BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig9852
         (946 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY395689_1604817 Solanum brevidens 60S ribosomal protein L13 ...   315   1e-84   
sp|P41127|RL13_ARATH|RL13_ARATH 60S ribosomal protein L13 (BBC1 protein hom...   306   3e-82   Arabidopsis thaliana [mouse-ear cress]
gb:AY084928_1570010 Arabidopsis thaliana clone 12182 mRNA, compl...   304   1e-81   
sp|P41129|R132_BRANA|R132_BRANA 60S ribosomal protein L13-2 (Cold induced p...   303   4e-81   Brassica napus [oilseed rape]
gb:AB005244_1509563 Arabidopsis thaliana genomic DNA, chromosome...   302   7e-81   
gb:AP001389_1821265 Oryza sativa (japonica cultivar-group) genom...   301   9e-81   
pir|S42555|S42555 ribosomal protein L13.B, cytosolic - rape           301   1e-80   Brassica napus [oilseed rape]
pir|S42553|S42553 ribosomal protein L13.A, cytosolic - rape           301   2e-80   Brassica napus [oilseed rape]
sp|P41128|R131_BRANA|R131_BRANA 60S ribosomal protein L13-1 (Cold induced p...   301   2e-80   Brassica napus [oilseed rape]
gb:PAB132537_1698617 Picea abies mRNA for 60S ribosomal protein ...   300   4e-80   
gb:AY323130_1599151 Oryza sativa (japonica cultivar-group) ribos...   296   4e-79   
pir|T46134|T46134 60S ribosomal protein L13 (BBC1)-like - Arabid...   265   7e-70   Arabidopsis thaliana [mouse-ear cress]
sp|P49627|RL13_TOBAC|RL13_TOBAC 60S ribosomal protein L13 (Clone 6.2.1).>pi...   247   2e-64   Nicotiana tabacum [American tobacco]
gb:AY389645_1178269 Hyacinthus orientalis cold-induced protein m...   229   3e-60   
gb:PSP439527_1702310 Polytomella sp. 'Pringsheim 198.80' mRNA fo...   224   2e-57   
sp|O48513|RL13_CHLSW|RL13_CHLSW 60S ribosomal protein L13 (BBC1 protein hom...   206   5e-52   
gb:AB051074_1521068 Oryza sativa (japonica cultivar-group) bbc1l...   199   9e-50   
gb:AF385081_2490926 Danio rerio 60S ribosomal protein L13 mRNA, ...   198   1e-49   
sp|Q90Z10|RL13_BRARE|RL13_BRARE 60S ribosomal protein L13.                       198   1e-49   Danio rerio [leopard danio]
gb:AY231817_1177110 Drosophila yakuba clone yak-em_RpL13 mRNA se...   198   1e-49   
sp|P41126|RL13_DROME|RL13_DROME 60S ribosomal protein L13 (BBC1 protein hom...   197   2e-49   Drosophila melanogaster
gb:AF487458_1804283 Triticum aestivum BBC1-like protein mRNA, co...   197   3e-49   
pir|S42877|S42877 ribosomal protein L13.e, cytosolic - fruit fly...   194   3e-48   Drosophila melanogaster
gb:CHKESTFL03_2569022 Gallus gallus mRNA for human bbc1 (breast ...   191   1e-47   
sp|P41125|RL13_CHICK|RL13_CHICK 60S ribosomal protein L13 (Breast basic con...   191   1e-47   Gallus gallus [bantam]
gb:BC075140_2558253 Xenopus laevis ribosomal protein L13, mRNA (...   189   5e-47   
gb:BC058143_2103059 Rattus norvegicus ribosomal protein L13, mRN...   187   3e-46   
gb:BC066320_1987059 Homo sapiens ribosomal protein L13, transcri...   187   3e-46   
gb:AB062392_1868880 Homo sapiens OK/SW-cl.46 mRNA for ribosomal ...   187   3e-46   
gb:AK010989_1156112 Mus musculus 13 days embryo liver cDNA, RIKE...   187   3e-46   
gb:AK002787_1151444 Mus musculus adult male kidney cDNA, RIKEN f...   187   3e-46   
sp|P41123|RL13_RAT|RL13_RAT 60S ribosomal protein L13.                         187   3e-46   Rattus norvegicus [brown rat]
sp|P47963|RL13_MOUSE|RL13_MOUSE 60S ribosomal protein L13 (A52).                 187   3e-46   Mus musculus [mouse]
sp|P26373|RL13_HUMAN|RL13_HUMAN 60S ribosomal protein L13 (Breast basic con...   187   3e-46   Homo sapiens [man]
gb:AF401567_2491994 Ictalurus punctatus ribosomal protein L13 mR...   186   4e-46   
sp|Q90YV5|RL13_ICTPU|RL13_ICTPU 60S ribosomal protein L13.                       186   4e-46   Ictalurus punctatus
gb:BC041531_2547979 Xenopus laevis mRNA similar to ribosomal pro...   186   8e-46   
pir|S23753|S23753 ribosomal protein L13, cytosolic - human>gb:HS...   186   8e-46   Homo sapiens [man]
gb:BC062495_2553375 Xenopus tropicalis ribosomal protein L13, mR...   185   1e-45   
pir|JC2368|JC2368 ribosomal protein L13, cytosolic [validated] -...   185   1e-45   Rattus norvegicus [brown rat]
gb:MMU28917_2120261 Mus musculus 60S ribosomal protein (A52) mRN...   184   2e-45   
gb:AB014876_2043800 Cricetulus griseus mRNA for robosomal protei...   184   3e-45   
sp|Q9Z313|RL13_CRIGR|RL13_CRIGR 60S ribosomal protein L13.                       184   3e-45   Cricetulus griseus [Chinese hamsters]
gb:AY130423_2514080 Scyliorhinus canicula ribosomal protein L13 ...   179   9e-44   
gb:AY769282_1350433 Bombyx mori ribosomal protein L13 (RpL13) mR...   179   9e-44   
gb:AY846882_1353723 Helicoverpa zea ribosomal protein L13 (RpL13...   178   2e-43   
sp|Q962U1|RL13_SPOFR|RL13_SPOFR 60S ribosomal protein L13.>gb:AF400183_1268...   178   2e-43   Spodoptera frugiperda
gb:AB179618_1202394 Antheraea yamamai mRNA for 60S ribosomal pro...   177   3e-43   
gb:AY220747_1310452 Schistosoma japonicum breast basic conserved...   175   1e-42   
gb:AY389928_2531423 Protopterus dolloi ribosomal protein L13 mRN...   174   3e-42   
gb:AY389971_2531461 Xenopus laevis ribosomal protein L13 mRNA, p...   172   7e-42   
gb:AY389927_2531422 Latimeria chalumnae ribosomal protein L13 mR...   172   7e-42   
gb:AY232046_1177339 Drosophila yakuba clone yak-ad_RpL13 mRNA se...   172   9e-42   
sp|O74175|RL13_SCHPO|RL13_SCHPO 60S ribosomal protein L13.>pir|T43385|T4338...   172   9e-42   Schizosaccharomyces pombe
sp|Q95043|RL13_SCHMA|RL13_SCHMA 60S ribosomal protein L13 (BBC1 protein hom...   172   9e-42   Schistosoma mansoni
gb:SMU58093_1397878 Schistosoma mansoni breast basic conserved p...   172   1e-41   
gb:BC085493_2109238 Mus musculus cDNA clone MGC:102076 IMAGE:681...   170   4e-41   
gb:AY130420_1302455 Branchiostoma lanceolatum ribosomal protein ...   168   1e-40   
sp|P91128|RL13_CAEEL|RL13_CAEEL 60S ribosomal protein L13.>pir|T25599|T2559...   167   4e-40   Caenorhabditis elegans [roundworm]
gb:CR382128_1660864 Yarrowia lipolytica chromosome B of strain C...   156   5e-37   
sp|O46157|RL13_LUMRU|RL13_LUMRU 60S ribosomal protein L13.>gb:RLAJ3198_1396...   154   3e-36   Lumbricus rubellus
gb:AY857619_1354153 Pectinaria gouldii ribosomal protein L13 mRN...   146   7e-34   
gb:AY130421_2514079 Myxine glutinosa ribosomal protein L13 mRNA,...   143   6e-33   
gb:AE017353_1760026 Cryptococcus neoformans var. neoformans JEC2...   142   7e-33   
gb:AK003487_1151887 Mus musculus 18-day embryo whole body cDNA, ...   141   2e-32   
gb:AY144954_1583745 Saccharomyces castellii clone Contig1629 RPL...   140   4e-32   
gb:AY144853_1583644 Saccharomyces bayanus clone Contig4022 RPL13...   137   3e-31   
gb:AY144852_1583643 Saccharomyces bayanus clone Contig2653 RPL13...   136   5e-31   
gb:AY144953_1583744 Saccharomyces castellii clone Contig2037 RPL...   136   7e-31   
gb:AY145049_1583840 Kluyveromyces lactis clone P2258 RPL13 gene,...   135   9e-31   
gb:CR380958_1653372 Candida glabrata strain CBS138 chromosome L ...   135   1e-30   
sp|Q876B2|RL13_SACEX|RL13_SACEX 60S ribosomal protein L13.>gb:AY144903_1583...   135   1e-30   Kazachstania exigua
sp|Q12690|R13A_YEAST|R13A_YEAST 60S ribosomal protein L13-A.>pir|S67618|S67...   134   3e-30   Saccharomyces cerevisiae [brewer's yeast]
sp|P40212|R13B_YEAST|R13B_YEAST 60S ribosomal protein L13-B.>pir|S50398|S50...   133   6e-30   Saccharomyces cerevisiae [brewer's yeast]
gb:AY145015_1583806 Saccharomyces kluyveri clone P2220 RPL13 gen...   132   8e-30   
gb:CR382136_1668968 Debaryomyces hansenii chromosome D of strain...   132   1e-29   
gb:AE016817_1747641 Ashbya gossypii (= Eremothecium gossypii) AT...   132   1e-29   
gb:AX884822_1480275 Sequence 685 from Patent EP1033401.>gb:AX884...   130   3e-29   
sp|O59931|RL13_CANAL|RL13_CANAL 60S ribosomal protein L13.>pir|T52146|T5214...   130   3e-29   Candida albicans
gb:AY144895_1583686 Saccharomyces servazzii clone S054 RPL13 gen...   126   5e-28   
gb:BNC24AGNB_1633510 B.napus cold induced protein (BnC24B).           115   1e-24   
gb:AX970293_1485602 Sequence 1096 from Patent EP1104808.              109   7e-23   
gb:PFMAL8P1_1192199 Plasmodium falciparum 3D7 chromosome 8, *** ...   103   4e-21   
gb:AB002774_1192795 Entamoeba histolytica mRNA for ribosomal pro...    89   1e-16   
gb:U88308_1406731 Caenorhabditis elegans cosmid C32E8, complete ...    82   2e-14   
gb:AY389735_1178344 Hyacinthus orientalis 60S ribosomal protein ...    82   2e-14   
gb:AF192977_1415885 Ovis aries breast basic conserved protein 1 ...    81   3e-14   
gb:CNS07EGA_1372945 chromosome III of strain GB-M1 of Encephalit...    79   2e-13   
gb:HVJ222784_1682428 Hordeum vulgare mRNA for ribosomal like-pro...    77   4e-13   
pir|T05930|T05930 probable ribosomal protein L13 - barley (fragm...    77   4e-13   Hordeum vulgare [barley]
pir|H90104|H90104 60S ribosomal protein L13 [imported] - Guillar...    66   1e-09   Guillardia theta
gb:AX970327_1485636 Sequence 1130 from Patent EP1104808.               57   4e-07   
pir|T13002|T13002 ribosomal protein L13, cytosolic - Arabidopsis...    50   5e-05   Arabidopsis thaliana [mouse-ear cress]
gb:SPU97372_1722282 Schizosaccharomyces pombe unknown protein mR...    48   3e-04   
gb:AP005504_1853008 Oryza sativa (japonica cultivar-group) genom...    40   5e-04   
gb:AE009831_256247 Pyrobaculum aerophilum strain IM2 section 86 ...    44   0.005   
gb:AX970194_1485503 Sequence 997 from Patent EP1104808.                43   0.010   
pir|C72638|C72638 probable ribosomal protein L13 APES024 - Aerop...    43   0.010   Aeropyrum pernix
sp|Q9YEN9|R13E_AERPE|R13E_AERPE 50S ribosomal protein L13e.                       43   0.010   Aeropyrum pernix
pir|B90416|B90416 lSU ribosomal protein L13E (rpl13E) [imported]...    40   0.051   Saccharolobus solfataricus
sp|Q97W05|R13E_SULSO|R13E_SULSO 50S ribosomal protein L13e.                       40   0.051   Saccharolobus solfataricus
gb:AB007172_1863937 Homo sapiens gene for ribosomal protein L13,...    39   0.19    
sp|P58469|R13E_SULTO|R13E_SULTO 50S ribosomal protein L13e.>gb:BA000023_691...    39   0.19    Sulfurisphaera tokodaii
gb:CP000021_873470 Vibrio fischeri ES114 chromosome II, complete...    35   2.1     
gb:AB088224_11543 Streptomyces rochei plasmid pSLA2-L DNA, compl...    34   4.8     
gb:CP000030_83252 Anaplasma marginale str. St. Maries, complete ...    33   6.2     


>gb:AY395689_1604817 Solanum brevidens 60S ribosomal protein L13
           (Ci-1) mRNA, partial cds.
          Length = 200

 Score =  315 bits (806), Expect = 1e-84
 Identities = 152/191 (79%), Positives = 167/191 (87%)
 Frame = -3

Query: 893 MKHNNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQ 714
           MKHNNV+P+GHF+KHWQNYV+TWFNQP             AVKIFPRPTAG+LRPIVHGQ
Sbjct: 1   MKHNNVIPNGHFKKHWQNYVRTWFNQPARKTRRRAARQQKAVKIFPRPTAGSLRPIVHGQ 60

Query: 713 TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA 534
           TLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKA
Sbjct: 61  TLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKA 120

Query: 533 KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL 354
           KLV+FPRRA+K KAGDS+ EELATATQV GPYLPI RE+ +V+FVKVTD+MKSF AY KL
Sbjct: 121 KLVIFPRRAKKVKAGDSSAEELATATQVQGPYLPITREQPAVDFVKVTDEMKSFXAYGKL 180

Query: 353 RLERTNERHIG 321
           R+ERTN RH+G
Sbjct: 181 RIERTNARHVG 191



>sp|P41127|RL13_ARATH 60S ribosomal protein L13 (BBC1 protein
           homolog).>pir|S37271|S37271 ribosomal protein L13 -
           Arabidopsis thaliana>gb:ATRNABBC1_1554058 A.thaliana
           gene for BBC1 protein.>gb:ATT2J13_1555706 Arabidopsis
           thaliana DNA chromosome 3, BAC clone
           T2J13.>gb:AY050854_1562351 Arabidopsis thaliana putative
           60S ribosomal protein L13, BBC1 protein (At3g49010)
           mRNA, complete cds.>gb:AY065137_1566291 Arabidopsis
           thaliana 60S ribosomal protein L13, BBC1 protein
           (At3g49010; T2J13.150) mRNA, complete
           cds.>gb:AY079381_1568271 Arabidopsis thaliana putative
           60S ribosomal protein L13, BBC1 protein (At3g49010)
           mRNA, complete cds.>gb:AY081595_1568855 Arabidopsis
           thaliana 60S ribosomal protein L13, BBC1 protein
           (At3g49010) mRNA, complete cds.>gb:AF428384_1799314
           Arabidopsis thaliana AT3g49010/T2J13_150 mRNA, complete
           cds.
          Length = 206

 Score =  306 bits (785), Expect = 3e-82
 Identities = 146/191 (76%), Positives = 164/191 (85%)
 Frame = -3

Query: 893 MKHNNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQ 714
           MKHNNV+P+GHF+KHWQNYVKTWFNQP             AVKIFPRPT+G LRP+VHGQ
Sbjct: 1   MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPVVHGQ 60

Query: 713 TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA 534
           TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLKTYK 
Sbjct: 61  TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKTYKT 120

Query: 533 KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL 354
           KLV+FPRRARK KAGDSTPEELA ATQV G YLPI+REK ++E VK+T +MKSFKA+DK+
Sbjct: 121 KLVIFPRRARKVKAGDSTPEELANATQVQGDYLPIVREKPTMELVKLTSEMKSFKAFDKI 180

Query: 353 RLERTNERHIG 321
           RLERTN+RH G
Sbjct: 181 RLERTNKRHAG 191



>gb:AY084928_1570010 Arabidopsis thaliana clone 12182 mRNA, complete
           sequence.
          Length = 206

 Score =  304 bits (779), Expect = 1e-81
 Identities = 145/191 (75%), Positives = 163/191 (85%)
 Frame = -3

Query: 893 MKHNNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQ 714
           MKHNNV+P+GHF+KHWQNYVKTWFNQP             AVKIFPRPT+G LRP+VHGQ
Sbjct: 1   MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPVVHGQ 60

Query: 713 TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA 534
           TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLKTYK 
Sbjct: 61  TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKTYKT 120

Query: 533 KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL 354
           KLV+FPRRARK KAGDSTPEELA ATQV G YLPI+REK ++E VK+T +MKSF A+DK+
Sbjct: 121 KLVIFPRRARKVKAGDSTPEELANATQVQGDYLPIVREKPTMELVKLTSEMKSFMAFDKI 180

Query: 353 RLERTNERHIG 321
           RLERTN+RH G
Sbjct: 181 RLERTNKRHAG 191



>sp|P41129|R132_BRANA 60S ribosomal protein L13-2 (Cold induced
           protein C24B).>gb:BNC24AGNC_1633511 B.napus cold induced
           protein (BnC24B).
          Length = 206

 Score =  303 bits (775), Expect = 4e-81
 Identities = 145/191 (75%), Positives = 163/191 (85%)
 Frame = -3

Query: 893 MKHNNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQ 714
           MKHNNV+P+GHF+KHWQNYVKTWFNQP             AVKIFPRPTAG LRP+VHGQ
Sbjct: 1   MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVHGQ 60

Query: 713 TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA 534
           TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGIS+DHRR+N SLEGLQ+NVQRLKTYKA
Sbjct: 61  TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGISLDHRRKNRSLEGLQSNVQRLKTYKA 120

Query: 533 KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL 354
           KLV+FPRRARK KAGDST EELA ATQV G Y+PI+REK ++E VK+T +MKS  AYDK+
Sbjct: 121 KLVIFPRRARKVKAGDSTAEELANATQVQGDYMPIVREKQAMELVKLTSEMKSVNAYDKI 180

Query: 353 RLERTNERHIG 321
           RLERTN+RH G
Sbjct: 181 RLERTNKRHAG 191



>gb:AB005244_1509563 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MRO11.>gb:AY052746_1562906 Arabidopsis thaliana
           AT5g23900/MRO11_6 mRNA, complete
           cds.>gb:AF378895_1793480 Arabidopsis thaliana
           AT5g23900/MRO11_6 mRNA, complete cds.
          Length = 206

 Score =  302 bits (773), Expect = 7e-81
 Identities = 146/191 (76%), Positives = 162/191 (84%)
 Frame = -3

Query: 893 MKHNNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQ 714
           MKHNNV+PS HFRKHWQNYVKTWFNQP             AVKIFPRPT+G LRP+VHGQ
Sbjct: 1   MKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTSGPLRPVVHGQ 60

Query: 713 TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA 534
           TLKYNMKVRAG+GF+LEELK AGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct: 61  TLKYNMKVRAGKGFTLEELKVAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA 120

Query: 533 KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL 354
           KLVVFPRR+R+ KAGDSTPEELA ATQV G Y+PI   KA++E VK+T D+K+FKAYDK+
Sbjct: 121 KLVVFPRRSRQVKAGDSTPEELANATQVQGDYMPIASVKAAMELVKLTADLKAFKAYDKI 180

Query: 353 RLERTNERHIG 321
           RLERTN RH G
Sbjct: 181 RLERTNARHAG 191



>gb:AP001389_1821265 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0541H01.>gb:AP002837_1822993 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBa0019F11.
          Length = 208

 Score =  301 bits (772), Expect = 9e-81
 Identities = 151/193 (78%), Positives = 164/193 (84%), Gaps = 1/193 (0%)
 Frame = -3

Query: 896 VMKHNNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHG 717
           ++KHNNV+P+GHF+KHWQNYVKTWFNQP             AVKIFPRPT+G LRPIV  
Sbjct: 1   MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQC 60

Query: 716 QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK 537
           QTLKYNMK RAGRGF+LEELKAAGI KK APTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct: 61  QTLKYNMKSRAGRGFTLEELKAAGIPKKFAPTIGISVDHRRKNRSLEGLQANVQRLKTYK 120

Query: 536 AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYD 360
           AKLV+FPRRARK KAGDSTPEELATATQV G Y+PI R EK SVE VKVTDDMK+FKAY 
Sbjct: 121 AKLVIFPRRARKVKAGDSTPEELATATQVQGDYMPITRGEKRSVEVVKVTDDMKAFKAYA 180

Query: 359 KLRLERTNERHIG 321
           KLR+ER N+RHIG
Sbjct: 181 KLRVERMNQRHIG 193



>pir|S42555|S42555 ribosomal protein L13.B, cytosolic - rape
          Length = 206

 Score =  301 bits (771), Expect = 1e-80
 Identities = 144/191 (75%), Positives = 162/191 (84%)
 Frame = -3

Query: 893 MKHNNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQ 714
           MKHNNV+P+GHF+KHWQNYVKTWFNQP             AVKIFPRPTAG LRP+VHGQ
Sbjct: 1   MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVHGQ 60

Query: 713 TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA 534
           TLKYNMKVR G+GF+LEELKAAGI KKL PTIGIS+DHRR+N SLEGLQ+NVQRLKTYKA
Sbjct: 61  TLKYNMKVRTGKGFTLEELKAAGIPKKLTPTIGISLDHRRKNRSLEGLQSNVQRLKTYKA 120

Query: 533 KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL 354
           KLV+FPRRARK KAGDST EELA ATQV G Y+PI+REK ++E VK+T +MKS  AYDK+
Sbjct: 121 KLVIFPRRARKVKAGDSTAEELANATQVQGDYMPIVREKQAMELVKLTSEMKSVNAYDKI 180

Query: 353 RLERTNERHIG 321
           RLERTN+RH G
Sbjct: 181 RLERTNKRHAG 191



>pir|S42553|S42553 ribosomal protein L13.A, cytosolic - rape
          Length = 206

 Score =  301 bits (770), Expect = 2e-80
 Identities = 144/191 (75%), Positives = 163/191 (85%)
 Frame = -3

Query: 893 MKHNNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQ 714
           MKHNNV+P+GHF+KHWQNYVKTWFNQP             AVKIFPRPTAG LRP+VHGQ
Sbjct: 1   MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVHGQ 60

Query: 713 TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA 534
           TLKYNMKVR G+GF+LEELK+AGI KKLAPTIGIS+DHRR+N SLEGLQ+NVQRLKTYKA
Sbjct: 61  TLKYNMKVRTGKGFTLEELKSAGIPKKLAPTIGISLDHRRKNRSLEGLQSNVQRLKTYKA 120

Query: 533 KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL 354
           KLV+FPRRARK KAGDST EELA ATQV G Y+PI+REK + E VK+T +MKS KA+DK+
Sbjct: 121 KLVIFPRRARKVKAGDSTAEELANATQVQGDYMPIVREKHATELVKLTTEMKSVKAFDKI 180

Query: 353 RLERTNERHIG 321
           RLERTN+RH G
Sbjct: 181 RLERTNKRHAG 191



>sp|P41128|R131_BRANA 60S ribosomal protein L13-1 (Cold induced
           protein C24A).>gb:BNC24AGNA_1633509 B.napus cold induced
           protein (BnC24A) mRNA.
          Length = 206

 Score =  301 bits (770), Expect = 2e-80
 Identities = 144/191 (75%), Positives = 163/191 (85%)
 Frame = -3

Query: 893 MKHNNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQ 714
           MKHNNV+P+GHF+KHWQNYVKTWFNQP             AVKIFPRPTAG LRP+VHGQ
Sbjct: 1   MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVHGQ 60

Query: 713 TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA 534
           TLKYNMKVR G+GF+LEELK+AGI KKLAPTIGI+VDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct: 61  TLKYNMKVRTGKGFTLEELKSAGIPKKLAPTIGIAVDHRRKNRSLEGLQSNVQRLKTYKA 120

Query: 533 KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL 354
           KLV+FPRRARK KAGDST EELA ATQV G Y+PI+REK + E VK+T +MKS KA+DK+
Sbjct: 121 KLVIFPRRARKVKAGDSTAEELANATQVQGDYMPIVREKHATELVKLTTEMKSVKAFDKI 180

Query: 353 RLERTNERHIG 321
           RLERTN+RH G
Sbjct: 181 RLERTNKRHAG 191



>gb:PAB132537_1698617 Picea abies mRNA for 60S ribosomal protein
           L13E.
          Length = 207

 Score =  300 bits (767), Expect = 4e-80
 Identities = 149/192 (77%), Positives = 163/192 (84%)
 Frame = -3

Query: 896 VMKHNNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHG 717
           ++KHNNVVP+GHF+KHWQNYVKTWFNQP             AVKIFPRPTAG LRPIVHG
Sbjct: 1   MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKKRRRIARQKKAVKIFPRPTAGPLRPIVHG 60

Query: 716 QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK 537
           QT KYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLE LQANVQRLKTYK
Sbjct: 61  QTQKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLESLQANVQRLKTYK 120

Query: 536 AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK 357
           AKLVVFPR ARK KAGDS+PEELATATQV G Y+ I +EK S+E VKVTD+MK+FKAY K
Sbjct: 121 AKLVVFPRTARKLKAGDSSPEELATATQVQGKYMTITQEKPSLELVKVTDEMKNFKAYAK 180

Query: 356 LRLERTNERHIG 321
           LR+ER N+R +G
Sbjct: 181 LRVERMNKRLVG 192



>gb:AY323130_1599151 Oryza sativa (japonica cultivar-group)
           ribosomal protein large subunit 13 mRNA, complete
           cds.>gb:OSA272394_1692429 Oryza sativa mRNA for putative
           cold-induced protein (cip1 gene).>gb:AC146468_1744548
           Oryza sativa (japonica cultivar-group) chromosome 3
           clone OSJNBa0008D12 map MAP_LOC, complete sequence.
          Length = 208

 Score =  296 bits (758), Expect = 4e-79
 Identities = 148/193 (76%), Positives = 163/193 (84%), Gaps = 1/193 (0%)
 Frame = -3

Query: 896 VMKHNNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHG 717
           ++KHNNV+P+GHF+KHWQNYVKTWFNQP             AVKIFPRPT+G LRPIV  
Sbjct: 1   MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQC 60

Query: 716 QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK 537
           QTLKYNMK RAGRGF+LEELKAAGI KK APTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct: 61  QTLKYNMKSRAGRGFTLEELKAAGIPKKYAPTIGISVDHRRKNRSLEGLQANVQRLKTYK 120

Query: 536 AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYD 360
           AKLV+FPRRARK KAGDST EELATATQV G Y+PI R EK SVE VKVTD+MK+FKAY 
Sbjct: 121 AKLVIFPRRARKVKAGDSTAEELATATQVQGDYMPIARGEKRSVEVVKVTDEMKAFKAYA 180

Query: 359 KLRLERTNERHIG 321
           KLR+ER N+RH+G
Sbjct: 181 KLRVERMNQRHVG 193



>pir|T46134|T46134 60S ribosomal protein L13 (BBC1)-like -
           Arabidopsis thaliana>gb:ATT2J13_1555711 Arabidopsis
           thaliana DNA chromosome 3, BAC clone T2J13.
          Length = 206

 Score =  265 bits (678), Expect = 7e-70
 Identities = 130/191 (68%), Positives = 149/191 (78%)
 Frame = -3

Query: 893 MKHNNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQ 714
           MKHNNV+P+GHF+K W+NYVKT FNQP             AVKIFPRPTAG +RP+VH Q
Sbjct: 1   MKHNNVIPNGHFKKKWENYVKTSFNQPAMKTRRRIARQNKAVKIFPRPTAGPIRPVVHAQ 60

Query: 713 TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA 534
           TL YNMKVRAG+GF+LEELKAAGI KKLAPTIGISVDH R+N SLEG Q NVQRLKTYKA
Sbjct: 61  TLTYNMKVRAGKGFTLEELKAAGIPKKLAPTIGISVDHHRKNRSLEGFQTNVQRLKTYKA 120

Query: 533 KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL 354
           KLV+FPR AR  K GDS  +ELA ATQV   ++PI+RE  ++E VK+T DMK F AYDK+
Sbjct: 121 KLVIFPRCARTVKVGDSAQQELANATQVQVDHMPIVREMPTMELVKLTSDMKLFNAYDKI 180

Query: 353 RLERTNERHIG 321
           RLE  N+RH G
Sbjct: 181 RLEGINKRHAG 191



>sp|P49627|RL13_TOBAC 60S ribosomal protein L13 (Clone
           6.2.1).>pir|S50116|S50116 ribosomal protein L13 - common
           tobacco>gb:TOBXANC1_1725577 Nicotiana tabacum (clone
           6.2.1) mRNA, complete cds.
          Length = 202

 Score =  247 bits (631), Expect = 2e-64
 Identities = 126/183 (68%), Positives = 139/183 (75%)
 Frame = -3

Query: 869 SGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLKYNMKV 690
           +GHF+KHWQNYVKTWFNQP             AVKI PRPTAG LRPIVHGQTLKYNMKV
Sbjct: 5   NGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKISPRPTAGTLRPIVHGQTLKYNMKV 64

Query: 689 RAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRR 510
           R+GRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRL+  + +LVVFPRR
Sbjct: 65  RSGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLEDLQGQLVVFPRR 124

Query: 509 ARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNER 330
           A + +     P    TATQV+G Y+PI REK  +   KV   MKSF AY KLR+ERTNER
Sbjct: 125 ASRSRLVILPPRNCLTATQVHGAYMPIEREKHQLILSKVLKKMKSFNAYAKLRVERTNER 184

Query: 329 HIG 321
           HIG
Sbjct: 185 HIG 187



>gb:AY389645_1178269 Hyacinthus orientalis cold-induced protein
           mRNA, partial cds.
          Length = 185

 Score =  229 bits (583), Expect(2) = 3e-60
 Identities = 113/150 (75%), Positives = 128/150 (85%)
 Frame = -3

Query: 770 VKIFPRPTAGALRPIVHGQTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRR 591
           VKIFPRPTAG LRP+VH QTLKYNMK RAGRGFSLEELK AGI KK APT+GI+VDHRRR
Sbjct: 33  VKIFPRPTAGPLRPVVHCQTLKYNMKTRAGRGFSLEELKMAGIPKKWAPTVGIAVDHRRR 92

Query: 590 NSSLEGLQANVQRLKTYKAKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKAS 411
           N SLEGLQANVQRLK YKAKLV+FPRR  KFK+GDS+ EELA+ TQV G Y+P+++EK  
Sbjct: 93  NRSLEGLQANVQRLKEYKAKLVIFPRRPGKFKSGDSSAEELASITQVQGEYMPLVKEKPV 152

Query: 410 VEFVKVTDDMKSFKAYDKLRLERTNERHIG 321
           V  VKVT +M +FKAY KL +ERTNERH+G
Sbjct: 153 VNLVKVTAEMNAFKAYHKLPVERTNERHLG 182



 Score = 26.6 bits (57), Expect(2) = 3e-60
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = -1

Query: 853 STGRTM*RHGSTNLLANKGGELLDKKRLLRFSP 755
           S G+TM  HGS NL   +GG    + + ++  P
Sbjct: 5   SIGKTMRGHGSINLHGKQGGRTARQTKAVKIFP 37



>gb:PSP439527_1702310 Polytomella sp. 'Pringsheim 198.80' mRNA for
           60S ribosomal protein L13 (rl13 gene).
          Length = 207

 Score =  224 bits (570), Expect = 2e-57
 Identities = 110/192 (57%), Positives = 136/192 (70%)
 Frame = -3

Query: 896 VMKHNNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHG 717
           +++HNNVVP+ HF+K WQ YVKTWFNQ              A K+FPRP AG+L+PIVHG
Sbjct: 1   MVRHNNVVPNNHFKKKWQFYVKTWFNQAARKLRRRSARAEKAKKVFPRPVAGSLKPIVHG 60

Query: 716 QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK 537
           QT+KYN K+R GRGF+L ELK AGI  K APTIGISVD+RRRN S+EGLQ N  RLK Y+
Sbjct: 61  QTVKYNSKLRLGRGFTLAELKEAGIPAKFAPTIGISVDYRRRNKSVEGLQENANRLKAYR 120

Query: 536 AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK 357
           + LV+FPR  +K KA +++ EE A+A Q  G  LPI R K +VE   +T +MK F AY K
Sbjct: 121 SNLVIFPRNVKKPKAFEASAEEKASAAQFAGEILPIARCKPTVETAAITAEMKEFNAYAK 180

Query: 356 LRLERTNERHIG 321
           LR+ER N R +G
Sbjct: 181 LRVERMNVRQVG 192



>sp|O48513|RL13_CHLSW 60S ribosomal protein L13 (BBC1 protein
           homolog).>gb:AB009086_1510765 Chlamydomonas sp. W80 mRNA
           for BBC1 protein, complete cds.
          Length = 208

 Score =  206 bits (524), Expect = 5e-52
 Identities = 102/189 (53%), Positives = 131/189 (69%)
 Frame = -3

Query: 896 VMKHNNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHG 717
           +++ N+++P+GHF K WQ +VKTWFNQP             A   FPRP AG+L+PIV  
Sbjct: 1   MVRGNDMLPNGHFHKKWQFHVKTWFNQPARKQRRRNARAEKAKATFPRPVAGSLKPIVRC 60

Query: 716 QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK 537
           QT+KYN K R GRGF+LEELK AGI  K APT+GI+VDHRR+N SLE LQANVQRLKTY+
Sbjct: 61  QTVKYNTKQRLGRGFTLEELKEAGIPAKFAPTVGIAVDHRRKNRSLETLQANVQRLKTYR 120

Query: 536 AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK 357
           A LV+FPR  +K KA +++  + + A+Q  G  LP+   K ++E VK+T DMK    Y K
Sbjct: 121 ASLVIFPRNMKKPKAFEASAADCSAASQAKGELLPLKGTKPALELVKITADMKEGSQYGK 180

Query: 356 LRLERTNER 330
           LR+ER N R
Sbjct: 181 LRIERVNAR 189



>gb:AB051074_1521068 Oryza sativa (japonica cultivar-group) bbc1l
           mRNA for BBC1-like protein, complete cds.
          Length = 142

 Score =  199 bits (505), Expect = 9e-50
 Identities = 103/127 (81%), Positives = 112/127 (88%), Gaps = 1/127 (0%)
 Frame = -3

Query: 698 MKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVF 519
           MK RAGRGF+LEELKAAGI KK APTIGISVDHRR+N SLEGLQANVQRLKTYKAKLV+F
Sbjct: 1   MKSRAGRGFTLEELKAAGIPKKYAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVIF 60

Query: 518 PRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLER 342
           PRRARK KA DST EELATATQV G Y+PI R EK SVE VKVTD+MK+FKAY KLR+ER
Sbjct: 61  PRRARKVKAXDSTAEELATATQVQGDYMPIARGEKRSVEVVKVTDEMKAFKAYAKLRVER 120

Query: 341 TNERHIG 321
            N+RH+G
Sbjct: 121 MNQRHVG 127



>gb:AF385081_2490926 Danio rerio 60S ribosomal protein L13 mRNA,
           complete cds.>gb:AY561516_2537706 Danio rerio ribosomal
           protein L13 (rpl13) mRNA, complete
           cds.>gb:BC075977_2558862 Danio rerio ribosomal protein
           L13, mRNA (cDNA clone MGC:92272 IMAGE:7053229), complete
           cds.
          Length = 211

 Score =  198 bits (504), Expect = 1e-49
 Identities = 101/188 (53%), Positives = 127/188 (67%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N ++ + HF K WQ  V+TWFNQP             A +I PRP +G LRP+V   T++
Sbjct: 6   NGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKARRIAPRPVSGPLRPVVRCPTIR 65

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           Y+ KVRAGRGF+LEELKAAGI KK+A TIGISVD RRRN S E LQANVQRLK Y+ KL+
Sbjct: 66  YHTKVRAGRGFTLEELKAAGINKKVARTIGISVDSRRRNRSTESLQANVQRLKEYRTKLI 125

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLE 345
           +FPR+A K K GDST EEL  ATQ+ GP +PI +     +   +++D K+FKA+  LR+ 
Sbjct: 126 IFPRKAAKPKKGDSTEEELKMATQLTGPVMPIKKVHKKEKARVISEDEKNFKAFASLRMA 185

Query: 344 RTNERHIG 321
           R N R  G
Sbjct: 186 RANARLFG 193



>sp|Q90Z10|RL13_BRARE 60S ribosomal protein L13.
          Length = 210

 Score =  198 bits (504), Expect = 1e-49
 Identities = 101/188 (53%), Positives = 127/188 (67%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N ++ + HF K WQ  V+TWFNQP             A +I PRP +G LRP+V   T++
Sbjct: 5   NGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKARRIAPRPVSGPLRPVVRCPTIR 64

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           Y+ KVRAGRGF+LEELKAAGI KK+A TIGISVD RRRN S E LQANVQRLK Y+ KL+
Sbjct: 65  YHTKVRAGRGFTLEELKAAGINKKVARTIGISVDSRRRNRSTESLQANVQRLKEYRTKLI 124

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLE 345
           +FPR+A K K GDST EEL  ATQ+ GP +PI +     +   +++D K+FKA+  LR+ 
Sbjct: 125 IFPRKAAKPKKGDSTEEELKMATQLTGPVMPIKKVHKKEKARVISEDEKNFKAFASLRMA 184

Query: 344 RTNERHIG 321
           R N R  G
Sbjct: 185 RANARLFG 192



>gb:AY231817_1177110 Drosophila yakuba clone yak-em_RpL13 mRNA
           sequence.
          Length = 218

 Score =  198 bits (503), Expect = 1e-49
 Identities = 100/191 (52%), Positives = 130/191 (68%), Gaps = 1/191 (0%)
 Frame = -3

Query: 890 KHNNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQT 711
           K NN++P+ H+ K WQ +VKTWFNQP             A  +FPRP +GALRP+V   T
Sbjct: 3   KGNNMIPNQHYHKWWQRHVKTWFNQPARKVRRHANRVKKAKAVFPRPASGALRPVVRCPT 62

Query: 710 LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK 531
           ++Y+ K+RAGRGF+LEELK AGI    A TIGI+VD RR+N SLE  Q N+QRLK Y++K
Sbjct: 63  IRYHTKLRAGRGFTLEELKGAGIGANFAKTIGIAVDRRRKNKSLESRQRNIQRLKEYRSK 122

Query: 530 LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREK-ASVEFVKVTDDMKSFKAYDKL 354
           L++FP   +K +AG+S+ EE   ATQ+ GP LPI  E+ A VEF +VT D K FKA+  L
Sbjct: 123 LILFPINEKKIRAGESSLEECKLATQLKGPVLPITNEQPAVVEFREVTKDEKKFKAFATL 182

Query: 353 RLERTNERHIG 321
           R  RT+ R +G
Sbjct: 183 RKARTDARLVG 193



>sp|P41126|RL13_DROME 60S ribosomal protein L13 (BBC1 protein
           homolog).>pir|JC4260|JC4260 breast basic conserved
           protein 1 - fruit fly (Drosophila
           melanogaster)>gb:AE014134_1128464 Drosophila
           melanogaster chromosome 2L, complete
           sequence.>gb:AE003626_1218571 Drosophila melanogaster
           chromosome 2L, section 35 of 83 of the complete
           sequence.>gb:DMBBBC1_1378128 D.melanogaster (Brighton)
           BBC1 gene.
          Length = 218

 Score =  197 bits (502), Expect = 2e-49
 Identities = 100/191 (52%), Positives = 130/191 (68%), Gaps = 1/191 (0%)
 Frame = -3

Query: 890 KHNNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQT 711
           K NN++P+ H+ K WQ +VKTWFNQP             A  +FPRP +GALRP+V   T
Sbjct: 3   KGNNMIPNQHYHKWWQRHVKTWFNQPARKVRRHANRVKKAKAVFPRPASGALRPVVRCPT 62

Query: 710 LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK 531
           ++Y+ K+RAGRGF+LEELK AGI    A TIGI+VD RR+N SLE  Q N+QRLK Y++K
Sbjct: 63  IRYHTKLRAGRGFTLEELKGAGIGANFAKTIGIAVDRRRKNKSLESRQRNIQRLKEYRSK 122

Query: 530 LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREK-ASVEFVKVTDDMKSFKAYDKL 354
           L++FP   +K +AG+S+ EE   ATQ+ GP LPI  E+ A VEF +VT D K FKA+  L
Sbjct: 123 LILFPINEKKIRAGESSLEECKLATQLKGPVLPIKNEQPAVVEFREVTKDEKKFKAFATL 182

Query: 353 RLERTNERHIG 321
           R  RT+ R +G
Sbjct: 183 RKARTDARLVG 193



>gb:AF487458_1804283 Triticum aestivum BBC1-like protein mRNA,
           complete cds.
          Length = 142

 Score =  197 bits (500), Expect = 3e-49
 Identities = 99/127 (77%), Positives = 112/127 (88%), Gaps = 1/127 (0%)
 Frame = -3

Query: 698 MKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVF 519
           MK RAGRGF+LEELK+AGI KKLAPTIGISVDHRR+N SLEG+Q+N+QRLKTYKAKLV+F
Sbjct: 1   MKARAGRGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGMQSNIQRLKTYKAKLVIF 60

Query: 518 PRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLER 342
           PRRARK KAGDSTPEELA ATQV G Y+PI R EK SVE VKVT++MK FKAY KLR+ER
Sbjct: 61  PRRARKVKAGDSTPEELANATQVQGDYMPIARGEKRSVEVVKVTEEMKEFKAYGKLRVER 120

Query: 341 TNERHIG 321
            N+R +G
Sbjct: 121 MNQRQLG 127



>pir|S42877|S42877 ribosomal protein L13.e, cytosolic - fruit fly
           (Drosophila melanogaster)
          Length = 217

 Score =  194 bits (492), Expect = 3e-48
 Identities = 100/191 (52%), Positives = 130/191 (68%), Gaps = 1/191 (0%)
 Frame = -3

Query: 890 KHNNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQT 711
           K NN++P+ H+ K WQ +VKTWFNQP             A  +FPRP +GALRP+V   T
Sbjct: 3   KGNNMIPNQHYHKWWQRHVKTWFNQPARKVRRHANRVKKAKAVFPRPASGALRPVVRCPT 62

Query: 710 LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK 531
           ++Y+ K+RAGRGF+LEELK AGI    A TIGI+VD RR+N SLE  Q N+QRLK Y++K
Sbjct: 63  IRYHTKLRAGRGFTLEELKGAGIGANFAKTIGIAVDRRRKNKSLESRQRNIQRLKEYRSK 122

Query: 530 LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREK-ASVEFVKVTDDMKSFKAYDKL 354
           L++FP   +K +AG+S+ EE   ATQ+ GP LPI  E+ A VEF +VT D K FKA+  L
Sbjct: 123 LILFPINEKKIRAGESSLEECKLATQLKGPVLPIKNEQPAVVEFREVTKDEKKFKAFATL 182

Query: 353 RLERTNERHIG 321
           R  RT+ R +G
Sbjct: 183 R-TRTDARLVG 192



>gb:CHKESTFL03_2569022 Gallus gallus mRNA for human bbc1 (breast
           basic conserved gene) product homologue, complete cds,
           clone CLFEST14.
          Length = 211

 Score =  191 bits (486), Expect = 1e-47
 Identities = 103/192 (53%), Positives = 127/192 (66%), Gaps = 4/192 (2%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N ++   HF K WQ  V TWFNQP             A +I PRP AG +RPIV   T++
Sbjct: 6   NGMILKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPVAGPIRPIVRCPTVR 65

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           Y+ KVRAGRGFSLEELK AGI K+ A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct: 66  YHKKVRAGRGFSLEELKLAGINKRFARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLI 125

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDK 357
           +FPR+    K GDS+PEEL  ATQ++GP +PI     REKA V    ++++ K+FKA+  
Sbjct: 126 LFPRKPSAPKKGDSSPEELKMATQLSGPVMPIRNVFKREKARV----ISEEEKNFKAFAS 181

Query: 356 LRLERTNERHIG 321
           LR+ R N R  G
Sbjct: 182 LRMARANARLFG 193



>sp|P41125|RL13_CHICK 60S ribosomal protein L13 (Breast basic
           conserved protein 1).
          Length = 210

 Score =  191 bits (486), Expect = 1e-47
 Identities = 103/192 (53%), Positives = 127/192 (66%), Gaps = 4/192 (2%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N ++   HF K WQ  V TWFNQP             A +I PRP AG +RPIV   T++
Sbjct: 5   NGMILKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPVAGPIRPIVRCPTVR 64

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           Y+ KVRAGRGFSLEELK AGI K+ A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct: 65  YHKKVRAGRGFSLEELKLAGINKRFARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLI 124

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDK 357
           +FPR+    K GDS+PEEL  ATQ++GP +PI     REKA V    ++++ K+FKA+  
Sbjct: 125 LFPRKPSAPKKGDSSPEELKMATQLSGPVMPIRNVFKREKARV----ISEEEKNFKAFAS 180

Query: 356 LRLERTNERHIG 321
           LR+ R N R  G
Sbjct: 181 LRMARANARLFG 192



>gb:BC075140_2558253 Xenopus laevis ribosomal protein L13, mRNA
           (cDNA clone MGC:81947 IMAGE:7009865), complete cds.
          Length = 211

 Score =  189 bits (481), Expect = 5e-47
 Identities = 103/192 (53%), Positives = 125/192 (65%), Gaps = 4/192 (2%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N ++   HF K WQ  V TWFNQP             A  + PRP +G +RP+V   T +
Sbjct: 6   NGMILKPHFHKDWQRRVTTWFNQPARKIRRRKARQVKARLVAPRPVSGPVRPVVRCPTNR 65

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           Y+ KVRAGRGFSLEELKAAGI KK+A TIGISVD RRRN S EGLQ NVQRLK Y++KL+
Sbjct: 66  YHTKVRAGRGFSLEELKAAGINKKVARTIGISVDPRRRNKSTEGLQTNVQRLKEYRSKLI 125

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDK 357
           VFPR+    K GDST EEL  ATQ+ GP +PI     +EKA V    +T++ K+FKA+  
Sbjct: 126 VFPRKPSAPKKGDSTAEELKLATQLKGPIMPIRSVYKKEKARV----ITEEEKNFKAFAS 181

Query: 356 LRLERTNERHIG 321
           LR+ R N R  G
Sbjct: 182 LRMARANARLFG 193



>gb:BC058143_2103059 Rattus norvegicus ribosomal protein L13, mRNA
           (cDNA clone MGC:72796 IMAGE:6919851), complete cds.
          Length = 211

 Score =  187 bits (475), Expect = 3e-46
 Identities = 97/188 (51%), Positives = 122/188 (64%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N ++   HF K WQ  V TWFNQP             A +I PRP +G +RPIV   T++
Sbjct: 6   NGMILKPHFHKDWQQRVDTWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVR 65

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           Y+ KVRAGRGFSLEEL+ AGI KK+A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct: 66  YHTKVRAGRGFSLEELRVAGIHKKMARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLI 125

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLE 345
           +FPR+    K GDS+ EEL  ATQ+ GP +PI       +   +T++ K+FKA+  LR+ 
Sbjct: 126 LFPRKPSAPKKGDSSAEELKLATQLTGPVMPIRNVYKKEKARAITEEEKNFKAFASLRMA 185

Query: 344 RTNERHIG 321
           R N R  G
Sbjct: 186 RANARLFG 193



>gb:BC066320_1987059 Homo sapiens ribosomal protein L13, transcript
           variant 1, mRNA (cDNA clone MGC:87209 IMAGE:5300601),
           complete cds.
          Length = 211

 Score =  187 bits (475), Expect = 3e-46
 Identities = 101/192 (52%), Positives = 126/192 (65%), Gaps = 4/192 (2%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N +V   HF K WQ  V TWFNQP             A +I PRP +G +RPIV   T++
Sbjct: 6   NGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCTTVR 65

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           Y+ KVRAGRGFSLEEL+ AGI KK+A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct: 66  YHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLI 125

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDK 357
           +FPR+    K GDS+ EEL  ATQ+ GP +P+     +EKA V    +T++ K+FKA+  
Sbjct: 126 LFPRKPSAPKKGDSSAEELKLATQLTGPVMPVRNVYKKEKARV----ITEEEKNFKAFAS 181

Query: 356 LRLERTNERHIG 321
           LR+ R N R  G
Sbjct: 182 LRMARANARLFG 193



>gb:AB062392_1868880 Homo sapiens OK/SW-cl.46 mRNA for ribosomal
           protein L13, complete cds.>gb:BC004954_1969473 Homo
           sapiens ribosomal protein L13, mRNA (cDNA clone
           MGC:10897 IMAGE:3623320), complete
           cds.>gb:BC007345_1970660 Homo sapiens ribosomal protein
           L13, transcript variant 1, mRNA (cDNA clone MGC:15415
           IMAGE:3688320), complete cds.>gb:BC007563_1970814 Homo
           sapiens ribosomal protein L13, transcript variant 2,
           mRNA (cDNA clone MGC:15490 IMAGE:2989021), complete
           cds.>gb:BC007805_1971004 Homo sapiens ribosomal protein
           L13, transcript variant 1, mRNA (cDNA clone MGC:14332
           IMAGE:4298327), complete cds.>gb:BC010994_1972878 Homo
           sapiens ribosomal protein L13, transcript variant 1,
           mRNA (cDNA clone MGC:15073 IMAGE:3842093), complete
           cds.>gb:BC013078_1973939 Homo sapiens ribosomal protein
           L13, transcript variant 1, mRNA (cDNA clone MGC:17534
           IMAGE:3459415), complete cds.>gb:BC014167_1974441 Homo
           sapiens ribosomal protein L13, transcript variant 1,
           mRNA (cDNA clone MGC:20892 IMAGE:4550361), complete
           cds.>gb:BC020804_1977217 Homo sapiens ribosomal protein
           L13, mRNA (cDNA clone MGC:23822 IMAGE:4276103), complete
           cds.>gb:BC027463_1978898 Homo sapiens ribosomal protein
           L13, transcript variant 1, mRNA (cDNA clone MGC:34920
           IMAGE:5111302), complete cds.>gb:BC063378_1986153 Homo
           sapiens ribosomal protein L13, transcript variant 1,
           mRNA (cDNA clone MGC:71373 IMAGE:3542514), complete cds.
          Length = 211

 Score =  187 bits (475), Expect = 3e-46
 Identities = 101/192 (52%), Positives = 126/192 (65%), Gaps = 4/192 (2%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N +V   HF K WQ  V TWFNQP             A +I PRP +G +RPIV   T++
Sbjct: 6   NGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVR 65

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           Y+ KVRAGRGFSLEEL+ AGI KK+A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct: 66  YHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLI 125

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDK 357
           +FPR+    K GDS+ EEL  ATQ+ GP +P+     +EKA V    +T++ K+FKA+  
Sbjct: 126 LFPRKPSAPKKGDSSAEELKLATQLTGPVMPVRNVYKKEKARV----ITEEEKNFKAFAS 181

Query: 356 LRLERTNERHIG 321
           LR+ R N R  G
Sbjct: 182 LRMARANARLFG 193



>gb:AK010989_1156112 Mus musculus 13 days embryo liver cDNA, RIKEN
           full-length enriched library, clone:2510022D06
           product:ribosomal protein L13, full insert sequence.
          Length = 207

 Score =  187 bits (475), Expect = 3e-46
 Identities = 101/192 (52%), Positives = 126/192 (65%), Gaps = 4/192 (2%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N ++   HF K WQ  V TWFNQP             A +I PRP +G +RPIV   T++
Sbjct: 6   NGMILKPHFHKDWQQRVDTWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVR 65

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           Y+ KVRAGRGFSLEEL+ AGI KK+A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct: 66  YHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLI 125

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDK 357
           +FPR+    K GDS+ EEL  ATQ+ GP +PI     +EKA V    +T++ K+FKA+  
Sbjct: 126 LFPRKPSAPKKGDSSAEELKLATQLTGPVMPIRNVYKKEKARV----ITEEEKNFKAFAS 181

Query: 356 LRLERTNERHIG 321
           LR+ R N R  G
Sbjct: 182 LRMARANARLFG 193



>gb:AK002787_1151444 Mus musculus adult male kidney cDNA, RIKEN
           full-length enriched library, clone:0610038B12
           product:ribosomal protein L13, full insert
           sequence.>gb:BC055358_2102009 Mus musculus ribosomal
           protein L13, mRNA (cDNA clone MGC:68013 IMAGE:5352468),
           complete cds.
          Length = 211

 Score =  187 bits (475), Expect = 3e-46
 Identities = 101/192 (52%), Positives = 126/192 (65%), Gaps = 4/192 (2%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N ++   HF K WQ  V TWFNQP             A +I PRP +G +RPIV   T++
Sbjct: 6   NGMILKPHFHKDWQQRVDTWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVR 65

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           Y+ KVRAGRGFSLEEL+ AGI KK+A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct: 66  YHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLI 125

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDK 357
           +FPR+    K GDS+ EEL  ATQ+ GP +PI     +EKA V    +T++ K+FKA+  
Sbjct: 126 LFPRKPSAPKKGDSSAEELKLATQLTGPVMPIRNVYKKEKARV----ITEEEKNFKAFAS 181

Query: 356 LRLERTNERHIG 321
           LR+ R N R  G
Sbjct: 182 LRMARANARLFG 193



>sp|P41123|RL13_RAT 60S ribosomal protein L13.
          Length = 210

 Score =  187 bits (475), Expect = 3e-46
 Identities = 97/188 (51%), Positives = 122/188 (64%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N ++   HF K WQ  V TWFNQP             A +I PRP +G +RPIV   T++
Sbjct: 5   NGMILKPHFHKDWQQRVDTWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVR 64

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           Y+ KVRAGRGFSLEEL+ AGI KK+A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct: 65  YHTKVRAGRGFSLEELRVAGIHKKMARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLI 124

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLE 345
           +FPR+    K GDS+ EEL  ATQ+ GP +PI       +   +T++ K+FKA+  LR+ 
Sbjct: 125 LFPRKPSAPKKGDSSAEELKLATQLTGPVMPIRNVYKKEKARAITEEEKNFKAFASLRMA 184

Query: 344 RTNERHIG 321
           R N R  G
Sbjct: 185 RANARLFG 192



>sp|P47963|RL13_MOUSE 60S ribosomal protein L13 (A52).
          Length = 210

 Score =  187 bits (475), Expect = 3e-46
 Identities = 101/192 (52%), Positives = 126/192 (65%), Gaps = 4/192 (2%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N ++   HF K WQ  V TWFNQP             A +I PRP +G +RPIV   T++
Sbjct: 5   NGMILKPHFHKDWQQRVDTWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVR 64

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           Y+ KVRAGRGFSLEEL+ AGI KK+A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct: 65  YHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLI 124

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDK 357
           +FPR+    K GDS+ EEL  ATQ+ GP +PI     +EKA V    +T++ K+FKA+  
Sbjct: 125 LFPRKPSAPKKGDSSAEELKLATQLTGPVMPIRNVYKKEKARV----ITEEEKNFKAFAS 180

Query: 356 LRLERTNERHIG 321
           LR+ R N R  G
Sbjct: 181 LRMARANARLFG 192



>sp|P26373|RL13_HUMAN 60S ribosomal protein L13 (Breast basic
           conserved protein 1).
          Length = 210

 Score =  187 bits (475), Expect = 3e-46
 Identities = 101/192 (52%), Positives = 126/192 (65%), Gaps = 4/192 (2%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N +V   HF K WQ  V TWFNQP             A +I PRP +G +RPIV   T++
Sbjct: 5   NGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVR 64

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           Y+ KVRAGRGFSLEEL+ AGI KK+A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct: 65  YHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLI 124

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDK 357
           +FPR+    K GDS+ EEL  ATQ+ GP +P+     +EKA V    +T++ K+FKA+  
Sbjct: 125 LFPRKPSAPKKGDSSAEELKLATQLTGPVMPVRNVYKKEKARV----ITEEEKNFKAFAS 180

Query: 356 LRLERTNERHIG 321
           LR+ R N R  G
Sbjct: 181 LRMARANARLFG 192



>gb:AF401567_2491994 Ictalurus punctatus ribosomal protein L13 mRNA,
           complete cds.
          Length = 211

 Score =  186 bits (473), Expect = 4e-46
 Identities = 96/188 (51%), Positives = 121/188 (64%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N ++ + HF K WQ  V+TWFNQP             A +I PRP AG LRPIV   T++
Sbjct: 6   NGMILNPHFHKDWQKRVRTWFNQPARKLRRRKARQAKARRIAPRPVAGPLRPIVRCPTVR 65

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           YN KVRAGRGF+LEELKAAGI K++A TIGI+VD RRRN S E L  NVQRLK Y++KL+
Sbjct: 66  YNTKVRAGRGFTLEELKAAGINKRVARTIGIAVDPRRRNRSTESLHVNVQRLKVYRSKLI 125

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLE 345
           +FPR+    K GDST EE+  ATQ+ GP +PI       +   +T++ K F A+  LR+ 
Sbjct: 126 LFPRKVSAPKKGDSTEEEVKMATQLTGPVMPIKIVHKKEKARMITEEEKKFNAFANLRMA 185

Query: 344 RTNERHIG 321
           R N R  G
Sbjct: 186 RANARLFG 193



>sp|Q90YV5|RL13_ICTPU 60S ribosomal protein L13.
          Length = 210

 Score =  186 bits (473), Expect = 4e-46
 Identities = 96/188 (51%), Positives = 121/188 (64%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N ++ + HF K WQ  V+TWFNQP             A +I PRP AG LRPIV   T++
Sbjct: 5   NGMILNPHFHKDWQKRVRTWFNQPARKLRRRKARQAKARRIAPRPVAGPLRPIVRCPTVR 64

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           YN KVRAGRGF+LEELKAAGI K++A TIGI+VD RRRN S E L  NVQRLK Y++KL+
Sbjct: 65  YNTKVRAGRGFTLEELKAAGINKRVARTIGIAVDPRRRNRSTESLHVNVQRLKVYRSKLI 124

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLE 345
           +FPR+    K GDST EE+  ATQ+ GP +PI       +   +T++ K F A+  LR+ 
Sbjct: 125 LFPRKVSAPKKGDSTEEEVKMATQLTGPVMPIKIVHKKEKARMITEEEKKFNAFANLRMA 184

Query: 344 RTNERHIG 321
           R N R  G
Sbjct: 185 RANARLFG 192



>gb:BC041531_2547979 Xenopus laevis mRNA similar to ribosomal
           protein L13 (cDNA clone MGC:53222 IMAGE:5543356),
           complete cds.
          Length = 211

 Score =  186 bits (471), Expect = 8e-46
 Identities = 100/192 (52%), Positives = 125/192 (65%), Gaps = 4/192 (2%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N ++   HF K WQ  V TWFNQP             A  + PRP +G +RP+V   T++
Sbjct: 6   NGMILKPHFHKDWQRRVTTWFNQPARKIRRRKARQVKARLVAPRPVSGPVRPVVRCPTVR 65

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           Y+ KVRAGRGFSLEELKAAGI KK+A TIGI+VD RRRN S EGLQ NVQRLK Y++KL+
Sbjct: 66  YHTKVRAGRGFSLEELKAAGINKKVARTIGIAVDPRRRNKSTEGLQTNVQRLKEYRSKLI 125

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDK 357
           +FPR+    K GDST EEL  ATQ+ G  +PI     +EKA V    +T++ K+FKA+  
Sbjct: 126 IFPRKPSAPKKGDSTAEELKLATQLKGIVMPIRSVYKKEKARV----ITEEEKNFKAFAS 181

Query: 356 LRLERTNERHIG 321
           LR+ R N R  G
Sbjct: 182 LRMARANARLFG 193



>pir|S23753|S23753 ribosomal protein L13, cytosolic -
           human>gb:HSBBC1_2010991 H.sapiens BBC1 mRNA.
          Length = 211

 Score =  186 bits (471), Expect = 8e-46
 Identities = 100/192 (52%), Positives = 125/192 (65%), Gaps = 4/192 (2%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N +V   HF K WQ  V TWFNQP             A +I PRP +G +RPIV   T++
Sbjct: 6   NGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVR 65

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           Y+ KVRAGRGFSLEEL+ AGI KK+A TIGISVD RRRN S E LQ NVQRLK Y++KL+
Sbjct: 66  YHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQTNVQRLKEYRSKLI 125

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDK 357
           +FPR+    K GDS+ EEL  ATQ+ GP +P+     +EKA V    +T++ K+FKA+  
Sbjct: 126 LFPRKPSAPKKGDSSAEELKLATQLTGPVMPVRNVYKKEKARV----ITEEEKNFKAFAS 181

Query: 356 LRLERTNERHIG 321
           LR+ R N R  G
Sbjct: 182 LRMARANARLFG 193



>gb:BC062495_2553375 Xenopus tropicalis ribosomal protein L13, mRNA
           (cDNA clone MGC:75681 IMAGE:5380148), complete cds.
          Length = 211

 Score =  185 bits (469), Expect = 1e-45
 Identities = 96/188 (51%), Positives = 121/188 (64%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N ++   HF K WQ  V TWFNQP             A  + PRP +G +RP+V   T++
Sbjct: 6   NGMILKPHFHKDWQRRVATWFNQPARKIRRRKARQVKARLVAPRPVSGPVRPVVKCPTIR 65

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           Y+ KVR GRGFSLEELKAAGI KK+A TIGISVD RRRN S EGLQ NVQRLK Y++KL+
Sbjct: 66  YHTKVRMGRGFSLEELKAAGINKKVARTIGISVDPRRRNRSTEGLQTNVQRLKEYRSKLI 125

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLE 345
           +FPR+    K GDS+ EEL  ATQ+ GP +PI       +   +T++ K+FKA+  LR+ 
Sbjct: 126 IFPRKPAAPKKGDSSAEELKLATQLKGPVMPIRSVYKKEKPRVITEEEKNFKAFASLRMA 185

Query: 344 RTNERHIG 321
           R N R  G
Sbjct: 186 RANARLFG 193



>pir|JC2368|JC2368 ribosomal protein L13, cytosolic [validated] -
           rat>gb:RNSDRPL13_2136445 R.norvegicus (Sprague Dawley)
           ribosomal protein L13 mRNA.
          Length = 211

 Score =  185 bits (469), Expect = 1e-45
 Identities = 96/188 (51%), Positives = 121/188 (64%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N ++   HF K WQ  V TWFNQP             A +I PRP +G + PIV   T++
Sbjct: 6   NGMILKPHFHKDWQQRVDTWFNQPARKIRRRKARQAKARRIAPRPASGPISPIVRCPTVR 65

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           Y+ KVRAGRGFSLEEL+ AGI KK+A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct: 66  YHTKVRAGRGFSLEELRVAGIHKKMARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLI 125

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLE 345
           +FPR+    K GDS+ EEL  ATQ+ GP +PI       +   +T++ K+FKA+  LR+ 
Sbjct: 126 LFPRKPSAPKKGDSSAEELKLATQLTGPVMPIRNVYKKEKARAITEEEKNFKAFASLRMA 185

Query: 344 RTNERHIG 321
           R N R  G
Sbjct: 186 RANARLFG 193



>gb:MMU28917_2120261 Mus musculus 60S ribosomal protein (A52) mRNA,
           complete cds.
          Length = 213

 Score =  184 bits (468), Expect = 2e-45
 Identities = 99/187 (52%), Positives = 124/187 (66%), Gaps = 4/187 (2%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N ++   HF K WQ  V TWFNQP             A +I PRP +G +RPIV   T++
Sbjct: 6   NGMILKPHFHKDWQQRVDTWFNQPARKIRRRKARLAKARRIAPRPASGPIRPIVRCPTVR 65

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           Y+ KVRAGRGFSLEEL+ AGI KK+A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct: 66  YHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLI 125

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDK 357
           +FPR+    K GDS+ EEL  ATQ+ GP +PI     +EKA V    +T++ K+FKA+  
Sbjct: 126 LFPRKPSAPKKGDSSAEELKLATQLTGPVMPIRNVYKKEKARV----ITEEEKNFKAFAS 181

Query: 356 LRLERTN 336
           LR+ R N
Sbjct: 182 LRMARAN 188



>gb:AB014876_2043800 Cricetulus griseus mRNA for robosomal protein
           L13, complete cds.
          Length = 211

 Score =  184 bits (466), Expect = 3e-45
 Identities = 100/192 (52%), Positives = 125/192 (65%), Gaps = 4/192 (2%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N ++   HF K WQ  V TWFNQP             A +I PRP +G +RPIV   T++
Sbjct: 6   NGMILKPHFHKDWQRRVDTWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVR 65

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           Y+ KVRAGRGFSLEEL+ AGI KK+A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct: 66  YHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLI 125

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDK 357
           +FPR+    K GDS+ EEL  ATQ+ GP + I     +EKA V    +T++ K+FKA+  
Sbjct: 126 LFPRKPSAPKKGDSSAEELKLATQLTGPVMRIRNVYKKEKARV----ITEEEKNFKAFAS 181

Query: 356 LRLERTNERHIG 321
           LR+ R N R  G
Sbjct: 182 LRMARANARLFG 193



>sp|Q9Z313|RL13_CRIGR 60S ribosomal protein L13.
          Length = 210

 Score =  184 bits (466), Expect = 3e-45
 Identities = 100/192 (52%), Positives = 125/192 (65%), Gaps = 4/192 (2%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N ++   HF K WQ  V TWFNQP             A +I PRP +G +RPIV   T++
Sbjct: 5   NGMILKPHFHKDWQRRVDTWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVR 64

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           Y+ KVRAGRGFSLEEL+ AGI KK+A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct: 65  YHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLI 124

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDK 357
           +FPR+    K GDS+ EEL  ATQ+ GP + I     +EKA V    +T++ K+FKA+  
Sbjct: 125 LFPRKPSAPKKGDSSAEELKLATQLTGPVMRIRNVYKKEKARV----ITEEEKNFKAFAS 180

Query: 356 LRLERTNERHIG 321
           LR+ R N R  G
Sbjct: 181 LRMARANARLFG 192



>gb:AY130423_2514080 Scyliorhinus canicula ribosomal protein L13
           mRNA, partial cds.
          Length = 180

 Score =  179 bits (453), Expect = 9e-44
 Identities = 93/176 (52%), Positives = 120/176 (68%), Gaps = 4/176 (2%)
 Frame = -3

Query: 836 VKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRGFSLEEL 657
           V+TWFNQP             A +I PRP AG LRP+V   T++Y+ KVRAGRGFSLEEL
Sbjct: 3   VRTWFNQPARKVRRRKARLAKARRIAPRPVAGPLRPVVRCPTVRYHTKVRAGRGFSLEEL 62

Query: 656 KAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFKAGDSTP 477
           KAAG+ +++A TIGI+VDHRRRN S E +Q NVQRLK Y++K ++FPR+A   K GDS+ 
Sbjct: 63  KAAGVNRRVARTIGIAVDHRRRNKSAESIQCNVQRLKEYRSKFIIFPRKASMPKKGDSSA 122

Query: 476 EELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG 321
           EE+  ATQ+ GP +PI     REKA V    +++D K+FKA+  LR+ R N R  G
Sbjct: 123 EEIKVATQLTGPIMPIKNIYKREKARV----ISEDEKNFKAFASLRMARANARLFG 174



>gb:AY769282_1350433 Bombyx mori ribosomal protein L13 (RpL13) mRNA,
           complete cds.
          Length = 220

 Score =  179 bits (453), Expect = 9e-44
 Identities = 90/190 (47%), Positives = 123/190 (64%)
 Frame = -3

Query: 890 KHNNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQT 711
           K NN++P+GHF K WQ +VKTWFNQP             A  + PRP AG LRPIV   T
Sbjct: 3   KGNNMIPNGHFHKDWQRFVKTWFNQPARRYRRKQNRIKKAKAVAPRPAAGPLRPIVRCPT 62

Query: 710 LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK 531
           ++Y+ KVRAGRGF+L E++AAG+    A TIGI+VD RRRN S+E LQ NVQR+K Y+A+
Sbjct: 63  VRYHTKVRAGRGFTLREIRAAGLNPVFARTIGIAVDPRRRNKSVESLQINVQRIKEYRAR 122

Query: 530 LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLR 351
           L++FP + +K   G++  EE   ATQ+ GP +P+ +         +T+D K+FKAY  LR
Sbjct: 123 LILFP-KGKKVLKGEANEEERKLATQLRGPLMPVQQPAPKSVARPITEDEKNFKAYQYLR 181

Query: 350 LERTNERHIG 321
             R+  + +G
Sbjct: 182 GARSIAKLVG 191



>gb:AY846882_1353723 Helicoverpa zea ribosomal protein L13 (RpL13)
           mRNA, complete cds.
          Length = 221

 Score =  178 bits (451), Expect = 2e-43
 Identities = 89/190 (46%), Positives = 122/190 (64%)
 Frame = -3

Query: 890 KHNNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQT 711
           K NN++P+GHF K WQ +VKTWFNQP             A  I PRP AG LRP+V   T
Sbjct: 3   KGNNMIPNGHFHKDWQRFVKTWFNQPARRHRRKQNRIKKAKAIAPRPAAGPLRPVVRCPT 62

Query: 710 LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK 531
           ++Y+ KVRAGRGF+L E++AAG+    A TIG++VD RRRN S+E LQ NVQRLK Y+A+
Sbjct: 63  IRYHTKVRAGRGFTLREIRAAGLNPAFARTIGVAVDPRRRNKSVESLQVNVQRLKEYRAR 122

Query: 530 LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLR 351
           L++FP + +K   G++  EE   ATQ+ GP +P+ +         +T++ K FKAY  LR
Sbjct: 123 LILFP-KGKKVLKGEANEEERKLATQLRGPLMPVQQPAPKSIARAITEEEKDFKAYQYLR 181

Query: 350 LERTNERHIG 321
             R+  + +G
Sbjct: 182 GARSIAKLVG 191



>sp|Q962U1|RL13_SPOFR 60S ribosomal protein L13.>gb:AF400183_1268282
           Spodoptera frugiperda ribosomal protein L13 mRNA,
           complete cds.
          Length = 219

 Score =  178 bits (451), Expect = 2e-43
 Identities = 89/190 (46%), Positives = 122/190 (64%)
 Frame = -3

Query: 890 KHNNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQT 711
           K NN++P+GHF K WQ +VKTWFNQP             A  + PRP AG LRP+V   T
Sbjct: 3   KGNNMIPNGHFHKDWQRFVKTWFNQPARRHRRKQNRIKKAKAVAPRPAAGPLRPVVRCPT 62

Query: 710 LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK 531
           ++Y+ KVRAGRGF+L E++AAG+    A TIGI+VD RRRN S+E LQ NVQRLK Y+A+
Sbjct: 63  IRYHTKVRAGRGFTLREIRAAGLNPAFARTIGIAVDPRRRNKSVESLQVNVQRLKEYRAR 122

Query: 530 LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLR 351
           L++FP + +K   G++  EE   ATQ+ GP +P+ +         +T++ K FKAY  LR
Sbjct: 123 LILFP-KGKKVLKGEANEEERKLATQLRGPLMPVQQPAPKSIARAITEEEKDFKAYQYLR 181

Query: 350 LERTNERHIG 321
             R+  + +G
Sbjct: 182 GARSIAKLVG 191



>gb:AB179618_1202394 Antheraea yamamai mRNA for 60S ribosomal
           protein L13, complete cds.
          Length = 221

 Score =  177 bits (448), Expect = 3e-43
 Identities = 88/190 (46%), Positives = 123/190 (64%)
 Frame = -3

Query: 890 KHNNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQT 711
           K NN++P+GHF K WQ +VKTWFNQP             A  + PRP AG LRP+V   T
Sbjct: 3   KGNNMIPNGHFHKDWQRFVKTWFNQPARRHRRKQNRIKKAKAVAPRPAAGPLRPVVRCPT 62

Query: 710 LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK 531
           ++Y+ KVRAGRGF+L E++A+G+    A TIGI+VD RRRN S+E LQ NVQRLK Y+A+
Sbjct: 63  VRYHTKVRAGRGFTLREIRASGLNPAFARTIGIAVDPRRRNKSVESLQINVQRLKEYRAR 122

Query: 530 LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLR 351
           L++FP + +K   G++  EE   ATQ+ GP +P+ +         +T++ K+FKAY  LR
Sbjct: 123 LILFP-KGKKVLKGEANEEERKLATQLRGPLMPVQQTAPKSVARPITEEEKNFKAYQYLR 181

Query: 350 LERTNERHIG 321
             R+  + +G
Sbjct: 182 GARSIAKLVG 191



>gb:AY220747_1310452 Schistosoma japonicum breast basic conserved
           protein (BBC1) mRNA, complete cds.
          Length = 204

 Score =  175 bits (444), Expect = 1e-42
 Identities = 90/188 (47%), Positives = 121/188 (64%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N+++ + HFRK WQ  +KTWFNQP             A +I PRP +G LRPIV+  T +
Sbjct: 5   NDILHNNHFRKKWQFMIKTWFNQPARKERRRKARKAKAQRIAPRPASGPLRPIVNCPTFR 64

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           YNMKVRAGRGFSL+E++AAG++ K A TIGI+VDHRRRN S+EGLQ NV RLK YKA+L+
Sbjct: 65  YNMKVRAGRGFSLQEVRAAGLSPKFARTIGIAVDHRRRNVSVEGLQRNVSRLKAYKARLI 124

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLE 345
           +FP    K +A D+  +E+   TQ++ P LPI +    ++  K T     + A+  +R  
Sbjct: 125 LFPLNPAKPQAMDAKADEVKKTTQLHRPILPITQGMKRMKAHKPTPSELRYSAFHAIRHH 184

Query: 344 RTNERHIG 321
           R N R  G
Sbjct: 185 RFNARLYG 192



>gb:AY389928_2531423 Protopterus dolloi ribosomal protein L13 mRNA,
           partial cds.
          Length = 180

 Score =  174 bits (440), Expect = 3e-42
 Identities = 94/176 (53%), Positives = 118/176 (67%), Gaps = 4/176 (2%)
 Frame = -3

Query: 836 VKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRGFSLEEL 657
           V+TWFNQP             A +I PRP AG LRP+V   T +Y+ KVRAGRGFSLEEL
Sbjct: 3   VRTWFNQPARKVRRRRARQAKARRIAPRPVAGPLRPVVRCPTFRYHTKVRAGRGFSLEEL 62

Query: 656 KAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFKAGDSTP 477
           +AAGI K++A TIGI+VD RRRN S E LQ NVQRLK Y++KL++FPR+A   K GDS+ 
Sbjct: 63  RAAGINKRVAKTIGIAVDPRRRNKSTESLQGNVQRLKEYRSKLILFPRKASLTKKGDSSA 122

Query: 476 EELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG 321
           EE+  ATQ+ GP +PI     +EKA V    +++D K FKA+  LR+ R N R  G
Sbjct: 123 EEIKMATQLVGPVMPIRQAFKKEKARV----ISEDEKHFKAFASLRMARANARLFG 174



>gb:AY389971_2531461 Xenopus laevis ribosomal protein L13 mRNA,
           partial cds.
          Length = 178

 Score =  172 bits (437), Expect = 7e-42
 Identities = 95/179 (53%), Positives = 118/179 (65%), Gaps = 4/179 (2%)
 Frame = -3

Query: 845 QNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRGFSL 666
           Q  V TWFNQP             A  + PRP +G +RP+V   T++Y+ KVRAGRGFSL
Sbjct: 1   QRRVTTWFNQPARKIRRRKARQVKARLVAPRPVSGPVRPVVRCPTVRYHTKVRAGRGFSL 60

Query: 665 EELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFKAGD 486
           EELKAAGI KK+A TIGI+VD RRRN S EGLQ NVQRLK Y++KL++FPR+    K GD
Sbjct: 61  EELKAAGINKKVARTIGIAVDPRRRNKSTEGLQTNVQRLKEYRSKLIIFPRKPSAPKKGD 120

Query: 485 STPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG 321
           ST EEL  ATQ+ G  +PI     +EKA V    +T++ K+FKA+  LR+ R N R  G
Sbjct: 121 STAEELKLATQLKGIVMPIRSVYKKEKARV----ITEEEKNFKAFASLRMARANARLFG 175



>gb:AY389927_2531422 Latimeria chalumnae ribosomal protein L13 mRNA,
           partial cds.
          Length = 180

 Score =  172 bits (437), Expect = 7e-42
 Identities = 91/172 (52%), Positives = 115/172 (66%)
 Frame = -3

Query: 836 VKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRGFSLEEL 657
           V+TWFNQP             A  I PRP AG LRPI+   T++Y+ KVRAGRGFSLEEL
Sbjct: 3   VRTWFNQPARKIRRRKARQAKARLIAPRPVAGPLRPIIRCPTVRYHTKVRAGRGFSLEEL 62

Query: 656 KAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFKAGDSTP 477
           KAA I +K+A TIGI+VD RRRN S E LQANVQRLK Y++KL++FPR+A   K GDS+ 
Sbjct: 63  KAASINRKMARTIGIAVDPRRRNRSTESLQANVQRLKEYRSKLILFPRKASAPKKGDSSA 122

Query: 476 EELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG 321
           EE+  ATQ+ GP +PI       +   +++D K+FKA+  LR+ R N R  G
Sbjct: 123 EEIKIATQLVGPIMPIRNVYKKEQARGISEDEKNFKAFASLRMARANARLFG 174



>gb:AY232046_1177339 Drosophila yakuba clone yak-ad_RpL13 mRNA
           sequence.
          Length = 156

 Score =  172 bits (436), Expect = 9e-42
 Identities = 82/154 (53%), Positives = 107/154 (69%)
 Frame = -3

Query: 890 KHNNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQT 711
           K NN++P+ H+ K WQ +VKTWFNQP             A  +FPRP +GALRP+V   T
Sbjct: 3   KGNNMIPNQHYHKWWQRHVKTWFNQPARKVRRHANRVKKAKAVFPRPASGALRPVVRCPT 62

Query: 710 LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK 531
           ++Y+ K+RAGRGF+LEELK AGI    A TIGI+VD RR+N SLE  Q N+QRLK Y++K
Sbjct: 63  IRYHTKLRAGRGFTLEELKGAGIGANFAKTIGIAVDRRRKNKSLESRQRNIQRLKEYRSK 122

Query: 530 LVVFPRRARKFKAGDSTPEELATATQVNGPYLPI 429
           L++FP   +K +AG+S+ EE   ATQ+ GP LPI
Sbjct: 123 LILFPINEKKIRAGESSLEECKLATQLKGPVLPI 156



>sp|O74175|RL13_SCHPO 60S ribosomal protein L13.>pir|T43385|T43385
           60S ribosomal protein L13 [similarity] - fission yeast
           (Schizosaccharomyces pombe)>gb:AB016216_1512782
           Schizosaccharomyces pombe mRNA for ribosomal protein L13
           homolog, complete cds.>gb:SPAC664_1718194 S.pombe
           chromosome I cosmid c664.
          Length = 208

 Score =  172 bits (436), Expect = 9e-42
 Identities = 95/185 (51%), Positives = 119/185 (64%)
 Frame = -3

Query: 875 VPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLKYNM 696
           +P+ HF K WQ YVKTWFNQP             A KI PRP   A+RP V   T++YNM
Sbjct: 9   LPNAHFHKDWQRYVKTWFNQPGRKLRRRQARQTKAAKIAPRPVE-AIRPAVKPPTIRYNM 67

Query: 695 KVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFP 516
           KVRAGRGF+LEELKAAG+++++A TIGI VDHRRRN S E LQ NV+R+K Y A L+VFP
Sbjct: 68  KVRAGRGFTLEELKAAGVSRRVASTIGIPVDHRRRNRSEESLQRNVERIKVYLAHLIVFP 127

Query: 515 RRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTN 336
           R+A + K GD+T    A  T V    LPI +E A  E   +T++ K+F A+  L  ER  
Sbjct: 128 RKAGQPKKGDATDVSGAEQTDV-AAVLPITQE-AVEEAKPITEEAKNFNAFSTLSNERAY 185

Query: 335 ERHIG 321
            R+ G
Sbjct: 186 ARYAG 190



>sp|Q95043|RL13_SCHMA 60S ribosomal protein L13 (BBC1 protein
           homolog).>gb:SMU57003_1397877 Schistosoma mansoni breast
           basic conserved protein (BBC1) mRNA, complete cds.
          Length = 184

 Score =  172 bits (436), Expect = 9e-42
 Identities = 89/178 (50%), Positives = 115/178 (64%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N+V+   HFRK WQ  VKTWFNQP             A +I PRP +G LRPIV+  T +
Sbjct: 5   NDVLHHNHFRKKWQFMVKTWFNQPARKERRRQARKAKAQRIAPRPASGPLRPIVNCPTFR 64

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           YNMKVR+GRGFSL+E++AAG+  K A TIGI+VDHRRRN S+EGLQ NV RLK YKAKL+
Sbjct: 65  YNMKVRSGRGFSLQEVRAAGLNPKFARTIGIAVDHRRRNVSVEGLQRNVARLKAYKAKLI 124

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLR 351
           +FP    K +A D+  +E+  ATQ+  P LPI +    ++  K T     + A+  +R
Sbjct: 125 LFPLNPAKPQAMDAKADEVKKATQLRRPVLPITQRAKRLKAHKPTSSELRYSAFHAIR 182



>gb:SMU58093_1397878 Schistosoma mansoni breast basic conserved
           protein (BBC1) gene, complete cds.
          Length = 184

 Score =  172 bits (435), Expect = 1e-41
 Identities = 89/178 (50%), Positives = 115/178 (64%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N+V+   HFRK WQ  VKTWFNQP             A +I PRP +G LRPIV+  T +
Sbjct: 5   NDVLHHNHFRKKWQFMVKTWFNQPARKERRRQARKAKAQRIAPRPASGPLRPIVNCPTFR 64

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           YNMKVR+GRGFSL+E++AAG+  K A TIGI+VDHRRRN S+EGLQ NV RLK YKAKL+
Sbjct: 65  YNMKVRSGRGFSLQEVRAAGLNPKFACTIGIAVDHRRRNVSVEGLQRNVARLKAYKAKLI 124

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLR 351
           +FP    K +A D+  +E+  ATQ+  P LPI +    ++  K T     + A+  +R
Sbjct: 125 LFPLNPAKPQAMDAKADEVKKATQLRRPVLPITQRAKRLKAHKPTSSELRYSAFHAIR 182



>gb:BC085493_2109238 Mus musculus cDNA clone MGC:102076
           IMAGE:6815564, complete cds.
          Length = 210

 Score =  170 bits (430), Expect = 4e-41
 Identities = 90/163 (55%), Positives = 109/163 (66%), Gaps = 4/163 (2%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N ++   HF K WQ  V TWFNQP             A +I PRP +G +RPIV   T++
Sbjct: 6   NGMILKPHFHKDWQQRVDTWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVR 65

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           Y+ KVRAGRGFSLEEL+ AGI KK+A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct: 66  YHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLI 125

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASV 408
           +FPR+    K GDS+ EEL  ATQ+ GP +PI     +EKA V
Sbjct: 126 LFPRKPSAPKKGDSSAEELKLATQLTGPVMPIRNVYKKEKARV 168



>gb:AY130420_1302455 Branchiostoma lanceolatum ribosomal protein L13
           mRNA, partial cds.
          Length = 181

 Score =  168 bits (426), Expect = 1e-40
 Identities = 87/174 (50%), Positives = 113/174 (64%)
 Frame = -3

Query: 842 NYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRGFSLE 663
           N V+TWFNQP             A ++ PRP  GALRPIV   T KY+ KVR GRGF+LE
Sbjct: 1   NRVRTWFNQPARKIRRRRSRVEKARRVAPRPAGGALRPIVRCSTFKYHTKVRVGRGFTLE 60

Query: 662 ELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFKAGDS 483
           E+KAAG+ KK A TIGISVD RRRN S E LQANVQRLK Y++KL++FP++    + GDS
Sbjct: 61  EIKAAGLNKKYARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLILFPKKLAAPRKGDS 120

Query: 482 TPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG 321
             EEL  ATQ+ GP +P+       +    T+D K ++A+  +R+ R+N R +G
Sbjct: 121 GAEELKMATQLQGPVMPVRTLYKKEKARAPTEDEKKYQAFQSMRMARSNCRLLG 174



>sp|P91128|RL13_CAEEL 60S ribosomal protein L13.>pir|T25599|T25599
           hypothetical protein C32E8.2 - Caenorhabditis
           elegans>gb:U88308_1406730 Caenorhabditis elegans cosmid
           C32E8, complete sequence.
          Length = 207

 Score =  167 bits (422), Expect = 4e-40
 Identities = 88/188 (46%), Positives = 117/188 (62%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N ++ + HFRKHW   +KTWF+QP             AV+I PRP AG LR +V     +
Sbjct: 6   NQMLGNAHFRKHWHKRIKTWFDQPARKLRRRQNRQAKAVEIAPRPVAGLLRSVVRCPQKR 65

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           YN K R GRGFSL+ELKAAGI++  A TIGI+VD RR N + EGL+AN  RLK YKAKL+
Sbjct: 66  YNTKTRLGRGFSLQELKAAGISQAQARTIGIAVDVRRTNKTAEGLKANADRLKEYKAKLI 125

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLE 345
           +FP++A   K GDS+ EEL  A Q+ G  LP+       E  +VTD  +  + +  LR E
Sbjct: 126 LFPKKASAPKKGDSSAEELKVAAQLRGDVLPLSHTITFDEPRQVTDAERKVEIFRLLRKE 185

Query: 344 RTNERHIG 321
           R ++++ G
Sbjct: 186 RADKKYRG 193



>gb:CR382128_1660864 Yarrowia lipolytica chromosome B of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 230

 Score =  156 bits (395), Expect = 5e-37
 Identities = 88/188 (46%), Positives = 114/188 (60%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N  +   HFRK+WQ  VKT F+QP             A  I PRP    LRPIV   T++
Sbjct: 29  NYPLVKNHFRKNWQERVKTHFDQPGKKSSRRLARTKKAAAIAPRPL-DLLRPIVRAPTIR 87

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           YN KVRAGRGFSLEELKAAGI +  A TIGI+VDHRR+N S+EGL+ANV RLK Y++KL+
Sbjct: 88  YNRKVRAGRGFSLEELKAAGIPRDYARTIGIAVDHRRQNRSVEGLEANVLRLKEYQSKLI 147

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLE 345
           VFP   RK K G++   + A          PI+++ A  E   ++ + K   AY  LR+ 
Sbjct: 148 VFP---RKLKKGETNEAKSAVQVLSTSATFPIVQQAAESEPRAISAEAKEQNAYRTLRMA 204

Query: 344 RTNERHIG 321
           R+ +R+ G
Sbjct: 205 RSTQRYAG 212



>sp|O46157|RL13_LUMRU 60S ribosomal protein L13.>gb:RLAJ3198_1396409
           Lumbricus rubellus mRNA for 60S ribosomal protein L13.
          Length = 188

 Score =  154 bits (388), Expect = 3e-36
 Identities = 87/172 (50%), Positives = 109/172 (63%), Gaps = 4/172 (2%)
 Frame = -3

Query: 824 FNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRGFSLEELKAAG 645
           FNQP             A+ I PRP AG+LRP V  QT KYN ++R GRGFSL+ELKAAG
Sbjct: 2   FNQPARKERRRVARRKKALAIAPRPAAGSLRPQVRCQTFKYNTRLREGRGFSLDELKAAG 61

Query: 644 ITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFKAGDSTPEELA 465
           I KK A  IGISVD RRRN S+E LQ NVQRLK Y++KL++FP++  K   GD+T EE+ 
Sbjct: 62  INKKEARAIGISVDVRRRNKSVESLQLNVQRLKEYRSKLILFPKKLSKPNKGDATEEEMK 121

Query: 464 TATQVNGPYLP----ILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG 321
            ATQ+ G  LP    I  EKA      +TD+ +  K +D+LR  R ++R  G
Sbjct: 122 LATQLKGKLLPRTAWIKPEKARA----ITDEERKVKVFDRLRQARAHKRLAG 169



>gb:AY857619_1354153 Pectinaria gouldii ribosomal protein L13 mRNA,
           complete cds.
          Length = 197

 Score =  146 bits (368), Expect = 7e-34
 Identities = 80/185 (43%), Positives = 108/185 (58%)
 Frame = -3

Query: 890 KHNNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQT 711
           K NN++P+ HF K WQN VKTWFNQP             A  + PRP  G LRP+V   T
Sbjct: 4   KRNNIIPNAHFHKDWQNRVKTWFNQPARKLRRRQTRQAKARVVAPRPVDGPLRPVVRCMT 63

Query: 710 LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK 531
            +YNMK R GRGFSL+ELK+AGI    A +IGI+VD RRRN S E LQ NVQRLK Y+++
Sbjct: 64  NRYNMKRRGGRGFSLDELKSAGIAVPTARSIGIAVDFRRRNKSTESLQQNVQRLKEYRSR 123

Query: 530 LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLR 351
           +V+  +        +  P+ + T+    G +    + K+     K+T++ K F AY  L+
Sbjct: 124 VVLLKK--------NPMPDNVQTSLSA-GQFAIKKQPKSRERPQKLTEEDKKFSAYATLK 174

Query: 350 LERTN 336
            ER +
Sbjct: 175 KERVD 179



>gb:AY130421_2514079 Myxine glutinosa ribosomal protein L13 mRNA,
           partial cds.
          Length = 143

 Score =  143 bits (360), Expect = 6e-33
 Identities = 74/139 (53%), Positives = 93/139 (66%)
 Frame = -3

Query: 845 QNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRGFSL 666
           Q  V+TWFNQP             A +I PRP AG LRP+V   T++Y+ KVRAGRGF+L
Sbjct: 1   QRRVRTWFNQPARKQRRHNKRVAKARRIAPRPVAGPLRPVVRCPTVRYHKKVRAGRGFTL 60

Query: 665 EELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFKAGD 486
            ELKAAGI ++ APT+GI+VD+RRRN S E LQ NVQRLK Y++ L++FPR+A K    D
Sbjct: 61  AELKAAGIHRRFAPTVGIAVDYRRRNRSSEALQENVQRLKLYRSSLILFPRKASKPAKTD 120

Query: 485 STPEELATATQVNGPYLPI 429
           S+ EE   A+Q  GP   I
Sbjct: 121 SSVEEQKIASQPKGPLYKI 139



>gb:AE017353_1760026 Cryptococcus neoformans var. neoformans JEC21
           chromosome 13, complete sequence.
          Length = 205

 Score =  142 bits (359), Expect = 7e-33
 Identities = 81/192 (42%), Positives = 112/192 (58%)
 Frame = -3

Query: 896 VMKHNNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHG 717
           ++KHNN +P  HF K WQ  VKTWF+QP             A+     P    LRP V  
Sbjct: 1   MVKHNNQLPKNHFHKDWQRRVKTWFDQPGKKKSRRVARSKKALASGAAPLQ-RLRPAVRC 59

Query: 716 QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK 537
            + +YN++VR GRGF+  ELK AGI +K A ++GISVD RRR+ S EG + NV+RLK YK
Sbjct: 60  PSQRYNIRVREGRGFTTSELKLAGIRRKEALSLGISVDPRRRSKSEEGQKLNVERLKEYK 119

Query: 536 AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK 357
           ++LVVFP++A K KAGD+T +  A    +    +P+     +     +TD+ K   A+  
Sbjct: 120 SRLVVFPKKAGKPKAGDATGD--ALTAHITRDSIPLPASYTAEAPRAITDEEKETNAFTT 177

Query: 356 LRLERTNERHIG 321
           LRL R  +R+ G
Sbjct: 178 LRLARAAQRNEG 189



>gb:AK003487_1151887 Mus musculus 18-day embryo whole body cDNA,
           RIKEN full-length enriched library, clone:1110006C21
           product:TAX INTERACTION PROTEIN 1
           (GLUTAMINASE-INTERACTING PROTEIN 3) (TAX-INTERACTING
           PROTEIN 1) homolog [Homo sapiens], full insert sequence.
          Length = 128

 Score =  141 bits (356), Expect = 2e-32
 Identities = 71/123 (57%), Positives = 85/123 (69%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N ++   HF K WQ  V TWFNQP             A +I PRP +G +RPIV   T++
Sbjct: 6   NGMILKPHFHKDWQQRVDTWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVR 65

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           Y+ KVRAGRGFSLEEL+ AGI KK+A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct: 66  YHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLI 125

Query: 524 VFP 516
           +FP
Sbjct: 126 LFP 128



>gb:AY144954_1583745 Saccharomyces castellii clone Contig1629 RPL13
           gene, partial cds.
          Length = 197

 Score =  140 bits (353), Expect = 4e-32
 Identities = 88/191 (46%), Positives = 111/191 (58%), Gaps = 3/191 (1%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N  +   HFRKHWQ  VK  F+Q              A KI PRP    LRP+V   T+K
Sbjct: 4   NLPILKNHFRKHWQERVKVHFDQAGKKASRRSARASRAAKIAPRPL-DLLRPVVRAPTIK 62

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           YN KVRAGRGFSL E+KAAG+T   A TIGI+VDHRR+N++ E  + NVQRLK Y++K++
Sbjct: 63  YNRKVRAGRGFSLAEVKAAGLTAAYARTIGIAVDHRRQNTNQEIFELNVQRLKEYQSKII 122

Query: 524 VFPRRARKFKAGDSTPE---ELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL 354
           VFPR A+       TPE    L+TA        PI +    VE   V D+ +S  AY  L
Sbjct: 123 VFPRNAK-------TPEVEQVLSTAAT-----FPIAQPVTDVETRAVEDNGES--AYRTL 168

Query: 353 RLERTNERHIG 321
           RL R+ +R+ G
Sbjct: 169 RLARSEKRYKG 179



>gb:AY144853_1583644 Saccharomyces bayanus clone Contig4022 RPL13
           gene, complete cds.
          Length = 199

 Score =  137 bits (345), Expect = 3e-31
 Identities = 86/188 (45%), Positives = 107/188 (56%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N  +   HFRKHWQ  VK  F+Q              A KI PRP    LRP+V   T+K
Sbjct: 6   NLPILKNHFRKHWQERVKVHFDQAGKKVSRRNARAARAAKIAPRPL-DLLRPVVRAPTVK 64

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           YN KVRAGRGF+L E+KAAG+T   A TIGI+VDHRR+N + E   ANVQRLK Y++K++
Sbjct: 65  YNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRRQNKNQEIFDANVQRLKEYQSKII 124

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLE 345
           VFPR     KA ++     A AT       PI +    VE   V D+ +S  AY  LRL 
Sbjct: 125 VFPRNG---KAPEAEQVLSAAAT------FPIAQPSTDVETRAVQDNGES--AYRTLRLA 173

Query: 344 RTNERHIG 321
           R+ +R  G
Sbjct: 174 RSEKRFRG 181



>gb:AY144852_1583643 Saccharomyces bayanus clone Contig2653 RPL13
           gene, complete cds.
          Length = 199

 Score =  136 bits (343), Expect = 5e-31
 Identities = 86/188 (45%), Positives = 107/188 (56%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N  +   HFRKHWQ  VK  F+Q              A KI PRP    LRP+V   T+K
Sbjct: 6   NLPILKNHFRKHWQERVKVHFDQAGKKVSRRNARATRAAKIAPRPL-DLLRPVVRAPTVK 64

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           YN KVRAGRGF+L E+KAAG+T   A TIGI+VDHRR+N + E   ANVQRLK Y++K++
Sbjct: 65  YNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRRQNRNQEIFDANVQRLKEYQSKII 124

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLE 345
           VFPR     KA ++     A AT       PI +    VE   V D+ +S  AY  LRL 
Sbjct: 125 VFPRNG---KAPETEQVLSAAAT------FPIAQPTTDVEARAVQDNGES--AYRTLRLA 173

Query: 344 RTNERHIG 321
           R+ +R  G
Sbjct: 174 RSEKRFRG 181



>gb:AY144953_1583744 Saccharomyces castellii clone Contig2037 RPL13
           gene, partial cds.
          Length = 197

 Score =  136 bits (342), Expect = 7e-31
 Identities = 84/190 (44%), Positives = 110/190 (57%), Gaps = 2/190 (1%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N  +   HFRKHWQ  VK  F+Q              A KI PRP    LRP+V   T+K
Sbjct: 4   NLPILKNHFRKHWQERVKVHFDQAGKKVSRRNARAAKAAKIAPRPL-DLLRPVVRAPTIK 62

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           YN KVRAGRGFSL E+KAAG+T   A TIGI+VDHRR+N++ E  + NVQRLK Y++K++
Sbjct: 63  YNRKVRAGRGFSLAEVKAAGLTAAYARTIGIAVDHRRQNTNQEIFELNVQRLKEYQSKII 122

Query: 524 VFPRRARKFKAGDSTP--EELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLR 351
           VFPR  +       TP  E++ +A        PI +    VE   V D+ +S  AY  LR
Sbjct: 123 VFPRNGK-------TPEVEQVLSAAAT----FPIAQPTTDVETRAVEDNGES--AYRTLR 169

Query: 350 LERTNERHIG 321
           L R+ +++ G
Sbjct: 170 LARSEKKYKG 179



>gb:AY145049_1583840 Kluyveromyces lactis clone P2258 RPL13 gene,
           complete cds.>gb:CR382125_1658210 Kluyveromyces lactis
           strain NRRL Y-1140 chromosome E of strain NRRL Y-1140 of
           Kluyveromyces lactis.
          Length = 199

 Score =  135 bits (341), Expect = 9e-31
 Identities = 83/188 (44%), Positives = 108/188 (57%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N  +   HFRKHWQ  VK  F+Q              A KI PRP    LRP+V   T+K
Sbjct: 6   NLPILKNHFRKHWQERVKVHFDQAGKKVSRRHARASKAAKIAPRPL-DLLRPVVRAPTVK 64

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           YN KVRAGRGF+L E+KAAG+T   A TIGI+VDHRR+N + E L  N+QRLK Y++K++
Sbjct: 65  YNRKVRAGRGFTLAEIKAAGLTPAYARTIGIAVDHRRQNRNQEILDLNIQRLKEYQSKII 124

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLE 345
           VFPR+ +        PE  A  T       PI++     E   V D+ +S  AY  LRL 
Sbjct: 125 VFPRKGK-------APE--AEQTLSAAASFPIVQPVTDSETRAVEDNGES--AYRTLRLA 173

Query: 344 RTNERHIG 321
           R+++R+ G
Sbjct: 174 RSDKRYKG 181



>gb:CR380958_1653372 Candida glabrata strain CBS138 chromosome L
           complete sequence.
          Length = 208

 Score =  135 bits (340), Expect = 1e-30
 Identities = 81/188 (43%), Positives = 107/188 (56%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N  +   HFRKHWQ  VK  F+Q              A KI PRP    LRP+V   T+K
Sbjct: 15  NLPILKNHFRKHWQERVKVHFDQAGKKESRRSARVAKAAKIAPRPL-DLLRPVVRAPTVK 73

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           YN KVRAGRGFSL E+KAAG+T   A T+GI+VDHRR+N + E    NVQRLK Y++KL+
Sbjct: 74  YNRKVRAGRGFSLAEIKAAGLTAAYARTVGIAVDHRRQNRNQETFDLNVQRLKEYQSKLI 133

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLE 345
           VFPR+ +       T + L+ A        PI +    +E   V D+ +S  A+  LRL 
Sbjct: 134 VFPRKGK----APETEQVLSVAAT-----FPIAQASTEIETRAVEDNGES--AFRTLRLA 182

Query: 344 RTNERHIG 321
           R++++  G
Sbjct: 183 RSDKKFKG 190



>sp|Q876B2|RL13_SACEX 60S ribosomal protein L13.>gb:AY144903_1583694
           Saccharomyces exiguus clone P2027 RPL13 gene, complete
           cds.
          Length = 199

 Score =  135 bits (340), Expect = 1e-30
 Identities = 81/181 (44%), Positives = 104/181 (57%)
 Frame = -3

Query: 863 HFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLKYNMKVRA 684
           HFRKHWQ  VK  FNQ              A KI PRP    LRP+V   T+KYN KVRA
Sbjct: 13  HFRKHWQERVKVHFNQAGKKASRRDARVAKAAKIAPRPL-DLLRPVVRAPTVKYNRKVRA 71

Query: 683 GRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRAR 504
           GRGF+  E+KAAG+T   A TIGI+VDHRR+N + E  + NVQRLK Y++K++VFPR  +
Sbjct: 72  GRGFTFGEVKAAGLTPAYARTIGIAVDHRRQNKNQEMFELNVQRLKEYQSKIIVFPRNGK 131

Query: 503 KFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHI 324
                  T + L+TA        PI +     E   V D+ +S  AY  LR+ R+ +R+ 
Sbjct: 132 V----PETEQVLSTAAA-----FPIAQPAVETETRAVQDNGES--AYRTLRMARSEKRYK 180

Query: 323 G 321
           G
Sbjct: 181 G 181



>sp|Q12690|R13A_YEAST 60S ribosomal protein L13-A.>pir|S67618|S67618
           ribosomal protein L13.e.A, cytosolic - yeast
           (Saccharomyces cerevisiae)>gb:SCYDL082W_1711648
           S.cerevisiae chromosome IV reading frame ORF YDL082w.
          Length = 199

 Score =  134 bits (336), Expect = 3e-30
 Identities = 84/188 (44%), Positives = 107/188 (56%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N  +   HFRKHWQ  VK  F+Q              A KI PRP    LRP+V   T+K
Sbjct: 6   NLPILKNHFRKHWQERVKVHFDQAGKKVSRRNARATRAAKIAPRPL-DLLRPVVRAPTVK 64

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           YN KVRAGRGF+L E+KAAG+T   A TIGI+VDHRR+N + E   ANVQRLK Y++K++
Sbjct: 65  YNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRRQNRNQEIFDANVQRLKEYQSKII 124

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLE 345
           VFPR     KA ++     A AT       PI +    VE   V D+ +S  A+  LRL 
Sbjct: 125 VFPRNG---KAPEAEQVLSAAAT------FPIAQPATDVEARAVQDNGES--AFRTLRLA 173

Query: 344 RTNERHIG 321
           R+ ++  G
Sbjct: 174 RSEKKFRG 181



>sp|P40212|R13B_YEAST 60S ribosomal protein L13-B.>pir|S50398|S50398
           ribosomal protein L13.e.B, cytosolic - yeast
           (Saccharomyces cerevisiae)>gb:SC9375_1705878
           S.cerevisiae chromosome XIII cosmid 9375.
          Length = 199

 Score =  133 bits (334), Expect = 6e-30
 Identities = 84/188 (44%), Positives = 107/188 (56%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N  +   HFRKHWQ  VK  F+Q              A KI PRP    LRP+V   T+K
Sbjct: 6   NLPILKNHFRKHWQERVKVHFDQAGKKVSRRNARAARAAKIAPRPL-DLLRPVVRAPTVK 64

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           YN KVRAGRGF+L E+KAAG+T   A TIGI+VDHRR+N + E   ANVQRLK Y++K++
Sbjct: 65  YNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRRQNRNQEIFDANVQRLKEYQSKII 124

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLE 345
           VFPR     KA ++     A AT       PI +    VE   V D+ +S  A+  LRL 
Sbjct: 125 VFPRDG---KAPEAEQVLSAAAT------FPIAQPATDVEARAVQDNGES--AFRTLRLA 173

Query: 344 RTNERHIG 321
           R+ ++  G
Sbjct: 174 RSEKKFRG 181



>gb:AY145015_1583806 Saccharomyces kluyveri clone P2220 RPL13 gene,
           complete cds.
          Length = 199

 Score =  132 bits (333), Expect = 8e-30
 Identities = 80/188 (42%), Positives = 110/188 (58%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N  +   HFRKHWQ  V+  F+Q              A KI P+P    LRP+V   T+K
Sbjct: 6   NLPILKNHFRKHWQERVRVHFDQAGKKVSRRNARATKAAKIAPKPL-DLLRPVVRAPTVK 64

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           YN KVRAGRGF+L E+KAAG+T   A TIGI+VDHRR+N S E  + NVQRLK Y++K++
Sbjct: 65  YNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRRQNRSTEIFELNVQRLKEYQSKII 124

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLE 345
           VFPR  +  +A     E++ +A        PI +    VE   V D+ +S  A+  LRL 
Sbjct: 125 VFPRNGKAPEA-----EQVLSAAAA----FPISQPATDVETRAVEDNGES--AFRTLRLA 173

Query: 344 RTNERHIG 321
           R+++++ G
Sbjct: 174 RSDKKYHG 181



>gb:CR382136_1668968 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 202

 Score =  132 bits (332), Expect = 1e-29
 Identities = 80/181 (44%), Positives = 101/181 (55%), Gaps = 3/181 (1%)
 Frame = -3

Query: 863 HFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLKYNMKVRA 684
           HFRKHWQ  VK   +Q              A KI PRP    LRP+V   T+KYN KVRA
Sbjct: 13  HFRKHWQERVKVHLDQAGKKASRRDHRLTKAAKIAPRPI-DTLRPVVRCPTIKYNRKVRA 71

Query: 683 GRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRAR 504
           GRGF+L ELKA G++ K A TIGISVDHRR+N S E  +ANV RL+ YK+KLVVF +  +
Sbjct: 72  GRGFTLAELKAVGLSAKYARTIGISVDHRRQNRSEETFEANVARLQEYKSKLVVFDKNTK 131

Query: 503 KFKAGDSTPEELATATQVNGPYL---PILREKASVEFVKVTDDMKSFKAYDKLRLERTNE 333
             +A      ++AT   V  P +   P   E+      +     KS K Y  +R +RT E
Sbjct: 132 AAEAASHKQADVATVFPVVQPSVESAPRAVEQPEQSAFRTLRLAKSDKKYKGIREKRTRE 191

Query: 332 R 330
           +
Sbjct: 192 K 192



>gb:AE016817_1747641 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 199

 Score =  132 bits (331), Expect = 1e-29
 Identities = 81/188 (43%), Positives = 107/188 (56%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N  +   HFRKHWQ  VK  F+Q              A KI PRP    LRP+V   T++
Sbjct: 6   NLPILKNHFRKHWQERVKVHFDQAGKKVSRRNARAAKAAKIAPRPL-DLLRPVVRAPTVR 64

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV 525
           YN KVRAGRGF+L E+KAAG+T   A TIGI+VDHRR+N + E    NVQRLK Y++K++
Sbjct: 65  YNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRRQNRNQEIFDLNVQRLKEYQSKII 124

Query: 524 VFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLE 345
           VFPR+     A  +  + L+ A        PI +    VE   V D+ +S  AY  LRL 
Sbjct: 125 VFPRKG----AAPAAEQVLSAAAA-----FPIEQPVTDVETRAVEDNGES--AYRTLRLA 173

Query: 344 RTNERHIG 321
           R+ +++ G
Sbjct: 174 RSEKKYHG 181



>gb:AX884822_1480275 Sequence 685 from Patent
           EP1033401.>gb:AX884823_1480276 Sequence 686 from Patent
           EP1033401.
          Length = 120

 Score =  130 bits (328), Expect = 3e-29
 Identities = 68/115 (59%), Positives = 77/115 (66%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N +V   HF K WQ  V TWFNQP             A +I PRP +G +RPIV   T++
Sbjct: 6   NGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVR 65

Query: 704 YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTY 540
           Y+ KVRAGRGFSLEEL+ AGI KK+A TIGISVD RRRN S E LQANVQRLK Y
Sbjct: 66  YHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEY 120



>sp|O59931|RL13_CANAL 60S ribosomal protein L13.>pir|T52146|T52146
           ribosomal protein L13e [imported] - yeast (Candida
           albicans)>gb:CAC49C10_1644809 C.albicans cosmid
           Ca49C10.>gb:CAU80854_1645578 Candida albicans ribosomal
           protein L13 gene, complete cds.>gb:AF050672_1764180
           Candida albicans ribosomal protein L13E gene, complete
           cds.
          Length = 202

 Score =  130 bits (328), Expect = 3e-29
 Identities = 77/183 (42%), Positives = 102/183 (55%)
 Frame = -3

Query: 869 SGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLKYNMKV 690
           + HFRKHWQ  V+  F+Q              A KI PRP   ALRP+V   T+KYN KV
Sbjct: 11  NNHFRKHWQERVRVHFDQAGKKASRRQSRLRKAAKIAPRPI-DALRPVVRAPTVKYNRKV 69

Query: 689 RAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRR 510
           RAGRGF+L ELKA GI  K A TIGISVDHRR+N S E   ANV RL+ YK+KLV+F ++
Sbjct: 70  RAGRGFTLAELKAVGIAPKYARTIGISVDHRRQNKSQETFDANVARLQEYKSKLVIFDKK 129

Query: 509 ARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNER 330
            +  +       +++    V  P       ++ +  V+V +      AY  LRL R  ++
Sbjct: 130 TKASEVASFEQVDVSATFPVEQP-----APESGLRAVEVPEQ----TAYRTLRLARNEKK 180

Query: 329 HIG 321
           + G
Sbjct: 181 YKG 183



>gb:AY144895_1583686 Saccharomyces servazzii clone S054 RPL13 gene,
           partial cds.
          Length = 174

 Score =  126 bits (317), Expect = 5e-28
 Identities = 74/174 (42%), Positives = 100/174 (57%)
 Frame = -3

Query: 863 HFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLKYNMKVRA 684
           HFRKHWQ  VK  F+Q              A KI PRP    LRP+V   T++YN KVRA
Sbjct: 13  HFRKHWQERVKVHFDQAGKKASRRQARASKAAKIAPRPL-DLLRPVVRAPTIRYNRKVRA 71

Query: 683 GRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRAR 504
           GRGF+  E+KAAG+T   A TIGI+VDHRR++ + E  + NVQRLK Y++K++VFPR  +
Sbjct: 72  GRGFTFGEIKAAGLTPSYARTIGIAVDHRRQDKNQETFETNVQRLKEYQSKIIVFPRNGK 131

Query: 503 KFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLER 342
             +    T + L+T+        PI++    +E   V    +S  A+  LRL R
Sbjct: 132 AVE----TEQVLSTSAA-----FPIVQASTEIETRAVEKSEQS--AFRTLRLAR 174



>gb:BNC24AGNB_1633510 B.napus cold induced protein (BnC24B).
          Length = 90

 Score =  115 bits (288), Expect = 1e-24
 Identities = 55/75 (73%), Positives = 64/75 (85%)
 Frame = -3

Query: 545 TYKAKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKA 366
           TYKAKLV+FPRRARK KAGDST EELA ATQV G Y+PI+REK ++E VK+T +MKS  A
Sbjct: 1   TYKAKLVIFPRRARKVKAGDSTAEELANATQVQGDYMPIVREKQAMELVKLTSEMKSVNA 60

Query: 365 YDKLRLERTNERHIG 321
           YDK+RLERTN+RH G
Sbjct: 61  YDKIRLERTNKRHAG 75



>gb:AX970293_1485602 Sequence 1096 from Patent EP1104808.
          Length = 128

 Score =  109 bits (273), Expect = 7e-23
 Identities = 62/123 (50%), Positives = 72/123 (58%), Gaps = 1/123 (0%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTA-GALRPIVHGQTL 708
           N +V   HF K WQ  V TWFNQP             A +I          R I    T+
Sbjct: 6   NGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAXXTXXQXXXRXIXRXPTV 65

Query: 707 KYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKL 528
           +Y  KVR G GFSLEEL+ AGI KK+A TIGISVD RRRN S E LQANVQRLK  ++KL
Sbjct: 66  RYXTKVRXGXGFSLEELRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEXRSKL 125

Query: 527 VVF 519
           ++F
Sbjct: 126 ILF 128



>gb:PFMAL8P1_1192199 Plasmodium falciparum 3D7 chromosome 8, ***
           SEQUENCING IN PROGRESS ***, 25 ordered pieces.
          Length = 215

 Score =  103 bits (258), Expect = 4e-21
 Identities = 71/198 (35%), Positives = 97/198 (48%), Gaps = 9/198 (4%)
 Frame = -3

Query: 896 VMKHNNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHG 717
           ++ HNNV+P+ H  K WQ +V+  F++                     P    L PIVH 
Sbjct: 1   MVAHNNVLPNVHLHKWWQRHVRVNFSKNIKKKKRRLLREKRRKANGGTPIE-KLHPIVHC 59

Query: 716 QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK 537
            T +YN + R G+GF+ EELK AG+T + A TIGI  D RR+N S E L  NV+RL  YK
Sbjct: 60  PTQRYNFRTRLGKGFTFEELKGAGLTPRAAQTIGICYDKRRKNRSEESLTKNVERLLKYK 119

Query: 536 AKLVVFPRRARKFKAG-DSTPEELATAT----QVNGPYLPILRE----KASVEFVKVTDD 384
             LV+ P +  K K G    P +    T    +   P L I ++    K   E ++V+  
Sbjct: 120 NSLVMIPLKKNKAKKGIGGIPADADKNTIKEFRNKKPLLSIFKKEKNTKPFYETIEVSKI 179

Query: 383 MKSFKAYDKLRLERTNER 330
            K F AY  LR  +  ER
Sbjct: 180 DKEFLAYKTLRRAKLAER 197



>gb:AB002774_1192795 Entamoeba histolytica mRNA for ribosomal
           protein L13, partial cds.
          Length = 138

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 51/111 (45%), Positives = 64/111 (57%)
 Frame = -3

Query: 860 FRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLKYNMKVRAG 681
           F K W++ V TW  QP             A  +FP  T  +L+P VH    ++N K+R G
Sbjct: 12  FGKDWRSKVHTWVQQPFRKIRRHQTRVEKAKSVFPA-TIKSLKPSVHCMNQRFNYKLRLG 70

Query: 680 RGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKL 528
           RGFSL+EL+AA I K LA TIGI+VD RR+ SS E L  N QRL  Y  +L
Sbjct: 71  RGFSLKELRAAKIDKNLARTIGIAVDPRRKESSKECLTRNAQRLTEYMNRL 121



>gb:U88308_1406731 Caenorhabditis elegans cosmid C32E8, complete
           sequence.
          Length = 88

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 39/79 (49%), Positives = 48/79 (60%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N ++ + HFRKHW   +KTWF+QP             AV+I PRP AG LR +V     +
Sbjct: 6   NQMLGNAHFRKHWHKRIKTWFDQPARKLRRRQNRQAKAVEIAPRPVAGLLRSVVRCPQKR 65

Query: 704 YNMKVRAGRGFSLEELKAA 648
           YN K R GRGFSL+ELKAA
Sbjct: 66  YNTKTRLGRGFSLQELKAA 84



>gb:AY389735_1178344 Hyacinthus orientalis 60S ribosomal protein L13
           mRNA, partial cds.
          Length = 84

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 37/58 (63%), Positives = 48/58 (82%)
 Frame = -3

Query: 494 AGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG 321
           +GDS+ EELA+ TQV G Y+PI +EK  V  VKVT++MK+FKAY KLR+ERTN+RH+G
Sbjct: 11  SGDSSAEELASITQVQGEYMPITKEKPVVNLVKVTEEMKTFKAYQKLRVERTNQRHLG 68



>gb:AF192977_1415885 Ovis aries breast basic conserved protein 1
           mRNA, partial cds.
          Length = 78

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 40/64 (62%), Positives = 49/64 (76%)
 Frame = -3

Query: 767 KIFPRPTAGALRPIVHGQTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRN 588
           +I PRP +G +RP+V   T++Y+ KVRAG GFSLEEL+ AGI KK+A TIGISVD RRRN
Sbjct: 14  RIAPRPASGPIRPVVRCPTVRYHTKVRAGWGFSLEELRVAGIHKKVARTIGISVDPRRRN 73

Query: 587 SSLE 576
              E
Sbjct: 74  KCTE 77



>gb:CNS07EGA_1372945 chromosome III of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 163

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 50/142 (35%), Positives = 74/142 (52%), Gaps = 2/142 (1%)
 Frame = -3

Query: 893 MKHNNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQ 714
           MK N+ +P+ HFRK     ++   +               A  +FP P    LRPIV   
Sbjct: 1   MKGNHALPNNHFRKTSLK-IRIHHDPETKARVMAEKKLRKAKALFPMPLK-KLRPIVRCP 58

Query: 713 TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA 534
           T+KYN   R GRGF+  E + AG+  + A  +GI+VD RRR+++ E    NV+R+KTY  
Sbjct: 59  TIKYNRNERLGRGFTAAECEKAGLDYRHARRLGIAVDLRRRDTNQEAFDKNVERIKTYLG 118

Query: 533 KLVVFP--RRARKFKAGDSTPE 474
           K+ ++   + AR+  A   T E
Sbjct: 119 KITIYESVKEARESGAKPYTKE 140



>gb:HVJ222784_1682428 Hordeum vulgare mRNA for ribosomal
           like-protein, clone RG131.
          Length = 74

 Score = 77.4 bits (189), Expect = 4e-13
 Identities = 38/58 (65%), Positives = 46/58 (79%), Gaps = 1/58 (1%)
 Frame = -3

Query: 491 GDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG 321
           G+STPEELA ATQV G Y+PI R EK SV+  KVT++MK FKAY KLR+ER N+R +G
Sbjct: 2   GESTPEELANATQVQGDYMPIARGEKRSVDVAKVTEEMKEFKAYGKLRVERMNQRQLG 59



>pir|T05930|T05930 probable ribosomal protein L13 - barley
           (fragment)
          Length = 74

 Score = 77.4 bits (189), Expect = 4e-13
 Identities = 38/58 (65%), Positives = 46/58 (79%), Gaps = 1/58 (1%)
 Frame = -3

Query: 491 GDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG 321
           G+STPEELA ATQV G Y+PI R EK SV+  KVT++MK FKAY KLR+ER N+R +G
Sbjct: 2   GESTPEELANATQVQGDYMPIARGEKRSVDVAKVTEEMKEFKAYGKLRVERMNQRQLG 59



>pir|H90104|H90104 60S ribosomal protein L13 [imported] - Guillardia
           theta nucleomorph>gb:GTAJ10592_1681058 Guillardia theta
           DNA for complete sequence of nucleomorph chromosome 2.
          Length = 127

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 36/97 (37%), Positives = 52/97 (53%), Gaps = 1/97 (1%)
 Frame = -3

Query: 866 GHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTA-GALRPIVHGQTLKYNMKV 690
           GHFRK W+N V T FNQP                   +      L+P+V   T  +N K+
Sbjct: 10  GHFRKKWKNLVITNFNQPILKIKRRKIRKNKKKNFLKKAIFYKKLKPLVKCPTRMHNTKI 69

Query: 689 RAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSL 579
           + GRGFS++E+K + I  K A + GIS+D RR+ S++
Sbjct: 70  KLGRGFSIQEIKKSMIKLKTATSYGISIDKRRKKSNI 106



>gb:AX970327_1485636 Sequence 1130 from Patent EP1104808.
          Length = 69

 Score = 57.4 bits (137), Expect = 4e-07
 Identities = 27/64 (42%), Positives = 34/64 (53%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLK 705
           N +V   HF K WQ  V TWFNQP             A +I PRP +G +RPIV   T++
Sbjct: 6   NGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRXPTVR 65

Query: 704 YNMK 693
           Y+ K
Sbjct: 66  YHTK 69



>pir|T13002|T13002 ribosomal protein L13, cytosolic - Arabidopsis
           thaliana>gb:ATT24C20_1555400 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T24C20.
          Length = 58

 Score = 50.4 bits (119), Expect = 5e-05
 Identities = 22/40 (55%), Positives = 32/40 (80%)
 Frame = -3

Query: 440 YLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG 321
           Y+PI+RE  ++E VK+T +MKSF+AY+ LR+ RT +RH G
Sbjct: 4   YMPIVRETPTMELVKLTAEMKSFEAYNTLRVARTMKRHAG 43



>gb:SPU97372_1722282 Schizosaccharomyces pombe unknown protein mRNA,
           partial cds.
          Length = 70

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 23/58 (39%), Positives = 29/58 (50%)
 Frame = -3

Query: 875 VPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGALRPIVHGQTLKY 702
           +P+ HF K WQ YVKTWFNQP             A KI PRP    + P+     L++
Sbjct: 12  LPNAHFHKDWQRYVKTWFNQP-GRKLRRQARQTKAAKIAPRPVEAIVPPLASHHPLQH 68



>gb:AP005504_1853008 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0577B11.>gb:AP005847_1859006 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ9990_A01.
          Length = 311

 Score = 39.7 bits (91), Expect(2) = 5e-04
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 1/27 (3%)
 Frame = -3

Query: 440 YLPILR-EKASVEFVKVTDDMKSFKAY 363
           Y+PI R EK SVE VKVTD+MK+FKAY
Sbjct: 283 YMPIARGEKRSVEAVKVTDEMKAFKAY 309



 Score = 26.9 bits (58), Expect(2) = 5e-04
 Identities = 12/20 (60%), Positives = 16/20 (80%)
 Frame = -1

Query: 499 LRLVILLPRNWPLQPKSMVL 440
           +RLVI LPR+ PL P+S V+
Sbjct: 262 VRLVIPLPRSLPLPPRSRVI 281



>gb:AE009831_256247 Pyrobaculum aerophilum strain IM2 section 86 of
           201 of the complete genome.>gb:AE009441_898873
           Pyrobaculum aerophilum strain IM2 complete genome.
          Length = 159

 Score = 43.9 bits (102), Expect = 0.005
 Identities = 24/65 (36%), Positives = 36/65 (55%)
 Frame = -3

Query: 758 PRPTAGALRPIVHGQTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSL 579
           P+P       I HG  +K+    + GRGFS+ EL+A G++   A  +GI VD RR  S  
Sbjct: 5   PKPLVKTPAKITHGGVVKW----KYGRGFSIGELRALGLSVDQARLLGIPVDERRETSWP 60

Query: 578 EGLQA 564
           + ++A
Sbjct: 61  QNIEA 65



>gb:AX970194_1485503 Sequence 997 from Patent EP1104808.
          Length = 55

 Score = 42.7 bits (99), Expect = 0.010
 Identities = 21/50 (42%), Positives = 25/50 (50%)
 Frame = -3

Query: 884 NNVVPSGHFRKHWQNYVKTWFNQPXXXXXXXXXXXXXAVKIFPRPTAGAL 735
           N +V   HF K WQ  V TWFNQP             A +I PRP +G +
Sbjct: 6   NGMVLKPHFHKDWQRRVATWFNQPARKIRRRKXRQAKARRIAPRPASGXI 55



>pir|C72638|C72638 probable ribosomal protein L13 APES024 -
           Aeropyrum pernix  (strain K1)>gb:BA000002_651251
           Aeropyrum pernix K1 DNA, complete genome.
          Length = 91

 Score = 42.7 bits (99), Expect = 0.010
 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 3/52 (5%)
 Frame = -3

Query: 692 VRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNS---SLEGLQANVQRLK 546
           VR GRGFSL EL  AG+  K A  +G+ VD RRR     ++E L+  ++RL+
Sbjct: 34  VRRGRGFSLGELAEAGLDAKKARKLGLHVDTRRRTVHPWNVEALKKYIERLR 85



>sp|Q9YEN9|R13E_AERPE 50S ribosomal protein L13e.
          Length = 80

 Score = 42.7 bits (99), Expect = 0.010
 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 3/52 (5%)
 Frame = -3

Query: 692 VRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNS---SLEGLQANVQRLK 546
           VR GRGFSL EL  AG+  K A  +G+ VD RRR     ++E L+  ++RL+
Sbjct: 23  VRRGRGFSLGELAEAGLDAKKARKLGLHVDTRRRTVHPWNVEALKKYIERLR 74



>pir|B90416|B90416 lSU ribosomal protein L13E (rpl13E) [imported] -
           Sulfolobus solfataricus>gb:AE006843_223199 Sulfolobus
           solfataricus P2 section 202 of 272 of the complete
           genome.>gb:AE006641_1109047 Sulfolobus solfataricus P2,
           complete genome.
          Length = 110

 Score = 40.4 bits (93), Expect = 0.051
 Identities = 28/75 (37%), Positives = 38/75 (50%)
 Frame = -3

Query: 752 PTAGALRPIVHGQTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEG 573
           P A   RP  H +        R GRGFS+ EL+ AG+    A  +GI VD RR++   E 
Sbjct: 35  PKAVIKRPNYHFEYPHKRKYKRIGRGFSVGELEKAGLNINKARKLGIFVDIRRKSVHEE- 93

Query: 572 LQANVQRLKTYKAKL 528
              NV+ LK +  +L
Sbjct: 94  ---NVETLKKFSEQL 105



>sp|Q97W05|R13E_SULSO 50S ribosomal protein L13e.
          Length = 79

 Score = 40.4 bits (93), Expect = 0.051
 Identities = 28/75 (37%), Positives = 38/75 (50%)
 Frame = -3

Query: 752 PTAGALRPIVHGQTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEG 573
           P A   RP  H +        R GRGFS+ EL+ AG+    A  +GI VD RR++   E 
Sbjct: 4   PKAVIKRPNYHFEYPHKRKYKRIGRGFSVGELEKAGLNINKARKLGIFVDIRRKSVHEE- 62

Query: 572 LQANVQRLKTYKAKL 528
              NV+ LK +  +L
Sbjct: 63  ---NVETLKKFSEQL 74



>gb:AB007172_1863937 Homo sapiens gene for ribosomal protein L13,
           partial cds.
          Length = 65

 Score = 38.5 bits (88), Expect = 0.19
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 4/54 (7%)
 Frame = -3

Query: 470 LATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG 321
           L  ATQ+ GP +P+     +EKA V    +T++ K+FKA+  LR+ R N R  G
Sbjct: 1   LKLATQLTGPVMPVRNVYKKEKARV----ITEEEKNFKAFASLRMARANARLFG 50



>sp|P58469|R13E_SULTO 50S ribosomal protein L13e.>gb:BA000023_691299
           Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 77

 Score = 38.5 bits (88), Expect = 0.19
 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 3/73 (4%)
 Frame = -3

Query: 737 LRPIVHGQTLKYNMK---VRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQ 567
           + PIV     ++ ++    + G+GFSL+ELK +G + + A  + + +D RR+ S  E   
Sbjct: 2   VEPIVKRPHYRFEIRKKDTKIGKGFSLKELKESGFSVQEAKKLRVRIDKRRKTSYPE--- 58

Query: 566 ANVQRLKTYKAKL 528
            NV+ LK  K +L
Sbjct: 59  -NVEVLKKLKEQL 70



>gb:CP000021_873470 Vibrio fischeri ES114 chromosome II, complete
            sequence.
          Length = 1613

 Score = 35.0 bits (79), Expect = 2.1
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 1/69 (1%)
 Frame = -1

Query: 814  LLANKGGELLDKKRLLR-FSPGQLLEPFAQLSMGRHSSTT*KSGLVGDSPSRSLRLQVSQ 638
            L ANK  E L K+ LLR  +   L+E  A++S+G  S++  K  L+ D     +   +  
Sbjct: 903  LKANKTSEELQKRFLLRALALNGLIELLARISLGSSSNSDYKKELISDRVQDYIETYILN 962

Query: 637  RNWHLQLAS 611
             NW   L S
Sbjct: 963  DNWEAPLTS 971



>gb:AB088224_11543 Streptomyces rochei plasmid pSLA2-L DNA, complete
           sequence.
          Length = 687

 Score = 33.9 bits (76), Expect = 4.8
 Identities = 19/47 (40%), Positives = 28/47 (59%)
 Frame = +1

Query: 400 TNSTEAFSRRIGR*GPLTWVAVANSSGVESPALNLRARLGKTTNLAL 540
           T +   F+R +G  GP   VA AN+SG+ +  L +RA   +T +LAL
Sbjct: 83  TTTAARFARALGLDGPALAVAAANASGLGAVHLAVRALRERTVDLAL 129



>gb:CP000030_83252 Anaplasma marginale str. St. Maries, complete
           genome.
          Length = 506

 Score = 33.5 bits (75), Expect = 6.2
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = +1

Query: 613 MPIVGASFFVIPAALSSSRENPLPALTFMLYLSVC 717
           +PI+  +FF+ P+A S  +E P+P L  M+  S C
Sbjct: 446 VPIIYRAFFIKPSAKSGRKEAPVPMLAAMMATSAC 480


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 882,835,883
Number of Sequences: 1806583
Number of extensions: 17049413
Number of successful extensions: 37827
Number of sequences better than 10.0: 106
Number of HSP's better than 10.0 without gapping: 36884
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37767
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 68001319770
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)