L                 ++Q+L+A ADR+ L RLK 
Sbjct: 8   RITIHDVEPVTFRAMLRFIYTDELEE--------KDSMATDLLQNLVAVADRYDLSRLKL 59

Query: 614 LCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           +C  KL E+V+V+ VAT L  A+ H C +LKT CL F
Sbjct: 60  MCAQKLWEKVSVENVATMLIYAEMHGCPELKTSCLDF 96



>gb:AE016959_1022748 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017097_1752567
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 51 of 77 of the complete sequence.
          Length = 280

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 43/115 (37%), Positives = 65/115 (56%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           FKA+ FG       D +++++++  +FKA+L F+YTD  P +              M Q 
Sbjct: 125 FKAELFGPTKKGTIDAIQIDNMKARVFKALLGFIYTDIWPEIGHGKDNVA------MAQQ 178

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAAT 495
           LLAAADR+GL RLK + E KLC  +   +V+T L L ++H C +LK  C  F ++
Sbjct: 179 LLAAADRYGLQRLKFVYEDKLCNHIDTYSVSTMLVLVEKHHCCKLKEACSTFLSS 233



>gb:AE016959_1022733 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017097_1752552
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 51 of 77 of the complete sequence.
          Length = 359

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 40/116 (34%), Positives = 67/116 (57%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           FKA+ F  +    TD +++++++  +FKA+L F+YTD  P + +             M  
Sbjct: 212 FKAELFRPMEGGTTDVIKIDNMDAQVFKALLVFIYTDTWPEIDQDETT---------MVQ 262

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           LL AA+++ L RLK +CE +LC  +   +V T L LAD+++C  LK +C  F A++
Sbjct: 263 LLVAANKYSLSRLKIMCEDRLCSYIDTSSVVTMLMLADKYQCHGLKKVCFNFLASS 318



>gb:AE016959_1022657 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752476
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 388

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 46/121 (38%), Positives = 67/121 (55%), Gaps = 5/121 (4%)
 Frame = -3

Query: 839 FKAQFFGLI-----GNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXX 675
           F+++ FG       G+     V  + I    F+A+L+F+YTD  P L E           
Sbjct: 236 FRSELFGATATSKAGSGGLVHVVDDGIGARAFEALLRFIYTDAPPELDEEDDDASS---- 291

Query: 674 IMMQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAAT 495
            M + LL AADR+ ++RLK +CE +LC+ + V+TVATTL+LA+QH C  LK  C+     
Sbjct: 292 -MARLLLGAADRYNVERLKMICENELCKRIDVNTVATTLALAEQHHCSSLKKACMDLVDA 350

Query: 494 N 492
           N
Sbjct: 351 N 351



>gb:AE016959_1022773 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017098_1752592
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 52 of 77 of the complete sequence.
          Length = 253

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 37/96 (38%), Positives = 60/96 (62%)
 Frame = -3

Query: 779 DIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQLCEAK 600
           D+E  +F+A+L F+YTD LP + +            M QHLL A+D +GL RL  +CE +
Sbjct: 130 DVEFMMFEALLIFIYTDMLPKMDQEDEVA-------MAQHLLVASDTYGLQRLMLICEDR 182

Query: 599 LCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           LC  +  D++A  L LA++H C++LK +C +F +++
Sbjct: 183 LCNHINTDSLAIMLVLAEKHHCIRLKEVCFEFLSSS 218



>gb:AP005554_1853984 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OJ1118_A10.
          Length = 394

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 41/112 (36%), Positives = 61/112 (54%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+A+  G +     + + + D+  S FK ML ++Y + LP   +             +QH
Sbjct: 211 FRAELLGSMAESKMECITISDMSASTFKHMLHYIYCNDLPTCVKDTDDQSSWIFE--LQH 268

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           LL  ADR+G+D LK LCE  LC ++T DTV +TL LA+     +L+T CL F
Sbjct: 269 LLVTADRYGVDTLKDLCEDTLCADITTDTVTSTLELAETRSYPKLRTSCLVF 320



>gb:AP004691_1843473 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0453D01.
          Length = 401

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 49/137 (35%), Positives = 72/137 (52%), Gaps = 22/137 (16%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTD------KVELEDIEPSIFKAMLQFLYTDQLP-------------- 720
           F AQFFG + + +         V + DI+P++F+A+L F+YTD LP              
Sbjct: 225 FSAQFFGPMADEDAAAAGSRRNVRIHDIKPAVFEAVLHFVYTDTLPPATTSWSASHRDKR 284

Query: 719 -NLHEXXXXX-XXXXXXIMMQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLAD 546
             L +            +M+   LAAADRF L+R++ LCE  L E + V   A TL LAD
Sbjct: 285 PKLSDVAAASCSEEEVRVMIGERLAAADRFDLERMRLLCEDALWETIDVANAAATLRLAD 344

Query: 545 QHRCLQLKTICLKFAAT 495
           +H C QLK +C+++ A+
Sbjct: 345 RHHCPQLKELCMEYIAS 361



>gb:AE016959_1022741 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017097_1752560
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 51 of 77 of the complete sequence.
          Length = 349

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 41/113 (36%), Positives = 63/113 (55%), Gaps = 1/113 (0%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNT-DKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQ 663
           F  + FG +    T +K+++ D+E  +F+ +L+F+Y D LP + +            M Q
Sbjct: 182 FMVELFGPMKESTTVNKIQIFDMEAQVFRVLLKFIYIDMLPEMDQEDEAA-------MAQ 234

Query: 662 HLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           HLL AAD++GL RLK +C   L   +  ++VAT L LAD+H C  L+  C  F
Sbjct: 235 HLLVAADKYGLHRLKMICVEILSNHIDANSVATILVLADKHHCYGLREACFDF 287



>gb:AB071989_2047434 Mus musculus mRNA for Spop, partial cds.
          Length = 373

 Score = 80.5 bits (197), Expect = 4e-14
 Identities = 44/112 (39%), Positives = 62/112 (55%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F   +     ++VE+ D+EP +FK M+ F+YT + PNL +            M   
Sbjct: 224 FSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDK------------MADD 271

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           LLAAAD++ L+RLK +CE  LC  ++V+  A  L LAD H   QLKT  + F
Sbjct: 272 LLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDF 323



>gb:CR861145_1185159 Pongo pygmaeus mRNA; cDNA DKFZp459J1214 (from
           clone DKFZp459J1214).
          Length = 374

 Score = 80.5 bits (197), Expect = 4e-14
 Identities = 44/112 (39%), Positives = 62/112 (55%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F   +     ++VE+ D+EP +FK M+ F+YT + PNL +            M   
Sbjct: 225 FSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDK------------MADD 272

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           LLAAAD++ L+RLK +CE  LC  ++V+  A  L LAD H   QLKT  + F
Sbjct: 273 LLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDF 324



>gb:AK004669_1152496 Mus musculus adult male lung cDNA, RIKEN
           full-length enriched library, clone:1200009E17
           product:speckle-type POZ protein, full insert sequence.
          Length = 425

 Score = 80.5 bits (197), Expect = 4e-14
 Identities = 44/112 (39%), Positives = 61/112 (54%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F   +     ++VE+ D+EP +FK M+ F+YT + PNL +            M   
Sbjct: 225 FSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDK------------MADD 272

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           LLAAAD++ L+RLK +CE  LC  ++V+  A  L LAD H   QLKT    F
Sbjct: 273 LLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTXAXDF 324



>sp|O43791|SPOP_HUMAN Speckle-type POZ protein.>gb:AK028201_1160852
           Mus musculus 11 days embryo whole body cDNA, RIKEN
           full-length enriched library, clone:2700043G01
           product:speckle-type POZ protein, full insert
           sequence.>gb:AK030746_1162157 Mus musculus 8 days embryo
           whole body cDNA, RIKEN full-length enriched library,
           clone:5730508O09 product:speckle-type POZ protein, full
           insert sequence.>gb:CR926019_1185535 Pongo pygmaeus
           mRNA; cDNA DKFZp459I2120 (from clone
           DKFZp459I2120).>gb:AX134283_1461821 Sequence 3 from
           Patent WO0132696.>gb:BC001269_1967438 Homo sapiens
           speckle-type POZ protein, mRNA (cDNA clone MGC:5068
           IMAGE:3461565), complete cds.>gb:BC003385_1968798 Homo
           sapiens speckle-type POZ protein, transcript variant 4,
           mRNA (cDNA clone MGC:5381 IMAGE:3445878), complete
           cds.>gb:HSJ000644_2015591 Homo sapiens mRNA for
           SPOP.>gb:AL662875_2072260 Mouse DNA sequence from clone
           RP23-67E18 on chromosome 11 Contains the 3' end of the
           gene for the likely ortholog of H. sapiens C/EBP-induced
           protein (5730593F17Rik), the Ugalt2 gene for
           UDP-galactose translocator 2, the Spop gene for
           speckle-type POZ protein, the Nxph3 gene for
           neurexophilin 3, the Ngfr gene for nerve growth factor
           receptor (TNFR superfamily, member 16), the 5' end of a
           novel gene and a CpG island, complete
           sequence.>gb:AY538613_2086386 Mus musculus PDX-1
           C-terminus interacting factor-1 (Pcif1) mRNA, complete
           cds.>gb:BC043131_2098857 Mus musculus speckle-type POZ
           protein, mRNA (cDNA clone MGC:58071 IMAGE:6811159),
           complete cds.>gb:BC045205_2099102 Mus musculus
           speckle-type POZ protein, mRNA (cDNA clone MGC:49448
           IMAGE:4988521), complete cds.
          Length = 374

 Score = 80.5 bits (197), Expect = 4e-14
 Identities = 44/112 (39%), Positives = 62/112 (55%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F   +     ++VE+ D+EP +FK M+ F+YT + PNL +            M   
Sbjct: 225 FSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDK------------MADD 272

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           LLAAAD++ L+RLK +CE  LC  ++V+  A  L LAD H   QLKT  + F
Sbjct: 273 LLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDF 324



>gb:OSJN00079_1694508 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0053K19, complete
           sequence.>gb:OSJN00106_1695020 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBb0060E08, complete
           sequence.
          Length = 373

 Score = 79.7 bits (195), Expect = 6e-14
 Identities = 41/115 (35%), Positives = 63/115 (54%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A+  G +       +E+  +EP+ F+A+L+F+YTD  P                    
Sbjct: 219 FDAELLGPMMETTAPCIEIHGVEPAAFEALLRFVYTDSWP---------LAGVDVAATVR 269

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAAT 495
           LL+AADR+GL+RL+ +CE KL E + VD  A  L++A+ H C QL+  C+ F A+
Sbjct: 270 LLSAADRYGLERLRLMCEEKLHEGIDVDNAADVLAMAELHHCSQLRDACVAFIAS 324



>gb:AE016959_1022662 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752481
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 312

 Score = 79.3 bits (194), Expect = 8e-14
 Identities = 39/92 (42%), Positives = 55/92 (59%)
 Frame = -3

Query: 779 DIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQLCEAK 600
           + +  +F AML F+YTD LP + +            M QHLL AADR+ L+R+K +CE K
Sbjct: 191 EFQVEVFAAMLTFIYTDALPEMKQQEEAA-------MAQHLLVAADRYNLERMKLICEDK 243

Query: 599 LCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           L + +   +VA  L+LA+QH C  LK  CL+F
Sbjct: 244 LSKHIDAGSVANILALAEQHSCHTLKEACLEF 275



>gb:AY159314_2077188 Mus musculus TDPOZ4 gene, complete cds.
          Length = 370

 Score = 79.0 bits (193), Expect = 1e-13
 Identities = 44/112 (39%), Positives = 63/112 (56%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+A F   +    T+ VE+ D++P +FK M+ F+YT ++P+LH             M   
Sbjct: 213 FRAMFEHQMEERLTNCVEIHDLDPQVFKEMMGFIYTGKVPHLHSHS----------MACD 262

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           LLAAADR+GL  LK +CE  LC  ++V+  A TL +AD H    +KT  L F
Sbjct: 263 LLAAADRYGLKDLKVMCEDALCRNLSVENAAHTLIVADLHSTEHVKTQALDF 314



>gb:AE016959_1022704 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752523
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 361

 Score = 79.0 bits (193), Expect = 1e-13
 Identities = 43/115 (37%), Positives = 67/115 (58%), Gaps = 3/115 (2%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKV-ELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQ 663
           F+A+ +G +   +  +V  ++D++P +F A+L F+YTD LP + +            M Q
Sbjct: 220 FEAELYGPMVERDAGRVIRIDDMDPQVFDALLDFMYTDALPGMRKRDAVA-------MSQ 272

Query: 662 HLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHR--CLQLKTICLKF 504
            LL AADR+ L RL+ LCE +LC+ V   TVA+ L+L +Q R  C  LK  C ++
Sbjct: 273 QLLVAADRYDLKRLRLLCEHELCKHVNKGTVASMLALVEQQRPSCQGLKKACFEY 327



>gb:AY159315_2077189 Mus musculus TDPOZ5 gene, complete cds.
          Length = 340

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 44/111 (39%), Positives = 62/111 (55%)
 Frame = -3

Query: 815 IGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRF 636
           +GNP     E+ D++P +FK M+ F+YT + P+L              M   +L AAD++
Sbjct: 225 LGNPT----EIHDLDPKVFKEMMGFIYTGKAPHLQSHS----------MATDVLTAADKY 270

Query: 635 GLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNLGV 483
           GL+ LK LCE  LC  ++V+  A TL LAD H+  QLKT  L F A +  V
Sbjct: 271 GLEGLKVLCEDALCRNLSVENAAQTLILADLHKREQLKTQALYFIALHASV 321



>gb:AP004761_1844591 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0686C03.
          Length = 157

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 44/104 (42%), Positives = 57/104 (54%), Gaps = 8/104 (7%)
 Frame = -3

Query: 791 VELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQL 612
           V L DIEP+ F+A+L  +YTD LP                  + LLAAADR+ LDRLK +
Sbjct: 4   VTLHDIEPATFRALLHLVYTDALPA--SSTSSSTAAAAVEFFRGLLAAADRYALDRLKLI 61

Query: 611 --------CEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
                   C  KL E V+ +TVA TL+ A+ H C +LKT C+ F
Sbjct: 62  ESIDNHCGCTQKLWEIVSAETVAATLACAEMHSCTELKTRCIDF 105



>gb:BC046272_2549618 Xenopus laevis speckle-type POZ protein, mRNA
           (cDNA clone MGC:53469 IMAGE:5572132), complete
           cds.>gb:BC061316_2553092 Xenopus tropicalis hypothetical
           protein MGC75799, mRNA (cDNA clone MGC:75799
           IMAGE:5382242), complete cds.
          Length = 374

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 43/112 (38%), Positives = 62/112 (55%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F   +     ++VE++D+EP +FK M+ F+YT +  NL +            M   
Sbjct: 225 FSAMFEHEMEESKKNRVEIKDVEPDVFKEMMCFIYTGKASNLDK------------MADD 272

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           LLAAAD++ L+RLK +CE  LC  ++V+  A  L LAD H   QLKT  + F
Sbjct: 273 LLAAADKYALERLKVMCEEALCSNLSVENAAEILILADLHSADQLKTQAVDF 324



>gb:AE016959_1022772 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017098_1752591
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 52 of 77 of the complete sequence.
          Length = 342

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 43/113 (38%), Positives = 62/113 (54%), Gaps = 2/113 (1%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNT-DKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQ 663
           FK + F       T + + + D +  +F+AML F+YTD  P + +            M Q
Sbjct: 188 FKIELFRTTEERTTPNAIPINDTDAQVFRAMLSFIYTDTWPKIDQENEAA-------MAQ 240

Query: 662 HLLAAADRFGLDRLKQLCEAKLCEE-VTVDTVATTLSLADQHRCLQLKTICLK 507
           HLL AA+R+GLDRLK +CE +LC   + + +V T L LA+ H C  LK  CL+
Sbjct: 241 HLLIAAERYGLDRLKLMCEDRLCNGIIDMGSVTTNLVLAENHYCHSLKKACLE 293



>gb:AP003865_1834533 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1081_B12.>gb:AP003887_1834862 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1186_G01.
          Length = 349

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 44/114 (38%), Positives = 61/114 (53%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           FKA  FG +       V L D++P+ F+A+L F+YTD LP   +            M QH
Sbjct: 204 FKAALFGSMAEATAPSVALRDMDPAAFRAVLHFIYTDALP---DDIDELAGFSPVDMFQH 260

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAA 498
           LLAAA+R+ L  LK L   KL + VT + VA  +  A+ + C +LK  CL + A
Sbjct: 261 LLAAAERYELGGLKLLSTKKLLDNVTPENVAGIIVCAETYGCPELKKKCLDYLA 314



>gb:CR860120_1184210 Pongo pygmaeus mRNA; cDNA DKFZp459K1011 (from
           clone DKFZp459K1011).
          Length = 374

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 43/112 (38%), Positives = 61/112 (54%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F   +     ++VE+ D+EP +FK M+  +YT + PNL +            M   
Sbjct: 225 FSAMFEHEMEESKKNRVEINDVEPEVFKEMMCVIYTGKAPNLDK------------MADD 272

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           LLAAAD++ L+RLK +CE  LC  ++V+  A  L LAD H   QLKT  + F
Sbjct: 273 LLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDF 324



>gb:BC071125_2555987 Xenopus laevis MGC81433 protein, mRNA (cDNA
           clone MGC:81433 IMAGE:6635598), complete cds.
          Length = 392

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 41/112 (36%), Positives = 61/112 (54%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F   +     ++V + D++P +FK M++F+YT   P++ +            M   
Sbjct: 225 FSAMFEHPMQESRKNRVYIRDVDPEVFKEMMRFIYTGGTPHVDK------------MADK 272

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           LLAAAD++ L+RLK +CE  LC  +TV+ VA  L LAD H   QLK   + F
Sbjct: 273 LLAAADKYALERLKVMCEESLCNNLTVENVADVLILADLHSAEQLKAQAIDF 324



>gb:BC053276_2550667 Danio rerio speckle-type POZ protein, mRNA
           (cDNA clone MGC:64140 IMAGE:6796934), complete cds.
          Length = 374

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 43/112 (38%), Positives = 61/112 (54%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F   +     ++VE+ D+E  +FK M+ F+YT + PNL +            M   
Sbjct: 225 FSAMFEHEMEESKKNRVEINDVEAEVFKEMMFFIYTGKAPNLDK------------MADD 272

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           LLAAAD++ L+RLK +CE  LC  ++V+  A  L LAD H   QLKT  + F
Sbjct: 273 LLAAADKYALERLKVMCEDALCTSLSVENAAEILILADLHSADQLKTQAVDF 324



>gb:OSJN00050_1693899 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0088K19, complete sequence.
          Length = 371

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 38/95 (40%), Positives = 60/95 (63%)
 Frame = -3

Query: 791 VELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQL 612
           + ++D+E   F+A+L F+YTD LP +              M+  L+AAA+R+ ++RL+ +
Sbjct: 245 IRVDDMEAQDFEALLHFIYTDSLPEMK-------GGDAVAMLPDLVAAANRYKMERLRLV 297

Query: 611 CEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLK 507
           CE KLCE VTV TVA  L+ A +H+C +L+  CL+
Sbjct: 298 CEDKLCEYVTVRTVAAMLAFAGEHQCPELEKKCLQ 332



>gb:AE016959_1022645 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752464
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 374

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 43/129 (33%), Positives = 68/129 (52%), Gaps = 14/129 (10%)
 Frame = -3

Query: 839 FKAQFFGLI---------GNPNTDKVELEDIEPSIFKAMLQFLYTDQLP-----NLHEXX 702
           F+A+ FG +          + +++ + ++D+E  +F A+L+F+YTD LP     +  +  
Sbjct: 210 FRAELFGAMREATAAAAASSSDSEAIRVDDMEAPVFSALLRFVYTDALPAPGGADDGQAA 269

Query: 701 XXXXXXXXXIMMQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLK 522
                     M QHLL AADR+ L RLK L E KL   +   + A+ L+L +QH C  LK
Sbjct: 270 GGGSYSEEAAMAQHLLVAADRYDLKRLKLLYEDKLRRHIEAASAASMLALVEQHHCRGLK 329

Query: 521 TICLKFAAT 495
             CL F ++
Sbjct: 330 EACLVFLSS 338



>gb:AE014297_1139472 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003702_1221465 Drosophila melanogaster
           chromosome 3R, section 40 of 118 of the complete
           sequence.>gb:AY121682_1301344 Drosophila melanogaster
           RE34508 full insert cDNA.
          Length = 374

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 42/116 (36%), Positives = 63/116 (54%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F   +     ++V + D++  + K ML+F+YT + PNL +            M   
Sbjct: 225 FAAMFEHEMEERKLNRVAITDVDHEVLKEMLRFIYTGKAPNLEK------------MADD 272

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           LLAAAD++ L++LK +CE  LC  ++V+T A TL LAD H   QLK   + F  T+
Sbjct: 273 LLAAADKYALEKLKVMCEEALCVNLSVETAAETLILADLHSADQLKAQTIDFINTH 328



>gb:AE014297_1139471 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003702_1221464 Drosophila melanogaster
           chromosome 3R, section 40 of 118 of the complete
           sequence.
          Length = 406

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 42/116 (36%), Positives = 63/116 (54%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F   +     ++V + D++  + K ML+F+YT + PNL +            M   
Sbjct: 257 FAAMFEHEMEERKLNRVAITDVDHEVLKEMLRFIYTGKAPNLEK------------MADD 304

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           LLAAAD++ L++LK +CE  LC  ++V+T A TL LAD H   QLK   + F  T+
Sbjct: 305 LLAAADKYALEKLKVMCEEALCVNLSVETAAETLILADLHSADQLKAQTIDFINTH 360



>gb:AE014297_1139469 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE014297_1139470 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE003702_1221462
           Drosophila melanogaster chromosome 3R, section 40 of 118
           of the complete sequence.>gb:AE003702_1221463 Drosophila
           melanogaster chromosome 3R, section 40 of 118 of the
           complete sequence.>gb:BT012443_1358105 Drosophila
           melanogaster RE74593 full insert cDNA.
          Length = 403

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 42/116 (36%), Positives = 63/116 (54%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F   +     ++V + D++  + K ML+F+YT + PNL +            M   
Sbjct: 254 FAAMFEHEMEERKLNRVAITDVDHEVLKEMLRFIYTGKAPNLEK------------MADD 301

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           LLAAAD++ L++LK +CE  LC  ++V+T A TL LAD H   QLK   + F  T+
Sbjct: 302 LLAAADKYALEKLKVMCEEALCVNLSVETAAETLILADLHSADQLKAQTIDFINTH 357



>gb:AF545858_2067959 Mus musculus TDPOZ1 (Tdpoz1) and TDPOZ2
           (Tdpoz2) genes, complete cds.
          Length = 364

 Score = 73.6 bits (179), Expect = 4e-12
 Identities = 41/116 (35%), Positives = 63/116 (54%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+A F   +     +  E+++++  +FK M+ F+YT + P LH             M   
Sbjct: 213 FRAMFEHQMEERLANCFEIQELDFQVFKEMMDFIYTGKAPTLHSHS----------MACD 262

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           +LAAAD++GL+ LK +CE  LC  ++V+  A TL +AD H   QLKT  L F A +
Sbjct: 263 VLAAADKYGLEGLKVICEDSLCRNLSVENAAHTLIVADLHSTEQLKTRALHFIAVH 318



>gb:AP005892_1859753 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OSJNBa0011D16.
          Length = 231

 Score = 73.6 bits (179), Expect = 4e-12
 Identities = 41/112 (36%), Positives = 58/112 (51%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           FK +  G +       V L +I+P+ FKA+L F+Y D L +                 + 
Sbjct: 85  FKTELLGSMAESAMPCVTLHNIDPATFKALLHFVYMDALLS-PTRGGASSTSTTTGFFKS 143

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           LL A D + L RLK +C  KL   V+V+TVATTL  A+ + C +LK+ CL F
Sbjct: 144 LLMAVDMYALKRLKLMCAQKLWGSVSVETVATTLGYAETYHCPELKSKCLSF 195



>gb:AP005410_1851312 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OSJNBa0038P10.>gb:AP005517_1853307 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBb0090H20.
          Length = 588

 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 37/100 (37%), Positives = 55/100 (55%)
 Frame = -3

Query: 791 VELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQL 612
           + ++D+ P +F A+L+++YTD LP                    LL AADR+G++RLK +
Sbjct: 218 IAIDDMRPDVFDALLRYIYTDALP------AAADDDDMEATWSDLLVAADRYGVERLKLI 271

Query: 611 CEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           CE  L   +    VA  L+LAD+  C  LK  C+KF AT+
Sbjct: 272 CERALRGRLDAGNVADMLALADRQHCETLKDACIKFMATS 311



 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 20/60 (33%), Positives = 36/60 (60%)
 Frame = -3

Query: 671 MMQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           +++HLL   DR+ ++ LK + E  LC+ +++  V    +L DQH C  LK +C +F  ++
Sbjct: 496 LIKHLLITVDRYAIEGLKTMLEDGLCKVLSLGNVKEMFALTDQHDCSILKDVCFEFITSS 555



>pir|S42384|S42384 Kruppel-like protein - Caenorhabditis elegans
          Length = 409

 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 39/116 (33%), Positives = 61/116 (52%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F   +   +T+   ++DIEP + + +L ++YT Q   + +            M Q 
Sbjct: 254 FSAMFEHHMQESDTNMTTVDDIEPEVMRELLVYMYTGQTKYIEQ------------MAQS 301

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           L+AAAD++ LDRLK +CE  LC ++T D  + TL LAD +   QL+   + F   N
Sbjct: 302 LIAAADKYQLDRLKVMCEQALCYQLTTDNASLTLMLADMYSASQLRAHSINFINVN 357



>sp|P34568|YNV5_CAEEL Hypothetical protein T16H12.5 in chromosome
           III.>gb:CET16H12_1367784 Caenorhabditis elegans cosmid
           T16H12, complete sequence.
          Length = 451

 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 39/116 (33%), Positives = 61/116 (52%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F   +   +T+   ++DIEP + + +L ++YT Q   + +            M Q 
Sbjct: 296 FSAMFEHHMQESDTNMTTVDDIEPEVMRELLVYMYTGQTKYIEQ------------MAQS 343

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           L+AAAD++ LDRLK +CE  LC ++T D  + TL LAD +   QL+   + F   N
Sbjct: 344 LIAAADKYQLDRLKVMCEQALCYQLTTDNASLTLMLADMYSASQLRAHSINFINVN 399



>gb:AE016959_1022648 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752467
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 368

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 40/123 (32%), Positives = 69/123 (56%), Gaps = 6/123 (4%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDK----VELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXI 672
           FKA+   L G P  D     ++++D++  +F+++L ++YTD LP                
Sbjct: 226 FKAEL--LAGVPAKDGGGAVIQIDDMDAEVFRSLLHYMYTDSLPP-----EKGTTREEAA 278

Query: 671 MMQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF--AA 498
           M Q+++ AADR+ ++ LK +CE +L + +   +VAT L+ AD+H C  L+  C +F  + 
Sbjct: 279 MAQNMIVAADRYSMETLKLMCEDRLRKHIGASSVATMLTFADRHHCHGLRAACTEFLSSP 338

Query: 497 TNL 489
           TNL
Sbjct: 339 TNL 341



>gb:OSJN00005_1693161 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0084A10, complete
           sequence.>gb:OSJN00050_1693895 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0088K19, complete
           sequence.
          Length = 368

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 39/114 (34%), Positives = 63/114 (55%), Gaps = 2/114 (1%)
 Frame = -3

Query: 839 FKAQFFGLI--GNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMM 666
           F+   FG    G  +  +V ++ ++   F+A+L ++YTD LP +              M+
Sbjct: 221 FRVALFGATTGGADDVVRVNIDAMKVQDFEALLHYMYTDSLPEMK-------GGEAAAML 273

Query: 665 QHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
             L+AAA+R+ ++RL+ +CE KLCE V   TV   L+ A +H+C  LK  CL+F
Sbjct: 274 PDLVAAANRYKMERLRLVCEHKLCEYVNGRTVVAMLAFAGEHQCNGLKEKCLRF 327



>gb:AP004761_1844589 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0686C03.
          Length = 304

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 42/111 (37%), Positives = 57/111 (51%), Gaps = 1/111 (0%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYT-DQLPNLHEXXXXXXXXXXXIMMQ 663
           FKA             + L DI+P++F+A+L F+YT D LP                 + 
Sbjct: 171 FKALLLSSTAEAAACSITLNDIKPAMFEALLHFMYTGDFLPAGAHSSSPDSSDTNTDTLH 230

Query: 662 HLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICL 510
            LLAAA  + LDRLK +C  KL E ++V+TVA TL  A    C +LK+ CL
Sbjct: 231 RLLAAAHEYKLDRLKLMCARKLEESLSVETVARTLGYAKMCGCSELKSKCL 281



>gb:AP004591_1841999 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0582D05.
          Length = 370

 Score = 69.3 bits (168), Expect = 8e-11
 Identities = 34/97 (35%), Positives = 57/97 (58%)
 Frame = -3

Query: 794 KVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQ 615
           ++ ++D++PS+F+A L F+YTD +P + +            +M HLL A DR+GL+RL+ 
Sbjct: 238 EITIQDMQPSVFEAFLYFIYTDCVPRMDDLGNGEKMH----LMMHLLKAGDRYGLERLRI 293

Query: 614 LCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           +CE  L   +  + V+  L LAD     +LK  C++F
Sbjct: 294 MCERFLATNLDTEHVSAILGLADLLDLKKLKEACMEF 330



>gb:AE016959_1022701 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752520
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 401

 Score = 69.3 bits (168), Expect = 8e-11
 Identities = 41/137 (29%), Positives = 62/137 (45%), Gaps = 21/137 (15%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKV-ELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXX---- 675
           F A+ FG +       V  ++D++  +F+ +L F+YTD+LP   +               
Sbjct: 227 FDAELFGPMKEGTAASVVRIDDMDADLFRGLLSFIYTDELPEREDHGGEKETSSDDDDDD 286

Query: 674 ----------------IMMQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQ 543
                             +Q L+ AADR+ L RLK LCE ++ + +   TV T L LAD 
Sbjct: 287 DDDDNGAQSDQKHKQFTWLQQLIVAADRYDLQRLKLLCEEEMYDHIGEKTVETMLILADH 346

Query: 542 HRCLQLKTICLKFAATN 492
           H C  LK  CL F  ++
Sbjct: 347 HHCRVLKDACLGFLGSH 363



>gb:AE016959_1022697 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752516
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 156

 Score = 69.3 bits (168), Expect = 8e-11
 Identities = 44/129 (34%), Positives = 56/129 (43%), Gaps = 31/129 (24%)
 Frame = -3

Query: 776 IEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXI------------------------- 672
           +EP +FK++L F+YTD LP L +                                     
Sbjct: 1   MEPQVFKSLLTFIYTDSLPELEDEEETESDRDEEEDQESEADGVHGEDYDDDDDDDDDDN 60

Query: 671 ----MMQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
               M   LL AADR+ L RLK +C  KLCE +   TVA  L LA++  C  LK  CL+F
Sbjct: 61  GGDEMWSPLLVAADRYDLQRLKLICAKKLCERIDASTVADNLGLAEKQHCRLLKEACLEF 120

Query: 503 --AATNLGV 483
             A  NL V
Sbjct: 121 LKAPANLKV 129



>gb:AF545858_2067958 Mus musculus TDPOZ1 (Tdpoz1) and TDPOZ2
           (Tdpoz2) genes, complete cds.
          Length = 365

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 40/114 (35%), Positives = 58/114 (50%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+A F   +       +++ ++ P +FK M+ F+YT + P+LH             M   
Sbjct: 213 FRAMFEHEMKESLKTPIKIHNLNPQVFKEMMGFIYTGKAPHLHSHS----------MACD 262

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAA 498
           +L AAD++GL  LK LCE  LC  ++V     TL LAD H   +LKT  L F A
Sbjct: 263 VLPAADKYGLVSLKVLCEDALCRNLSVKNATHTLILADLHSTEKLKTQALDFIA 316



>gb:AF290198_2061696 Mus musculus TDPOZ1 (Tdpoz1) mRNA, complete
           cds.
          Length = 361

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 40/114 (35%), Positives = 58/114 (50%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+A F   +       +++ ++ P +FK M+ F+YT + P+LH             M   
Sbjct: 209 FRAMFEHEMKESLKTPIKIHNLNPQVFKEMMGFIYTGKAPHLHSHS----------MACD 258

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAA 498
           +L AAD++GL  LK LCE  LC  ++V     TL LAD H   +LKT  L F A
Sbjct: 259 VLPAADKYGLVSLKVLCEDALCRNLSVKNATHTLILADLHSTEKLKTQALDFIA 312



>gb:AK033449_1163340 Mus musculus adult male colon cDNA, RIKEN
           full-length enriched library, clone:9030207F01
           product:POZ 56 PROTEIN homolog [Mus musculus], full
           insert sequence.
          Length = 365

 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 39/114 (34%), Positives = 56/114 (49%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+A F   +       +++ ++ P +FK M+ F+YT + P LH             M   
Sbjct: 213 FRAMFEHEMKESLKTPIKIHNLNPQVFKEMMSFIYTGKAPYLHSHS----------MACD 262

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAA 498
           +L AAD++GL  LK LCE   C  ++V     TL LAD H   +LKT  L F A
Sbjct: 263 VLPAADKYGLVSLKVLCEDAFCRNLSVKNATHTLILADLHSTEKLKTQALDFIA 316



>gb:AE016959_1022696 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752515
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 119

 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 33/70 (47%), Positives = 45/70 (64%)
 Frame = -3

Query: 800 TDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRL 621
           T  V ++D+E  +FKA+L+F+YTD LP + E            M QHLL AADR+ L+RL
Sbjct: 54  TGVVCVQDMEAQVFKALLRFMYTDSLPKMEEEEGV--------MCQHLLVAADRYNLERL 105

Query: 620 KQLCEAKLCE 591
           K +CE KLC+
Sbjct: 106 KLICEEKLCK 115



>gb:AF506823_2067193 Mus musculus MAPP2 gene, complete cds.
          Length = 365

 Score = 65.9 bits (159), Expect = 9e-10
 Identities = 39/114 (34%), Positives = 56/114 (49%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+A F   +       +++ ++ P +FK M+ F+YT + P LH             M   
Sbjct: 213 FRAMFEHEMKESLKTPIKIHNLNPQVFKEMMGFIYTGKAPYLHSHS----------MACD 262

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAA 498
           +L AAD++GL  LK LCE   C  ++V     TL LAD H   +LKT  L F A
Sbjct: 263 VLPAADKYGLVSLKVLCEDAFCRNLSVKNATHTLILADLHSTEKLKTQALDFIA 316



>gb:AX886908_1482361 Sequence 2771 from Patent EP1033401.
          Length = 97

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 35/83 (42%), Positives = 49/83 (59%)
 Frame = -3

Query: 752 MLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQLCEAKLCEEVTVDT 573
           M++F+YT + PNL +            M  +LLAAAD++ L+RLK +CE  LC  ++V+ 
Sbjct: 1   MMRFIYTGRAPNLDK------------MADNLLAAADKYALERLKVMCEEALCSNLSVEN 48

Query: 572 VATTLSLADQHRCLQLKTICLKF 504
           VA TL LAD H   QLK   + F
Sbjct: 49  VADTLVLADLHSAEQLKAQAIDF 71



>gb:AP004553_1841465 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1790_D02.>gb:AP005491_1852787 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBa0062G05.
          Length = 419

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 39/101 (38%), Positives = 52/101 (51%)
 Frame = -3

Query: 800 TDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRL 621
           T  + ++D+EP  F AML+F Y D LP L              M QHLLAAAD + +D L
Sbjct: 239 TTTITIDDMEPDAFAAMLRFAYDDTLPELP--GNSERDATGVHMAQHLLAAADLYRMDAL 296

Query: 620 KQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAA 498
            Q C+ +L   VT  T A T +LAD+     LK   ++  A
Sbjct: 297 SQACQDRLARCVTPATAADTYALADRLGLRLLKAAVVRDVA 337



>gb:AE016959_1022676 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017096_1752495
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 50 of 77 of the complete sequence.
          Length = 349

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 29/54 (53%), Positives = 35/54 (64%)
 Frame = -3

Query: 665 QHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           +HLL AADR+ L RLK +CE +LC  + V TV   L+LADQH C  LK  C  F
Sbjct: 78  RHLLVAADRYNLQRLKLICEERLCRYIAVGTVGNILALADQHHCAGLKKACFHF 131



>gb:AF545857_2067957 Mus musculus TDPOZ3 (Tdpoz3) gene, complete
           cds.
          Length = 365

 Score = 63.9 bits (154), Expect = 4e-09
 Identities = 39/114 (34%), Positives = 60/114 (52%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+A F   +     + +E+ D++  +FK M+ F+YT + P+LH             M   
Sbjct: 213 FRAMFEHEMKESLKNPIEIMDLDLDVFKEMMGFIYTGKAPHLHSHS----------MACD 262

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAA 498
           +L AAD++GL  LK LCE  LC  ++V   A TL LA+ +   +LK+  L F A
Sbjct: 263 VLPAADKYGLVGLKVLCEDVLCRNLSVKNAAHTLILAELNSTEKLKSQALDFIA 316



>gb:AP005554_1853983 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OJ1118_A10.
          Length = 383

 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 35/104 (33%), Positives = 57/104 (54%), Gaps = 5/104 (4%)
 Frame = -3

Query: 800 TDKVELEDIEPSIFKAMLQFLYTDQLP-----NLHEXXXXXXXXXXXIMMQHLLAAADRF 636
           T  V ++ I  + FK ML ++Y +QLP     +  +             +Q LL AAD +
Sbjct: 227 TAVVTIDGISATTFKHMLHYIYCNQLPPPATGDGDDDDGEADHVTRIAELQRLLVAADAY 286

Query: 635 GLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           G++ L+Q CE  LC  + +DTVA+TL+L ++    +L+  CL+F
Sbjct: 287 GVEALRQACEDTLCAGINMDTVASTLALTEKGSYPKLRGSCLEF 330



>gb:AP005517_1853298 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OSJNBb0090H20.
          Length = 215

 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 36/92 (39%), Positives = 49/92 (53%), Gaps = 6/92 (6%)
 Frame = -3

Query: 662 HLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAA----- 498
           +LL AAD +GL+RLK +CE KLC ++ V +V   L LADQH+C  LK  C  F A     
Sbjct: 124 NLLRAADCYGLERLKAICETKLCLDIDVKSVMVILLLADQHQCDMLKQACFSFIANPNTL 183

Query: 497 -TNLGV*RVQALGRELPLTVV*AVGNSCINRR 405
            T  G           P+ ++  + N CI R+
Sbjct: 184 ETVTGTPEYHQFKSLYPILLIEVLENVCILRK 215



>gb:AE016959_1022702 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AE017096_1752521 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 50 of 77
            of the complete sequence.
          Length = 1708

 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 37/117 (31%), Positives = 59/117 (50%), Gaps = 1/117 (0%)
 Frame = -3

Query: 839  FKAQFFG-LIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQ 663
            F+A+ FG +        V +ED++  +F+ +L F+YTD+L                    
Sbjct: 1544 FEAELFGPMREGAAASVVRIEDMDAEVFRGLLSFIYTDKLT------------------- 1584

Query: 662  HLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
                AADR+ L RLK LCE ++ + ++  TV + L LA+ H C  LK  CL F +++
Sbjct: 1585 ---VAADRYDLQRLKLLCEEEMYDYISERTVESMLILAEHHHCRVLKDACLDFLSSH 1638



>gb:AE016959_1022731 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017097_1752550
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 51 of 77 of the complete sequence.
          Length = 102

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 31/72 (43%), Positives = 44/72 (61%)
 Frame = -3

Query: 671 MMQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           M QHLLAAAD++GL RLK +C   L   +  ++VAT L LA++H C  LK  C +F  + 
Sbjct: 1   MAQHLLAAADKYGLHRLKMICLEILSSHIDANSVATILVLAEKHYCYGLKEACFEFLNSL 60

Query: 491 LGV*RVQALGRE 456
             +  + A G+E
Sbjct: 61  AVLSAIAARGKE 72



>gb:OSJN00056_1694017 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0015K02, complete
           sequence.>gb:OSJN00153_1695788 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0011F23, complete
           sequence.>gb:AF480497_1803764 Oryza sativa clone BAC
           24K23, complete sequence.
          Length = 353

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 32/110 (29%), Positives = 53/110 (48%), Gaps = 1/110 (0%)
 Frame = -3

Query: 839 FKAQFFGLIGNP-NTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQ 663
           F+   +G +GN  ++  + L ++ P  F A+L ++Y D LP                M +
Sbjct: 234 FRKLLYGQVGNEASSPAIRLREMSPEAFGAVLHYVYHDSLPP-----EANKGRNAAAMAR 288

Query: 662 HLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTIC 513
            +  AAD + ++RLK +C + LC  +  DT +  + LA  H C  LK  C
Sbjct: 289 EVFEAADMYAMERLKLMCASNLCRFIGDDTASGIMELAKAHSCDPLKKAC 338



>gb:AC132492_1741209 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0605G01, complete sequence.
          Length = 752

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 31/112 (27%), Positives = 57/112 (50%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+A F G     +   +E+ +I  ++F+ M++F+YT  +                 + Q 
Sbjct: 611 FRAMFDGGYREKDARDIEIPNIRWNVFELMMRFIYTGSVE------------VTSDISQD 658

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           LL AAD++ L+ LK+LCE  + ++V VD V+    L++    + L+  C+ F
Sbjct: 659 LLRAADQYLLEGLKRLCEYTIAQDVNVDNVSDMYDLSEAFHAMSLRHTCVLF 710



>gb:AY074524_1567570 Arabidopsis thaliana unknown protein
           (At5g13060) mRNA, partial cds.
          Length = 736

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 31/112 (27%), Positives = 54/112 (48%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+A F GL    N   VE+ +I   +F+ M++F+Y+ ++                 + + 
Sbjct: 592 FRAMFDGLYKERNAQNVEIPNIRWEVFELMMKFIYSGRI------------NIAKHLAKD 639

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           LL AAD++ L+ LK+ CE  + +E+ +D +     LAD      L+  C  F
Sbjct: 640 LLVAADQYLLEGLKRQCEYTIAQEICLDNIPEMYELADTFNASALRRACTLF 691



>gb:ATT19L5_1554837 Arabidopsis thaliana DNA chromosome 5, BAC clone
           T19L5 (ESSA project).
          Length = 706

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 31/112 (27%), Positives = 54/112 (48%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+A F GL    N   VE+ +I   +F+ M++F+Y+ ++                 + + 
Sbjct: 562 FRAMFDGLYKERNAQNVEIPNIRWEVFELMMKFIYSGRI------------NIAKHLAKD 609

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           LL AAD++ L+ LK+ CE  + +E+ +D +     LAD      L+  C  F
Sbjct: 610 LLVAADQYLLEGLKRQCEYTIAQEICLDNIPEMYELADTFNASALRRACTLF 661



>gb:BT010306_1357597 Drosophila melanogaster GH01369 full insert cDNA.
          Length = 1062

 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 34/118 (28%), Positives = 58/118 (49%)
 Frame = -3

Query: 794  KVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQ 615
            KV + D  P IF+ +L +LY   +                  +  L+  ADR+ +D LK+
Sbjct: 905  KVIITDTSPVIFRRLLLYLYGAPIDR----------TVGAEQVCELMLLADRYSIDDLKE 954

Query: 614  LCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNLGV*RVQALGRELPLTV 441
            LCE  L   +  D+V   L +AD++    LK+ CL F + +  + + + + +ELP T+
Sbjct: 955  LCENTLYSLIDEDSVVCLLGIADRYMATALKSKCLSFLSQHAQLTKCE-IFKELPQTL 1011



>gb:AE014298_1126353 Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE003510_1213362 Drosophila melanogaster
            chromosome X, section 62 of 74 of the complete sequence.
          Length = 1038

 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 34/118 (28%), Positives = 58/118 (49%)
 Frame = -3

Query: 794  KVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQ 615
            KV + D  P IF+ +L +LY   +                  +  L+  ADR+ +D LK+
Sbjct: 881  KVIITDTSPVIFRRLLLYLYGAPIDR----------TVGAEQVCELMLLADRYSIDDLKE 930

Query: 614  LCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNLGV*RVQALGRELPLTV 441
            LCE  L   +  D+V   L +AD++    LK+ CL F + +  + + + + +ELP T+
Sbjct: 931  LCENTLYSLIDEDSVVCLLGIADRYMATALKSKCLSFLSQHAQLTKCE-IFKELPQTL 987



>gb:AF527809_1808459 Sorghum bicolor clone BAC SB_BBc0234M12
           php200725 orthologous region.
          Length = 417

 Score = 52.8 bits (125), Expect = 8e-06
 Identities = 34/91 (37%), Positives = 46/91 (50%), Gaps = 13/91 (14%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDK-------------VELEDIEPSIFKAMLQFLYTDQLPNLHEXXX 699
           FKA+   L+G P  DK             + + DIEPS+F+A+L F+YTD LP       
Sbjct: 237 FKAE---LLGGPTDDKDAPPPTTSTTSRRLRIHDIEPSVFRAVLHFIYTDSLP------P 287

Query: 698 XXXXXXXXIMMQHLLAAADRFGLDRLKQLCE 606
                   +M Q LL AA R+ L+ LK +CE
Sbjct: 288 EIGAGDEMVMAQQLLVAAQRYKLEGLKWICE 318



>gb:AF527809_1808463 Sorghum bicolor clone BAC SB_BBc0234M12
           php200725 orthologous region.
          Length = 218

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 25/52 (48%), Positives = 35/52 (67%)
 Frame = -3

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           ++ AAD++GL       E++LC  + + TVATTLSLAD+H C  LK  C+KF
Sbjct: 138 VIVAADKYGL-------ESRLCSHIELKTVATTLSLADRHGCSSLKEACVKF 182



>gb:BC070653_2555628 Xenopus laevis hypothetical protein MGC82217,
            mRNA (cDNA clone MGC:82217 IMAGE:4030478), complete cds.
          Length = 1339

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 27/97 (27%), Positives = 48/97 (49%)
 Frame = -3

Query: 776  IEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQLCEAKL 597
            I   + + +L ++YTD++  + E             + ++L  AD+  + RLK++CE  +
Sbjct: 805  IHSDVLQVILDYIYTDEVLTVKESANVE-------FVCNVLVIADQLLIVRLKEICEVTI 857

Query: 596  CEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNLG 486
             E +T+   A  L  A  +   QLK  CL+F   N+G
Sbjct: 858  AERITLKNAAELLEFAALYNADQLKLSCLQFVGLNMG 894



>gb:HSDJ93K22_2012563 Human DNA sequence from clone RP1-93K22 on
            chromosome 6q14.1-15.3 Contains the gene for a novel
            BTB/POZ domain containing protein (KIAA1417) and a CpG
            island, complete sequence.
          Length = 1187

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 30/96 (31%), Positives = 46/96 (47%)
 Frame = -3

Query: 776  IEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQLCEAKL 597
            I   I K +L +LYTD+   + E             +  +L  AD+  + RLK++CE  L
Sbjct: 811  IHSDILKVILDYLYTDEAVVIKESQNVD-------FICSVLVVADQLLITRLKEICEVAL 863

Query: 596  CEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNL 489
             E++T+   A  L  A  +   QLK  CL+F   N+
Sbjct: 864  TEKLTLKNAAMLLEFAAMYSAKQLKLSCLQFIGLNM 899



>gb:HSDJ93K22_2012562 Human DNA sequence from clone RP1-93K22 on
            chromosome 6q14.1-15.3 Contains the gene for a novel
            BTB/POZ domain containing protein (KIAA1417) and a CpG
            island, complete sequence.
          Length = 1191

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 30/96 (31%), Positives = 46/96 (47%)
 Frame = -3

Query: 776  IEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQLCEAKL 597
            I   I K +L +LYTD+   + E             +  +L  AD+  + RLK++CE  L
Sbjct: 815  IHSDILKVILDYLYTDEAVVIKESQNVD-------FICSVLVVADQLLITRLKEICEVAL 867

Query: 596  CEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNL 489
             E++T+   A  L  A  +   QLK  CL+F   N+
Sbjct: 868  TEKLTLKNAAMLLEFAAMYSAKQLKLSCLQFIGLNM 903



>gb:AB037838_1866629 Homo sapiens mRNA for KIAA1417 protein, partial
            cds.
          Length = 1379

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 30/96 (31%), Positives = 46/96 (47%)
 Frame = -3

Query: 776  IEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQLCEAKL 597
            I   I K +L +LYTD+   + E             +  +L  AD+  + RLK++CE  L
Sbjct: 841  IHSDILKVILDYLYTDEAVVIKESQNVD-------FICSVLVVADQLLITRLKEICEVAL 893

Query: 596  CEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNL 489
             E++T+   A  L  A  +   QLK  CL+F   N+
Sbjct: 894  TEKLTLKNAAMLLEFAAMYSAKQLKLSCLQFIGLNM 929



>gb:AP004183_1838647 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1221_H04.>gb:AP004751_1844379 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0494D11.
          Length = 130

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 24/44 (54%), Positives = 34/44 (77%)
 Frame = -3

Query: 671 MMQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQH 540
           M++HLL AADR+ +DRLK +C+  L + + VD VATTL+LA+ H
Sbjct: 73  MIRHLLVAADRYAMDRLKLICQHILGKSLHVDNVATTLALANVH 116



>gb:AK129353_2069584 Mus musculus mRNA for mKIAA1417 protein.
          Length = 1167

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 30/96 (31%), Positives = 46/96 (47%)
 Frame = -3

Query: 776 IEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQLCEAKL 597
           I+  I K +L +LYTD+   + E             +  +L  AD+  + RLK++CE  L
Sbjct: 631 IQSEILKVILDYLYTDEAVVIKESQNVD-------FVCSVLVVADQLLITRLKEICEVAL 683

Query: 596 CEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNL 489
            E +T+   A  L  A  +   QLK  CL+F   N+
Sbjct: 684 TENLTLKNAAMLLEFAALYNAGQLKLSCLQFIGLNM 719



>gb:AP003865_1834522 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1081_B12.>gb:AP003887_1834851 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1186_G01.
          Length = 320

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 32/85 (37%), Positives = 43/85 (50%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+AQ  G +       V L DIEP+ FKA+L F+YTD LP L              +++ 
Sbjct: 191 FRAQLLGSMAEATMPCVTLHDIEPATFKALLHFVYTDVLPPL---------LGTSDLLEP 241

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEV 585
           LLAAA+R G +    LC    C E+
Sbjct: 242 LLAAANRDGCND-SDLCRVYNCPEL 265



>gb:BC068656_2555160 Xenopus laevis hypothetical protein MGC81035,
           mRNA (cDNA clone MGC:81035 IMAGE:6315914), complete cds.
          Length = 530

 Score = 49.3 bits (116), Expect = 9e-05
 Identities = 32/117 (27%), Positives = 53/117 (45%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+  F       N D +E++    S+++A L++LYTD +    E                
Sbjct: 394 FRTMFQSHWNENNKDIIEIDQFSYSVYRAFLEYLYTDIVDLPPEDAIG------------ 441

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNL 489
           LL  A  +  DRLK+LC+  +   +TVD     LS A ++    L+  C +F+  +L
Sbjct: 442 LLDLATSYCEDRLKKLCQDIIKRGITVDNAFLLLSAAVRYEAEDLEEFCFRFSVNHL 498



>gb:AP004591_1842000 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0582D05.
          Length = 300

 Score = 49.3 bits (116), Expect = 9e-05
 Identities = 26/72 (36%), Positives = 36/72 (50%)
 Frame = -3

Query: 761 FKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQLCEAKLCEEVT 582
           F A+L F YTD LP                ++  LL AA R+G+ RL  +CE  +C  + 
Sbjct: 227 FGALLHFAYTDTLP----VASGLDGAGHTALLGRLLVAAGRYGMARLGAICERAMCRSLD 282

Query: 581 VDTVATTLSLAD 546
             T A TL++AD
Sbjct: 283 AGTAADTLAMAD 294



>gb:AP003633_1831842 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0637D03.>gb:AP003635_1831891 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0686E06.
          Length = 263

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 24/62 (38%), Positives = 34/62 (54%)
 Frame = -3

Query: 782 EDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQLCEA 603
           +D+   +F+A+L F+YTD L  L              M+  L  AA R+GL+RLKQ+CE 
Sbjct: 189 DDMRAGVFRALLHFIYTDTLMELDWREDGSDPLLPRTMVMSLNEAAGRYGLERLKQICEN 248

Query: 602 KL 597
            L
Sbjct: 249 ML 250



>gb:AY085216_1570289 Arabidopsis thaliana clone 1391 mRNA, complete
           sequence.>gb:AK175155_1817143 Arabidopsis thaliana mRNA,
           complete cds, clone: RAFL21-57-H16.>gb:AK176077_1818065
           Arabidopsis thaliana mRNA, complete cds, clone:
           RAFL22-82-P12.>gb:AK176544_1818532 Arabidopsis thaliana
           mRNA, complete cds, clone: RAFL25-06-F11.
          Length = 809

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 31/110 (28%), Positives = 52/110 (47%), Gaps = 1/110 (0%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F   F   +   ++  + L D+ P  FKAM+ F+Y+ +L N+ +             + H
Sbjct: 378 FAKMFTNGMSESHSSTIYLTDVSPEAFKAMMNFMYSGEL-NMEDTVNFGTE------LIH 430

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQ-HRCLQLKTIC 513
           LL  ADRFG+  L Q C   L E ++ D+V + L +      C  ++ +C
Sbjct: 431 LLFLADRFGVVPLHQECCKMLLECLSEDSVCSVLQVVSSISSCKLIEEMC 480



>pir|D84710|D84710 hypothetical protein At2g30600 [imported] -
           Arabidopsis thaliana>gb:U93215_1726545 Arabidopsis
           thaliana chromosome 2 BAC T6B20 genomic sequence,
           complete sequence.
          Length = 586

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 31/110 (28%), Positives = 52/110 (47%), Gaps = 1/110 (0%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F   F   +   ++  + L D+ P  FKAM+ F+Y+ +L N+ +             + H
Sbjct: 378 FAKMFTNGMSESHSSTIYLTDVSPEAFKAMMNFMYSGEL-NMEDTVNFGTE------LIH 430

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQ-HRCLQLKTIC 513
           LL  ADRFG+  L Q C   L E ++ D+V + L +      C  ++ +C
Sbjct: 431 LLFLADRFGVVPLHQECCKMLLECLSEDSVCSVLQVVSSISSCKLIEEMC 480



>gb:YLI575660_1727987 Yarrowia lipolytica iah1, mts1, stl1, sip3,
            coq6, cdc37, aep2, tRNA-Gly, tRNA-Thr and 5S rRNA genes
            and ORF1, ORF2, ORFX, ORF6, ORF7, ORF12, ORF13, ORF15,
            ORFY, ORF18 and retrotransposon Ylt1.
          Length = 1456

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 30/102 (29%), Positives = 46/102 (45%), Gaps = 1/102 (0%)
 Frame = -3

Query: 791  VELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXX-IMMQHLLAAADRFGLDRLKQ 615
            V+L  +  +  +  L+F+YT  L +L +              +  LL+ AD   L  LK+
Sbjct: 778  VDLCHLPAASVRLCLRFMYTHNLDSLFDQVSSKVSSKDFIATVSQLLSTADELLLTPLKE 837

Query: 614  LCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNL 489
             CE  L E VTV   A+ L LA  + C +L T    +   N+
Sbjct: 838  FCELILSELVTVKNAASLLFLASAYNCDKLMTFMFSYICVNM 879



>gb:CR382127_1659907 Yarrowia lipolytica chromosome A of strain CLIB99
            of Yarrowia lipolytica.
          Length = 1456

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 30/102 (29%), Positives = 46/102 (45%), Gaps = 1/102 (0%)
 Frame = -3

Query: 791  VELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXX-IMMQHLLAAADRFGLDRLKQ 615
            V+L  +  +  +  L+F+YT  L +L +              +  LL+ AD   L  LK+
Sbjct: 778  VDLCHLPAASVRLCLRFMYTHNLDSLFDQVSSKVSSKDFIATVSQLLSTADELLLTPLKE 837

Query: 614  LCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNL 489
             CE  L E VTV   A+ L LA  + C +L T    +   N+
Sbjct: 838  FCELILSELVTVKNAASLLFLASAYNCDKLMTFMFSYICVNM 879



>gb:BC084809_2564054 Xenopus laevis hypothetical LOC495346, mRNA
           (cDNA clone MGC:84757 IMAGE:6950298), complete cds.
          Length = 615

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 31/112 (27%), Positives = 48/112 (42%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+A F G +   + D+VEL D+   I   +L F YT ++    E             ++ 
Sbjct: 71  FRAMFAGRLRESHADRVELHDVSGPILSLLLDFCYTGRVTVTLEN------------VEP 118

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           LL AAD F    +KQ C A L +++ V         A+ + C  L     +F
Sbjct: 119 LLQAADLFQFPSVKQACCAYLEQQLDVSNCLEIQDFAEAYACQGLAESTKRF 170



>gb:BC068834_2555332 Xenopus laevis hypothetical protein LOC398469,
           mRNA (cDNA clone MGC:81476 IMAGE:6636477), complete cds.
          Length = 530

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 29/117 (24%), Positives = 50/117 (42%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+  F       + D + ++     +++A L++LYTD +    E                
Sbjct: 394 FRTMFQSHWNENSKDVIGIDQFSYPVYRAFLEYLYTDNVDLAPEDAIG------------ 441

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNL 489
           LL  A  +  DRLK+LC+  +   +TVD     LS A ++    L+  C +F   +L
Sbjct: 442 LLDLATSYCEDRLKKLCQDIIKRGITVDNAFLLLSAAVRYEAEDLEEFCFRFCVNHL 498



>gb:BC043960_2548372 Xenopus laevis hypothetical protein LOC398469,
           mRNA (cDNA clone IMAGE:5571253), partial cds.
          Length = 589

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 28/117 (23%), Positives = 50/117 (42%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+  F       + D + ++     +++A L++LYTD +    E                
Sbjct: 453 FRTMFQSHWNENSKDVIGIDQFSYPVYRAFLEYLYTDNVDLAPEDAIG------------ 500

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNL 489
           LL  A  +  DRLK+LC+  +   ++VD     LS A ++    L+  C +F   +L
Sbjct: 501 LLDLATSYCEDRLKKLCQDIIKRGISVDNAFLLLSAAVRYEAEDLEEFCFRFCVNHL 557



>gb:BC045877_2549395 Danio rerio zgc:56037, mRNA (cDNA clone
           MGC:56037 IMAGE:3820088), complete cds.
          Length = 531

 Score = 42.4 bits (98), Expect = 0.011
 Identities = 28/117 (23%), Positives = 52/117 (44%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F++ F         + +E++     ++++ L+FLYTD +    E                
Sbjct: 395 FRSMFQSHWNEDMKEVIEIDQFSYPVYRSFLEFLYTDSVDLPPEDAIG------------ 442

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNL 489
           LL  A  +  +RLK+LC+  +   +TV+   + LS A ++    L+  C KF   +L
Sbjct: 443 LLDLATSYCENRLKKLCQHIIKRGITVENAFSLLSAAIRYDAEDLEEFCFKFCVNHL 499



>gb:BC044119_2548511 Xenopus laevis chromosome condensation 1-like,
           mRNA (cDNA clone MGC:53589 IMAGE:4683721), complete cds.
          Length = 526

 Score = 42.4 bits (98), Expect = 0.011
 Identities = 27/115 (23%), Positives = 49/115 (42%)
 Frame = -3

Query: 827 FFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAA 648
           F  L+     + +E+      +++A L+FLYTD +    E                LL  
Sbjct: 394 FRSLLHESEEEIIEMNQFSYPVYRAFLEFLYTDNISISPEDAIG------------LLEL 441

Query: 647 ADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNLGV 483
           A  +  +RLKQLC+  + + +  +     LS A ++    L+  C +F   ++ V
Sbjct: 442 ATIYRENRLKQLCQQTIKQGICEENAVVLLSAAVKYDAQDLEEYCFRFCVNHMTV 496



>gb:U13072_1401819 Caenorhabditis elegans cosmid C07D10, complete
           sequence.
          Length = 390

 Score = 42.4 bits (98), Expect = 0.011
 Identities = 28/120 (23%), Positives = 53/120 (44%), Gaps = 5/120 (4%)
 Frame = -3

Query: 836 KAQFFGLIGNPNTDKVE-----LEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXI 672
           ++  F  +  P+T + +     L DI+  + +A+L ++YT    N+              
Sbjct: 224 RSPVFAAMMEPHTAEAQNSRAILRDIDYEVVQAILYYIYTGTCTNMGGNALD-------- 275

Query: 671 MMQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
               +LAAA+RF L  LK + E  +   +  +TV   L+ A+ +  +  K   +K+   N
Sbjct: 276 ----ILAAAERFALPGLKNIAEVAMRNGLATETVCKNLAFAEMYGLVDFKKEAIKYICMN 331



>gb:U13072_1401818 Caenorhabditis elegans cosmid C07D10, complete
           sequence.
          Length = 397

 Score = 42.4 bits (98), Expect = 0.011
 Identities = 28/120 (23%), Positives = 53/120 (44%), Gaps = 5/120 (4%)
 Frame = -3

Query: 836 KAQFFGLIGNPNTDKVE-----LEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXI 672
           ++  F  +  P+T + +     L DI+  + +A+L ++YT    N+              
Sbjct: 231 RSPVFAAMMEPHTAEAQNSRAILRDIDYEVVQAILYYIYTGTCTNMGGNALD-------- 282

Query: 671 MMQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
               +LAAA+RF L  LK + E  +   +  +TV   L+ A+ +  +  K   +K+   N
Sbjct: 283 ----ILAAAERFALPGLKNIAEVAMRNGLATETVCKNLAFAEMYGLVDFKKEAIKYICMN 338



>gb:AC116956_1206565 Dictyostelium discoideum chromosome 2 map
           1418423-1684967 strain AX4, complete sequence.
          Length = 613

 Score = 42.4 bits (98), Expect = 0.011
 Identities = 20/56 (35%), Positives = 31/56 (55%)
 Frame = -3

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           +L  +D + + RLK +CEAK  E +  +TV      AD  +  +L+ +CL F A N
Sbjct: 516 ILYLSDLYCVPRLKTICEAKATEGIDCETVVQIFKEADSFKLAKLRKLCLNFIARN 571



>pir|T15442|T15442 hypothetical protein C07D10.2 - Caenorhabditis
           elegans
          Length = 410

 Score = 42.4 bits (98), Expect = 0.011
 Identities = 28/120 (23%), Positives = 53/120 (44%), Gaps = 5/120 (4%)
 Frame = -3

Query: 836 KAQFFGLIGNPNTDKVE-----LEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXI 672
           ++  F  +  P+T + +     L DI+  + +A+L ++YT    N+              
Sbjct: 244 RSPVFAAMMEPHTAEAQNSRAILRDIDYEVVQAILYYIYTGTCTNMGGNALD-------- 295

Query: 671 MMQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
               +LAAA+RF L  LK + E  +   +  +TV   L+ A+ +  +  K   +K+   N
Sbjct: 296 ----ILAAAERFALPGLKNIAEVAMRNGLATETVCKNLAFAEMYGLVDFKKEAIKYICMN 351



>gb:BC067005_2105900 Mus musculus regulator of chromosome
           condensation (RCC1) and BTB (POZ) domain containing
           protein 1, mRNA (cDNA clone MGC:92977 IMAGE:5721370),
           complete cds.
          Length = 531

 Score = 42.0 bits (97), Expect = 0.014
 Identities = 28/117 (23%), Positives = 51/117 (43%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F++ F         + +E++     +++A LQ+LYTD +    E                
Sbjct: 395 FRSMFQSYWNEDMKEVIEIDQFSYPVYRAFLQYLYTDTVDLPPEDAIG------------ 442

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNL 489
           LL  A  +  +RLK+LC+  +   +TV+   +  S A ++    L+  C KF   +L
Sbjct: 443 LLDLATSYCENRLKRLCQHIIKRGITVENAFSLFSAAVRYDAEDLEEFCFKFCINHL 499



>gb:AF334406_1897199 Homo sapiens CLLL7 protein (CLLD7) mRNA,
           complete cds.>gb:AK096654_1914645 Homo sapiens cDNA
           FLJ39335 fis, clone OCBBF2017398, moderately similar to
           Homo sapiens RCC1-like G exchanging factor RLG
           mRNA.>gb:HSA319660_2004050 Homo sapiens mRNA for guanine
           nucleotide exchange factor (E4.5 gene).
          Length = 531

 Score = 42.0 bits (97), Expect = 0.014
 Identities = 28/117 (23%), Positives = 51/117 (43%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F++ F         + +E++     +++A LQ+LYTD +    E                
Sbjct: 395 FRSMFQSYWNEDMKEVIEIDQFSYPVYRAFLQYLYTDTVDLPPEDAIG------------ 442

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNL 489
           LL  A  +  +RLK+LC+  +   +TV+   +  S A ++    L+  C KF   +L
Sbjct: 443 LLDLATSYCENRLKKLCQHIIKRGITVENAFSLFSAAVRYDAEDLEEFCFKFCINHL 499



>gb:AX877033_1476805 Sequence 11938 from Patent
           EP1074617.>gb:AK001578_1908514 Homo sapiens cDNA
           FLJ10716 fis, clone NT2RP3001081.
          Length = 223

 Score = 42.0 bits (97), Expect = 0.014
 Identities = 28/117 (23%), Positives = 51/117 (43%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F++ F         + +E++     +++A LQ+LYTD +    E                
Sbjct: 87  FRSMFQSYWNEDMKEVIEIDQFSYPVYRAFLQYLYTDTVDLPPEDAIG------------ 134

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNL 489
           LL  A  +  +RLK+LC+  +   +TV+   +  S A ++    L+  C KF   +L
Sbjct: 135 LLDLATSYCENRLKKLCQHIIKRGITVENAFSLFSAAVRYDAEDLEEFCFKFCINHL 191



>gb:HSM805096_1187323 Homo sapiens mRNA; cDNA DKFZp586K0319 (from
           clone DKFZp586K0319).>gb:AL139321_1920572 Human DNA
           sequence from clone RP11-185C18 on chromosome 13
           Contains a small nuclear ribonucleoprotein polypeptide G
           (SNRPG) pseudogene, the 3' end of the gene for CLLL8
           protein (CLLD8), a novel gene (contains putative zinc
           finger protein NY-REN-34 antigen (LOC51131)), the gene
           for CLLL7 protein (FLJ10716) and 4 CpG islands, complete
           sequence.
          Length = 531

 Score = 42.0 bits (97), Expect = 0.014
 Identities = 28/117 (23%), Positives = 51/117 (43%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F++ F         + +E++     +++A LQ+LYTD +    E                
Sbjct: 395 FRSMFQSYWNEDMKEVIEIDQFSYPVYRAFLQYLYTDTVDLPPEDAIG------------ 442

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNL 489
           LL  A  +  +RLK+LC+  +   +TV+   +  S A ++    L+  C KF   +L
Sbjct: 443 LLDLATSYCENRLKKLCQHIIKRGITVENAFSLFSAAVRYDAEDLEEFCFKFCINHL 499



>gb:AK089923_1176048 Mus musculus B lymphocyte B cells CRL-1669 BCL1
           Clone 13.20-3B3 cDNA, RIKEN full-length enriched
           library, clone:G430003L18 product:GUANINE NUCLEOTIDE
           EXCHANGE FACTOR (CLLL7 PROTEIN) homolog [Homo sapiens],
           full insert sequence.
          Length = 391

 Score = 42.0 bits (97), Expect = 0.014
 Identities = 28/117 (23%), Positives = 51/117 (43%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F++ F         + +E++     +++A LQ+LYTD +    E                
Sbjct: 255 FRSMFQSYWNEDMKEVIEIDQFSYPVYRAFLQYLYTDTVDLPPEDAIG------------ 302

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNL 489
           LL  A  +  +RLK+LC+  +   +TV+   +  S A ++    L+  C KF   +L
Sbjct: 303 LLDLATSYCENRLKRLCQHIIKRGITVENAFSLFSAAVRYDAEDLEEFCFKFCINHL 359



>gb:AK088299_1175319 Mus musculus 2 days neonate thymus thymic cells
           cDNA, RIKEN full-length enriched library,
           clone:E430010J17 product:GUANINE NUCLEOTIDE EXCHANGE
           FACTOR (CLLL7 PROTEIN) homolog [Homo sapiens], full
           insert sequence.
          Length = 531

 Score = 42.0 bits (97), Expect = 0.014
 Identities = 28/117 (23%), Positives = 51/117 (43%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F++ F         + +E++     +++A LQ+LYTD +    E                
Sbjct: 395 FRSMFQSYWNEDMKEVIEIDQFSYPVYRAFLQYLYTDTVDLPPEDAIG------------ 442

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNL 489
           LL  A  +  +RLK+LC+  +   +TV+   +  S A ++    L+  C KF   +L
Sbjct: 443 LLDLATSYCENRLKRLCQHIIKRGITVENAFSLFSAAVRYDAEDLEEFCFKFCINHL 499



>gb:AK033501_1163369 Mus musculus adult male colon cDNA, RIKEN
           full-length enriched library, clone:9030406H03
           product:GUANINE NUCLEOTIDE EXCHANGE FACTOR (CLLL7
           PROTEIN) homolog [Homo sapiens], full insert sequence.
          Length = 531

 Score = 42.0 bits (97), Expect = 0.014
 Identities = 28/117 (23%), Positives = 51/117 (43%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F++ F         + +E++     +++A LQ+LYTD +    E                
Sbjct: 395 FRSMFQSYWNEDMKEVIEIDQFSYPVYRAFLQYLYTDTVDLPPEDAIG------------ 442

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNL 489
           LL  A  +  +RLK+LC+  +   +TV+   +  S A ++    L+  C KF   +L
Sbjct: 443 LLDLATSYCENRLKRLCQHIIKRGITVENAFSLFSAAVRYDAEDLEEFCFKFCINHL 499



>gb:AP003865_1834531 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1081_B12.>gb:AP003887_1834860 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1186_G01.
          Length = 311

 Score = 41.6 bits (96), Expect = 0.019
 Identities = 17/40 (42%), Positives = 26/40 (65%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLP 720
           F+A+  G +       + L DIEP  F+A+L+F+YTD+LP
Sbjct: 152 FRAELLGSMAEAKMSCITLHDIEPVTFRALLRFVYTDELP 191



>gb:AK031248_1162362 Mus musculus 13 days embryo forelimb cDNA,
           RIKEN full-length enriched library, clone:5930437B21
           product:SIMILAR TO CHROMOSOME CONDENSATION 1-LIKE
           homolog [Mus musculus], full insert
           sequence.>gb:BC003224_2089088 Mus musculus chromosome
           condensation 1-like, mRNA (cDNA clone MGC:6577
           IMAGE:3482729), complete cds.
          Length = 551

 Score = 41.6 bits (96), Expect = 0.019
 Identities = 27/105 (25%), Positives = 46/105 (43%)
 Frame = -3

Query: 797 DKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLK 618
           D VE+ +    +F+A L++LYTD +    E                LL  A  +   RLK
Sbjct: 429 DIVEMSEFSYPVFRAFLEYLYTDNISLSPEEAVG------------LLDLATFYSETRLK 476

Query: 617 QLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNLGV 483
           +LC+  + + +  +     LS A ++    L+  C +F   +L V
Sbjct: 477 KLCQQTIKQGICEENAIALLSAAVKYDAQDLEEFCFRFCINHLTV 521



>gb:AK031242_1162359 Mus musculus 13 days embryo forelimb cDNA,
           RIKEN full-length enriched library, clone:5930436I15
           product:SIMILAR TO CHROMOSOME CONDENSATION 1-LIKE
           homolog [Mus musculus], full insert sequence.
          Length = 551

 Score = 41.6 bits (96), Expect = 0.019
 Identities = 27/105 (25%), Positives = 46/105 (43%)
 Frame = -3

Query: 797 DKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLK 618
           D VE+ +    +F+A L++LYTD +    E                LL  A  +   RLK
Sbjct: 429 DIVEMSEFSYPVFRAFLEYLYTDNISLSPEEAVG------------LLDLATFYSETRLK 476

Query: 617 QLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNLGV 483
           +LC+  + + +  +     LS A ++    L+  C +F   +L V
Sbjct: 477 KLCQQTIKQGICEENAIALLSAAVKYDAQDLEEFCFRFCINHLTV 521



>gb:BC061766_2104627 Rattus norvegicus chromosome condensation
           1-like, mRNA (cDNA clone MGC:72635 IMAGE:5621190),
           complete cds.
          Length = 551

 Score = 41.2 bits (95), Expect = 0.025
 Identities = 27/105 (25%), Positives = 46/105 (43%)
 Frame = -3

Query: 797 DKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLK 618
           D VE+ +    +F+A L++LYTD +    E                LL  A  +   RLK
Sbjct: 429 DIVEMSEFSYPVFRAFLEYLYTDNISLPPEEAVG------------LLDLATFYSETRLK 476

Query: 617 QLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNLGV 483
           +LC+  + + +  +     LS A ++    L+  C +F   +L V
Sbjct: 477 KLCQQTIKQGICEENAIALLSAAVKYDAQDLEEFCFRFCINHLTV 521



>gb:AP004691_1843477 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0453D01.
          Length = 276

 Score = 40.8 bits (94), Expect = 0.032
 Identities = 18/46 (39%), Positives = 33/46 (71%), Gaps = 2/46 (4%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDK--VELEDIEPSIFKAMLQFLYTDQLPNLHE 708
           F+AQFFG + +       V + D++P++F+A+L+F+YTD+LP + +
Sbjct: 212 FRAQFFGPMADTGGGDRYVRILDMKPTVFEAVLRFIYTDRLPPVED 257



>pir|T47740|T47740 hypothetical protein F18O21.190 - Arabidopsis
           thaliana>gb:ATF18O21_1549213 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F18O21.>gb:BT012360_1641511
           Arabidopsis thaliana At3g56230 mRNA, complete
           cds.>gb:AK176299_1818287 Arabidopsis thaliana mRNA for
           putative protein, complete cds, clone: RAFL23-25-I15.
          Length = 282

 Score = 40.8 bits (94), Expect = 0.032
 Identities = 24/101 (23%), Positives = 46/101 (45%)
 Frame = -3

Query: 791 VELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQL 612
           + L+++     +A+L+FLYT  L +                +  L  AAD++ +  L++L
Sbjct: 155 ITLQELNSEQLQALLEFLYTGTLAS----------DKLEKNVYALFIAADKYMIHYLQEL 204

Query: 611 CEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNL 489
           CE  +   + + +V   L ++D      LK  C+ F   N+
Sbjct: 205 CEQYMLSSLDISSVLNVLDVSDLGSSKTLKEACVGFVVRNM 245



>gb:BC075441_2558544 Xenopus tropicalis MGC89218 protein, mRNA (cDNA
           clone MGC:89218 IMAGE:7017472), complete cds.
          Length = 526

 Score = 40.4 bits (93), Expect = 0.042
 Identities = 26/115 (22%), Positives = 49/115 (42%)
 Frame = -3

Query: 827 FFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAA 648
           F  L+     + +E+      +++A L++LYTD +    E                LL  
Sbjct: 394 FRSLLHENEEEIIEMNQFSYPVYRAFLEYLYTDNISISPEDAIG------------LLEL 441

Query: 647 ADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNLGV 483
           A  +  +RLKQLC+  + + +  +     LS A ++    L+  C +F   ++ V
Sbjct: 442 ATIYRENRLKQLCQQTIKQGICEENAVVLLSAAVKYDAQDLEDYCFRFCINHMTV 496



>gb:AL663082_2072393 Mouse DNA sequence from clone RP23-327G1 on
           chromosome 11 Contains the 3' end of the Ankfy1 gene for
           ankyrin repeat and FYVE domain containing 1, a new gene,
           the gene for a novel ZZ type zinc finger domain
           containing protein, the 5' end of the Atp2a3 gene for
           ubiquitous Ca++ transporting ATPase and two CpG islands,
           complete sequence.>gb:AL808023_2073083 Mouse DNA
           sequence from clone RP23-32B6 on chromosome 11 Contains
           the 3' end of the Ube2g1 gene for ubiquitin-conjugating
           enzyme E2G 1 (UBC7 homolog, C. elegans), the 5' end of
           the Ankfy1 gene for ankyrin repeat and FYVE domain
           containing 1 and a CpG island, complete sequence.
          Length = 1169

 Score = 40.4 bits (93), Expect = 0.042
 Identities = 25/115 (21%), Positives = 51/115 (44%)
 Frame = -3

Query: 836 KAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHL 657
           ++  + L    +T++++L D  P +   ML+++YTD+L    +           + +  L
Sbjct: 89  RSDSWSLANLSSTEEIDLSDANPEVTMTMLRWIYTDELEFRED----------DVFLTEL 138

Query: 656 LAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           +  A+RF L  L++ CE  +   V V         A++     L   C +  A++
Sbjct: 139 MKLANRFQLQLLRERCEKGVMSLVNVRNCIRFYQTAEELNASTLMNYCAEIIASH 193



>gb:AX880033_1478097 Sequence 14938 from Patent EP1074617.
          Length = 551

 Score = 40.4 bits (93), Expect = 0.042
 Identities = 26/105 (24%), Positives = 47/105 (44%)
 Frame = -3

Query: 797 DKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLK 618
           D VE+ +    +++A L++LYTD +    E                LL  A  +  +RLK
Sbjct: 429 DIVEMSEFSYPVYRAFLEYLYTDSISLSPEEAVG------------LLDLATFYRENRLK 476

Query: 617 QLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNLGV 483
           +LC+  + + +  +     LS A ++    L+  C +F   +L V
Sbjct: 477 KLCQQTIKQGICEENAIALLSAAVKYDAQDLEEFCFRFCINHLTV 521



>gb:CR859763_1183866 Pongo pygmaeus mRNA; cDNA DKFZp469L0426 (from
           clone DKFZp469L0426).
          Length = 527

 Score = 40.4 bits (93), Expect = 0.042
 Identities = 26/105 (24%), Positives = 47/105 (44%)
 Frame = -3

Query: 797 DKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLK 618
           D VE+ +    +++A L++LYTD +    E                LL  A  +  +RLK
Sbjct: 405 DIVEMSEFSYPVYRAFLEYLYTDSISLSPEEAVG------------LLDLATFYRENRLK 452

Query: 617 QLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNLGV 483
           +LC+  + + +  +     LS A ++    L+  C +F   +L V
Sbjct: 453 KLCQQTIKQGICEENAIALLSAAVKYDAQDLEEFCFRFCINHLTV 497



>gb:CR857643_1181865 Pongo pygmaeus mRNA; cDNA DKFZp469P1529 (from
           clone DKFZp469P1529).
          Length = 527

 Score = 40.4 bits (93), Expect = 0.042
 Identities = 26/105 (24%), Positives = 47/105 (44%)
 Frame = -3

Query: 797 DKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLK 618
           D VE+ +    +++A L++LYTD +    E                LL  A  +  +RLK
Sbjct: 405 DIVEMSEFSYPVYRAFLEYLYTDSISLSPEEAVG------------LLDLATFYRENRLK 452

Query: 617 QLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNLGV 483
           +LC+  + + +  +     LS A ++    L+  C +F   +L V
Sbjct: 453 KLCQQTIKQGICEENAIALLSAAVKYDAQDLEEFCFRFCINHLTV 497



>gb:AE014134_1129000 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003639_1219107 Drosophila melanogaster
           chromosome 2L, section 48 of 83 of the complete
           sequence.>gb:AY118728_1300450 Drosophila melanogaster
           GH03286 full insert cDNA.
          Length = 627

 Score = 40.4 bits (93), Expect = 0.042
 Identities = 35/135 (25%), Positives = 52/135 (38%)
 Frame = -3

Query: 791 VELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQL 612
           V L  I+  I   +L F+YT +                   +Q LLAAAD   L+ +   
Sbjct: 126 VVLHTIDGDILHILLDFIYTGRCE------------ITQSNVQELLAAADMLQLNEVVDG 173

Query: 611 CEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNLGV*RVQALGRELPLTVV*A 432
           C   LC E+        L  A+ H C  L    L F   N     ++    E P T++  
Sbjct: 174 CCEFLCRELHASNALGILRFAEAHNCESLAKSALNFVHANFPAVTLEDEFLETPQTLLSQ 233

Query: 431 VGNSCINRRKGKSNL 387
           + NS + R   +S +
Sbjct: 234 LLNSELLRVDSESQV 248



>pir|T50663|T50663 RCC1-like G exchanging factor RLG [imported] -
           human>gb:CR858121_1182308 Pongo pygmaeus mRNA; cDNA
           DKFZp468G2212 (from clone
           DKFZp468G2212).>gb:AF060219_1879809 Homo sapiens
           RCC1-like G exchanging factor RLG mRNA, complete
           cds.>gb:AL157813_1921062 Human DNA sequence from clone
           RP11-165D7 on chromosome 13 Contains the CHC1L gene for
           chromosome condensation 1-like, 3 novel genes and a CpG
           island, complete sequence.>gb:AY341245_1946750 Homo
           sapiens chromosome condensation 1-like (CHC1L) gene,
           complete cds.>gb:BC029052_1979392 Homo sapiens
           chromosome condensation 1-like, mRNA (cDNA clone
           MGC:34511 IMAGE:5194795), complete cds.
          Length = 551

 Score = 40.4 bits (93), Expect = 0.042
 Identities = 26/105 (24%), Positives = 47/105 (44%)
 Frame = -3

Query: 797 DKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLK 618
           D VE+ +    +++A L++LYTD +    E                LL  A  +  +RLK
Sbjct: 429 DIVEMSEFSYPVYRAFLEYLYTDSISLSPEEAVG------------LLDLATFYRENRLK 476

Query: 617 QLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNLGV 483
           +LC+  + + +  +     LS A ++    L+  C +F   +L V
Sbjct: 477 KLCQQTIKQGICEENAIALLSAAVKYDAQDLEEFCFRFCINHLTV 521



>gb:BC084332_2563716 Xenopus laevis hypothetical LOC495136, mRNA
           (cDNA clone MGC:83991 IMAGE:6945934), complete cds.
          Length = 519

 Score = 40.0 bits (92), Expect = 0.055
 Identities = 19/68 (27%), Positives = 34/68 (50%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F+G +   N D++ + D+EP+ F AML+++Y D++    +            ++ H
Sbjct: 146 FHAMFYGELAEDN-DEIRIPDVEPAAFLAMLKYMYCDEIDLAADTVLATLYAGKKYIVPH 204

Query: 659 LLAAADRF 636
           L  A   F
Sbjct: 205 LARACVNF 212



>gb:BC063745_2553596 Danio rerio zgc:63520, mRNA (cDNA clone
           MGC:63520 IMAGE:2644458), complete cds.
          Length = 538

 Score = 40.0 bits (92), Expect = 0.055
 Identities = 27/106 (25%), Positives = 49/106 (46%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F   F   +   +  +VEL   EP I + +++F+YT ++                  +Q 
Sbjct: 71  FSLMFTSSMMEASNHEVELGGAEPEIIELLVEFIYTARI------------SVNSNNVQS 118

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLK 522
           LL AA+++ +D +K++C   L E+V         +LA+   C +LK
Sbjct: 119 LLNAANQYQIDPVKKMCVDFLKEQVDATNCLGISALAECLNCPELK 164



>gb:CR376850_2570112 Zebrafish DNA sequence from clone DKEY-246K9 in
           linkage group 20 Contains the 5' end of the gene for a
           novel protein (zgc:101107), the gene for a novel protein
           similar to human and mouse BTB (POZ) domain containing 3
           (BTBD3) and a CpG island, complete sequence.
          Length = 534

 Score = 39.7 bits (91), Expect = 0.072
 Identities = 19/68 (27%), Positives = 34/68 (50%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F+G +   +TD++ + D+EP  F AML+++Y D++    +            ++ H
Sbjct: 161 FHAMFYGELAE-DTDEIRIPDVEPPAFLAMLKYIYCDEIDLSADTVLATLYAAKKYIVPH 219

Query: 659 LLAAADRF 636
           L  A   F
Sbjct: 220 LARACVNF 227



>gb:BC066537_2554422 Danio rerio zgc:76933, mRNA (cDNA clone
           MGC:76933 IMAGE:6524703), complete cds.
          Length = 613

 Score = 39.7 bits (91), Expect = 0.072
 Identities = 26/117 (22%), Positives = 47/117 (40%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+A F G +     D+V L ++   +   ++ F YT ++   H+             +  
Sbjct: 63  FRAMFAGTLRESVMDRVVLHEVSAELLGLLVDFCYTGRVTVTHDN------------VDL 110

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNL 489
           LL  AD F    +K+ C A L + + V         A+ + C +L     +F   N+
Sbjct: 111 LLKTADLFQFPSVKEACCAFLEQRLDVSNCLEIQDFAEAYACRELAASARRFVLKNI 167



>gb:AC117176_1208028 Dictyostelium discoideum chromosome 2 map
           5018074-5200947 strain AX4, complete sequence.
          Length = 649

 Score = 39.7 bits (91), Expect = 0.072
 Identities = 20/56 (35%), Positives = 29/56 (51%)
 Frame = -3

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           LL  AD F L  LK  CE  L   + ++     L++AD++RC QL+ +   F   N
Sbjct: 535 LLQWADFFSLAGLKSSCEFYLWHYIDLENAPIILTVADRYRCTQLRNVAANFVLRN 590



>gb:CR860715_1184769 Pongo pygmaeus mRNA; cDNA DKFZp459O0927 (from
           clone DKFZp459O0927).
          Length = 769

 Score = 39.7 bits (91), Expect = 0.072
 Identities = 25/96 (26%), Positives = 44/96 (45%)
 Frame = -3

Query: 791 VELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQL 612
           +E+ D++  IF+ M+Q+LY     ++               +  LL+AA  F LD L++ 
Sbjct: 632 IEISDMKYHIFQMMMQYLYYGGTESME---------IPTADILELLSAASLFQLDALQRH 682

Query: 611 CEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           CE    + ++V++   T   A  H   +L   C  F
Sbjct: 683 CEILCSQTLSVESAVNTYKYAKIHNAPELALFCEGF 718



>sp|P34371|YLJ8_CAEEL Hypothetical protein C50C3.8 in chromosome
           III.>pir|S44626|S44626 C50C3.8 protein - Caenorhabditis
           elegans>gb:L14433_1386876 Caenorhabditis elegans cosmid
           C50C3, complete sequence.
          Length = 410

 Score = 39.7 bits (91), Expect = 0.072
 Identities = 25/117 (21%), Positives = 51/117 (43%), Gaps = 5/117 (4%)
 Frame = -3

Query: 827 FFGLIGNPNT-----DKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQ 663
           F  +  +PN       ++ +ED +    +AM++F+YT    +L               + 
Sbjct: 244 FKSMFSSPNMIEAQKGEIHIEDAKYDSVRAMVEFMYTGATESLESQGN----------ID 293

Query: 662 HLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
            +LA AD++ +  LK  CE  + + + +  V      +D +    LK+  ++F  T+
Sbjct: 294 EILAIADKYEVLMLKDQCERLIAQTINLKNVTQIAMFSDTYTADYLKSAVIRFLTTH 350



>gb:BC075364_2558467 Xenopus tropicalis MGC89072 protein, mRNA (cDNA
           clone MGC:89072 IMAGE:7005897), complete cds.
          Length = 538

 Score = 39.3 bits (90), Expect = 0.094
 Identities = 29/109 (26%), Positives = 52/109 (47%), Gaps = 5/109 (4%)
 Frame = -3

Query: 833 AQFFGLIGNPN-----TDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIM 669
           + FF L+   N     + +VEL+D EP I + +++F YT ++                  
Sbjct: 18  SHFFNLMFTTNMLESKSFEVELKDAEPDIIEQLVEFAYTARI------------SVNSNN 65

Query: 668 MQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLK 522
           +Q LL AA+++ ++ +K++C   L E+V          LA+   C +LK
Sbjct: 66  VQSLLDAANQYQIEPVKRMCVEFLKEQVDASNCLGISVLAECLDCPELK 114



>gb:BC070768_2555738 Xenopus laevis hypothetical protein MGC83797,
           mRNA (cDNA clone MGC:83797 IMAGE:6641932), complete cds.
          Length = 538

 Score = 39.3 bits (90), Expect = 0.094
 Identities = 29/109 (26%), Positives = 52/109 (47%), Gaps = 5/109 (4%)
 Frame = -3

Query: 833 AQFFGLIGNPN-----TDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIM 669
           + FF L+   N     + +VEL+D EP I + +++F YT ++                  
Sbjct: 18  SHFFNLMFTTNMLESKSFEVELKDAEPDIIEQLVEFAYTARI------------SVNSNN 65

Query: 668 MQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLK 522
           +Q LL AA+++ ++ +K++C   L E+V          LA+   C +LK
Sbjct: 66  VQSLLDAANQYQIEPVKRMCVEFLKEQVDASNCLGISVLAECLDCPELK 114



>gb:BC083903_2108959 Rattus norvegicus kelch-like 7 (Drosophila)
           (predicted), mRNA (cDNA clone MGC:95261 IMAGE:7133606),
           complete cds.
          Length = 586

 Score = 39.3 bits (90), Expect = 0.094
 Identities = 29/110 (26%), Positives = 53/110 (48%), Gaps = 5/110 (4%)
 Frame = -3

Query: 833 AQFFGLIGNPN-----TDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIM 669
           + FF L+   N     + +VEL+D EP I + +++F YT ++                  
Sbjct: 66  SHFFNLMFTTNMLESKSFEVELKDAEPDIIEQLVEFAYTARI------------SVNSNN 113

Query: 668 MQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKT 519
           +Q LL AA+++ ++ +K++C   L E+V          LA+   C +LK+
Sbjct: 114 VQSLLDAANQYQIEPVKKMCVDFLKEQVDASNCLGISVLAECLDCPELKS 163



>gb:AK090653_1913313 Homo sapiens cDNA FLJ33334 fis, clone
           BRACE2000733, weakly similar to RING CANAL
           PROTEIN.>gb:BC010437_1972635 Homo sapiens hypothetical
           protein MGC2610, mRNA (cDNA clone MGC:2610
           IMAGE:3354344), complete cds.
          Length = 558

 Score = 39.3 bits (90), Expect = 0.094
 Identities = 30/117 (25%), Positives = 48/117 (41%), Gaps = 5/117 (4%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           FKA F   +     +K++L  I   I + ++ + YT Q+                  +Q 
Sbjct: 62  FKAMFTADMKEKFKNKIKLSGIHHDILEGLVNYAYTSQIE------------ITKRNVQS 109

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQL-----KTICLKF 504
           LL AAD      +K+ CE  L   + +D      S A+ H C +L     + +C KF
Sbjct: 110 LLEAADLLQFLSVKKACERFLVRHLDIDNCIGMHSFAEFHVCPELEKESRRILCSKF 166



>gb:CR858210_1182396 Pongo pygmaeus mRNA; cDNA DKFZp459L0551 (from
           clone DKFZp459L0551).
          Length = 558

 Score = 39.3 bits (90), Expect = 0.094
 Identities = 30/117 (25%), Positives = 48/117 (41%), Gaps = 5/117 (4%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           FKA F   +     +K++L  I   I + ++ + YT Q+                  +Q 
Sbjct: 62  FKAMFTADMKEKFKNKIKLSGIHHDILEGLVNYAYTSQIEITERN------------VQS 109

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQL-----KTICLKF 504
           LL AAD      +K+ CE  L   + +D      S A+ H C +L     + +C KF
Sbjct: 110 LLEAADLLQFLSVKKACERFLVRHLDIDNCIGMHSFAEFHVCPELEKESRRILCSKF 166



>gb:BC087456_2565297 Xenopus laevis hypothetical LOC496053, mRNA
           (cDNA clone MGC:99278 IMAGE:7211088), complete cds.
          Length = 411

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 30/111 (27%), Positives = 52/111 (46%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F G +   +T+ +EL D+EP+ F A+L+FLY+D++    E             +  
Sbjct: 130 FDAMFNGGMATTSTE-IELPDVEPAAFLALLKFLYSDEVQIGPET------------VMT 176

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLK 507
            L  A ++ +  L+  C   L + +  D     L+ A      QL ++CL+
Sbjct: 177 TLYTAKKYAVPALEAHCVEFLKKNLRADNAFMLLTQARLFDEPQLASLCLE 227



>gb:AJ720951_2503138 Gallus gallus mRNA for hypothetical protein,
           clone 30p4.
          Length = 586

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 29/109 (26%), Positives = 52/109 (47%), Gaps = 5/109 (4%)
 Frame = -3

Query: 833 AQFFGLIGNPN-----TDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIM 669
           + FF L+   N     + +VEL+D EP I + +++F YT ++                  
Sbjct: 66  SHFFNLMFTTNMLESKSFEVELKDAEPDIIEQLVEFAYTARI------------SVNSNN 113

Query: 668 MQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLK 522
           +Q LL AA+++ ++ +K++C   L E+V          LA+   C +LK
Sbjct: 114 VQSLLDAANQYQIEPVKKMCVDFLKEQVDASNCLGISVLAECLDCPELK 162



>gb:BC055704_2102103 Mus musculus BTB (POZ) domain containing 2,
           mRNA (cDNA clone IMAGE:6413080), partial cds.
          Length = 392

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 30/111 (27%), Positives = 52/111 (46%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F G +   +T+ +EL D+EP+ F A+L+FLY+D++    E             +  
Sbjct: 13  FDAMFNGGMATTSTE-IELPDVEPAAFLALLKFLYSDEVQIGPET------------VMT 59

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLK 507
            L  A ++ +  L+  C   L + +  D     L+ A      QL ++CL+
Sbjct: 60  TLYTAKKYAVPALEAHCVEFLKKHLRADNAFMLLTQARLFDEPQLASLCLE 110



>gb:BC029154_2096497 Mus musculus kelch-like 7 (Drosophila), mRNA
           (cDNA clone MGC:37117 IMAGE:4952319), complete cds.
          Length = 400

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 29/109 (26%), Positives = 52/109 (47%), Gaps = 5/109 (4%)
 Frame = -3

Query: 833 AQFFGLIGNPN-----TDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIM 669
           + FF L+   N     + +VEL+D EP I + +++F YT ++                  
Sbjct: 66  SHFFNLMFTTNMLESKSFEVELKDAEPDIIEQLVEFAYTARI------------SVNSNN 113

Query: 668 MQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLK 522
           +Q LL AA+++ ++ +K++C   L E+V          LA+   C +LK
Sbjct: 114 VQSLLDAANQYQIEPVKKMCVDFLKEQVDASNCLGISVLAECLDCPELK 162



>gb:AY028802_1934436 Homo sapiens kelch/BTB protein mRNA, complete
           cds.
          Length = 538

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 29/109 (26%), Positives = 52/109 (47%), Gaps = 5/109 (4%)
 Frame = -3

Query: 833 AQFFGLIGNPN-----TDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIM 669
           + FF L+   N     + +VEL+D EP I + +++F YT ++                  
Sbjct: 18  SHFFNLMFTTNMLESKSFEVELKDAEPDIIEQLVEFAYTARI------------SVNSNN 65

Query: 668 MQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLK 522
           +Q LL AA+++ ++ +K++C   L E+V          LA+   C +LK
Sbjct: 66  VQSLLDAANQYQIEPVKKMCVDFLKEQVDASNCLGISVLAECLDCPELK 114



>gb:AK056390_1911726 Homo sapiens cDNA FLJ31828 fis, clone
           NT2RP6000109, weakly similar to RING CANAL PROTEIN.
          Length = 564

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 29/109 (26%), Positives = 52/109 (47%), Gaps = 5/109 (4%)
 Frame = -3

Query: 833 AQFFGLIGNPN-----TDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIM 669
           + FF L+   N     + +VEL+D EP I + +++F YT ++                  
Sbjct: 44  SHFFNLMFTTNMLESKSFEVELKDAEPDIIEQLVEFAYTARI------------SVNSNN 91

Query: 668 MQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLK 522
           +Q LL AA+++ ++ +K++C   L E+V          LA+   C +LK
Sbjct: 92  VQSLLDAANQYQIEPVKKMCVDFLREQVDASNCLGISVLAECLDCPELK 140



>gb:HSM801571_1186265 Homo sapiens mRNA; cDNA DKFZp564C1616 (from
           clone DKFZp564C1616).
          Length = 586

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 29/109 (26%), Positives = 52/109 (47%), Gaps = 5/109 (4%)
 Frame = -3

Query: 833 AQFFGLIGNPN-----TDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIM 669
           + FF L+   N     + +VEL+D EP I + +++F YT ++                  
Sbjct: 66  SHFFNLMFTTNMLESKSFEVELKDAEPDIIEQLVEFAYTARI------------SVNSNN 113

Query: 668 MQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLK 522
           +Q LL AA+++ ++ +K++C   L E+V          LA+   C +LK
Sbjct: 114 VQSLLDAANQYQIEPVKKMCVDFLKEQVDASNCLGISVLAECLDCPELK 162



>gb:AK083358_1173934 Mus musculus 2 days neonate thymus thymic cells
           cDNA, RIKEN full-length enriched library,
           clone:C920019I01 product:CDNA FLJ31828 FIS, CLONE
           NT2RP6000109, WEAKLY SIMILAR TO RING CANAL PROTEIN
           homolog [Homo sapiens], full insert sequence.
          Length = 586

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 29/109 (26%), Positives = 52/109 (47%), Gaps = 5/109 (4%)
 Frame = -3

Query: 833 AQFFGLIGNPN-----TDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIM 669
           + FF L+   N     + +VEL+D EP I + +++F YT ++                  
Sbjct: 66  SHFFNLMFTTNMLESKSFEVELKDAEPDIIEQLVEFAYTARI------------SVNSNN 113

Query: 668 MQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLK 522
           +Q LL AA+++ ++ +K++C   L E+V          LA+   C +LK
Sbjct: 114 VQSLLDAANQYQIEPVKKMCVDFLKEQVDASNCLGISVLAECLDCPELK 162



>gb:AK012326_1156891 Mus musculus 11 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2700038B03
           product:CDNA FLJ31828 FIS, CLONE NT2RP6000109, WEAKLY
           SIMILAR TO RING CANAL PROTEIN homolog [Homo sapiens],
           full insert sequence.
          Length = 586

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 29/109 (26%), Positives = 52/109 (47%), Gaps = 5/109 (4%)
 Frame = -3

Query: 833 AQFFGLIGNPN-----TDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIM 669
           + FF L+   N     + +VEL+D EP I + +++F YT ++                  
Sbjct: 66  SHFFNLMFTTNMLESKSFEVELKDAEPDIIEQLVEFAYTARI------------SVNSNN 113

Query: 668 MQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLK 522
           +Q LL AA+++ ++ +K++C   L E+V          LA+   C +LK
Sbjct: 114 VQSLLDAANQYQIEPVKKMCVDFLKEQVDASNCLGISVLAECLDCPELK 162



>sp|Q9BX70|BTB2_HUMAN BTB/POZ domain containing protein
           2.>gb:AF355797_1898827 Homo sapiens BTBD2 protein mRNA,
           complete cds.
          Length = 525

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 30/111 (27%), Positives = 52/111 (46%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F G +   +T+ +EL D+EP+ F A+L+FLY+D++    E             +  
Sbjct: 146 FDAMFNGGMATTSTE-IELPDVEPAAFLALLKFLYSDEVQIGPET------------VMT 192

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLK 507
            L  A ++ +  L+  C   L + +  D     L+ A      QL ++CL+
Sbjct: 193 TLYTAKKYAVPALEAHCVEFLKKNLRADNAFMLLTQARLFDEPQLASLCLE 243



>gb:BC062968_2105109 Mus musculus BTB (POZ) domain containing 3,
           mRNA (cDNA clone MGC:76394 IMAGE:6408511), complete cds.
          Length = 530

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 18/68 (26%), Positives = 34/68 (50%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F+G +   + D++ + D+EP+ F AML+++Y D++    +            ++ H
Sbjct: 157 FHAMFYGELAE-DKDEIRIPDVEPAAFLAMLKYIYCDEIDLAADTVLATLYAAKKYIVPH 215

Query: 659 LLAAADRF 636
           L  A   F
Sbjct: 216 LARACVNF 223



>gb:AB093275_2048060 Mus musculus mRNA for mKIAA0952 protein.
          Length = 547

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 18/68 (26%), Positives = 34/68 (50%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F+G +   + D++ + D+EP+ F AML+++Y D++    +            ++ H
Sbjct: 174 FHAMFYGELAE-DKDEIRIPDVEPAAFLAMLKYIYCDEIDLAADTVLATLYAAKKYIVPH 232

Query: 659 LLAAADRF 636
           L  A   F
Sbjct: 233 LARACVNF 240



>gb:HS742J24_1999415 Human DNA sequence from clone RP4-742J24 on
           chromosome 20p11.23-12.3 Contains the BTBD3 gene for BTB
           (POZ) domain containing 3 (KIAA0952), a novel gene and a
           CpG island, complete sequence.
          Length = 461

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 18/68 (26%), Positives = 34/68 (50%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F+G +   + D++ + D+EP+ F AML+++Y D++    +            ++ H
Sbjct: 88  FHAMFYGELAE-DKDEIRIPDVEPAAFLAMLKYIYCDEIDLAADTVLATLYAAKKYIVPH 146

Query: 659 LLAAADRF 636
           L  A   F
Sbjct: 147 LARACVNF 154



>gb:BC052308_1984807 Homo sapiens ankyrin repeat and FYVE domain
           containing 1, transcript variant 2, mRNA (cDNA clone
           IMAGE:6729940), complete cds.
          Length = 487

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 25/115 (21%), Positives = 50/115 (43%)
 Frame = -3

Query: 836 KAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHL 657
           ++  + L    +T +++L D  P +   ML+++YTD+L    +           + +  L
Sbjct: 89  RSDSWSLANLSSTKELDLSDANPEVTMTMLRWIYTDELEFRED----------DVFLTEL 138

Query: 656 LAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           +  A+RF L  L++ CE  +   V V         A++     L   C +  A++
Sbjct: 139 MKLANRFQLQLLRERCEKGVMSLVNVRNCIRFYQTAEELNASTLMNYCAEIIASH 193



>gb:AK095632_1914407 Homo sapiens cDNA FLJ38313 fis, clone
           FCBBF3022566.
          Length = 839

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 24/96 (25%), Positives = 44/96 (45%)
 Frame = -3

Query: 791 VELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQL 612
           +E+ D++  IF+ M+Q+LY     ++               +  LL+AA  F LD L++ 
Sbjct: 702 IEISDMKYHIFQMMMQYLYYGGTESME---------IPTTDILELLSAASLFQLDALQRH 752

Query: 611 CEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           CE    + +++++   T   A  H   +L   C  F
Sbjct: 753 CEILCSQTLSMESAVNTYKYAKIHNAPELALFCEGF 788



>gb:AK091560_1913513 Homo sapiens cDNA FLJ34241 fis, clone
           FCBBF3028202, highly similar to Cca3 protein.
          Length = 532

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 24/96 (25%), Positives = 44/96 (45%)
 Frame = -3

Query: 791 VELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQL 612
           +E+ D++  IF+ M+Q+LY     ++               +  LL+AA  F LD L++ 
Sbjct: 395 IEISDMKYHIFQMMMQYLYYGGTESME---------IPTTDILELLSAASLFQLDALQRH 445

Query: 611 CEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           CE    + +++++   T   A  H   +L   C  F
Sbjct: 446 CEILCSQTLSMESAVNTYKYAKIHNAPELALFCEGF 481



>gb:AB033081_1866261 Homo sapiens mRNA for KIAA1255 protein, partial
           cds.
          Length = 1232

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 25/115 (21%), Positives = 50/115 (43%)
 Frame = -3

Query: 836 KAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHL 657
           ++  + L    +T +++L D  P +   ML+++YTD+L    +           + +  L
Sbjct: 152 RSDSWSLANLSSTKELDLSDANPEVTMTMLRWIYTDELEFRED----------DVFLTEL 201

Query: 656 LAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           +  A+RF L  L++ CE  +   V V         A++     L   C +  A++
Sbjct: 202 MKLANRFQLQLLRERCEKGVMSLVNVRNCIRFYQTAEELNASTLMNYCAEIIASH 256



>gb:AB023169_1865491 Homo sapiens mRNA for KIAA0952 protein, partial
           cds.
          Length = 539

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 18/68 (26%), Positives = 34/68 (50%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F+G +   + D++ + D+EP+ F AML+++Y D++    +            ++ H
Sbjct: 166 FHAMFYGELAE-DKDEIRIPDVEPAAFLAMLKYIYCDEIDLAADTVLATLYAAKKYIVPH 224

Query: 659 LLAAADRF 636
           L  A   F
Sbjct: 225 LARACVNF 232



>gb:HSM806953_1187784 Homo sapiens mRNA; cDNA DKFZp686L21216 (from
           clone DKFZp686L21216).
          Length = 400

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 24/96 (25%), Positives = 44/96 (45%)
 Frame = -3

Query: 791 VELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQL 612
           +E+ D++  IF+ M+Q+LY     ++               +  LL+AA  F LD L++ 
Sbjct: 263 IEISDMKYHIFQMMMQYLYYGGTESME---------IPTTDILELLSAASLFQLDALQRH 313

Query: 611 CEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKF 504
           CE    + +++++   T   A  H   +L   C  F
Sbjct: 314 CEILCSQTLSMESAVNTYKYAKIHNAPELALFCEGF 349



>gb:CR860153_1184241 Pongo pygmaeus mRNA; cDNA DKFZp459C1423 (from
           clone DKFZp459C1423).
          Length = 461

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 18/68 (26%), Positives = 34/68 (50%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F+G +   + D++ + D+EP+ F AML+++Y D++    +            ++ H
Sbjct: 88  FHAMFYGELAE-DKDEIRIPDVEPAAFLAMLKYIYCDEIDLAADTVLATLYAAKKYIVPH 146

Query: 659 LLAAADRF 636
           L  A   F
Sbjct: 147 LARACVNF 154



>pir|T21980|T21980 hypothetical protein F38H4.7 - Caenorhabditis
           elegans>gb:CEF38H4_1363647 Caenorhabditis elegans cosmid
           F38H4, complete sequence.
          Length = 602

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 19/42 (45%), Positives = 29/42 (69%), Gaps = 3/42 (7%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDK---VELEDIEPSIFKAMLQFLYTDQL 723
           F A F G +   NT++   +EL D+EPS F A+L+FLY+D++
Sbjct: 218 FDAMFNGGLTPKNTEEALEIELPDVEPSAFLALLKFLYSDEV 259



>sp|P34147|RACA_DICDI RAS-related protein racA.>gb:AF310886_1261377
           Dictyostelium discoideum RacA (racA) gene, complete cds.
          Length = 598

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 32/112 (28%), Positives = 49/112 (43%), Gaps = 11/112 (9%)
 Frame = -3

Query: 794 KVEL-EDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLK 618
           KVE+ +D+    F A+L++LYT   P + E                +L   +RF L RL 
Sbjct: 444 KVEMSDDVTFDSFMAILEYLYTAHAP-IEEGDSVG-----------ILVLGNRFDLRRLV 491

Query: 617 QLCEAKLCEEVTVDT----------VATTLSLADQHRCLQLKTICLKFAATN 492
            LCE  + +E+   T          +   L  A +H   QL+  CL F ++N
Sbjct: 492 SLCELYISKEIERATTIGIFRSELDIIGLLICAQRHNAPQLEKFCLHFISSN 543



>sp|P58545|BTB3_MOUSE BTB/POZ domain containing protein
           3.>gb:BC018174_2092566 Mus musculus BTB (POZ) domain
           containing 3, mRNA (cDNA clone MGC:25591 IMAGE:4011475),
           complete cds.
          Length = 532

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 18/68 (26%), Positives = 34/68 (50%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F+G +   + D++ + D+EP+ F AML+++Y D++    +            ++ H
Sbjct: 159 FHAMFYGELAE-DKDEIRIPDVEPAAFLAMLKYIYCDEIDLAADTVLATLYAAKKYIVPH 217

Query: 659 LLAAADRF 636
           L  A   F
Sbjct: 218 LARACVNF 225



>sp|Q9Y2F9|BTB3_HUMAN BTB/POZ domain containing protein
           3.>gb:HS742J24_1999414 Human DNA sequence from clone
           RP4-742J24 on chromosome 20p11.23-12.3 Contains the
           BTBD3 gene for BTB (POZ) domain containing 3 (KIAA0952),
           a novel gene and a CpG island, complete sequence.
          Length = 522

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 18/68 (26%), Positives = 34/68 (50%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F+G +   + D++ + D+EP+ F AML+++Y D++    +            ++ H
Sbjct: 149 FHAMFYGELAE-DKDEIRIPDVEPAAFLAMLKYIYCDEIDLAADTVLATLYAAKKYIVPH 207

Query: 659 LLAAADRF 636
           L  A   F
Sbjct: 208 LARACVNF 215



>sp|Q9P2R3|AFY1_HUMAN Ankyrin repeats- and FYVE domain-containing
           protein 1 (Ankyrin repeats hooked to a zinc finger
           motif).
          Length = 1169

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 25/115 (21%), Positives = 50/115 (43%)
 Frame = -3

Query: 836 KAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHL 657
           ++  + L    +T +++L D  P +   ML+++YTD+L    +           + +  L
Sbjct: 89  RSDSWSLANLSSTKELDLSDANPEVTMTMLRWIYTDELEFRED----------DVFLTEL 138

Query: 656 LAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           +  A+RF L  L++ CE  +   V V         A++     L   C +  A++
Sbjct: 139 MKLANRFQLQLLRERCEKGVMSLVNVRNCIRFYQTAEELNASTLMNYCAEIIASH 193



>gb:BC072626_2106602 Mus musculus RIKEN cDNA C130068N17 gene, mRNA
           (cDNA clone MGC:99858 IMAGE:6827841), complete cds.
          Length = 558

 Score = 38.1 bits (87), Expect = 0.21
 Identities = 29/117 (24%), Positives = 47/117 (40%), Gaps = 5/117 (4%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           FKA F   +      K++L  I   I + ++ + YT Q+                  +Q 
Sbjct: 62  FKAMFTADMKEKFKSKIKLSGIHHDILEGLVNYAYTSQIE------------ITKRNVQS 109

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQL-----KTICLKF 504
           LL AAD      +K+ CE  L   + +D      S A+ H C +L     + +C +F
Sbjct: 110 LLEAADLLQFLSVKKACEQFLVRHLDIDNCIGMHSFAEFHVCSELEKESRRILCSRF 166



>gb:AB037360_1866450 Homo sapiens mRNA for ANKHZN, complete cds.
          Length = 1166

 Score = 38.1 bits (87), Expect = 0.21
 Identities = 25/115 (21%), Positives = 50/115 (43%)
 Frame = -3

Query: 836 KAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHL 657
           ++  + L    +T +++L D  P +   ML+++YTD+L    +           + +  L
Sbjct: 89  RSDSWSLANLSSTKELDLSDANPEVTVTMLRWIYTDELEFRED----------DVFLTEL 138

Query: 656 LAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           +  A+RF L  L++ CE  +   V V         A++     L   C +  A++
Sbjct: 139 MKLANRFQLQLLRERCEKGVMSLVNVRNCIRFYQTAEELNASTLMNYCAEIIASH 193



>gb:AK048518_1168403 Mus musculus 16 days embryo head cDNA, RIKEN
           full-length enriched library, clone:C130068N17
           product:hypothetical BTB/POZ domain/Kelch repeat
           containing protein, full insert sequence.
          Length = 558

 Score = 38.1 bits (87), Expect = 0.21
 Identities = 29/117 (24%), Positives = 47/117 (40%), Gaps = 5/117 (4%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           FKA F   +      K++L  I   I + ++ + YT Q+                  +Q 
Sbjct: 62  FKAMFTADMKEKFKSKIKLSGIHHDILEGLVNYAYTSQIE------------ITKRNVQS 109

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQL-----KTICLKF 504
           LL AAD      +K+ CE  L   + +D      S A+ H C +L     + +C +F
Sbjct: 110 LLEAADLLQFLSVKKACEQFLVRHLDIDNCIGMHSFAEFHVCSELEKESRRILCSRF 166



>gb:BC084274_2563661 Xenopus laevis hypothetical LOC495101, mRNA (cDNA
            clone MGC:82146 IMAGE:7012341), complete cds.
          Length = 1016

 Score = 37.7 bits (86), Expect = 0.27
 Identities = 24/101 (23%), Positives = 41/101 (40%)
 Frame = -3

Query: 791  VELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQL 612
            + + D++ SIF+ ++Q+LY                      +  LL+AA +F LD L++ 
Sbjct: 879  IVISDVKYSIFQMLMQYLY---------YGGTEAIKVPMAAVLELLSAASQFQLDALQRH 929

Query: 611  CEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATNL 489
            CE      +  D   +    A  H   +L   C  F   N+
Sbjct: 930  CEIICSHSINTDNAVSIYKYAKIHNAPELALYCEGFFLQNM 970



>gb:AB098135S2_2048244 Mus musculus Ankhzn gene for ankyrin repeat
           hooked to a zinc finger motif long form, exon 25 and
           complete cds.
          Length = 1169

 Score = 37.7 bits (86), Expect = 0.27
 Identities = 23/115 (20%), Positives = 51/115 (44%)
 Frame = -3

Query: 836 KAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHL 657
           ++  + L    +T++++L D  P +   +++++YTD+L    +           + +  L
Sbjct: 89  RSDSWSLANLSSTEEIDLSDANPEVTMTIVRWIYTDELEFRED----------DVFLTEL 138

Query: 656 LAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           +  A+RF L  L++ CE  +   V V         A++     L   C +  A++
Sbjct: 139 MKLANRFQLQLLRERCEKGVMSLVNVRNCIRFYQTAEELNASTLMNYCAEIIASH 193



>gb:AB011370_2043651 Mus musculus Ankhzn mRNA, complete
           cds.>gb:AB098135S0_2048243 Mus musculus Ankhzn gene for
           ankyrin repeat hooked to a zinc finger motif, exon 9s,
           9, 10 and Ankhzn short form complete cds.
          Length = 439

 Score = 37.7 bits (86), Expect = 0.27
 Identities = 23/115 (20%), Positives = 51/115 (44%)
 Frame = -3

Query: 836 KAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHL 657
           ++  + L    +T++++L D  P +   +++++YTD+L    +           + +  L
Sbjct: 89  RSDSWSLANLSSTEEIDLSDANPEVTMTIVRWIYTDELEFRED----------DVFLTEL 138

Query: 656 LAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           +  A+RF L  L++ CE  +   V V         A++     L   C +  A++
Sbjct: 139 MKLANRFQLQLLRERCEKGVMSLVNVRNCIRFYQTAEELNASTLMNYCAEIIASH 193



>gb:BC039585_1982579 Homo sapiens kelch-like 7 (Drosophila), mRNA
           (cDNA clone MGC:48764 IMAGE:5527346), complete cds.
          Length = 586

 Score = 37.7 bits (86), Expect = 0.27
 Identities = 28/109 (25%), Positives = 52/109 (47%), Gaps = 5/109 (4%)
 Frame = -3

Query: 833 AQFFGLIGNPN-----TDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIM 669
           + FF L+   N     + ++EL+D EP I + +++F YT ++                  
Sbjct: 66  SHFFNLMFTTNMLESKSFELELKDAEPDIIEQLVEFAYTARI------------SVNSNN 113

Query: 668 MQHLLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLK 522
           +Q LL AA+++ ++ +K++C   L E+V          LA+   C +LK
Sbjct: 114 VQSLLDAANQYQIEPVKKMCVDFLKEQVDASNCLGISVLAECLDCPELK 162



>sp|Q810B6|AFY1_MOUSE Ankyrin repeats- and FYVE domain-containing
           protein 1 (Ankyrin repeats hooked to a zinc finger
           motif).>gb:AB098329_2048249 Mus musculus Ankhzn mRNA for
           ankyrin repeat hooked to a zinc finger motif long form,
           complete cds.
          Length = 1169

 Score = 37.7 bits (86), Expect = 0.27
 Identities = 23/115 (20%), Positives = 51/115 (44%)
 Frame = -3

Query: 836 KAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHL 657
           ++  + L    +T++++L D  P +   +++++YTD+L    +           + +  L
Sbjct: 89  RSDSWSLANLSSTEEIDLSDANPEVTMTIVRWIYTDELEFRED----------DVFLTEL 138

Query: 656 LAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           +  A+RF L  L++ CE  +   V V         A++     L   C +  A++
Sbjct: 139 MKLANRFQLQLLRERCEKGVMSLVNVRNCIRFYQTAEELNASTLMNYCAEIIASH 193



>gb:BC087937_2110266 Mus musculus cDNA clone MGC:107314
           IMAGE:6705214, complete cds.
          Length = 488

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 29/110 (26%), Positives = 50/110 (45%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F G +   + + +EL D+EP+ F A+L+FLY+D++    E             +  
Sbjct: 110 FDAMFNGGMATTSAE-IELPDVEPAAFLALLRFLYSDEVQIGPET------------VMT 156

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICL 510
            L  A ++ +  L+  C   L + +  D     L+ A      QL ++CL
Sbjct: 157 TLYTAKKYAVPALEAHCVEFLTKHLRADNAFMLLTQARLFDEPQLASLCL 206



>gb:BC072618_2106597 Mus musculus BTB (POZ) domain containing 1,
           mRNA (cDNA clone MGC:92985 IMAGE:6811133), complete cds.
          Length = 488

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 29/110 (26%), Positives = 50/110 (45%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F G +   + + +EL D+EP+ F A+L+FLY+D++    E             +  
Sbjct: 110 FDAMFNGGMATTSAE-IELPDVEPAAFLALLRFLYSDEVQIGPET------------VMT 156

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICL 510
            L  A ++ +  L+  C   L + +  D     L+ A      QL ++CL
Sbjct: 157 TLYTAKKYAVPALEAHCVEFLTKHLRADNAFMLLTQARLFDEPQLASLCL 206



>gb:BC060183_2103911 Mus musculus kelch-like 20 (Drosophila), mRNA
           (cDNA clone IMAGE:6831959), partial cds.
          Length = 461

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 28/116 (24%), Positives = 45/116 (38%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+A F G +      +V + DI+    + ++ F YT Q+                  +Q 
Sbjct: 122 FRAMFTGELAESRQTEVVIRDIDERAMELLIDFAYTSQI------------TVEEGNVQT 169

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           LL AA    L  +++ C   L  ++         + AD H C +L  I  KF   N
Sbjct: 170 LLPAACLLQLAEIQEACCEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHN 225



>gb:BC005253_1969718 Homo sapiens kelch-like 20 (Drosophila), mRNA
           (cDNA clone IMAGE:3951189), complete cds.
          Length = 230

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 28/116 (24%), Positives = 45/116 (38%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+A F G +      +V + DI+    + ++ F YT Q+                  +Q 
Sbjct: 93  FRAMFTGELAESRQTEVVIRDIDERAMELLIDFAYTSQI------------TVEEGNVQT 140

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           LL AA    L  +++ C   L  ++         + AD H C +L  I  KF   N
Sbjct: 141 LLPAACLLQLAEIQEACCEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHN 196



>gb:AK130594_1917649 Homo sapiens cDNA FLJ27084 fis, clone SPL03658,
           highly similar to Homo sapiens ankyrin repeat and BTB
           (POZ) domain containing 1 (ABTB1).
          Length = 405

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 26/98 (26%), Positives = 42/98 (42%)
 Frame = -3

Query: 791 VELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQL 612
           V L  I P +F  +L ++Y+D      E                +L+ AD + L  LK+L
Sbjct: 156 VTLHGISPDVFTHVLYYMYSDHTELSPEAAYD------------VLSVADMYLLPGLKRL 203

Query: 611 CEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAA 498
           C   L + +  DTV     +A   R  +L+  C ++ A
Sbjct: 204 CGRSLAQMLDEDTVVGVWRVAKLFRLARLEDQCTEYMA 241



>gb:AK000731_1908092 Homo sapiens cDNA FLJ20724 fis, clone HEP15061.
          Length = 482

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 29/110 (26%), Positives = 50/110 (45%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F G +   + + +EL D+EP+ F A+L+FLY+D++    E             +  
Sbjct: 104 FDAMFNGGMATTSAE-IELPDVEPAAFLALLRFLYSDEVQIGPET------------VMT 150

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICL 510
            L  A ++ +  L+  C   L + +  D     L+ A      QL ++CL
Sbjct: 151 TLYTAKKYAVPALEAHCVEFLTKHLRADNAFMLLTQARLFDEPQLASLCL 200



>gb:AJ844466_1907447 Homo sapiens partial mRNA for KLEIP (kelch-like
           ECT2 interacting protein), (KLHLX
           gene).>gb:BC063418_1986176 Homo sapiens kelch-like 20
           (Drosophila), mRNA (cDNA clone MGC:74874 IMAGE:5221643),
           complete cds.>gb:BX248409_1991648 Human DNA sequence
           from clone RP11-360D2 on chromosome 1 Contains the 5'
           end of a novel gene (FLJ45235), a novel gene, the 5' end
           of the gene for Kelch motif containing protein, a
           ribosomal protein S27 (metallopanstimulin 1) (RPS27)
           pseudogene and a CpG island, complete
           sequence.>gb:HSDJ383J4_2012060 Human DNA sequence from
           clone RP3-383J4 on chromosome 1q24.1-24.3 Contains two
           genes for novel proteins (FLJ10514) and two CpG islands,
           complete sequence.
          Length = 609

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 28/116 (24%), Positives = 45/116 (38%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+A F G +      +V + DI+    + ++ F YT Q+                  +Q 
Sbjct: 93  FRAMFTGELAESRQTEVVIRDIDERAMELLIDFAYTSQI------------TVEEGNVQT 140

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           LL AA    L  +++ C   L  ++         + AD H C +L  I  KF   N
Sbjct: 141 LLPAACLLQLAEIQEACCEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHN 196



>gb:AF355402_1898814 Homo sapiens BTBD1 protein mRNA, complete cds.
          Length = 482

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 29/110 (26%), Positives = 50/110 (45%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F G +   + + +EL D+EP+ F A+L+FLY+D++    E             +  
Sbjct: 104 FDAMFNGGMATTSAE-IELPDVEPAAFLALLRFLYSDEVQIGPET------------VMT 150

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICL 510
            L  A ++ +  L+  C   L + +  D     L+ A      QL ++CL
Sbjct: 151 TLYTAKKYAVPALEAHCVEFLTKHLRADNAFMLLTQARLFDEPQLASLCL 200



>gb:AB053326_1868215 Homo sapiens mRNA for BPOZ splice variant
           type3, complete cds.
          Length = 453

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 26/98 (26%), Positives = 42/98 (42%)
 Frame = -3

Query: 791 VELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQL 612
           V L  I P +F  +L ++Y+D      E                +L+ AD + L  LK+L
Sbjct: 295 VTLHGISPDVFTHVLYYMYSDHTELSPEAAYD------------VLSVADMYLLPGLKRL 342

Query: 611 CEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAA 498
           C   L + +  DTV     +A   R  +L+  C ++ A
Sbjct: 343 CGRSLAQMLDEDTVVGVWRVAKLFRLARLEDQCTEYMA 380



>gb:AB053324_1868213 Homo sapiens mRNA for BPOZ splicing variant
           type1, complete cds.
          Length = 336

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 26/98 (26%), Positives = 42/98 (42%)
 Frame = -3

Query: 791 VELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQL 612
           V L  I P +F  +L ++Y+D      E                +L+ AD + L  LK+L
Sbjct: 178 VTLHGISPDVFTHVLYYMYSDHTELSPEAAYD------------VLSVADMYLLPGLKRL 225

Query: 611 CEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAA 498
           C   L + +  DTV     +A   R  +L+  C ++ A
Sbjct: 226 CGRSLAQMLDEDTVVGVWRVAKLFRLARLEDQCTEYMA 263



>gb:AX876729_1476666 Sequence 11634 from Patent EP1074617.
          Length = 609

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 28/116 (24%), Positives = 45/116 (38%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+A F G +      +V + DI+    + ++ F YT Q+                  +Q 
Sbjct: 93  FRAMFTGELAESRQTEVVIRDIDERAMELLIDFAYTSQI------------TVEEGNVQT 140

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           LL AA    L  +++ C   L  ++         + AD H C +L  I  KF   N
Sbjct: 141 LLPAACLLQLAEIQEACCEFLKRQLDPSNCQGIRAFADTHSCRELLRIADKFTQHN 196



>gb:CR860200_1184287 Pongo pygmaeus mRNA; cDNA DKFZp469C0719 (from
           clone DKFZp469C0719).
          Length = 609

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 28/116 (24%), Positives = 45/116 (38%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+A F G +      +V + DI+    + ++ F YT Q+                  +Q 
Sbjct: 93  FRAMFTGELAESRQTEVVIRDIDERAMELLIDFAYTSQI------------TVEEGNVQT 140

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           LL AA    L  +++ C   L  ++         + AD H C +L  I  KF   N
Sbjct: 141 LLPAACLLQLAEIQEACCEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHN 196



>gb:AK088345_1175347 Mus musculus 2 days neonate thymus thymic cells
           cDNA, RIKEN full-length enriched library,
           clone:E430013J22 product:BTB/POZ DOMAIN CONTAINING
           PROTEIN 1 homolog [Homo sapiens], full insert sequence.
          Length = 391

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 29/110 (26%), Positives = 50/110 (45%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F G +   + + +EL D+EP+ F A+L+FLY+D++    E             +  
Sbjct: 110 FDAMFNGGMATTSAE-IELPDVEPAAFLALLRFLYSDEVQIGPET------------VMT 156

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICL 510
            L  A ++ +  L+  C   L + +  D     L+ A      QL ++CL
Sbjct: 157 TLYTAKKYAVPALEAHCVEFLTKHLRADNAFMLLTQARLFDEPQLASLCL 206



>gb:AK053371_1170414 Mus musculus 0 day neonate eyeball cDNA, RIKEN
           full-length enriched library, clone:E130012G03
           product:KELCH-LIKE PROTEIN X homolog [Homo sapiens],
           full insert sequence.
          Length = 201

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 28/116 (24%), Positives = 45/116 (38%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+A F G +      +V + DI+    + ++ F YT Q+                  +Q 
Sbjct: 88  FRAMFTGELAESRQTEVVIRDIDERAMELLIDFAYTSQI------------TVEEGNVQT 135

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           LL AA    L  +++ C   L  ++         + AD H C +L  I  KF   N
Sbjct: 136 LLPAACLLQLAEIQEACCEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHN 191



>gb:AK053102_1170314 Mus musculus 15 days embryo head cDNA, RIKEN
           full-length enriched library, clone:D930050H05
           product:KELCH-LIKE PROTEIN X homolog [Homo sapiens],
           full insert sequence.>gb:BC019571_2093020 Mus musculus
           kelch-like 20 (Drosophila), mRNA (cDNA clone MGC:28950
           IMAGE:4235202), complete cds.
          Length = 604

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 28/116 (24%), Positives = 45/116 (38%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+A F G +      +V + DI+    + ++ F YT Q+                  +Q 
Sbjct: 88  FRAMFTGELAESRQTEVVIRDIDERAMELLIDFAYTSQI------------TVEEGNVQT 135

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           LL AA    L  +++ C   L  ++         + AD H C +L  I  KF   N
Sbjct: 136 LLPAACLLQLAEIQEACCEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHN 191



>gb:AF447886_1150982 Homo sapiens PP2259 mRNA, complete cds.
          Length = 337

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 26/98 (26%), Positives = 42/98 (42%)
 Frame = -3

Query: 791 VELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQL 612
           V L  I P +F  +L ++Y+D      E                +L+ AD + L  LK+L
Sbjct: 179 VTLHGISPDVFTHVLYYMYSDHTELSPEAAYD------------VLSVADMYLLPGLKRL 226

Query: 611 CEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAA 498
           C   L + +  DTV     +A   R  +L+  C ++ A
Sbjct: 227 CGRSLAQMLDEDTVVGVWRVAKLFRLARLEDQCTEYMA 264



>pir|JC7326|JC7326 ankyrin repeat and BTB/POZ domain protein 1 -
           human>gb:AB053325_1868214 Homo sapiens mRNA for BPOZ
           splice variant type2, complete cds.>gb:AF297986_1895615
           Homo sapiens elongation factor 1A binding protein mRNA,
           complete cds.>gb:BC011858_1973265 Homo sapiens ankyrin
           repeat and BTB (POZ) domain containing 1, transcript
           variant 2, mRNA (cDNA clone MGC:20585 IMAGE:4309664),
           complete cds.
          Length = 478

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 26/98 (26%), Positives = 42/98 (42%)
 Frame = -3

Query: 791 VELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQHLLAAADRFGLDRLKQL 612
           V L  I P +F  +L ++Y+D      E                +L+ AD + L  LK+L
Sbjct: 320 VTLHGISPDVFTHVLYYMYSDHTELSPEAAYD------------VLSVADMYLLPGLKRL 367

Query: 611 CEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAA 498
           C   L + +  DTV     +A   R  +L+  C ++ A
Sbjct: 368 CGRSLAQMLDEDTVVGVWRVAKLFRLARLEDQCTEYMA 405



>sp|Q9Y2M5|KHLX_HUMAN Kelch-like protein X.>gb:AB026190_1865686 Homo
           sapiens mRNA for Kelch motif containing protein,
           complete cds.
          Length = 609

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 28/116 (24%), Positives = 45/116 (38%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F+A F G +      +V + DI+    + ++ F YT Q+                  +Q 
Sbjct: 93  FRAMFTGELAESRQTEVVIRDIDERAMELLIDFAYTSQI------------TVEEGNVQT 140

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICLKFAATN 492
           LL AA    L  +++ C   L  ++         + AD H C +L  I  KF   N
Sbjct: 141 LLPAACLLQLAEIQEACCEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHN 196



>sp|P58544|BTB1_MOUSE BTB/POZ domain containing protein 1 (Glucose
           signal repressing protein).
          Length = 488

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 29/110 (26%), Positives = 50/110 (45%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F G +   + + +EL D+EP+ F A+L+FLY+D++    E             +  
Sbjct: 110 FDAMFNGGMATTSAE-IELPDVEPAAFLALLRFLYSDEVQIGPET------------VMT 156

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICL 510
            L  A ++ +  L+  C   L + +  D     L+ A      QL ++CL
Sbjct: 157 TLYTAKKYAVPALEAHCVEFLTKHLRADNAFMLLTQARLFDEPQLASLCL 206



>sp|Q9H0C5|BTB1_HUMAN BTB/POZ domain containing protein 1 (Hepatitis
           C virus NS5A- transactivated protein 8)
           (NS5ATP8).>gb:HSM801821_1186481 Homo sapiens mRNA; cDNA
           DKFZp434G0635 (from clone
           DKFZp434G0635).>gb:AF257241_1893206 Homo sapiens BTB/POZ
           domain containing 1 protein (BTBD1) mRNA, complete
           cds.>gb:AF529369_1906082 Homo sapiens NS5ATP8 (NS5ATP8)
           mRNA, complete cds.>gb:BC028097_1979107 Homo sapiens BTB
           (POZ) domain containing 1, mRNA (cDNA clone MGC:39879
           IMAGE:5242418), complete cds.
          Length = 482

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 29/110 (26%), Positives = 50/110 (45%)
 Frame = -3

Query: 839 FKAQFFGLIGNPNTDKVELEDIEPSIFKAMLQFLYTDQLPNLHEXXXXXXXXXXXIMMQH 660
           F A F G +   + + +EL D+EP+ F A+L+FLY+D++    E             +  
Sbjct: 104 FDAMFNGGMATTSAE-IELPDVEPAAFLALLRFLYSDEVQIGPET------------VMT 150

Query: 659 LLAAADRFGLDRLKQLCEAKLCEEVTVDTVATTLSLADQHRCLQLKTICL 510
            L  A ++ +  L+  C   L + +  D     L+ A      QL ++CL
Sbjct: 151 TLYTAKKYAVPALEAHCVEFLTKHLRADNAFMLLTQARLFDEPQLASLCL 200


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 754,613,749
Number of Sequences: 1806583
Number of extensions: 13063023
Number of successful extensions: 27074
Number of sequences better than 10.0: 327
Number of HSP's better than 10.0 without gapping: 25832
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26865
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 56114489496
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)