BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig9787
         (903 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AC084296_1733453 Oryza sativa chromosome 3 BAC OSJNBb0024J04 ...   473   e-132   
gb:AY091113_1574337 Arabidopsis thaliana putative cullin (At5g46...   465   e-130   
gb:AY084267_1569359 Arabidopsis thaliana clone 101723 mRNA, comp...   465   e-130   
gb:ATH318018_1552493 Arabidopsis thaliana mRNA for cullin 4 (cul...   465   e-130   
gb:AB025620_1516422 Arabidopsis thaliana genomic DNA, chromosome...   436   e-121   
gb:HSU58091_2025039 Human Hs-cul-4B mRNA, partial cds.                358   1e-97   
gb:HSM805877_2018085 Homo sapiens mRNA; cDNA DKFZp779P1063 (from...   358   1e-97   
gb:AL451005_1928094 Human DNA sequence from clone RP11-92B10 on ...   358   1e-97   
gb:AC002476_1874445 Human PAC clone RP1-318C15 from Xq23, comple...   358   1e-97   
gb:AB014595_1864624 Homo sapiens mRNA for KIAA0695 protein, part...   358   1e-97   
sp|Q13620|CU4B_HUMAN|CU4B_HUMAN Cullin homolog 4B (CUL-4B).                      358   1e-97   Homo sapiens [man]
gb:BC010347_2090980 Mus musculus cullin 4B, mRNA (cDNA clone IMA...   357   2e-97   
gb:BC004026_2089542 Mus musculus cullin 4B, mRNA (cDNA clone MGC...   357   2e-97   
gb:BC036216_1981869 Homo sapiens cullin 4B, mRNA (cDNA clone MGC...   357   2e-97   
gb:AY365125_1948082 Homo sapiens cullin 4B (CUL4B) mRNA, complet...   357   2e-97   
gb:AK012410_1156942 Mus musculus 11 days embryo whole body cDNA,...   357   2e-97   
gb:AF212995_1890266 Homo sapiens cullin CUL4B (CUL4B) mRNA, comp...   357   2e-97   
gb:AK032701_1163036 Mus musculus 12 days embryo male wolffian du...   355   5e-97   
gb:AB093259_2048044 Mus musculus mRNA for mKIAA0695 protein.          352   7e-96   
gb:AY389766_1178372 Hyacinthus orientalis cullin mRNA, partial cds.   343   3e-93   
gb:AY059387_1564535 Olea europaea putative cullin protein mRNA, ...   342   4e-93   
gb:BC024113_2094386 Mus musculus cullin 4A, mRNA (cDNA clone MGC...   340   2e-92   
gb:BC010211_2090896 Mus musculus cullin 4A, mRNA (cDNA clone MGC...   340   2e-92   
gb:BT007619_2150551 Synthetic construct Homo sapiens cullin 4A m...   339   5e-92   
gb:HSU58090_2025038 Human Hs-cul-4A mRNA, partial cds.                339   5e-92   
gb:AY365124_1948081 Homo sapiens cullin 4A (CUL4A) mRNA, complet...   339   5e-92   
gb:AB012193_1864393 Homo sapiens mRNA for cullin-4A, partial cds.     339   5e-92   
sp|Q13619|CU4A_HUMAN|CU4A_HUMAN Cullin homolog 4A (CUL-4A).>gb:AF077188_188...   339   5e-92   Homo sapiens [man]
pir|T07163|T07163 probable cullin protein - tomato>gb:LES16124_1...   338   1e-91   Solanum lycopersicum
gb:AY051648_1290242 Drosophila melanogaster GM14815 full length ...   305   8e-82   
gb:AE013599_1130587 Drosophila melanogaster chromosome 2R, compl...   305   8e-82   
gb:AK005426_1153010 Mus musculus adult female placenta cDNA, RIK...   295   8e-79   
gb:AK003679_1152006 Mus musculus 18-day embryo whole body cDNA, ...   246   3e-64   
gb:AP004114_1837795 Oryza sativa (japonica cultivar-group) genom...   220   3e-56   
gb:ATH319540_1552502 Arabidopsis thaliana partial mRNA for culli...   219   4e-56   
pir|A86395|A86395 hypothetical protein T2P11.2 [imported] - Arab...   219   4e-56   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00009_1693194 Oryza sativa genomic DNA, chromosome 4, BAC...   218   1e-55   
gb:ATH344541_1552519 Arabidopsis thaliana partial mRNA for culli...   216   4e-55   
pir|E96718|E96718 probable cullin T6C23.13 [imported] - Arabidop...   216   4e-55   Arabidopsis thaliana [mouse-ear cress]
gb:AP005501_1852965 Oryza sativa (japonica cultivar-group) genom...   211   2e-53   
sp|O14122|CUL4_SCHPO|CUL4_SCHPO Cullin 4 homolog (Cul-4).>pir|T43408|T43408...   207   3e-52   Schizosaccharomyces pombe
gb:AP003236_1825935 Oryza sativa (japonica cultivar-group) genom...   205   1e-51   
gb:AY336990_1600291 Oryza sativa (japonica cultivar-group) CUL1 ...   205   1e-51   
gb:AC011806_1537435 Genomic Sequence For Oryza sativa Clone 10P2...   205   1e-51   
gb:AC105772_1738237 Oryza sativa (japonica cultivar-group) chrom...   202   7e-51   
gb:NTA344533_1691349 Nicotiana tabacum mRNA for cullin 1A (cul1A...   202   9e-51   
gb:ATH318017_1552492 Arabidopsis thaliana mRNA for cullin 1 (cul...   200   3e-50   
pir|T01092|T01092 cullin-like protein T10P11.14.1 - Arabidopsis ...   200   3e-50   Arabidopsis thaliana [mouse-ear cress]
gb:AC011806_1537438 Genomic Sequence For Oryza sativa Clone 10P2...   200   4e-50   
gb:NTA344534_1691350 Nicotiana tabacum mRNA for cullin 1B (cul1B...   199   8e-50   
gb:HSU58089_2025037 Human Hs-cul-3 mRNA, partial cds.                 196   5e-49   
gb:AF062537_1880198 Homo sapiens cullin 3 mRNA, complete cds.         196   5e-49   
gb:AF052147_1879212 Homo sapiens clone 24454 cul-3 mRNA, complet...   196   5e-49   
gb:AB014517_1864546 Homo sapiens mRNA for KIAA0617 protein, part...   196   5e-49   
sp|Q13618|CUL3_HUMAN|CUL3_HUMAN Cullin homolog 3 (CUL-3).>gb:AF064087_18803...   196   5e-49   Homo sapiens [man]
gb:AK129174_2069405 Mus musculus mRNA for mKIAA0617 protein.          196   7e-49   
gb:BT006231_1639123 Arabidopsis thaliana At1g02980 gene, complet...   196   7e-49   
pir|D86160|D86160 hypothetical protein F22D16.2 - Arabidopsis th...   196   7e-49   Arabidopsis thaliana [mouse-ear cress]
sp|Q9JLV5|CUL3_MOUSE|CUL3_MOUSE Cullin homolog 3 (CUL-3).>gb:AF129738_20556...   196   7e-49   Mus musculus [mouse]
gb:BC073186_2557041 Xenopus laevis MGC80402 protein, mRNA (cDNA ...   195   1e-48   
gb:AY337761_1944151 Homo sapiens cullin 3 isoform (CUL3) mRNA, c...   194   3e-48   
gb:BC065357_2553975 Danio rerio cullin 3, mRNA (cDNA clone MGC:7...   193   3e-48   
gb:AY423034_2532120 Danio rerio cullin 3 (CUL3) mRNA, complete cds.   193   3e-48   
gb:BC031844_1980253 Homo sapiens cullin 3, mRNA (cDNA clone IMAG...   193   3e-48   
gb:BC077239_2559956 Xenopus laevis cullin 3, mRNA (cDNA clone MG...   193   4e-48   
gb:NTA344535_1691351 Nicotiana tabacum partial mRNA for cullin 1...   191   2e-47   
gb:AB080190_1523944 Pisum sativum cul1 mRNA for cullin-like prot...   188   1e-46   
gb:U29536_1402828 Caenorhabditis elegans cosmid F45E12, complete...   181   2e-44   
gb:CEU58086_1368584 Caenorhabditis elegans cul-4 mRNA, complete ...   181   2e-44   
pir|T16367|T16367 hypothetical protein F45E12.3 - Caenorhabditis...   181   2e-44   Caenorhabditis elegans [roundworm]
sp|Q17392|CUL4_CAEEL|CUL4_CAEEL Cullin 4.                                        181   2e-44   Caenorhabditis elegans [roundworm]
pir|S62405|S62405 hypothetical protein SPAC24H6.03 - fission yea...   180   4e-44   Schizosaccharomyces pombe
sp|Q09760|CUL3_SCHPO|CUL3_SCHPO Cullin 3 homolog (Cul-3).>pir|T38359|T38359...   180   4e-44   Schizosaccharomyces pombe
gb:BC054607_2551017 Danio rerio cullin 4A, mRNA (cDNA clone MGC:...   179   7e-44   
gb:AE017347_1758066 Cryptococcus neoformans var. neoformans JEC2...   177   2e-43   
gb:AE014134_1129264 Drosophila melanogaster chromosome 2L, compl...   170   3e-41   
gb:AE017347_1758096 Cryptococcus neoformans var. neoformans JEC2...   169   5e-41   
sp|Q17391|CUL3_CAEEL|CUL3_CAEEL Cullin 3.>gb:AC024744_1204336 Caenorhabditi...   167   2e-40   Caenorhabditis elegans [roundworm]
gb:CEU58085_1368583 Caenorhabditis elegans cul-3 mRNA, complete ...   160   3e-38   
gb:BX842631_1643970 Neurospora crassa DNA linkage group I BAC co...   152   7e-36   
gb:AX888127_1483580 Sequence 3990 from Patent EP1033401.              145   8e-34   
gb:CR382128_1660486 Yarrowia lipolytica chromosome B of strain C...   145   1e-33   
gb:HSU83410_2026686 Human CUL-2 (cul-2) mRNA, complete cds.           139   1e-31   
gb:AL392046_1927132 Human DNA sequence from clone RP11-297A16 on...   139   1e-31   
sp|Q13617|CUL2_HUMAN|CUL2_HUMAN Cullin homolog 2 (CUL-2).>gb:CR858317_11825...   139   1e-31   Homo sapiens [man]
gb:BC025902_2095213 Mus musculus cullin 2, mRNA (cDNA clone IMAG...   138   1e-31   
gb:HSU58088_2025036 Human Hs-cul-2 mRNA, partial cds.                 138   1e-31   
sp|Q9D4H8|CUL2_MOUSE|CUL2_MOUSE Cullin homolog 2 (CUL-2).>gb:BC026779_20955...   138   1e-31   Mus musculus [mouse]
gb:BC059348_2552383 Xenopus laevis hypothetical protein MGC69167...   138   2e-31   
gb:AF020287_1233328 Dictyostelium discoideum CulA (culA) mRNA, c...   137   4e-31   
gb:AE016819_1749333 Ashbya gossypii (= Eremothecium gossypii) AT...   127   3e-28   
gb:BX649606_1643414 Aspergillus fumigatus BAC pilot project supe...   127   3e-28   
gb:BC048370_2550044 Danio rerio zgc:55483, mRNA (cDNA clone MGC:...   126   5e-28   
gb:HSU58087_2025035 Human Hs-cul-1 mRNA, complete cds.                125   1e-27   
gb:AC006323_1875122 Homo sapiens PAC clone RP5-1151M5 from 7, co...   125   1e-27   
sp|Q9WTX6|CUL1_MOUSE|CUL1_MOUSE Cullin homolog 1 (CUL-1).>gb:AF083216_20538...   125   1e-27   Mus musculus [mouse]
sp|Q13616|CUL1_HUMAN|CUL1_HUMAN Cullin homolog 1 (CUL-1).>gb:CR861282_11852...   125   1e-27   Homo sapiens [man]
gb:HSM805708_2018008 Homo sapiens mRNA; cDNA DKFZp686G0852 (from...   125   1e-27   
gb:BC066480_2554369 Danio rerio zgc:77500, mRNA (cDNA clone MGC:...   124   2e-27   
gb:BC034318_1981233 Homo sapiens cullin 1, mRNA (cDNA clone MGC:...   124   2e-27   
gb:CR382123_1656277 Kluyveromyces lactis strain NRRL Y-1140 chro...   123   4e-27   
gb:BC045445_2549282 Danio rerio zgc:77500, mRNA (cDNA clone MGC:...   122   7e-27   
gb:CR382130_1662827 Yarrowia lipolytica chromosome D of strain C...   120   5e-26   
gb:AFA5C11_1810866 Aspergillus fumigatus BAC AFA5C11.                 119   8e-26   
gb:AF236663_1779597 Aspergillus nidulans SCF complex protein cul...   119   8e-26   
pir|T20365|T20365 hypothetical protein D2045.6 - Caenorhabditis ...   119   8e-26   Caenorhabditis elegans [roundworm]
sp|Q17389|CUL1_CAEEL|CUL1_CAEEL Cullin 1 (Abnormal cell lineage 19 protein)...   119   8e-26   Caenorhabditis elegans [roundworm]
gb:DRODMPR_1381914 Drosophila melanogaster homologue of C.elegan...   118   2e-25   
gb:AE014134_1130056 Drosophila melanogaster chromosome 2L, compl...   118   2e-25   
sp|Q24311|CUL1_DROME|CUL1_DROME Cullin homolog 1 (Lin-19 homolog protein).>...   118   2e-25   Drosophila melanogaster
gb:AF136441_2055946 Mus musculus cullin 1 (Cul1) mRNA, complete ...   117   4e-25   
gb:CR382135_1668247 Debaryomyces hansenii chromosome C of strain...   117   4e-25   
sp|Q21346|CUL6_CAEEL|CUL6_CAEEL Cullin 6.>pir|T23474|T23474 hypothetical pr...   117   4e-25   Caenorhabditis elegans [roundworm]
gb:AB016896_1513270 Schizosaccharomyces pombe pcu1+ gene for Pcu...   116   5e-25   
pir|T43398|T43398 SCF complex protein cul-1 - fission yeast  (Sc...   116   5e-25   Schizosaccharomyces pombe
sp|O13790|CUL1_SCHPO|CUL1_SCHPO Cullin 1 homolog (Cul-1) (Cell division con...   116   5e-25   Schizosaccharomyces pombe
gb:CR380952_1650594 Candida glabrata strain CBS138 chromosome F ...   115   2e-24   
gb:AF144717_1244549 Dictyostelium discoideum CulB mRNA, complete...   114   2e-24   
gb:CR382127_1659676 Yarrowia lipolytica chromosome A of strain C...   114   3e-24   
gb:AY449460_1327338 Oikopleura dioica clone BACOIKO004 7xk22, co...   114   3e-24   
gb:AE017356_1760306 Cryptococcus neoformans var. neoformans JEC2...   107   2e-22   
gb:CR382135_1668101 Debaryomyces hansenii chromosome C of strain...   103   3e-21   
gb:CR380956_1652387 Candida glabrata strain CBS138 chromosome J ...   103   6e-21   
sp|Q17390|CUL2_CAEEL|CUL2_CAEEL Cullin 2.                                        102   8e-21   Caenorhabditis elegans [roundworm]
gb:CEZK520_1371638 Caenorhabditis elegans cosmid ZK520, complete...   102   1e-20   
gb:CEZK520_1371637 Caenorhabditis elegans cosmid ZK520, complete...   102   1e-20   
gb:CEZK520_1371636 Caenorhabditis elegans cosmid ZK520, complete...   102   1e-20   
gb:AY071504_1295588 Drosophila melanogaster RE55959 full length ...   100   5e-20   
gb:AE014297_1141905 Drosophila melanogaster chromosome 3R, compl...   100   5e-20   
pir|T27884|T27884 hypothetical protein ZK520.4 - Caenorhabditis ...   100   5e-20   Caenorhabditis elegans [roundworm]
pir|C88618|C88618 protein ZK520.4 [imported] - Caenorhabditis el...   100   5e-20   Caenorhabditis elegans [roundworm]
gb:CEU58084_1368582 Caenorhabditis elegans cul-2 mRNA, complete ...   100   7e-20   
gb:AF017061_1876725 Homo sapiens vasopressin-activated calcium m...    99   9e-20   
gb:CEZK520_1371639 Caenorhabditis elegans cosmid ZK520, complete...    99   9e-20   
gb:CR858821_1182969 Pongo pygmaeus mRNA; cDNA DKFZp469O0710 (fro...    99   9e-20   
sp|Q93034|CUL5_HUMAN|CUL5_HUMAN Cullin homolog 5 (CUL-5) (Vasopressin-activ...    99   9e-20   Homo sapiens [man]
gb:HSVACM1_2027971 H.sapiens mRNA for for vasopressin activated ...    98   2e-19   
sp|Q9JJ31|CUL5_RAT|CUL5_RAT Cullin homolog 5 (CUL-5) (Vasopressin-activat...    97   3e-19   Rattus norvegicus [brown rat]
gb:AK038873_1165202 Mus musculus adult male hypothalamus cDNA, R...    96   9e-19   
sp|Q9D5V5|CUL5_MOUSE|CUL5_MOUSE Cullin homolog 5 (CUL-5).>gb:AK014894_11581...    96   9e-19   Mus musculus [mouse]
gb:AE016817_1747490 Ashbya gossypii (= Eremothecium gossypii) AT...    95   2e-18   
gb:CR382136_1669315 Debaryomyces hansenii chromosome D of strain...    95   2e-18   
sp|Q29425|CUL5_RABIT|CUL5_RABIT Cullin homolog 5 (CUL-5) (Vasopressin-activ...    95   2e-18   Oryctolagus cuniculus [domestic rabbit]
gb:AK031955_1162664 Mus musculus adult male medulla oblongata cD...    91   3e-17   
gb:CR382126_1658592 Kluyveromyces lactis strain NRRL Y-1140 chro...    90   5e-17   
gb:AE014296_1136092 Drosophila melanogaster chromosome 3L, compl...    90   5e-17   
sp|P53202|CUL3_YEAST|CUL3_YEAST Cullin B.>pir|S64292|S64292 hypothetical pr...    89   1e-16   Saccharomyces cerevisiae [brewer's yeast]
gb:AK016520_1158756 Mus musculus adult male testis cDNA, RIKEN f...    89   2e-16   
sp|Q12018|CC53_YEAST|CC53_YEAST Cell division control protein 53 (Cullin A)...    88   2e-16   Saccharomyces cerevisiae [brewer's yeast]
gb:AL392046_1927130 Human DNA sequence from clone RP11-297A16 on...    87   3e-16   
gb:AK003885_1152123 Mus musculus 18-day embryo whole body cDNA, ...    81   2e-14   
gb:AF126814_1243258 Strongyloides stercoralis cullin-like protei...    76   1e-12   
gb:PFMAL8P1_1192230 Plasmodium falciparum 3D7 chromosome 8, *** ...    75   1e-12   
gb:AK080305_1172923 Mus musculus 3 days neonate thymus cDNA, RIK...    62   2e-08   
gb:CR382401_1375119 Plasmodium falciparum chromosome 6, complete...    55   2e-06   
gb:AK118453_1816430 Arabidopsis thaliana At2g04660 mRNA for unkn...    53   9e-06   
gb:AY138228_1582270 Arabidopsis thaliana APC2 mRNA, complete cds.      53   9e-06   
gb:BC085675_2564551 Danio rerio cDNA clone MGC:92577 IMAGE:59128...    51   3e-05   
sp|P47050|YJE7_YEAST|YJE7_YEAST Hypothetical 99.3 kDa protein in MTR4-GYP6 ...    50   8e-05   Saccharomyces cerevisiae [brewer's yeast]
pir|H84459|H84459 hypothetical protein At2g04660 [imported] - Ar...    49   1e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AY675111_1621933 Ostreococcus tauri anaphase promoting comple...    48   2e-04   
gb:BC027351_2095920 Mus musculus anaphase promoting complex subu...    47   5e-04   
gb:AK129351_2069582 Mus musculus mRNA for mKIAA1406 protein.           47   5e-04   
gb:AC150162_1745054 Solanum demissum chromosome 5 clone PGEC160O...    46   9e-04   
gb:AK030306_1161932 Mus musculus 11 days pregnant adult female o...    46   9e-04   
gb:BC001579_1967688 Homo sapiens anaphase promoting complex subu...    46   0.001   
gb:AB037827_1866618 Homo sapiens mRNA for KIAA1406 protein, part...    46   0.001   
gb:OSJN00053_1693965 Oryza sativa genomic DNA, chromosome 4, BAC...    46   0.001   
sp|Q8BZQ7|ANC2_MOUSE|ANC2_MOUSE Anaphase promoting complex subunit 2 (APC2)...    46   0.001   Mus musculus [mouse]
sp|Q9UJX6|ANC2_HUMAN|ANC2_HUMAN Anaphase promoting complex subunit 2 (APC2)...    46   0.001   Homo sapiens [man]
pir|S44845|S44845 K06H7.5 protein - Caenorhabditis elegans             45   0.003   Caenorhabditis elegans [roundworm]
sp|P34514|ANC2_CAEEL|ANC2_CAEEL Anaphase-promoting complex subunit 2 (APC2)...    45   0.003   Caenorhabditis elegans [roundworm]
gb:BC065421_2105603 Mus musculus cDNA clone IMAGE:5057899, parti...    44   0.003   
gb:AC154033_1745269 Solanum demissum chromosome 5 clone PGEC132D...    44   0.003   
gb:AY226099_2079940 Rattus norvegicus swan mRNA, complete cds.         22   0.020   
gb:CNS07EGE_1373673 chromosome VII of strain GB-M1 of Encephalit...    41   0.028   
gb:AY058717_1291871 Drosophila melanogaster LD45730 full length ...    41   0.028   
gb:AE013599_1133667 Drosophila melanogaster chromosome 2R, compl...    41   0.028   
gb:CR380956_1652192 Candida glabrata strain CBS138 chromosome J ...    39   0.11    
gb:AF345334_2063778 Mus musculus SWAN mRNA, complete cds.>gb:AF3...    22   0.22    
sp|Q8R4X3|RBMC_MOUSE|RBMC_MOUSE RNA-binding protein 12 (RNA binding motif p...    22   0.22    Mus musculus [mouse]
gb:BC027810_2096128 Mus musculus RNA binding motif protein 12, m...    22   0.27    
gb:AY653733_2371187 Mimivirus, complete genome.                        38   0.31    
gb:AC115592_1205726 Dictyostelium discoideum chromosome 2 map 1-...    37   0.52    
gb:AK029180_1161381 Mus musculus 0 day neonate head cDNA, RIKEN ...    22   1.3     
gb:AP004031_1836628 Oryza sativa (japonica cultivar-group) genom...    35   1.5     
gb:CR382131_1663663 Yarrowia lipolytica chromosome E of strain C...    35   1.5     
gb:BX897700_828607 Bartonella quintana str. Toulouse, complete g...    35   2.6     
sp|Q57836|CBIT_METJA|CBIT_METJA Probable cobalt-precorrin-6Y C(15)-methyltr...    35   2.6     Methanocaldococcus jannaschii
gb:SAG766845_169913 Streptococcus agalactiae NEM316 complete gen...    34   3.4     
gb:AB042935_1519954 Oryza sativa (japonica cultivar-group) Os-Re...    34   4.4     
pir|A75127|A75127 hypothetical protein PAB1818 - Pyrococcus abys...    34   4.4     Pyrococcus abyssi
gb:AF132669_2200789 White spot syndrome virus ribonucleotide red...    33   5.8     
gb:CR380950_1649691 Candida glabrata strain CBS138 chromosome D ...    33   5.8     
gb:AE014291_307934 Brucella suis 1330 chromosome I, complete seq...    33   5.8     
pir|F96977|F96977 probable phosphatase [imported] - Clostridium ...    33   9.8     Clostridium acetobutylicum


>gb:AC084296_1733453 Oryza sativa chromosome 3 BAC OSJNBb0024J04
            genomic sequence, complete sequence.
          Length = 813

 Score =  473 bits (1217), Expect = e-132
 Identities = 233/255 (91%), Positives = 246/255 (96%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSG 724
            ESFKQSSQARTKLP GIEMSVHVLTTGYWPTYPPMDV+LPHELNVYQDIFKEFYLSKYSG
Sbjct: 559  ESFKQSSQARTKLPSGIEMSVHVLTTGYWPTYPPMDVKLPHELNVYQDIFKEFYLSKYSG 618

Query: 723  RRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKEL 544
            RRLMWQNSLGHCVLKAEFPKG+KELAVS FQ+VVLMLFN+A+K SF DIKE+ GIEDKEL
Sbjct: 619  RRLMWQNSLGHCVLKAEFPKGKKELAVSLFQSVVLMLFNDAQKLSFLDIKESTGIEDKEL 678

Query: 543  RRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTST 364
            RRTLQSLACGKVRVLQK+PKGRDVED D FVFN++F+APLYRIKVNAIQMKETVEENTST
Sbjct: 679  RRTLQSLACGKVRVLQKMPKGRDVEDKDEFVFNEEFSAPLYRIKVNAIQMKETVEENTST 738

Query: 363  TERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREY 184
            TERVFQDRQYQVDAAIVRIMKTRK LSHTLLI ELFQQLKFPIKP+D+KKRIESLIDREY
Sbjct: 739  TERVFQDRQYQVDAAIVRIMKTRKTLSHTLLITELFQQLKFPIKPSDIKKRIESLIDREY 798

Query: 183  LERDKSNPQIYNYLA 139
            LERD+SNPQIYNYLA
Sbjct: 799  LERDRSNPQIYNYLA 813



>gb:AY091113_1574337 Arabidopsis thaliana putative cullin (At5g46210)
            mRNA, complete cds.
          Length = 792

 Score =  465 bits (1196), Expect = e-130
 Identities = 231/255 (90%), Positives = 241/255 (94%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSG 724
            ESFKQSSQARTKLP GIEMSVHVLTTGYWPTYPPMDV+LPHELNVYQDIFKEFYLSKYSG
Sbjct: 538  ESFKQSSQARTKLPSGIEMSVHVLTTGYWPTYPPMDVKLPHELNVYQDIFKEFYLSKYSG 597

Query: 723  RRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKEL 544
            RRLMWQNSLGHCVLKA+F KG+KELAVS FQ VVLMLFN+A K SF+DIK++  IEDKEL
Sbjct: 598  RRLMWQNSLGHCVLKADFSKGKKELAVSLFQAVVLMLFNDAMKLSFEDIKDSTSIEDKEL 657

Query: 543  RRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTST 364
            RRTLQSLACGKVRVLQK PKGRDVED D F FND+F APLYRIKVNAIQMKETVEENTST
Sbjct: 658  RRTLQSLACGKVRVLQKNPKGRDVEDGDEFEFNDEFAAPLYRIKVNAIQMKETVEENTST 717

Query: 363  TERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREY 184
            TERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLIDREY
Sbjct: 718  TERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREY 777

Query: 183  LERDKSNPQIYNYLA 139
            LER+KSNPQIYNYLA
Sbjct: 778  LEREKSNPQIYNYLA 792



>gb:AY084267_1569359 Arabidopsis thaliana clone 101723 mRNA, complete
            sequence.
          Length = 792

 Score =  465 bits (1196), Expect = e-130
 Identities = 231/255 (90%), Positives = 241/255 (94%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSG 724
            ESFKQSSQARTKLP GIEMSVHVLTTGYWPTYPPMDV+LPHELNVYQDIFKEFYLSKYSG
Sbjct: 538  ESFKQSSQARTKLPSGIEMSVHVLTTGYWPTYPPMDVKLPHELNVYQDIFKEFYLSKYSG 597

Query: 723  RRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKEL 544
            RRLMWQNSLGHCVLKA+F KG+KELAVS FQ VVLMLFN+A K SF+DIK++  IEDKEL
Sbjct: 598  RRLMWQNSLGHCVLKADFSKGKKELAVSLFQAVVLMLFNDAMKLSFEDIKDSTSIEDKEL 657

Query: 543  RRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTST 364
            RRTLQSLACGKVRVLQK PKGRDVED D F FND+F APLYRIKVNAIQMKETVEENTST
Sbjct: 658  RRTLQSLACGKVRVLQKNPKGRDVEDGDEFEFNDEFAAPLYRIKVNAIQMKETVEENTST 717

Query: 363  TERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREY 184
            TERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLIDREY
Sbjct: 718  TERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREY 777

Query: 183  LERDKSNPQIYNYLA 139
            LER+KSNPQIYNYLA
Sbjct: 778  LEREKSNPQIYNYLA 792



>gb:ATH318018_1552493 Arabidopsis thaliana mRNA for cullin 4 (cul4
            gene).
          Length = 742

 Score =  465 bits (1196), Expect = e-130
 Identities = 231/255 (90%), Positives = 241/255 (94%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSG 724
            ESFKQSSQARTKLP GIEMSVHVLTTGYWPTYPPMDV+LPHELNVYQDIFKEFYLSKYSG
Sbjct: 488  ESFKQSSQARTKLPSGIEMSVHVLTTGYWPTYPPMDVKLPHELNVYQDIFKEFYLSKYSG 547

Query: 723  RRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKEL 544
            RRLMWQNSLGHCVLKA+F KG+KELAVS FQ VVLMLFN+A K SF+DIK++  IEDKEL
Sbjct: 548  RRLMWQNSLGHCVLKADFSKGKKELAVSLFQAVVLMLFNDAMKLSFEDIKDSTSIEDKEL 607

Query: 543  RRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTST 364
            RRTLQSLACGKVRVLQK PKGRDVED D F FND+F APLYRIKVNAIQMKETVEENTST
Sbjct: 608  RRTLQSLACGKVRVLQKNPKGRDVEDGDEFEFNDEFAAPLYRIKVNAIQMKETVEENTST 667

Query: 363  TERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREY 184
            TERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLIDREY
Sbjct: 668  TERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREY 727

Query: 183  LERDKSNPQIYNYLA 139
            LER+KSNPQIYNYLA
Sbjct: 728  LEREKSNPQIYNYLA 742



>gb:AB025620_1516422 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MDE13.
          Length = 617

 Score =  436 bits (1122), Expect = e-121
 Identities = 222/258 (86%), Positives = 232/258 (89%), Gaps = 3/258 (1%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSG 724
            ESFKQSSQARTKLP GIEMSVHVLTTGYWPTYPPMDV+LPHELNVYQDIFKEFYLSKYSG
Sbjct: 360  ESFKQSSQARTKLPSGIEMSVHVLTTGYWPTYPPMDVKLPHELNVYQDIFKEFYLSKYSG 419

Query: 723  RRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSF---QDIKEAIGIED 553
            RRLMWQNSLGHCVLKA+F KG+KELAVS FQ   +         SF   +DIK++  IED
Sbjct: 420  RRLMWQNSLGHCVLKADFSKGKKELAVSLFQVSQIFFPPPPLLSSFLSSRDIKDSTSIED 479

Query: 552  KELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEEN 373
            KELRRTLQSLACGKVRVLQK PKGRDVED D F FND+F APLYRIKVNAIQMKETVEEN
Sbjct: 480  KELRRTLQSLACGKVRVLQKNPKGRDVEDGDEFEFNDEFAAPLYRIKVNAIQMKETVEEN 539

Query: 372  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLID 193
            TSTTERVFQDRQYQ+DAAIVRIMKTRKVLSHTLLI ELFQQLKFPIKPADLKKRIESLID
Sbjct: 540  TSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLID 599

Query: 192  REYLERDKSNPQIYNYLA 139
            REYLER+KSNPQIYNYLA
Sbjct: 600  REYLEREKSNPQIYNYLA 617



>gb:HSU58091_2025039 Human Hs-cul-4B mRNA, partial cds.
          Length = 288

 Score =  358 bits (918), Expect = 1e-97
 Identities = 173/253 (68%), Positives = 209/253 (82%)
 Frame = -1

Query: 897 FKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRR 718
           FKQ  Q +  +P  IE++V++LT GYWPTY PM+V LP E+   Q+IFK FYL K+SGR+
Sbjct: 37  FKQYMQNQN-VPGNIELTVNILTMGYWPTYVPMEVHLPPEMVKLQEIFKTFYLGKHSGRK 95

Query: 717 LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR 538
           L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct: 96  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR 155

Query: 537 TLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE 358
           TLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct: 156 TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE 215

Query: 357 RVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLE 178
           RVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLIDR+Y+E
Sbjct: 216 RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME 275

Query: 177 RDKSNPQIYNYLA 139
           RDK NP  YNY+A
Sbjct: 276 RDKENPNQYNYIA 288



>gb:HSM805877_2018085 Homo sapiens mRNA; cDNA DKFZp779P1063 (from
            clone DKFZp779P1063); complete cds.
          Length = 895

 Score =  358 bits (918), Expect = 1e-97
 Identities = 173/253 (68%), Positives = 209/253 (82%)
 Frame = -1

Query: 897  FKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRR 718
            FKQ  Q +  +P  IE++V++LT GYWPTY PM+V LP E+   Q+IFK FYL K+SGR+
Sbjct: 644  FKQYMQNQN-VPGNIELTVNILTMGYWPTYVPMEVHLPPEMVKLQEIFKTFYLGKHSGRK 702

Query: 717  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR 538
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct: 703  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR 762

Query: 537  TLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE 358
            TLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct: 763  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE 822

Query: 357  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLE 178
            RVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLIDR+Y+E
Sbjct: 823  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME 882

Query: 177  RDKSNPQIYNYLA 139
            RDK NP  YNY+A
Sbjct: 883  RDKENPNQYNYIA 895



>gb:AL451005_1928094 Human DNA sequence from clone RP11-92B10 on
            chromosome X Contains the 5' end of a variant of the
            CUL4B gene for cullin 4B and the 5' end of a variant of
            the gene for MCT-1 protein (MCT-1), complete sequence.
          Length = 913

 Score =  358 bits (918), Expect = 1e-97
 Identities = 173/253 (68%), Positives = 209/253 (82%)
 Frame = -1

Query: 897  FKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRR 718
            FKQ  Q +  +P  IE++V++LT GYWPTY PM+V LP E+   Q+IFK FYL K+SGR+
Sbjct: 662  FKQYMQNQN-VPGNIELTVNILTMGYWPTYVPMEVHLPPEMVKLQEIFKTFYLGKHSGRK 720

Query: 717  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR 538
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct: 721  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR 780

Query: 537  TLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE 358
            TLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct: 781  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE 840

Query: 357  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLE 178
            RVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLIDR+Y+E
Sbjct: 841  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME 900

Query: 177  RDKSNPQIYNYLA 139
            RDK NP  YNY+A
Sbjct: 901  RDKENPNQYNYIA 913



>gb:AC002476_1874445 Human PAC clone RP1-318C15 from Xq23, complete
            sequence.
          Length = 652

 Score =  358 bits (918), Expect = 1e-97
 Identities = 173/253 (68%), Positives = 209/253 (82%)
 Frame = -1

Query: 897  FKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRR 718
            FKQ  Q +  +P  IE++V++LT GYWPTY PM+V LP E+   Q+IFK FYL K+SGR+
Sbjct: 401  FKQYMQNQN-VPGNIELTVNILTMGYWPTYVPMEVHLPPEMVKLQEIFKTFYLGKHSGRK 459

Query: 717  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR 538
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct: 460  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR 519

Query: 537  TLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE 358
            TLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct: 520  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE 579

Query: 357  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLE 178
            RVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLIDR+Y+E
Sbjct: 580  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME 639

Query: 177  RDKSNPQIYNYLA 139
            RDK NP  YNY+A
Sbjct: 640  RDKENPNQYNYIA 652



>gb:AB014595_1864624 Homo sapiens mRNA for KIAA0695 protein, partial
            cds.
          Length = 781

 Score =  358 bits (918), Expect = 1e-97
 Identities = 173/253 (68%), Positives = 209/253 (82%)
 Frame = -1

Query: 897  FKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRR 718
            FKQ  Q +  +P  IE++V++LT GYWPTY PM+V LP E+   Q+IFK FYL K+SGR+
Sbjct: 530  FKQYMQNQN-VPGNIELTVNILTMGYWPTYVPMEVHLPPEMVKLQEIFKTFYLGKHSGRK 588

Query: 717  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR 538
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct: 589  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR 648

Query: 537  TLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE 358
            TLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct: 649  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE 708

Query: 357  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLE 178
            RVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLIDR+Y+E
Sbjct: 709  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME 768

Query: 177  RDKSNPQIYNYLA 139
            RDK NP  YNY+A
Sbjct: 769  RDKENPNQYNYIA 781



>sp|Q13620|CU4B_HUMAN Cullin homolog 4B (CUL-4B).
          Length = 717

 Score =  358 bits (918), Expect = 1e-97
 Identities = 173/253 (68%), Positives = 209/253 (82%)
 Frame = -1

Query: 897  FKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRR 718
            FKQ  Q +  +P  IE++V++LT GYWPTY PM+V LP E+   Q+IFK FYL K+SGR+
Sbjct: 466  FKQYMQNQN-VPGNIELTVNILTMGYWPTYVPMEVHLPPEMVKLQEIFKTFYLGKHSGRK 524

Query: 717  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR 538
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct: 525  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR 584

Query: 537  TLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE 358
            TLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct: 585  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE 644

Query: 357  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLE 178
            RVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLIDR+Y+E
Sbjct: 645  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME 704

Query: 177  RDKSNPQIYNYLA 139
            RDK NP  YNY+A
Sbjct: 705  RDKENPNQYNYIA 717



>gb:BC010347_2090980 Mus musculus cullin 4B, mRNA (cDNA clone
           IMAGE:3707849), complete cds.
          Length = 285

 Score =  357 bits (916), Expect = 2e-97
 Identities = 173/253 (68%), Positives = 208/253 (82%)
 Frame = -1

Query: 897 FKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRR 718
           FKQ  Q +  +P  IE++V++LT GYWPTY PM+V LP E+   Q+IFK FYL K+SGR+
Sbjct: 34  FKQYMQNQN-VPGNIELTVNILTMGYWPTYVPMEVHLPPEMVKLQEIFKTFYLGKHSGRK 92

Query: 717 LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR 538
           L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK A GIED ELRR
Sbjct: 93  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTMVLLMFNEGEEFSLEEIKHATGIEDGELRR 152

Query: 537 TLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE 358
           TLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct: 153 TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE 212

Query: 357 RVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLE 178
           RVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLIDR+Y+E
Sbjct: 213 RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME 272

Query: 177 RDKSNPQIYNYLA 139
           RDK NP  YNY+A
Sbjct: 273 RDKENPNQYNYIA 285



>gb:BC004026_2089542 Mus musculus cullin 4B, mRNA (cDNA clone MGC:7617
            IMAGE:3494708), complete cds.
          Length = 614

 Score =  357 bits (916), Expect = 2e-97
 Identities = 173/253 (68%), Positives = 208/253 (82%)
 Frame = -1

Query: 897  FKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRR 718
            FKQ  Q +  +P  IE++V++LT GYWPTY PM+V LP E+   Q+IFK FYL K+SGR+
Sbjct: 363  FKQYMQNQN-VPGNIELTVNILTMGYWPTYVPMEVHLPPEMVKLQEIFKTFYLGKHSGRK 421

Query: 717  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR 538
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK A GIED ELRR
Sbjct: 422  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTMVLLMFNEGEEFSLEEIKHATGIEDGELRR 481

Query: 537  TLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE 358
            TLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct: 482  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE 541

Query: 357  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLE 178
            RVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLIDR+Y+E
Sbjct: 542  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME 601

Query: 177  RDKSNPQIYNYLA 139
            RDK NP  YNY+A
Sbjct: 602  RDKENPNQYNYIA 614



>gb:BC036216_1981869 Homo sapiens cullin 4B, mRNA (cDNA clone
            MGC:39677 IMAGE:5269392), complete cds.
          Length = 913

 Score =  357 bits (916), Expect = 2e-97
 Identities = 172/253 (67%), Positives = 209/253 (82%)
 Frame = -1

Query: 897  FKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRR 718
            FKQ  Q +  +P  IE++V++LT GYWPTY PM+V LP E+   Q+IFK FYL K+SGR+
Sbjct: 662  FKQYMQNQN-VPGNIELTVNILTMGYWPTYVPMEVHLPPEMVKLQEIFKTFYLGKHSGRK 720

Query: 717  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR 538
            L WQ+++GHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct: 721  LQWQSTIGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR 780

Query: 537  TLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE 358
            TLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct: 781  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE 840

Query: 357  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLE 178
            RVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLIDR+Y+E
Sbjct: 841  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME 900

Query: 177  RDKSNPQIYNYLA 139
            RDK NP  YNY+A
Sbjct: 901  RDKENPNQYNYIA 913



>gb:AY365125_1948082 Homo sapiens cullin 4B (CUL4B) mRNA, complete
            cds.
          Length = 895

 Score =  357 bits (916), Expect = 2e-97
 Identities = 172/253 (67%), Positives = 209/253 (82%)
 Frame = -1

Query: 897  FKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRR 718
            FKQ  Q +  +P  IE++V++LT GYWPTY PM+V LP E+   Q+IFK FYL K+SGR+
Sbjct: 644  FKQYMQNQN-VPGNIELTVNILTMGYWPTYVPMEVHLPPEMVKLQEIFKTFYLGKHSGRK 702

Query: 717  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR 538
            L WQ+++GHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELRR
Sbjct: 703  LQWQSTIGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR 762

Query: 537  TLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE 358
            TLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct: 763  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE 822

Query: 357  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLE 178
            RVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLIDR+Y+E
Sbjct: 823  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME 882

Query: 177  RDKSNPQIYNYLA 139
            RDK NP  YNY+A
Sbjct: 883  RDKENPNQYNYIA 895



>gb:AK012410_1156942 Mus musculus 11 days embryo whole body cDNA,
            RIKEN full-length enriched library, clone:2700050M05
            product:cullin 4B, full insert sequence.
          Length = 915

 Score =  357 bits (916), Expect = 2e-97
 Identities = 173/253 (68%), Positives = 208/253 (82%)
 Frame = -1

Query: 897  FKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRR 718
            FKQ  Q +  +P  IE++V++LT GYWPTY PM+V LP E+   Q+IFK FYL K+SGR+
Sbjct: 664  FKQYMQNQN-VPGNIELTVNILTMGYWPTYVPMEVHLPPEMVKLQEIFKTFYLGKHSGRK 722

Query: 717  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR 538
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK A GIED ELRR
Sbjct: 723  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTMVLLMFNEGEEFSLEEIKHATGIEDGELRR 782

Query: 537  TLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE 358
            TLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct: 783  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE 842

Query: 357  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLE 178
            RVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLIDR+Y+E
Sbjct: 843  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME 902

Query: 177  RDKSNPQIYNYLA 139
            RDK NP  YNY+A
Sbjct: 903  RDKENPNQYNYIA 915



>gb:AF212995_1890266 Homo sapiens cullin CUL4B (CUL4B) mRNA, complete
            cds.
          Length = 782

 Score =  357 bits (915), Expect = 2e-97
 Identities = 172/254 (67%), Positives = 209/254 (82%), Gaps = 1/254 (0%)
 Frame = -1

Query: 897  FKQSSQARTK-LPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGR 721
            FKQ    + + +P  IE++V++LT GYWPTY PM+V LP E+   Q+IFK FYL K+SGR
Sbjct: 529  FKQVKYMQNQNVPGNIELTVNILTMGYWPTYVPMEVHLPPEMVKLQEIFKTFYLGKHSGR 588

Query: 720  RLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELR 541
            +L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK+A GIED ELR
Sbjct: 589  KLQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELR 648

Query: 540  RTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTT 361
            RTLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STT
Sbjct: 649  RTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTT 708

Query: 360  ERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYL 181
            ERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLIDR+Y+
Sbjct: 709  ERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYM 768

Query: 180  ERDKSNPQIYNYLA 139
            ERDK NP  YNY+A
Sbjct: 769  ERDKENPNQYNYIA 782



>gb:AK032701_1163036 Mus musculus 12 days embryo male wolffian duct
            includes surrounding region cDNA, RIKEN full-length
            enriched library, clone:6720405B21 product:cullin 4B,
            full insert sequence.>gb:AY330868_2083636 Mus musculus
            cullin 4B mRNA, complete cds.
          Length = 970

 Score =  355 bits (912), Expect = 5e-97
 Identities = 172/253 (67%), Positives = 208/253 (82%)
 Frame = -1

Query: 897  FKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRR 718
            FKQ  Q +  +P  IE++V++LT GYWPTY PM+V LP E+   Q+IFK FYL K+SGR+
Sbjct: 719  FKQYMQNQN-VPGNIELTVNILTMGYWPTYVPMEVHLPPEMVKLQEIFKTFYLGKHSGRK 777

Query: 717  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR 538
            L WQ++LGHCVLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK A GIED ELRR
Sbjct: 778  LQWQSTLGHCVLKAEFKEGKKELQVSLFQTMVLLMFNEGEEFSLEEIKHATGIEDGELRR 837

Query: 537  TLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE 358
            TLQSLACGK RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTE
Sbjct: 838  TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE 897

Query: 357  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLE 178
            RVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ +LKFP+KPADLKKRIESLIDR+Y+E
Sbjct: 898  RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNRLKFPVKPADLKKRIESLIDRDYME 957

Query: 177  RDKSNPQIYNYLA 139
            RDK NP  YNY+A
Sbjct: 958  RDKENPNQYNYIA 970



>gb:AB093259_2048044 Mus musculus mRNA for mKIAA0695 protein.
          Length = 737

 Score =  352 bits (902), Expect = 7e-96
 Identities = 168/243 (69%), Positives = 202/243 (83%)
 Frame = -1

Query: 867  LPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHC 688
            +P  IE++V++LT GYWPTY PM+V LP E+   Q+IFK FYL K+SGR+L WQ++LGHC
Sbjct: 495  VPGNIELTVNILTMGYWPTYVPMEVHLPPEMVKLQEIFKTFYLGKHSGRKLQWQSTLGHC 554

Query: 687  VLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKV 508
            VLKAEF +G+KEL VS FQT+VL++FNE E+FS ++IK A GIED ELRRTLQSLACGK 
Sbjct: 555  VLKAEFKEGKKELQVSLFQTMVLLMFNEGEEFSLEEIKHATGIEDGELRRTLQSLACGKA 614

Query: 507  RVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQV 328
            RVL K PKG+D+ED D F+ ND F   L+RIK+N IQMKETVEE  STTERVFQDRQYQ+
Sbjct: 615  RVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTERVFQDRQYQI 674

Query: 327  DAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLERDKSNPQIYN 148
            DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLIDR+Y+ERDK NP   N
Sbjct: 675  DAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYMERDKENPNQSN 734

Query: 147  YLA 139
            Y+A
Sbjct: 735  YIA 737



>gb:AY389766_1178372 Hyacinthus orientalis cullin mRNA, partial cds.
          Length = 270

 Score =  343 bits (880), Expect = 3e-93
 Identities = 167/196 (85%), Positives = 181/196 (92%)
 Frame = -1

Query: 900 SFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGR 721
           SFKQSSQARTKLP GIEMSV VLTTGYWPTYPPMDV+LPHELNVYQDIFKEFYLSKYSGR
Sbjct: 73  SFKQSSQARTKLPSGIEMSVLVLTTGYWPTYPPMDVKLPHELNVYQDIFKEFYLSKYSGR 132

Query: 720 RLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELR 541
           RLMWQNSLGHCVLK +FPKG+KELAVSFFQTVVLMLFN+ +K SFQDIK++  I+DKELR
Sbjct: 133 RLMWQNSLGHCVLKVDFPKGKKELAVSFFQTVVLMLFNDTQKLSFQDIKDSTSIDDKELR 192

Query: 540 RTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTT 361
           RTLQSLACGK RVLQK PKGR+V+DDD+FVFN++F+APLYRI VNAI M ETVEENTS T
Sbjct: 193 RTLQSLACGKFRVLQKYPKGREVDDDDSFVFNEEFSAPLYRINVNAIHMNETVEENTSPT 252

Query: 360 ERVFQDRQYQVDAAIV 313
           E VFQDRQ QVDAAIV
Sbjct: 253 ETVFQDRQSQVDAAIV 268



>gb:AY059387_1564535 Olea europaea putative cullin protein mRNA,
            complete cds.
          Length = 816

 Score =  342 bits (878), Expect = 4e-93
 Identities = 183/262 (69%), Positives = 206/262 (78%), Gaps = 7/262 (2%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSG 724
            ESFKQSSQARTKLP GIEMSVHVLTTGYWPT PPMDVRLPHELNVYQDIFKEFYLSK+SG
Sbjct: 561  ESFKQSSQARTKLPSGIEMSVHVLTTGYWPTSPPMDVRLPHELNVYQDIFKEFYLSKHSG 620

Query: 723  RRLMWQNSLGHCVLKAE-FPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKE 547
            RRLMW NSLGHCVL+++ F K  +     +F+ +        +  + QDIKE+ GI    
Sbjct: 621  RRLMWHNSLGHCVLESQNFQKVERSWLFLYFRRLCCAHLTMHKTLASQDIKESTGI---- 676

Query: 546  LRRTLQSLACGKVRVLQKIPKGRDVEDDD------TFVFNDQFTAPLYRIKVNAIQMKET 385
            LR  ++S     +  ++K P+  +    +      +FVFNDQFTAPLYRIKVNAIQMKET
Sbjct: 677  LR--IKSEEDSAIPCMRKSPRSSENSQGERCGGLCSFVFNDQFTAPLYRIKVNAIQMKET 734

Query: 384  VEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIE 205
            VEEN STTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLK P K +DLKKRIE
Sbjct: 735  VEENASTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKVPHKTSDLKKRIE 794

Query: 204  SLIDREYLERDKSNPQIYNYLA 139
            SLIDREYLERDK+NPQ+YNYLA
Sbjct: 795  SLIDREYLERDKNNPQVYNYLA 816



>gb:BC024113_2094386 Mus musculus cullin 4A, mRNA (cDNA clone
            MGC:36573 IMAGE:5097944), complete cds.
          Length = 594

 Score =  340 bits (873), Expect = 2e-92
 Identities = 165/253 (65%), Positives = 203/253 (80%)
 Frame = -1

Query: 897  FKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRR 718
            FKQ  Q ++  P  I+++V++LT GYWPTY PM+V LP E+   Q++FK FYL K+SGR+
Sbjct: 343  FKQHMQNQSA-PGPIDLTVNILTMGYWPTYTPMEVHLPPEMVRLQEVFKTFYLGKHSGRK 401

Query: 717  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR 538
            L WQ +LGH VLKA+F +G+KE  VS FQT+VL++FNE + FSF++IK A GIED ELRR
Sbjct: 402  LQWQTTLGHAVLKADFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRR 461

Query: 537  TLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE 358
            TLQSLACGK RVL K PKG++VED D F+FN  F   L+RIK+N IQMKETVEE  STTE
Sbjct: 462  TLQSLACGKARVLIKSPKGKEVEDGDKFIFNADFKHKLFRIKINQIQMKETVEEQVSTTE 521

Query: 357  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLE 178
            RVFQDRQYQ+DAAIVRIMK RK L H LL++EL+ QLKFP+KP DLKKRIESLIDR+Y+E
Sbjct: 522  RVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYME 581

Query: 177  RDKSNPQIYNYLA 139
            RDK +P  Y+Y+A
Sbjct: 582  RDKDSPNQYHYVA 594



>gb:BC010211_2090896 Mus musculus cullin 4A, mRNA (cDNA clone
            MGC:11743 IMAGE:3969515), complete cds.
          Length = 614

 Score =  340 bits (873), Expect = 2e-92
 Identities = 165/253 (65%), Positives = 203/253 (80%)
 Frame = -1

Query: 897  FKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRR 718
            FKQ  Q ++  P  I+++V++LT GYWPTY PM+V LP E+   Q++FK FYL K+SGR+
Sbjct: 363  FKQHMQNQSA-PGPIDLTVNILTMGYWPTYTPMEVHLPPEMVRLQEVFKTFYLGKHSGRK 421

Query: 717  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR 538
            L WQ +LGH VLKA+F +G+KE  VS FQT+VL++FNE + FSF++IK A GIED ELRR
Sbjct: 422  LQWQTTLGHAVLKADFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRR 481

Query: 537  TLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE 358
            TLQSLACGK RVL K PKG++VED D F+FN  F   L+RIK+N IQMKETVEE  STTE
Sbjct: 482  TLQSLACGKARVLIKSPKGKEVEDGDKFIFNADFKHKLFRIKINQIQMKETVEEQVSTTE 541

Query: 357  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLE 178
            RVFQDRQYQ+DAAIVRIMK RK L H LL++EL+ QLKFP+KP DLKKRIESLIDR+Y+E
Sbjct: 542  RVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYME 601

Query: 177  RDKSNPQIYNYLA 139
            RDK +P  Y+Y+A
Sbjct: 602  RDKDSPNQYHYVA 614



>gb:BT007619_2150551 Synthetic construct Homo sapiens cullin 4A mRNA,
            partial cds.
          Length = 660

 Score =  339 bits (869), Expect = 5e-92
 Identities = 161/239 (67%), Positives = 196/239 (82%)
 Frame = -1

Query: 855  IEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA 676
            I+++V++LT GYWPTY PM+V L  E+   Q++FK FYL K+SGR+L WQ +LGH VLKA
Sbjct: 421  IDLTVNILTMGYWPTYTPMEVHLTPEMIKLQEVFKAFYLGKHSGRKLQWQTTLGHAVLKA 480

Query: 675  EFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQ 496
            EF +G+KE  VS FQT+VL++FNE + FSF++IK A GIED ELRRTLQSLACGK RVL 
Sbjct: 481  EFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLI 540

Query: 495  KIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAI 316
            K PKG++VED D F+FN +F   L+RIK+N IQMKETVEE  STTERVFQDRQYQ+DAAI
Sbjct: 541  KSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAI 600

Query: 315  VRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
            VRIMK RK L H LL++EL+ QLKFP+KP DLKKRIESLIDR+Y+ERDK NP  Y+Y+A
Sbjct: 601  VRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA 659



>gb:HSU58090_2025038 Human Hs-cul-4A mRNA, partial cds.
          Length = 421

 Score =  339 bits (869), Expect = 5e-92
 Identities = 161/239 (67%), Positives = 196/239 (82%)
 Frame = -1

Query: 855 IEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA 676
           I+++V++LT GYWPTY PM+V L  E+   Q++FK FYL K+SGR+L WQ +LGH VLKA
Sbjct: 183 IDLTVNILTMGYWPTYTPMEVHLTPEMIKLQEVFKAFYLGKHSGRKLQWQTTLGHAVLKA 242

Query: 675 EFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQ 496
           EF +G+KE  VS FQT+VL++FNE + FSF++IK A GIED ELRRTLQSLACGK RVL 
Sbjct: 243 EFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLI 302

Query: 495 KIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAI 316
           K PKG++VED D F+FN +F   L+RIK+N IQMKETVEE  STTERVFQDRQYQ+DAAI
Sbjct: 303 KSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAI 362

Query: 315 VRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
           VRIMK RK L H LL++EL+ QLKFP+KP DLKKRIESLIDR+Y+ERDK NP  Y+Y+A
Sbjct: 363 VRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA 421



>gb:AY365124_1948081 Homo sapiens cullin 4A (CUL4A) mRNA, complete
            cds.
          Length = 759

 Score =  339 bits (869), Expect = 5e-92
 Identities = 161/239 (67%), Positives = 196/239 (82%)
 Frame = -1

Query: 855  IEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA 676
            I+++V++LT GYWPTY PM+V L  E+   Q++FK FYL K+SGR+L WQ +LGH VLKA
Sbjct: 521  IDLTVNILTMGYWPTYTPMEVHLTPEMIKLQEVFKAFYLGKHSGRKLQWQTTLGHAVLKA 580

Query: 675  EFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQ 496
            EF +G+KE  VS FQT+VL++FNE + FSF++IK A GIED ELRRTLQSLACGK RVL 
Sbjct: 581  EFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLI 640

Query: 495  KIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAI 316
            K PKG++VED D F+FN +F   L+RIK+N IQMKETVEE  STTERVFQDRQYQ+DAAI
Sbjct: 641  KSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAI 700

Query: 315  VRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
            VRIMK RK L H LL++EL+ QLKFP+KP DLKKRIESLIDR+Y+ERDK NP  Y+Y+A
Sbjct: 701  VRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA 759



>gb:AB012193_1864393 Homo sapiens mRNA for cullin-4A, partial cds.
          Length = 524

 Score =  339 bits (869), Expect = 5e-92
 Identities = 161/239 (67%), Positives = 196/239 (82%)
 Frame = -1

Query: 855  IEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA 676
            I+++V++LT GYWPTY PM+V L  E+   Q++FK FYL K+SGR+L WQ +LGH VLKA
Sbjct: 286  IDLTVNILTMGYWPTYTPMEVHLTPEMIKLQEVFKAFYLGKHSGRKLQWQTTLGHAVLKA 345

Query: 675  EFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQ 496
            EF +G+KE  VS FQT+VL++FNE + FSF++IK A GIED ELRRTLQSLACGK RVL 
Sbjct: 346  EFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLI 405

Query: 495  KIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAI 316
            K PKG++VED D F+FN +F   L+RIK+N IQMKETVEE  STTERVFQDRQYQ+DAAI
Sbjct: 406  KSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAI 465

Query: 315  VRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
            VRIMK RK L H LL++EL+ QLKFP+KP DLKKRIESLIDR+Y+ERDK NP  Y+Y+A
Sbjct: 466  VRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA 524



>sp|Q13619|CU4A_HUMAN Cullin homolog 4A (CUL-4A).>gb:AF077188_1881092
            Homo sapiens cullin 4A (CUL4A) mRNA, complete
            cds.>gb:AL136221_1919036 Human DNA sequence from clone
            RP11-391H12 on chromosome 13 Contains the CUL4A gene for
            cullin 4A, the LAMP1 gene for lysosomal-associated
            membrane protein 1, the GRTP1 gene for growth hormone
            regulated TBC protein 1, a novel gene, the 5' end of a
            novel gene (FLJ11305) an LDHB (lactate dehydrogenase B)
            pseudogene and six CpG islands, complete
            sequence.>gb:BC008308_1971290 Homo sapiens cullin 4A,
            mRNA (cDNA clone MGC:15238 IMAGE:3537176), complete cds.
          Length = 659

 Score =  339 bits (869), Expect = 5e-92
 Identities = 161/239 (67%), Positives = 196/239 (82%)
 Frame = -1

Query: 855  IEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA 676
            I+++V++LT GYWPTY PM+V L  E+   Q++FK FYL K+SGR+L WQ +LGH VLKA
Sbjct: 421  IDLTVNILTMGYWPTYTPMEVHLTPEMIKLQEVFKAFYLGKHSGRKLQWQTTLGHAVLKA 480

Query: 675  EFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQ 496
            EF +G+KE  VS FQT+VL++FNE + FSF++IK A GIED ELRRTLQSLACGK RVL 
Sbjct: 481  EFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLI 540

Query: 495  KIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAI 316
            K PKG++VED D F+FN +F   L+RIK+N IQMKETVEE  STTERVFQDRQYQ+DAAI
Sbjct: 541  KSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAI 600

Query: 315  VRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
            VRIMK RK L H LL++EL+ QLKFP+KP DLKKRIESLIDR+Y+ERDK NP  Y+Y+A
Sbjct: 601  VRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA 659



>pir|T07163|T07163 probable cullin protein -
            tomato>gb:LES16124_1684470 Lycopersicon esculentum mRNA
            for putative cullin protein.
          Length = 615

 Score =  338 bits (866), Expect = 1e-91
 Identities = 183/256 (71%), Positives = 198/256 (77%), Gaps = 1/256 (0%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSG 724
            ESFKQSSQARTKLP GIEMSVHVLT GYWPTYPPMDVRLPHELNVYQDIFKEFYLS+YSG
Sbjct: 360  ESFKQSSQARTKLPTGIEMSVHVLTMGYWPTYPPMDVRLPHELNVYQDIFKEFYLSEYSG 419

Query: 723  RRLMWQNSLGHCVLKA-EFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKE 547
            RRLMWQNSLGHCVL++    K ++     F + +   L    +  + QDIKEA GI   +
Sbjct: 420  RRLMWQNSLGHCVLESWNIQKEKRSSQFLFSRLLFCALLMMRKILASQDIKEATGILRIK 479

Query: 546  LRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTS 367
              +        K     +  K +      TFVF  QFTAPLYRIKVNAIQMKETVEENTS
Sbjct: 480  SEKDSTVSCMWKSSCSPEDSKRKRCGGLCTFVFLYQFTAPLYRIKVNAIQMKETVEENTS 539

Query: 366  TTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDRE 187
            TTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLI ELFQQLKFP K + LKKRIESLIDRE
Sbjct: 540  TTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPNKTSYLKKRIESLIDRE 599

Query: 186  YLERDKSNPQIYNYLA 139
            YLERDK+NPQIYNYLA
Sbjct: 600  YLERDKNNPQIYNYLA 615



>gb:AY051648_1290242 Drosophila melanogaster GM14815 full length cDNA.
          Length = 601

 Score =  305 bits (781), Expect = 8e-82
 Identities = 149/239 (62%), Positives = 184/239 (76%)
 Frame = -1

Query: 855  IEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA 676
            +++ V +LT GYWPTY P +V +P +    Q IF +FYL K+SGR+L WQ +LG+C+L+A
Sbjct: 363  LDLCVSILTMGYWPTYAPTEVTMPPQFINPQQIFNKFYLEKHSGRKLQWQPTLGNCMLRA 422

Query: 675  EFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQ 496
            +F  G KEL VS FQ +VL+LFN+    S+++I  A  IED ELRRTLQSLACG+ RV+ 
Sbjct: 423  QFDAGPKELLVSLFQALVLLLFNDKPVLSYEEILAATLIEDGELRRTLQSLACGRARVIT 482

Query: 495  KIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAI 316
            K PKGR++ D D F FN++FT  L+RIK+N IQMKET EE  +T ERVFQDRQYQ+DAAI
Sbjct: 483  KTPKGREILDGDQFDFNNEFTNKLFRIKINQIQMKETNEEQKATEERVFQDRQYQIDAAI 542

Query: 315  VRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
            VRIMK RK LSH LLI ELF QL FP+KPADLKKRIESLIDR+Y+ERDK N   YNY+A
Sbjct: 543  VRIMKMRKTLSHNLLITELFNQLTFPVKPADLKKRIESLIDRDYMERDKDNQNQYNYVA 601



>gb:AE013599_1130587 Drosophila melanogaster chromosome 2R, complete
            sequence.>gb:AE003838_1227089 Drosophila melanogaster
            chromosome 2R, section 12 of 74 of the complete sequence.
          Length = 821

 Score =  305 bits (781), Expect = 8e-82
 Identities = 149/239 (62%), Positives = 184/239 (76%)
 Frame = -1

Query: 855  IEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA 676
            +++ V +LT GYWPTY P +V +P +    Q IF +FYL K+SGR+L WQ +LG+C+L+A
Sbjct: 583  LDLCVSILTMGYWPTYAPTEVTMPPQFINPQQIFNKFYLEKHSGRKLQWQPTLGNCMLRA 642

Query: 675  EFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQ 496
            +F  G KEL VS FQ +VL+LFN+    S+++I  A  IED ELRRTLQSLACG+ RV+ 
Sbjct: 643  QFDAGPKELLVSLFQALVLLLFNDKPVLSYEEILAATLIEDGELRRTLQSLACGRARVIT 702

Query: 495  KIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAI 316
            K PKGR++ D D F FN++FT  L+RIK+N IQMKET EE  +T ERVFQDRQYQ+DAAI
Sbjct: 703  KTPKGREILDGDQFDFNNEFTNKLFRIKINQIQMKETNEEQKATEERVFQDRQYQIDAAI 762

Query: 315  VRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
            VRIMK RK LSH LLI ELF QL FP+KPADLKKRIESLIDR+Y+ERDK N   YNY+A
Sbjct: 763  VRIMKMRKTLSHNLLITELFNQLTFPVKPADLKKRIESLIDRDYMERDKDNQNQYNYVA 821



>gb:AK005426_1153010 Mus musculus adult female placenta cDNA, RIKEN
           full-length enriched library, clone:1600012G11
           product:hypothetical Cullin family containing protein,
           full insert sequence.
          Length = 205

 Score =  295 bits (755), Expect = 8e-79
 Identities = 142/205 (69%), Positives = 169/205 (82%)
 Frame = -1

Query: 753 KEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIK 574
           K FYL K+SGR+L WQ +LGH VLKA+F +G+KE  VS FQT+VL++FNE + FSF++IK
Sbjct: 1   KTFYLGKHSGRKLQWQTTLGHAVLKADFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIK 60

Query: 573 EAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQM 394
            A GIED ELRRTLQSLACGK RVL K PKG++VED D F+FN  F   L+RIK+N IQM
Sbjct: 61  MATGIEDSELRRTLQSLACGKARVLIKSPKGKEVEDGDKFIFNADFKHKLFRIKINQIQM 120

Query: 393 KETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKK 214
           KETVEE  STTERVFQDRQYQ+DAAIVRIMK RK L H LL++EL+ QLKFP+KP DLKK
Sbjct: 121 KETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKK 180

Query: 213 RIESLIDREYLERDKSNPQIYNYLA 139
           RIESLIDR+Y+ERDK +P  Y+Y+A
Sbjct: 181 RIESLIDRDYMERDKDSPNQYHYVA 205



>gb:AK003679_1152006 Mus musculus 18-day embryo whole body cDNA,
           RIKEN full-length enriched library, clone:1110014C11
           product:hypothetical Cullin family containing protein,
           full insert sequence.
          Length = 171

 Score =  246 bits (629), Expect = 3e-64
 Identities = 120/169 (71%), Positives = 141/169 (83%)
 Frame = -1

Query: 645 VSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVED 466
           VS FQT+VL++FNE + FSF++IK A GIED ELRRTLQSLACGK RVL K PKG++VED
Sbjct: 3   VSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLIKSPKGKEVED 62

Query: 465 DDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVL 286
            D F+FN  F   L+RIK+N IQMKETVEE  STTERVFQDRQYQ+DAAIVRIMK RK L
Sbjct: 63  GDKFIFNADFKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTL 122

Query: 285 SHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
            H LL++EL+ QLKFP+KP DLKKRIESLIDR+Y+ERDK +P  Y+Y+A
Sbjct: 123 GHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDSPNQYHYVA 171



>gb:AP004114_1837795 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC
            clone:OJ1118_G04.>gb:AP005733_1856810 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, BAC
            clone:OSJNBb0024K03.
          Length = 736

 Score =  220 bits (560), Expect = 3e-56
 Identities = 117/245 (47%), Positives = 167/245 (68%), Gaps = 5/245 (2%)
 Frame = -1

Query: 858  GIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLK 679
            G  + VH+LTTG WPT P     LP E+    D F+ +YL  +SGRRL WQ ++G   +K
Sbjct: 492  GPTLDVHILTTGSWPTQPCPPCNLPTEILAICDKFRTYYLGTHSGRRLTWQTNMGTADIK 551

Query: 678  AEFPKGRK-ELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVR- 505
            A F KG+K EL VS +Q  VLMLFN  +  +++DI++   I   +L+R LQSLAC K + 
Sbjct: 552  ATFGKGQKHELNVSTYQMCVLMLFNSTDGLTYKDIEQDTAIPASDLKRCLQSLACVKGKN 611

Query: 504  VLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKV-NAIQMKETVEENTSTTERVFQDRQYQV 328
            VL+K P  +D+ +DDTF FND+FT+ L ++K+   +  KE+  E   T +RV +DR+ Q+
Sbjct: 612  VLRKEPMSKDISEDDTFYFNDKFTSKLVKVKIGTVVAQKESEPEKQETRQRVEEDRKPQI 671

Query: 327  DAAIVRIMKTRKVLSHTLLIAELFQQL--KFPIKPADLKKRIESLIDREYLERDKSNPQI 154
            +AAIVRIMK+R+VL H  ++AE+ +QL  +F   P  +KKRIESLI+RE+LERDK++ ++
Sbjct: 672  EAAIVRIMKSRRVLDHNSIVAEVTKQLQARFMPNPVVIKKRIESLIEREFLERDKADRKL 731

Query: 153  YNYLA 139
            Y YLA
Sbjct: 732  YRYLA 736



>gb:ATH319540_1552502 Arabidopsis thaliana partial mRNA for cullin
           3a (cul3a gene).
          Length = 338

 Score =  219 bits (559), Expect = 4e-56
 Identities = 116/249 (46%), Positives = 173/249 (69%), Gaps = 5/249 (2%)
 Frame = -1

Query: 870 KLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGH 691
           +L  G  + V VLTTG WPT P +   LP E++V  + F+ +YL  ++GRRL WQ ++G 
Sbjct: 90  ELSEGPTLIVQVLTTGSWPTQPAVPCNLPAEVSVLCEKFRSYYLGTHTGRRLSWQTNMGT 149

Query: 690 CVLKAEFPKGRK-ELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACG 514
             +KA F KG+K EL VS FQ  VLMLFN +++ S+++I++A  I   +L+R LQSLAC 
Sbjct: 150 ADIKAIFGKGQKHELNVSTFQMCVLMLFNNSDRLSYKEIEQATEIPAADLKRCLQSLACV 209

Query: 513 KVR-VLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKV-NAIQMKETVEENTSTTERVFQDR 340
           K + V++K P  +D+ ++D FV ND+FT+  Y++K+   +  KET  E   T +RV +DR
Sbjct: 210 KGKNVIKKEPMSKDIGEEDLFVVNDKFTSKFYKVKIGTVVAQKETEPEKQETRQRVEEDR 269

Query: 339 QYQVDAAIVRIMKTRKVLSHTLLIAELFQQL--KFPIKPADLKKRIESLIDREYLERDKS 166
           + Q++AAIVRIMK+RK+L H  +IAE+ +QL  +F   P ++KKRIESLI+R++LERD +
Sbjct: 270 KPQIEAAIVRIMKSRKILDHNNIIAEVTKQLQPRFLANPTEIKKRIESLIERDFLERDST 329

Query: 165 NPQIYNYLA 139
           + ++Y YLA
Sbjct: 330 DRKLYRYLA 338



>pir|A86395|A86395 hypothetical protein T2P11.2 [imported] -
            Arabidopsis thaliana>gb:AE005172_891560 Arabidopsis
            thaliana chromosome 1, top arm complete
            sequence.>gb:AC005508_1532790 Arabidopsis thaliana
            chromosome I BAC T2P11 genomic sequence, complete
            sequence.>gb:AC006535_1534427 Genomic sequence for
            Arabidopsis thaliana BAC T24P13 from chromosome I,
            complete sequence.>gb:ATH344252_1552507 Arabidopsis
            thaliana mRNA for cullin 3a (cul3a gene).
          Length = 732

 Score =  219 bits (559), Expect = 4e-56
 Identities = 116/249 (46%), Positives = 173/249 (69%), Gaps = 5/249 (2%)
 Frame = -1

Query: 870  KLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGH 691
            +L  G  + V VLTTG WPT P +   LP E++V  + F+ +YL  ++GRRL WQ ++G 
Sbjct: 484  ELSEGPTLIVQVLTTGSWPTQPAVPCNLPAEVSVLCEKFRSYYLGTHTGRRLSWQTNMGT 543

Query: 690  CVLKAEFPKGRK-ELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACG 514
              +KA F KG+K EL VS FQ  VLMLFN +++ S+++I++A  I   +L+R LQSLAC 
Sbjct: 544  ADIKAIFGKGQKHELNVSTFQMCVLMLFNNSDRLSYKEIEQATEIPAADLKRCLQSLACV 603

Query: 513  KVR-VLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKV-NAIQMKETVEENTSTTERVFQDR 340
            K + V++K P  +D+ ++D FV ND+FT+  Y++K+   +  KET  E   T +RV +DR
Sbjct: 604  KGKNVIKKEPMSKDIGEEDLFVVNDKFTSKFYKVKIGTVVAQKETEPEKQETRQRVEEDR 663

Query: 339  QYQVDAAIVRIMKTRKVLSHTLLIAELFQQL--KFPIKPADLKKRIESLIDREYLERDKS 166
            + Q++AAIVRIMK+RK+L H  +IAE+ +QL  +F   P ++KKRIESLI+R++LERD +
Sbjct: 664  KPQIEAAIVRIMKSRKILDHNNIIAEVTKQLQPRFLANPTEIKKRIESLIERDFLERDST 723

Query: 165  NPQIYNYLA 139
            + ++Y YLA
Sbjct: 724  DRKLYRYLA 732



>gb:OSJN00009_1693194 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0033G05, complete
            sequence.>gb:OSJN00250_1697384 Oryza sativa genomic DNA,
            chromosome 4, BAC clone: OSJNBa0063C18, complete
            sequence.
          Length = 731

 Score =  218 bits (556), Expect = 1e-55
 Identities = 116/241 (48%), Positives = 165/241 (68%), Gaps = 4/241 (1%)
 Frame = -1

Query: 849  MSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEF 670
            +SV +LTTG WPT P    +LP E+    + F+ FYL  ++GRRL WQ ++G+  +KA F
Sbjct: 491  ISVQILTTGSWPTQPCTPCKLPPEIVDISEKFRAFYLGTHNGRRLTWQTNMGNADIKATF 550

Query: 669  PKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVR-VLQK 493
               R EL VS +Q  VLMLFN A+  ++ DI++A GI   +L+R LQSLAC K + VL+K
Sbjct: 551  GGRRHELNVSTYQMCVLMLFNSADGLTYGDIEQATGIPHADLKRCLQSLACVKGKNVLRK 610

Query: 492  IPKGRDVEDDDTFVFNDQFTAPLYRIKV-NAIQMKETVEENTSTTERVFQDRQYQVDAAI 316
             P  +D+ +DDTF +ND+FT+ L ++K+   +  KET  E   T +RV +DR+ Q++AAI
Sbjct: 611  EPMSKDISEDDTFYYNDKFTSKLVKVKIGTVVAQKETEPEKLETRQRVEEDRKPQIEAAI 670

Query: 315  VRIMKTRKVLSHTLLIAELFQQL--KFPIKPADLKKRIESLIDREYLERDKSNPQIYNYL 142
            VRIMK+R+VL H  +I E+ +QL  +F   P  +KKRIESLI+RE+LERDK + ++Y YL
Sbjct: 671  VRIMKSRRVLDHNSIITEVTKQLQSRFLPNPVVIKKRIESLIEREFLERDKVDRKMYRYL 730

Query: 141  A 139
            A
Sbjct: 731  A 731



>gb:ATH344541_1552519 Arabidopsis thaliana partial mRNA for cullin 3B
            (cul3B gene).
          Length = 601

 Score =  216 bits (551), Expect = 4e-55
 Identities = 114/249 (45%), Positives = 172/249 (69%), Gaps = 5/249 (2%)
 Frame = -1

Query: 870  KLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGH 691
            +L  G  + V VLTTG WPT P +   LP E++V  + F+ +YL  ++GRRL WQ ++G 
Sbjct: 353  ELSEGPTLVVQVLTTGSWPTQPTIQCNLPAEVSVLCEKFRSYYLGTHTGRRLSWQTNMGT 412

Query: 690  CVLKAEFPKGRK-ELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACG 514
              +KA F KG+K EL VS FQ  VLMLFN +++ S+++I++A  I   +L+R LQS+AC 
Sbjct: 413  ADIKAVFGKGQKHELNVSTFQMCVLMLFNNSDRLSYKEIEQATEIPTPDLKRCLQSMACV 472

Query: 513  KVR-VLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKV-NAIQMKETVEENTSTTERVFQDR 340
            K + VL+K P  +++ ++D FV ND+F +  Y++K+   +  KET  E   T +RV +DR
Sbjct: 473  KGKNVLRKEPMSKEIAEEDWFVVNDRFASKFYKVKIGTVVAQKETEPEKQETRQRVEEDR 532

Query: 339  QYQVDAAIVRIMKTRKVLSHTLLIAELFQQL--KFPIKPADLKKRIESLIDREYLERDKS 166
            + Q++AAIVRIMK+R+VL H  +IAE+ +QL  +F   P ++KKRIESLI+R++LERD +
Sbjct: 533  KPQIEAAIVRIMKSRRVLDHNNIIAEVTKQLQTRFLANPTEIKKRIESLIERDFLERDNT 592

Query: 165  NPQIYNYLA 139
            + ++Y YLA
Sbjct: 593  DRKLYRYLA 601



>pir|E96718|E96718 probable cullin T6C23.13 [imported] - Arabidopsis
            thaliana>gb:AE005173_894551 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:AC013289_1537882 Arabidopsis thaliana
            chromosome 1 BAC T6C23 genomic sequence, complete
            sequence.
          Length = 732

 Score =  216 bits (551), Expect = 4e-55
 Identities = 114/249 (45%), Positives = 172/249 (69%), Gaps = 5/249 (2%)
 Frame = -1

Query: 870  KLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGH 691
            +L  G  + V VLTTG WPT P +   LP E++V  + F+ +YL  ++GRRL WQ ++G 
Sbjct: 484  ELSEGPTLVVQVLTTGSWPTQPTIQCNLPAEVSVLCEKFRSYYLGTHTGRRLSWQTNMGT 543

Query: 690  CVLKAEFPKGRK-ELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACG 514
              +KA F KG+K EL VS FQ  VLMLFN +++ S+++I++A  I   +L+R LQS+AC 
Sbjct: 544  ADIKAVFGKGQKHELNVSTFQMCVLMLFNNSDRLSYKEIEQATEIPTPDLKRCLQSMACV 603

Query: 513  KVR-VLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKV-NAIQMKETVEENTSTTERVFQDR 340
            K + VL+K P  +++ ++D FV ND+F +  Y++K+   +  KET  E   T +RV +DR
Sbjct: 604  KGKNVLRKEPMSKEIAEEDWFVVNDRFASKFYKVKIGTVVAQKETEPEKQETRQRVEEDR 663

Query: 339  QYQVDAAIVRIMKTRKVLSHTLLIAELFQQL--KFPIKPADLKKRIESLIDREYLERDKS 166
            + Q++AAIVRIMK+R+VL H  +IAE+ +QL  +F   P ++KKRIESLI+R++LERD +
Sbjct: 664  KPQIEAAIVRIMKSRRVLDHNNIIAEVTKQLQTRFLANPTEIKKRIESLIERDFLERDNT 723

Query: 165  NPQIYNYLA 139
            + ++Y YLA
Sbjct: 724  DRKLYRYLA 732



>gb:AP005501_1852965 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, PAC
            clone:P0458D06.>gb:AP005606_1854787 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 8, BAC
            clone:OJ1590_E05.
          Length = 731

 Score =  211 bits (537), Expect = 2e-53
 Identities = 113/242 (46%), Positives = 163/242 (67%), Gaps = 5/242 (2%)
 Frame = -1

Query: 849  MSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEF 670
            +SV +LTTG WPT P     LP E+    ++F+ FYL  ++GRRL WQ ++G   +KA F
Sbjct: 490  ISVQILTTGSWPTQPCNTCNLPPEILGVSEMFRGFYLGTHNGRRLTWQTNMGTADIKAVF 549

Query: 669  PKGRK-ELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVR-VLQ 496
              G K EL VS +Q  VLMLFN A+  S++DI++   I   +L+R LQSLA  K + VL+
Sbjct: 550  GNGSKHELNVSTYQMCVLMLFNSADCLSYRDIEQTTAIPSADLKRCLQSLALVKGKNVLR 609

Query: 495  KIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAI-QMKETVEENTSTTERVFQDRQYQVDAA 319
            K P  RD+ DDD F  ND+FT+ L+++K+  +   KE+  E   T +RV +DR+ Q++AA
Sbjct: 610  KEPMSRDISDDDNFYVNDKFTSKLFKVKIGTVATQKESEPEKMETRQRVEEDRKPQIEAA 669

Query: 318  IVRIMKTRKVLSHTLLIAELFQQL--KFPIKPADLKKRIESLIDREYLERDKSNPQIYNY 145
            IVRIMK+R+VL H  ++ E+ +QL  +F   P  +KKR+ESLI+RE+LERDK++ ++Y Y
Sbjct: 670  IVRIMKSRRVLDHNSIVTEVTKQLQPRFMPNPVVIKKRVESLIEREFLERDKTDRKLYRY 729

Query: 144  LA 139
            LA
Sbjct: 730  LA 731



>sp|O14122|CUL4_SCHPO Cullin 4 homolog (Cul-4).>pir|T43408|T43408
            cullin-4 - fission yeast (Schizosaccharomyces
            pombe)>gb:AB017029_1513279 Schizosaccharomyces pombe gene
            for Pcu4, complete cds.>gb:SPAC3A11_1717775 S.pombe
            chromosome I cosmid c3A11.
          Length = 734

 Score =  207 bits (526), Expect = 3e-52
 Identities = 105/258 (40%), Positives = 165/258 (63%), Gaps = 5/258 (1%)
 Frame = -1

Query: 900  SFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGR 721
            SF+ S  A     +  ++ V+VL+  YWP+YP   +RLP ++    D F++FYLSK  G+
Sbjct: 481  SFRHSKAAHN---LHRDLYVNVLSQAYWPSYPESHIRLPDDMQQDLDCFEKFYLSKQVGK 537

Query: 720  RLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEA---EKFSFQDIKEAIGIEDK 550
            ++ W  SLGHC++KA FP G KEL++S FQ  VL+ FN     E  S+QD+K++  + D 
Sbjct: 538  KISWYASLGHCIVKARFPLGNKELSISLFQACVLLQFNNCLGGEGISYQDLKKSTELSDI 597

Query: 549  ELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENT 370
            +L RTLQSL+C ++R L  +PK +    D  F  N++FT  LYR+K+N I +KE  +EN+
Sbjct: 598  DLTRTLQSLSCARIRPLVMVPKSKKPSPDTMFYVNEKFTDKLYRVKINQIYLKEERQENS 657

Query: 369  STTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLI 196
               E+V +DRQ+++ A+IVR+MK ++ + H  L+  +   +K    P  +D+K  IE L+
Sbjct: 658  DVQEQVVRDRQFELQASIVRVMKQKEKMKHDDLVQYVINNVKDRGIPLVSDVKTAIEKLL 717

Query: 195  DREYLERDKSNPQIYNYL 142
            ++EYLER+ ++  IY Y+
Sbjct: 718  EKEYLEREDND--IYTYV 733



>gb:AP003236_1825935 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0043B10.
          Length = 744

 Score =  205 bits (521), Expect = 1e-51
 Identities = 107/255 (41%), Positives = 155/255 (60%), Gaps = 2/255 (0%)
 Frame = -1

Query: 897  FKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRR 718
            F++     ++L  GI ++V VLTTG+WP+Y   D+ LP E+    ++FKEFY ++   R+
Sbjct: 494  FEEFISTHSELNPGIALAVTVLTTGFWPSYKSFDINLPAEMVKCVEVFKEFYQTRTKHRK 553

Query: 717  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR 538
            L W  SLG C + A+F     EL V+ +Q  +L+LFN  ++ S+ +I   + + D ++ R
Sbjct: 554  LTWIYSLGTCNINAKFEAKTIELIVTTYQAALLLLFNGVDRLSYSEIVTQLNLSDDDVVR 613

Query: 537  TLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE 358
             L SL+C K ++L K P  R +  +D F FN +FT  L R+K+        V+E     E
Sbjct: 614  LLHSLSCAKYKILSKEPNNRSISPNDVFEFNSKFTDKLRRLKIPL----PPVDEKKKVVE 669

Query: 357  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREY 184
             V +DR+Y +DA+IVRIMK+RKVL H  L+ E  +QL    KP    +KKRIE LI R+Y
Sbjct: 670  DVDKDRRYAIDASIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFKAIKKRIEDLITRDY 729

Query: 183  LERDKSNPQIYNYLA 139
            LERDK NP +Y YLA
Sbjct: 730  LERDKDNPNVYRYLA 744



>gb:AY336990_1600291 Oryza sativa (japonica cultivar-group) CUL1 mRNA,
            complete cds.>gb:AP003281_1827204 Oryza sativa (japonica
            cultivar-group) genomic DNA, chromosome 1, PAC
            clone:P0560B06.
          Length = 732

 Score =  205 bits (521), Expect = 1e-51
 Identities = 107/255 (41%), Positives = 155/255 (60%), Gaps = 2/255 (0%)
 Frame = -1

Query: 897  FKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRR 718
            F++     ++L  GI ++V VLTTG+WP+Y   D+ LP E+    ++FKEFY ++   R+
Sbjct: 482  FEEFISTHSELNPGIALAVTVLTTGFWPSYKSFDINLPAEMVKCVEVFKEFYQTRTKHRK 541

Query: 717  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR 538
            L W  SLG C + A+F     EL V+ +Q  +L+LFN  ++ S+ +I   + + D ++ R
Sbjct: 542  LTWIYSLGTCNINAKFEAKTIELIVTTYQAALLLLFNGVDRLSYSEIVTQLNLSDDDVVR 601

Query: 537  TLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE 358
             L SL+C K ++L K P  R +  +D F FN +FT  L R+K+        V+E     E
Sbjct: 602  LLHSLSCAKYKILSKEPNNRSISPNDVFEFNSKFTDKLRRLKIPL----PPVDEKKKVVE 657

Query: 357  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREY 184
             V +DR+Y +DA+IVRIMK+RKVL H  L+ E  +QL    KP    +KKRIE LI R+Y
Sbjct: 658  DVDKDRRYAIDASIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFKAIKKRIEDLITRDY 717

Query: 183  LERDKSNPQIYNYLA 139
            LERDK NP +Y YLA
Sbjct: 718  LERDKDNPNVYRYLA 732



>gb:AC011806_1537435 Genomic Sequence For Oryza sativa Clone 10P20,
            Lemont Strain, Complete Sequence, complete sequence.
          Length = 750

 Score =  205 bits (521), Expect = 1e-51
 Identities = 107/255 (41%), Positives = 155/255 (60%), Gaps = 2/255 (0%)
 Frame = -1

Query: 897  FKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRR 718
            F++     ++L  GI ++V VLTTG+WP+Y   D+ LP E+    ++FKEFY ++   R+
Sbjct: 500  FEEFISTHSELNPGIALAVTVLTTGFWPSYKSFDINLPAEMVKCVEVFKEFYQTRTKHRK 559

Query: 717  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR 538
            L W  SLG C + A+F     EL V+ +Q  +L+LFN  ++ S+ +I   + + D ++ R
Sbjct: 560  LTWIYSLGTCNINAKFEAKTIELIVTTYQAALLLLFNGVDRLSYSEIVTQLNLSDDDVVR 619

Query: 537  TLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE 358
             L SL+C K ++L K P  R +  +D F FN +FT  L R+K+        V+E     E
Sbjct: 620  LLHSLSCAKYKILSKEPNNRSISPNDVFEFNSKFTDKLRRLKIPL----PPVDEKKKVVE 675

Query: 357  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREY 184
             V +DR+Y +DA+IVRIMK+RKVL H  L+ E  +QL    KP    +KKRIE LI R+Y
Sbjct: 676  DVDKDRRYAIDASIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFKAIKKRIEDLITRDY 735

Query: 183  LERDKSNPQIYNYLA 139
            LERDK NP +Y YLA
Sbjct: 736  LERDKDNPNVYRYLA 750



>gb:AC105772_1738237 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OJ1504_G04, complete sequence.
          Length = 693

 Score =  202 bits (514), Expect = 7e-51
 Identities = 105/255 (41%), Positives = 157/255 (61%), Gaps = 2/255 (0%)
 Frame = -1

Query: 897  FKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRR 718
            F++   A  +L  GI+++V VLTTG+WP+Y   D+ LP E+    ++FKEFY ++   R+
Sbjct: 443  FEEFVAAHQELNPGIDLAVTVLTTGFWPSYKTFDINLPAEMVKCVEVFKEFYQTRTKHRK 502

Query: 717  LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR 538
            L W  SLG C + A+F     EL V+ +Q  +L+LFN +++ ++ +I   + + D ++ R
Sbjct: 503  LTWIYSLGTCNINAKFEAKTIELIVTTYQAALLLLFNGSDRLTYSEIVTQLNLSDDDVVR 562

Query: 537  TLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTE 358
             L SL+C K ++L K P  R +  +D F FN +FT  + RIK+        V+E     E
Sbjct: 563  LLHSLSCAKYKILNKEPANRSISPNDVFEFNSKFTDRMRRIKIPL----PPVDEKKKVVE 618

Query: 357  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREY 184
             V +DR+Y +DA+IVRIMK+RKV+ H  L+AE  +QL    KP    +KKRIE LI R+Y
Sbjct: 619  DVDKDRRYAIDASIVRIMKSRKVMGHQQLVAECVEQLSRMFKPDFKAIKKRIEDLITRDY 678

Query: 183  LERDKSNPQIYNYLA 139
            LER+K N  +Y YLA
Sbjct: 679  LEREKDNANVYRYLA 693



>gb:NTA344533_1691349 Nicotiana tabacum mRNA for cullin 1A (cul1A
            gene).
          Length = 741

 Score =  202 bits (513), Expect = 9e-51
 Identities = 107/242 (44%), Positives = 149/242 (61%), Gaps = 2/242 (0%)
 Frame = -1

Query: 858  GIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLK 679
            GI+++V VLTTG+WP+Y   D+ LP E+    ++FKEFY +K   R+L W  SLG C + 
Sbjct: 504  GIDLTVTVLTTGFWPSYKSSDLSLPVEMVKCVEVFKEFYQTKTKHRKLTWIYSLGTCNIN 563

Query: 678  AEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVL 499
             +F     EL V  +Q   L+LFN +++ S+  IK  + + D +L R LQSL+C K ++L
Sbjct: 564  GKFEPKTIELIVGTYQAAALLLFNASDRLSYSHIKSQLNLADDDLVRLLQSLSCAKYKIL 623

Query: 498  QKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAA 319
             K P  R V   D F FN +FT  + RI++        V+E     E V +DR+Y +DA 
Sbjct: 624  TKEPTSRTVSSTDHFEFNSKFTDRMRRIRIPL----PPVDERKKVVEDVDKDRRYAIDAC 679

Query: 318  IVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKSNPQIYNY 145
            IVRIMK+RKVL H+ L++E  +QL    KP    +KKRIE LI R+YLERDK NP ++ Y
Sbjct: 680  IVRIMKSRKVLPHSQLVSECVEQLSRMFKPDFKAIKKRIEDLITRDYLERDKENPNLFKY 739

Query: 144  LA 139
            LA
Sbjct: 740  LA 741



>gb:ATH318017_1552492 Arabidopsis thaliana mRNA for cullin 1 (cul1
            gene).>gb:AY046030_1561522 Arabidopsis thaliana putative
            cullin 1 protein (At4g02570) mRNA, complete
            cds.>gb:AY133878_1581698 Arabidopsis thaliana clone
            U09998 putative cullin 1 protein (AT4g02570) mRNA,
            complete cds.
          Length = 738

 Score =  200 bits (509), Expect = 3e-50
 Identities = 106/242 (43%), Positives = 150/242 (61%), Gaps = 2/242 (0%)
 Frame = -1

Query: 858  GIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLK 679
            GI+++V VLTTG+WP+Y   D+ LP E+    ++FK FY +K   R+L W  SLG C + 
Sbjct: 501  GIDLTVTVLTTGFWPSYKSFDINLPSEMIKCVEVFKGFYETKTKHRKLTWIYSLGTCHIN 560

Query: 678  AEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVL 499
             +F +   EL VS +Q  VL+LFN  +K S+ +I   + +  ++L R L SL+C K ++L
Sbjct: 561  GKFDQKAIELIVSTYQAAVLLLFNTTDKLSYTEILAQLNLSHEDLVRLLHSLSCAKYKIL 620

Query: 498  QKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAA 319
             K P  + V  +D F FN +FT  + RIK+        V+E     E V +DR+Y +DAA
Sbjct: 621  LKEPNTKTVSQNDAFEFNSKFTDRMRRIKIPL----PPVDERKKVVEDVDKDRRYAIDAA 676

Query: 318  IVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKSNPQIYNY 145
            IVRIMK+RKVL H  L++E  +QL    KP    +KKR+E LI R+YLERDK NP ++ Y
Sbjct: 677  IVRIMKSRKVLGHQQLVSECVEQLSRMFKPDIKAIKKRMEDLITRDYLERDKENPNMFRY 736

Query: 144  LA 139
            LA
Sbjct: 737  LA 738



>pir|T01092|T01092 cullin-like protein T10P11.14.1 - Arabidopsis
            thaliana>gb:AC002330_1530287 Arabidopsis thaliana BAC
            T10P11 from chromosome IV, near 15 cM, complete
            sequence.>gb:ATCHRIV6_1546245 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 6.
          Length = 676

 Score =  200 bits (509), Expect = 3e-50
 Identities = 106/242 (43%), Positives = 150/242 (61%), Gaps = 2/242 (0%)
 Frame = -1

Query: 858  GIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLK 679
            GI+++V VLTTG+WP+Y   D+ LP E+    ++FK FY +K   R+L W  SLG C + 
Sbjct: 439  GIDLTVTVLTTGFWPSYKSFDINLPSEMIKCVEVFKGFYETKTKHRKLTWIYSLGTCHIN 498

Query: 678  AEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVL 499
             +F +   EL VS +Q  VL+LFN  +K S+ +I   + +  ++L R L SL+C K ++L
Sbjct: 499  GKFDQKAIELIVSTYQAAVLLLFNTTDKLSYTEILAQLNLSHEDLVRLLHSLSCAKYKIL 558

Query: 498  QKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAA 319
             K P  + V  +D F FN +FT  + RIK+        V+E     E V +DR+Y +DAA
Sbjct: 559  LKEPNTKTVSQNDAFEFNSKFTDRMRRIKIPL----PPVDERKKVVEDVDKDRRYAIDAA 614

Query: 318  IVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKSNPQIYNY 145
            IVRIMK+RKVL H  L++E  +QL    KP    +KKR+E LI R+YLERDK NP ++ Y
Sbjct: 615  IVRIMKSRKVLGHQQLVSECVEQLSRMFKPDIKAIKKRMEDLITRDYLERDKENPNMFRY 674

Query: 144  LA 139
            LA
Sbjct: 675  LA 676



>gb:AC011806_1537438 Genomic Sequence For Oryza sativa Clone 10P20,
            Lemont Strain, Complete Sequence, complete
            sequence.>gb:AP003236_1825937 Oryza sativa (japonica
            cultivar-group) genomic DNA, chromosome 1, PAC
            clone:P0043B10.>gb:AP003281_1827206 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 1, PAC
            clone:P0560B06.
          Length = 746

 Score =  200 bits (508), Expect = 4e-50
 Identities = 106/241 (43%), Positives = 148/241 (61%), Gaps = 2/241 (0%)
 Frame = -1

Query: 855  IEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA 676
            I+++V VLTTGYWPTY   D+ LP E+    ++FKE+Y S    R+L W  SLG+CV+  
Sbjct: 510  IDLNVTVLTTGYWPTYKNSDINLPLEMVKCVEVFKEYYRSDKQHRKLTWIFSLGNCVVIG 569

Query: 675  EFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQ 496
             F     E  ++ +Q  +L+LFNEA+K S+ DI   + + D +  R L SL+C K ++L 
Sbjct: 570  NFDAKPVEFVLNTYQAALLLLFNEADKLSYSDIVSQLKLSDDDAVRLLHSLSCAKYKILN 629

Query: 495  KIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAI 316
            K P  R +  +D F FN +FT  + RIKV   Q    ++E     + V +DR++ +DA++
Sbjct: 630  KEPSNRVISPEDEFEFNSKFTDRMRRIKVPLPQ----IDEKKKVVDDVNKDRRFAIDASL 685

Query: 315  VRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKSNPQIYNYL 142
            VRIMK+RKVL H  L+AE  +QL    KP    +K+RIE LI REYLERD  N Q Y YL
Sbjct: 686  VRIMKSRKVLGHQQLVAECVEQLSRMFKPDIKIIKRRIEDLISREYLERDSENAQTYKYL 745

Query: 141  A 139
            A
Sbjct: 746  A 746



>gb:NTA344534_1691350 Nicotiana tabacum mRNA for cullin 1B (cul1B
            gene).
          Length = 739

 Score =  199 bits (505), Expect = 8e-50
 Identities = 106/242 (43%), Positives = 146/242 (60%), Gaps = 2/242 (0%)
 Frame = -1

Query: 858  GIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLK 679
            GI+++V VLTTG+WP+Y   D+ LP E+    ++FKEFY +K   R+L W  SLG C + 
Sbjct: 502  GIDLTVTVLTTGFWPSYKSSDLSLPVEMVKSVEVFKEFYQTKTKHRKLTWIYSLGTCNIN 561

Query: 678  AEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVL 499
             +F     EL V  +Q   L+LFN +++ S+ +IK  + + D +L R L SL+C K ++L
Sbjct: 562  GKFAPKTIELIVGTYQAAALLLFNASDRLSYSEIKSQLNLADDDLVRLLHSLSCAKYKIL 621

Query: 498  QKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAA 319
             K P  R V   D F FN +FT  + RI+V         +E     E V +DR+Y +DA 
Sbjct: 622  TKEPSNRTVSPSDHFEFNSKFTDRMRRIRVPL----PPADERKKVVEDVDKDRRYAIDAC 677

Query: 318  IVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKSNPQIYNY 145
            IVRIMK+RKVL H  L+ E  +QL    KP    +KKRIE LI R+YLERDK NP ++ Y
Sbjct: 678  IVRIMKSRKVLPHQQLVLECVEQLSRMFKPDFKAIKKRIEDLITRDYLERDKENPNLFKY 737

Query: 144  LA 139
            LA
Sbjct: 738  LA 739



>gb:HSU58089_2025037 Human Hs-cul-3 mRNA, partial cds.
          Length = 577

 Score =  196 bits (498), Expect = 5e-49
 Identities = 116/284 (40%), Positives = 170/284 (59%), Gaps = 29/284 (10%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMD-VRLPHELNVYQDIFKEFYLSKYS 727
            + F+Q  QA      G++++V VLTTGYWPT        +P       +IF+ FYL+K+S
Sbjct: 294  DEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHS 353

Query: 726  GRRLMWQNSLGHCVLKAEF--PKGRKE--------------------LAVSFFQTVVLML 613
            GR+L  Q+ +G   L A F  P  +++                    L VS FQ  +LML
Sbjct: 354  GRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILML 413

Query: 612  FNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKV--RVLQKIPKGRDVEDDDTFVFNDQ 439
            FN  EK++F++I++   I ++EL R LQSLACGK   RVL K PK +++E+   F  NDQ
Sbjct: 414  FNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQ 473

Query: 438  FTAPLYRIKVNAIQMK--ETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIA 265
            FT+ L+R+K+  +  K  E+  E   T ++V  DR+++++AAIVRIMK+RK + H +L+A
Sbjct: 474  FTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVA 533

Query: 264  ELFQQLK--FPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
            E+ QQLK  F   P  +KKRIE LI+REYL R   + ++Y Y+A
Sbjct: 534  EVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA 577



>gb:AF062537_1880198 Homo sapiens cullin 3 mRNA, complete cds.
          Length = 768

 Score =  196 bits (498), Expect = 5e-49
 Identities = 116/284 (40%), Positives = 170/284 (59%), Gaps = 29/284 (10%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMD-VRLPHELNVYQDIFKEFYLSKYS 727
            + F+Q  QA      G++++V VLTTGYWPT        +P       +IF+ FYL+K+S
Sbjct: 485  DEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHS 544

Query: 726  GRRLMWQNSLGHCVLKAEF--PKGRKE--------------------LAVSFFQTVVLML 613
            GR+L  Q+ +G   L A F  P  +++                    L VS FQ  +LML
Sbjct: 545  GRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILML 604

Query: 612  FNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKV--RVLQKIPKGRDVEDDDTFVFNDQ 439
            FN  EK++F++I++   I ++EL R LQSLACGK   RVL K PK +++E+   F  NDQ
Sbjct: 605  FNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQ 664

Query: 438  FTAPLYRIKVNAIQMK--ETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIA 265
            FT+ L+R+K+  +  K  E+  E   T ++V  DR+++++AAIVRIMK+RK + H +L+A
Sbjct: 665  FTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVA 724

Query: 264  ELFQQLK--FPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
            E+ QQLK  F   P  +KKRIE LI+REYL R   + ++Y Y+A
Sbjct: 725  EVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA 768



>gb:AF052147_1879212 Homo sapiens clone 24454 cul-3 mRNA, complete
           cds.
          Length = 343

 Score =  196 bits (498), Expect = 5e-49
 Identities = 116/284 (40%), Positives = 170/284 (59%), Gaps = 29/284 (10%)
 Frame = -1

Query: 903 ESFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMD-VRLPHELNVYQDIFKEFYLSKYS 727
           + F+Q  QA      G++++V VLTTGYWPT        +P       +IF+ FYL+K+S
Sbjct: 60  DEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHS 119

Query: 726 GRRLMWQNSLGHCVLKAEF--PKGRKE--------------------LAVSFFQTVVLML 613
           GR+L  Q+ +G   L A F  P  +++                    L VS FQ  +LML
Sbjct: 120 GRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILML 179

Query: 612 FNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKV--RVLQKIPKGRDVEDDDTFVFNDQ 439
           FN  EK++F++I++   I ++EL R LQSLACGK   RVL K PK +++E+   F  NDQ
Sbjct: 180 FNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQ 239

Query: 438 FTAPLYRIKVNAIQMK--ETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIA 265
           FT+ L+R+K+  +  K  E+  E   T ++V  DR+++++AAIVRIMK+RK + H +L+A
Sbjct: 240 FTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVA 299

Query: 264 ELFQQLK--FPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
           E+ QQLK  F   P  +KKRIE LI+REYL R   + ++Y Y+A
Sbjct: 300 EVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA 343



>gb:AB014517_1864546 Homo sapiens mRNA for KIAA0617 protein, partial
            cds.
          Length = 786

 Score =  196 bits (498), Expect = 5e-49
 Identities = 116/284 (40%), Positives = 170/284 (59%), Gaps = 29/284 (10%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMD-VRLPHELNVYQDIFKEFYLSKYS 727
            + F+Q  QA      G++++V VLTTGYWPT        +P       +IF+ FYL+K+S
Sbjct: 503  DEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHS 562

Query: 726  GRRLMWQNSLGHCVLKAEF--PKGRKE--------------------LAVSFFQTVVLML 613
            GR+L  Q+ +G   L A F  P  +++                    L VS FQ  +LML
Sbjct: 563  GRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILML 622

Query: 612  FNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKV--RVLQKIPKGRDVEDDDTFVFNDQ 439
            FN  EK++F++I++   I ++EL R LQSLACGK   RVL K PK +++E+   F  NDQ
Sbjct: 623  FNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQ 682

Query: 438  FTAPLYRIKVNAIQMK--ETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIA 265
            FT+ L+R+K+  +  K  E+  E   T ++V  DR+++++AAIVRIMK+RK + H +L+A
Sbjct: 683  FTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVA 742

Query: 264  ELFQQLK--FPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
            E+ QQLK  F   P  +KKRIE LI+REYL R   + ++Y Y+A
Sbjct: 743  EVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA 786



>sp|Q13618|CUL3_HUMAN Cullin homolog 3 (CUL-3).>gb:AF064087_1880336
            Homo sapiens cullin 3 mRNA, complete
            cds.>gb:BC039598_1982589 Homo sapiens cullin 3, mRNA
            (cDNA clone MGC:48882 IMAGE:5784147), complete cds.
          Length = 768

 Score =  196 bits (498), Expect = 5e-49
 Identities = 116/284 (40%), Positives = 170/284 (59%), Gaps = 29/284 (10%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMD-VRLPHELNVYQDIFKEFYLSKYS 727
            + F+Q  QA      G++++V VLTTGYWPT        +P       +IF+ FYL+K+S
Sbjct: 485  DEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHS 544

Query: 726  GRRLMWQNSLGHCVLKAEF--PKGRKE--------------------LAVSFFQTVVLML 613
            GR+L  Q+ +G   L A F  P  +++                    L VS FQ  +LML
Sbjct: 545  GRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILML 604

Query: 612  FNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKV--RVLQKIPKGRDVEDDDTFVFNDQ 439
            FN  EK++F++I++   I ++EL R LQSLACGK   RVL K PK +++E+   F  NDQ
Sbjct: 605  FNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQ 664

Query: 438  FTAPLYRIKVNAIQMK--ETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIA 265
            FT+ L+R+K+  +  K  E+  E   T ++V  DR+++++AAIVRIMK+RK + H +L+A
Sbjct: 665  FTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVA 724

Query: 264  ELFQQLK--FPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
            E+ QQLK  F   P  +KKRIE LI+REYL R   + ++Y Y+A
Sbjct: 725  EVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA 768



>gb:AK129174_2069405 Mus musculus mRNA for mKIAA0617 protein.
          Length = 792

 Score =  196 bits (497), Expect = 7e-49
 Identities = 116/284 (40%), Positives = 169/284 (59%), Gaps = 29/284 (10%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMD-VRLPHELNVYQDIFKEFYLSKYS 727
            + F+Q  QA      G++++V VLTTGYWPT        +P       +IF+ FYL+K+S
Sbjct: 509  DEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHS 568

Query: 726  GRRLMWQNSLGHCVLKAEF--PKGRKE--------------------LAVSFFQTVVLML 613
            GR+L  Q+ +G   L A F  P  +++                    L VS FQ  +LML
Sbjct: 569  GRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILML 628

Query: 612  FNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKV--RVLQKIPKGRDVEDDDTFVFNDQ 439
            FN  EK++F++I++   I ++EL R LQSLACGK   RVL K PK +++E    F  NDQ
Sbjct: 629  FNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIESGHIFTVNDQ 688

Query: 438  FTAPLYRIKVNAIQMK--ETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIA 265
            FT+ L+R+K+  +  K  E+  E   T ++V  DR+++++AAIVRIMK+RK + H +L+A
Sbjct: 689  FTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVA 748

Query: 264  ELFQQLK--FPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
            E+ QQLK  F   P  +KKRIE LI+REYL R   + ++Y Y+A
Sbjct: 749  EVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA 792



>gb:BT006231_1639123 Arabidopsis thaliana At1g02980 gene, complete
           cds.>gb:AK117909_1815916 Arabidopsis thaliana At1g02980
           mRNA for unknown protein, complete cds, clone:
           RAFL19-09-D14.
          Length = 268

 Score =  196 bits (497), Expect = 7e-49
 Identities = 105/243 (43%), Positives = 150/243 (61%), Gaps = 2/243 (0%)
 Frame = -1

Query: 861 MGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVL 682
           +G++ +V VLTTG+WP+Y   D+ LP E+    + FK +Y +K + RRL W  SLG C L
Sbjct: 30  LGMDFTVTVLTTGFWPSYKTTDLNLPIEMVNCVEAFKAYYGTKTNSRRLSWIYSLGTCQL 89

Query: 681 KAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRV 502
             +F K   E+ V+ +Q  VL+LFN  E+ S+ +I E + +  ++L R L SL+C K ++
Sbjct: 90  AGKFDKKTIEIVVTTYQAAVLLLFNNTERLSYTEILEQLNLGHEDLARLLHSLSCLKYKI 149

Query: 501 LQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDA 322
           L K P  R++ + DTF FN +FT  + RI+V    M    +E     E V +DR+Y +DA
Sbjct: 150 LIKEPMSRNISNTDTFEFNSKFTDKMRRIRVPLPPM----DERKKIVEDVDKDRRYAIDA 205

Query: 321 AIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKSNPQIYN 148
           A+VRIMK+RKVL H  L++E  + L    KP    +KKRIE LI R+YLERD  NP  + 
Sbjct: 206 ALVRIMKSRKVLGHQQLVSECVEHLSKMFKPDIKMIKKRIEDLISRDYLERDTDNPNTFK 265

Query: 147 YLA 139
           YLA
Sbjct: 266 YLA 268



>pir|D86160|D86160 hypothetical protein F22D16.2 - Arabidopsis
            thaliana>gb:AE005172_889317 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC009525_1536824 Arabidopsis thaliana
            chromosome I BAC F22D16 genomic sequence, complete
            sequence.
          Length = 742

 Score =  196 bits (497), Expect = 7e-49
 Identities = 105/243 (43%), Positives = 150/243 (61%), Gaps = 2/243 (0%)
 Frame = -1

Query: 861  MGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVL 682
            +G++ +V VLTTG+WP+Y   D+ LP E+    + FK +Y +K + RRL W  SLG C L
Sbjct: 504  LGMDFTVTVLTTGFWPSYKTTDLNLPIEMVNCVEAFKAYYGTKTNSRRLSWIYSLGTCQL 563

Query: 681  KAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRV 502
              +F K   E+ V+ +Q  VL+LFN  E+ S+ +I E + +  ++L R L SL+C K ++
Sbjct: 564  AGKFDKKTIEIVVTTYQAAVLLLFNNTERLSYTEILEQLNLGHEDLARLLHSLSCLKYKI 623

Query: 501  LQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDA 322
            L K P  R++ + DTF FN +FT  + RI+V    M    +E     E V +DR+Y +DA
Sbjct: 624  LIKEPMSRNISNTDTFEFNSKFTDKMRRIRVPLPPM----DERKKIVEDVDKDRRYAIDA 679

Query: 321  AIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKSNPQIYN 148
            A+VRIMK+RKVL H  L++E  + L    KP    +KKRIE LI R+YLERD  NP  + 
Sbjct: 680  ALVRIMKSRKVLGHQQLVSECVEHLSKMFKPDIKMIKKRIEDLISRDYLERDTDNPNTFK 739

Query: 147  YLA 139
            YLA
Sbjct: 740  YLA 742



>sp|Q9JLV5|CUL3_MOUSE Cullin homolog 3 (CUL-3).>gb:AF129738_2055650
            Mus musculus cullin 3 (Cul3) mRNA, complete
            cds.>gb:BC027304_2095892 Mus musculus cullin 3, mRNA
            (cDNA clone MGC:28933 IMAGE:3981170), complete cds.
          Length = 768

 Score =  196 bits (497), Expect = 7e-49
 Identities = 116/284 (40%), Positives = 169/284 (59%), Gaps = 29/284 (10%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMD-VRLPHELNVYQDIFKEFYLSKYS 727
            + F+Q  QA      G++++V VLTTGYWPT        +P       +IF+ FYL+K+S
Sbjct: 485  DEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHS 544

Query: 726  GRRLMWQNSLGHCVLKAEF--PKGRKE--------------------LAVSFFQTVVLML 613
            GR+L  Q+ +G   L A F  P  +++                    L VS FQ  +LML
Sbjct: 545  GRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILML 604

Query: 612  FNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKV--RVLQKIPKGRDVEDDDTFVFNDQ 439
            FN  EK++F++I++   I ++EL R LQSLACGK   RVL K PK +++E    F  NDQ
Sbjct: 605  FNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIESGHIFTVNDQ 664

Query: 438  FTAPLYRIKVNAIQMK--ETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIA 265
            FT+ L+R+K+  +  K  E+  E   T ++V  DR+++++AAIVRIMK+RK + H +L+A
Sbjct: 665  FTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVA 724

Query: 264  ELFQQLK--FPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
            E+ QQLK  F   P  +KKRIE LI+REYL R   + ++Y Y+A
Sbjct: 725  EVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA 768



>gb:BC073186_2557041 Xenopus laevis MGC80402 protein, mRNA (cDNA clone
            MGC:80402 IMAGE:5154783), complete cds.
          Length = 768

 Score =  195 bits (495), Expect = 1e-48
 Identities = 115/284 (40%), Positives = 166/284 (58%), Gaps = 29/284 (10%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMD-VRLPHELNVYQDIFKEFYLSKYS 727
            + F+Q  Q       G++++V VLTTGYWPT        +P       +IF+ FYL+K+S
Sbjct: 485  DEFRQHLQTTGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPSPRHAFEIFRRFYLAKHS 544

Query: 726  GRRLMWQNSLGHCVLKAEFPKGRKE----------------------LAVSFFQTVVLML 613
            GR+L  Q+ +G   L A F    K+                      L VS FQ  +LML
Sbjct: 545  GRQLTLQHHMGSADLNATFYGAVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILML 604

Query: 612  FNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKV--RVLQKIPKGRDVEDDDTFVFNDQ 439
            FN  EK++F++I++   I ++EL R LQSLACGK   RVL K PK +++E    F  NDQ
Sbjct: 605  FNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIESGHMFTVNDQ 664

Query: 438  FTAPLYRIKVNAIQMK--ETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIA 265
            FT+ L+R+K+  +  K  E+  E   T ++V  DR+++++AAIVRIMK+RK + H +L+A
Sbjct: 665  FTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVA 724

Query: 264  ELFQQLK--FPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
            E+ QQLK  F   P  +KKRIE LI+REYL R   + ++Y Y+A
Sbjct: 725  EVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA 768



>gb:AY337761_1944151 Homo sapiens cullin 3 isoform (CUL3) mRNA,
            complete cds.
          Length = 744

 Score =  194 bits (492), Expect = 3e-48
 Identities = 115/284 (40%), Positives = 169/284 (59%), Gaps = 29/284 (10%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMD-VRLPHELNVYQDIFKEFYLSKYS 727
            + F+Q  QA      G++++V VLTTGYWPT        +P       +IF+ FYL+K+S
Sbjct: 461  DEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHS 520

Query: 726  GRRLMWQNSLGHCVLKAEF--PKGRKE--------------------LAVSFFQTVVLML 613
            GR+L  Q+ +G   L A F  P  +++                    L VS FQ  +LML
Sbjct: 521  GRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILML 580

Query: 612  FNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKV--RVLQKIPKGRDVEDDDTFVFNDQ 439
            FN  EK++F++I++   I ++EL R LQSLACGK   RVL K PK +++E+   F  NDQ
Sbjct: 581  FNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQ 640

Query: 438  FTAPLYRIKVNAIQMK--ETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIA 265
            F + L+R+K+  +  K  E+  E   T ++V  DR+++++AAIVRIMK+RK + H +L+A
Sbjct: 641  FISKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVA 700

Query: 264  ELFQQLK--FPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
            E+ QQLK  F   P  +KKRIE LI+REYL R   + ++Y Y+A
Sbjct: 701  EVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA 744



>gb:BC065357_2553975 Danio rerio cullin 3, mRNA (cDNA clone MGC:77385
            IMAGE:6969310), complete cds.
          Length = 766

 Score =  193 bits (491), Expect = 3e-48
 Identities = 113/284 (39%), Positives = 165/284 (58%), Gaps = 29/284 (10%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMD-VRLPHELNVYQDIFKEFYLSKYS 727
            + F+   Q       G++++V VLTTGYWPT        +P       ++F+ FYL+K+S
Sbjct: 483  DEFRHHLQTSQVSLCGVDLTVRVLTTGYWPTQSATPKCNIPPSPRHAFEVFRRFYLAKHS 542

Query: 726  GRRLMWQNSLGHCVLKAEFPKGRKE----------------------LAVSFFQTVVLML 613
            GR+L  Q+ +G   L A F    K+                      L VS FQ  +LML
Sbjct: 543  GRQLTLQHHMGSADLNATFYGPIKKEDGSDVGVGGALLTGSNTRKHILQVSTFQMTILML 602

Query: 612  FNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGK--VRVLQKIPKGRDVEDDDTFVFNDQ 439
            FN  EKF+F++I++   I ++EL R LQSLACGK   RVL K PK +++E    F  NDQ
Sbjct: 603  FNNREKFTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIESGHVFTVNDQ 662

Query: 438  FTAPLYRIKVNAIQMK--ETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIA 265
            FT+ L+R+K+  +  K  E+  E   T ++V  DR+++++AAIVRIMK+RK + H +L+A
Sbjct: 663  FTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVA 722

Query: 264  ELFQQL--KFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
            E+ QQL  +F   P  +KKRIE LI+REYL R   + ++Y Y+A
Sbjct: 723  EVTQQLRARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA 766



>gb:AY423034_2532120 Danio rerio cullin 3 (CUL3) mRNA, complete cds.
          Length = 766

 Score =  193 bits (491), Expect = 3e-48
 Identities = 113/284 (39%), Positives = 165/284 (58%), Gaps = 29/284 (10%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMD-VRLPHELNVYQDIFKEFYLSKYS 727
            + F+   Q       G++++V VLTTGYWPT        +P       ++F+ FYL+K+S
Sbjct: 483  DEFRHHLQTSQVSLCGVDLTVRVLTTGYWPTQSATPKCNIPPSPRHAFEVFRRFYLAKHS 542

Query: 726  GRRLMWQNSLGHCVLKAEFPKGRKE----------------------LAVSFFQTVVLML 613
            GR+L  Q+ +G   L A F    K+                      L VS FQ  +LML
Sbjct: 543  GRQLTLQHHMGSADLNATFYGPIKKEDGSDVGVGGALLTGSNTRKHILQVSTFQMTILML 602

Query: 612  FNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGK--VRVLQKIPKGRDVEDDDTFVFNDQ 439
            FN  EKF+F++I++   I ++EL R LQSLACGK   RVL K PK +++E    F  NDQ
Sbjct: 603  FNNREKFTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIESGHVFTVNDQ 662

Query: 438  FTAPLYRIKVNAIQMK--ETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIA 265
            FT+ L+R+K+  +  K  E+  E   T ++V  DR+++++AAIVRIMK+RK + H +L+A
Sbjct: 663  FTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVA 722

Query: 264  ELFQQL--KFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
            E+ QQL  +F   P  +KKRIE LI+REYL R   + ++Y Y+A
Sbjct: 723  EVTQQLRARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA 766



>gb:BC031844_1980253 Homo sapiens cullin 3, mRNA (cDNA clone
           IMAGE:3861760), partial cds.
          Length = 373

 Score =  193 bits (491), Expect = 3e-48
 Identities = 115/284 (40%), Positives = 169/284 (59%), Gaps = 29/284 (10%)
 Frame = -1

Query: 903 ESFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMD-VRLPHELNVYQDIFKEFYLSKYS 727
           + F+Q  QA      G++++V VLTTGYWPT        +P       +IF+ FYL+K+S
Sbjct: 90  DEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHS 149

Query: 726 GRRLMWQNSLGHCVLKAEF--PKGRKE--------------------LAVSFFQTVVLML 613
           GR+L  Q+ +G   L A F  P  +++                    L VS FQ  +LML
Sbjct: 150 GRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILML 209

Query: 612 FNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKV--RVLQKIPKGRDVEDDDTFVFNDQ 439
           FN   K++F++I++   I ++EL R LQSLACGK   RVL K PK +++E+   F  NDQ
Sbjct: 210 FNNRGKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQ 269

Query: 438 FTAPLYRIKVNAIQMK--ETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIA 265
           FT+ L+R+K+  +  K  E+  E   T ++V  DR+++++AAIVRIMK+RK + H +L+A
Sbjct: 270 FTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVA 329

Query: 264 ELFQQLK--FPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
           E+ QQLK  F   P  +KKRIE LI+REYL R   + ++Y Y+A
Sbjct: 330 EVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA 373



>gb:BC077239_2559956 Xenopus laevis cullin 3, mRNA (cDNA clone
            MGC:79108 IMAGE:5048925), complete cds.
          Length = 768

 Score =  193 bits (490), Expect = 4e-48
 Identities = 114/284 (40%), Positives = 168/284 (59%), Gaps = 29/284 (10%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMD-VRLPHELNVYQDIFKEFYLSKYS 727
            + F+Q  Q       G++++V VLTTGYWPT        +P       +IF+ FYL+K+S
Sbjct: 485  DEFRQHLQTTGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHS 544

Query: 726  GRRLMWQNSLGHCVLKAEF--PKGRKE--------------------LAVSFFQTVVLML 613
            GR+L  Q+ +G   L A F  P  +++                    L VS FQ  +LML
Sbjct: 545  GRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILML 604

Query: 612  FNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKV--RVLQKIPKGRDVEDDDTFVFNDQ 439
            FN  +K++F++I++   I ++EL R LQSLACGK   RVL K PK +++E    F  NDQ
Sbjct: 605  FNNRDKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIESGHMFTVNDQ 664

Query: 438  FTAPLYRIKVNAIQMK--ETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIA 265
            FT+ L+R+K+  +  K  E+  E   T ++V  DR+++++AAIVRIMK+RK + H +L+A
Sbjct: 665  FTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVA 724

Query: 264  ELFQQLK--FPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
            E+ QQLK  F   P  +KKRIE LI+REYL R   + ++Y Y+A
Sbjct: 725  EVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA 768



>gb:NTA344535_1691351 Nicotiana tabacum partial mRNA for cullin 1C
           (cul1C gene).
          Length = 447

 Score =  191 bits (485), Expect = 2e-47
 Identities = 101/242 (41%), Positives = 147/242 (60%), Gaps = 2/242 (0%)
 Frame = -1

Query: 858 GIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLK 679
           GI+++V VLTTG+WP+Y   D+ LP E+    ++FKEFY +K   R+L W  SLG C + 
Sbjct: 210 GIDLTVTVLTTGFWPSYKSFDLNLPAEMVRCVEVFKEFYQTKTKHRKLTWIYSLGTCNIN 269

Query: 678 AEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVL 499
            +F     EL V+ +Q   L+LFN +++ S+Q+I   + + D ++ R L SL+C K ++L
Sbjct: 270 GKFEPKTIELVVTTYQASALLLFNASDRLSYQEIMTQLNLSDDDVVRLLHSLSCAKYKIL 329

Query: 498 QKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAA 319
            K P  + +   D F FN +F   + RIK+         +E     E V +DR+Y +DA+
Sbjct: 330 FKEPSTKTISPTDVFEFNSRFADKMRRIKIPL----PPEDEKKKVIEDVDKDRRYAIDAS 385

Query: 318 IVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKSNPQIYNY 145
           IVRIMK+RKVL +  L+ E  +QL    KP    +KKRIE LI R+YLERDK NP ++ Y
Sbjct: 386 IVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNLFKY 445

Query: 144 LA 139
           LA
Sbjct: 446 LA 447



>gb:AB080190_1523944 Pisum sativum cul1 mRNA for cullin-like protein1,
            complete cds.
          Length = 742

 Score =  188 bits (478), Expect = 1e-46
 Identities = 102/256 (39%), Positives = 152/256 (59%), Gaps = 2/256 (0%)
 Frame = -1

Query: 900  SFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGR 721
            SF++       +  GI+++V VLTTG+ P+Y   D+ LP E+    ++FKEFY +K   R
Sbjct: 491  SFEEYLSNNPNIDPGIDLTVTVLTTGFGPSYKSFDLNLPAEMVRCVEVFKEFYQTKTKHR 550

Query: 720  RLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELR 541
            +L W  SLG C +  +F     EL V+ +Q   L+LFN +++ S+ +I   + + D ++ 
Sbjct: 551  KLTWIYSLGTCNVSGKFEPKTMELVVTTYQASALLLFNSSDRLSYSEIMTQLNLTDDDVV 610

Query: 540  RTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTT 361
            R L SL+C K ++L K P  + +   D F FN +FT  + RIK+        V+E     
Sbjct: 611  RLLHSLSCAKYKILTKEPSTKTISPTDHFEFNSKFTDKMRRIKIPL----PPVDEKKKVI 666

Query: 360  ERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDRE 187
            E V +DR+Y +DA+IVRIMK+RKVLS+  L+ E  +QL    KP    +KKRIE LI R+
Sbjct: 667  EDVDKDRRYAIDASIVRIMKSRKVLSYQQLVMECVEQLGRMFKPDVKAIKKRIEDLISRD 726

Query: 186  YLERDKSNPQIYNYLA 139
            YLERD+ N  ++ YLA
Sbjct: 727  YLERDRDNANLFKYLA 742



>gb:U29536_1402828 Caenorhabditis elegans cosmid F45E12, complete
            sequence.
          Length = 840

 Score =  181 bits (458), Expect = 2e-44
 Identities = 95/247 (38%), Positives = 146/247 (59%), Gaps = 11/247 (4%)
 Frame = -1

Query: 846  SVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFP 667
            +  V+T  YWPTY   ++ +P E+      +++FY  ++  R + W + L   V+ A F 
Sbjct: 594  TARVITPEYWPTYDTYEINIPKEMRDTLTDYQDFYRVQHGNRNVKWHHGLASAVISASFR 653

Query: 666  KG-RKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACG--KVRVLQ 496
             G +KEL  + +QTV+L+LFN+ E ++  +I E   I + E+ + + +L  G  K +VLQ
Sbjct: 654  PGCKKELIATMYQTVILLLFNKCETWTVAEIVEHTKILEIEVVKNVLALLGGRDKPKVLQ 713

Query: 495  KIPKGRDVEDDDT--------FVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDR 340
            ++  G   + + T        FV N +FT    R+++  + +K  VEE     E V  DR
Sbjct: 714  RVEGGGSEKKEGTVENLKNEKFVVNSKFTEKRCRVRIAQVNIKTAVEETKEVKEEVNSDR 773

Query: 339  QYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLERDKSNP 160
            QY++DAA+VRIMK RK L+H  L+ EL QQL+FP+  AD+KKR+ESLI+REY+ RD    
Sbjct: 774  QYKIDAAVVRIMKARKQLNHQTLMTELLQQLRFPVSTADIKKRLESLIEREYISRDPEEA 833

Query: 159  QIYNYLA 139
              YNY+A
Sbjct: 834  SSYNYVA 840



>gb:CEU58086_1368584 Caenorhabditis elegans cul-4 mRNA, complete cds.
          Length = 803

 Score =  181 bits (458), Expect = 2e-44
 Identities = 95/247 (38%), Positives = 146/247 (59%), Gaps = 11/247 (4%)
 Frame = -1

Query: 846  SVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFP 667
            +  V+T  YWPTY   ++ +P E+      +++FY  ++  R + W + L   V+ A F 
Sbjct: 557  TARVITPEYWPTYDTYEINIPKEMRDTLTDYQDFYRVQHGNRNVKWHHGLASAVISASFR 616

Query: 666  KG-RKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACG--KVRVLQ 496
             G +KEL  + +QTV+L+LFN+ E ++  +I E   I + E+ + + +L  G  K +VLQ
Sbjct: 617  PGCKKELIATMYQTVILLLFNKCETWTVAEIVEHTKILEIEVVKNVLALLGGRDKPKVLQ 676

Query: 495  KIPKGRDVEDDDT--------FVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDR 340
            ++  G   + + T        FV N +FT    R+++  + +K  VEE     E V  DR
Sbjct: 677  RVEGGGSEKKEGTVENLKNEKFVVNSKFTEKRCRVRIAQVNIKTAVEETKEVKEEVNSDR 736

Query: 339  QYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLERDKSNP 160
            QY++DAA+VRIMK RK L+H  L+ EL QQL+FP+  AD+KKR+ESLI+REY+ RD    
Sbjct: 737  QYKIDAAVVRIMKARKQLNHQTLMTELLQQLRFPVSTADIKKRLESLIEREYISRDPEEA 796

Query: 159  QIYNYLA 139
              YNY+A
Sbjct: 797  SSYNYVA 803



>pir|T16367|T16367 hypothetical protein F45E12.3 - Caenorhabditis
            elegans
          Length = 796

 Score =  181 bits (458), Expect = 2e-44
 Identities = 95/247 (38%), Positives = 146/247 (59%), Gaps = 11/247 (4%)
 Frame = -1

Query: 846  SVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFP 667
            +  V+T  YWPTY   ++ +P E+      +++FY  ++  R + W + L   V+ A F 
Sbjct: 550  TARVITPEYWPTYDTYEINIPKEMRDTLTDYQDFYRVQHGNRNVKWHHGLASAVISASFR 609

Query: 666  KG-RKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACG--KVRVLQ 496
             G +KEL  + +QTV+L+LFN+ E ++  +I E   I + E+ + + +L  G  K +VLQ
Sbjct: 610  PGCKKELIATMYQTVILLLFNKCETWTVAEIVEHTKILEIEVVKNVLALLGGRDKPKVLQ 669

Query: 495  KIPKGRDVEDDDT--------FVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDR 340
            ++  G   + + T        FV N +FT    R+++  + +K  VEE     E V  DR
Sbjct: 670  RVEGGGSEKKEGTVENLKNEKFVVNSKFTEKRCRVRIAQVNIKTAVEETKEVKEEVNSDR 729

Query: 339  QYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLERDKSNP 160
            QY++DAA+VRIMK RK L+H  L+ EL QQL+FP+  AD+KKR+ESLI+REY+ RD    
Sbjct: 730  QYKIDAAVVRIMKARKQLNHQTLMTELLQQLRFPVSTADIKKRLESLIEREYISRDPEEA 789

Query: 159  QIYNYLA 139
              YNY+A
Sbjct: 790  SSYNYVA 796



>sp|Q17392|CUL4_CAEEL Cullin 4.
          Length = 833

 Score =  181 bits (458), Expect = 2e-44
 Identities = 95/247 (38%), Positives = 146/247 (59%), Gaps = 11/247 (4%)
 Frame = -1

Query: 846  SVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFP 667
            +  V+T  YWPTY   ++ +P E+      +++FY  ++  R + W + L   V+ A F 
Sbjct: 587  TARVITPEYWPTYDTYEINIPKEMRDTLTDYQDFYRVQHGNRNVKWHHGLASAVISASFR 646

Query: 666  KG-RKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACG--KVRVLQ 496
             G +KEL  + +QTV+L+LFN+ E ++  +I E   I + E+ + + +L  G  K +VLQ
Sbjct: 647  PGCKKELIATMYQTVILLLFNKCETWTVAEIVEHTKILEIEVVKNVLALLGGRDKPKVLQ 706

Query: 495  KIPKGRDVEDDDT--------FVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDR 340
            ++  G   + + T        FV N +FT    R+++  + +K  VEE     E V  DR
Sbjct: 707  RVEGGGSEKKEGTVENLKNEKFVVNSKFTEKRCRVRIAQVNIKTAVEETKEVKEEVNSDR 766

Query: 339  QYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLERDKSNP 160
            QY++DAA+VRIMK RK L+H  L+ EL QQL+FP+  AD+KKR+ESLI+REY+ RD    
Sbjct: 767  QYKIDAAVVRIMKARKQLNHQTLMTELLQQLRFPVSTADIKKRLESLIEREYISRDPEEA 826

Query: 159  QIYNYLA 139
              YNY+A
Sbjct: 827  SSYNYVA 833



>pir|S62405|S62405 hypothetical protein SPAC24H6.03 - fission yeast
            (Schizosaccharomyces pombe)
          Length = 798

 Score =  180 bits (456), Expect = 4e-44
 Identities = 103/265 (38%), Positives = 160/265 (60%), Gaps = 10/265 (3%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWPT-YPPMDVR--LPHELNVYQDIFKEFYLSK 733
            + +K +S  ++  P  ++++V +L + +WP    P  ++   P  L    D F +FYLSK
Sbjct: 535  QEYKHNSALQSAKP-ALDLNVSILASTFWPIDLSPHKIKCNFPKVLLAQIDQFTDFYLSK 593

Query: 732  YSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEK---FSFQDIKEAIG 562
            ++GR+L+W  S+G   ++  F   + +L VS   +V+L+LF + ++     F++I E   
Sbjct: 594  HTGRKLLWYPSMGSADVRVNFKDRKYDLNVSTIASVILLLFQDLKENQCLIFEEILEKTN 653

Query: 561  IEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMK--E 388
            IE  +L+R LQSLAC K ++L K PKGR+V   D F FN+ F + L RIK++ +     E
Sbjct: 654  IEVGDLKRNLQSLACAKYKILLKDPKGREVNAGDKFYFNENFVSNLARIKISTVAQTRVE 713

Query: 387  TVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQL--KFPIKPADLKK 214
               E   T E+V + R++Q DA IVR+MK RKV  H  L+AE+ +QL  +F   P  +K+
Sbjct: 714  DDSERKRTLEKVDESRKHQADACIVRVMKDRKVCEHNQLMAEVTRQLNPRFHPSPMMIKR 773

Query: 213  RIESLIDREYLERDKSNPQIYNYLA 139
            RIE+LI+REYL+R   N +IY YLA
Sbjct: 774  RIEALIEREYLQRQADNGRIYEYLA 798



>sp|Q09760|CUL3_SCHPO Cullin 3 homolog (Cul-3).>pir|T38359|T38359
            cullin 3 homolog - fission yeast (Schizosaccharomyces
            pombe)>gb:SPAC24H6_1717396 S.pombe chromosome I cosmid
            c24H6.
          Length = 785

 Score =  180 bits (456), Expect = 4e-44
 Identities = 103/265 (38%), Positives = 160/265 (60%), Gaps = 10/265 (3%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWPT-YPPMDVR--LPHELNVYQDIFKEFYLSK 733
            + +K +S  ++  P  ++++V +L + +WP    P  ++   P  L    D F +FYLSK
Sbjct: 522  QEYKHNSALQSAKP-ALDLNVSILASTFWPIDLSPHKIKCNFPKVLLAQIDQFTDFYLSK 580

Query: 732  YSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEK---FSFQDIKEAIG 562
            ++GR+L+W  S+G   ++  F   + +L VS   +V+L+LF + ++     F++I E   
Sbjct: 581  HTGRKLLWYPSMGSADVRVNFKDRKYDLNVSTIASVILLLFQDLKENQCLIFEEILEKTN 640

Query: 561  IEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMK--E 388
            IE  +L+R LQSLAC K ++L K PKGR+V   D F FN+ F + L RIK++ +     E
Sbjct: 641  IEVGDLKRNLQSLACAKYKILLKDPKGREVNAGDKFYFNENFVSNLARIKISTVAQTRVE 700

Query: 387  TVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQL--KFPIKPADLKK 214
               E   T E+V + R++Q DA IVR+MK RKV  H  L+AE+ +QL  +F   P  +K+
Sbjct: 701  DDSERKRTLEKVDESRKHQADACIVRVMKDRKVCEHNQLMAEVTRQLNPRFHPSPMMIKR 760

Query: 213  RIESLIDREYLERDKSNPQIYNYLA 139
            RIE+LI+REYL+R   N +IY YLA
Sbjct: 761  RIEALIEREYLQRQADNGRIYEYLA 785



>gb:BC054607_2551017 Danio rerio cullin 4A, mRNA (cDNA clone
           MGC:64071 IMAGE:6794393), complete cds.
          Length = 635

 Score =  179 bits (454), Expect = 7e-44
 Identities = 85/144 (59%), Positives = 114/144 (79%)
 Frame = -1

Query: 897 FKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRR 718
           FKQ  Q +T+ P  IE++V++LT GYWP+Y PMDV LP E+   Q++FK FYL K+SGR+
Sbjct: 493 FKQYMQNQTE-PSNIELTVNILTMGYWPSYTPMDVHLPAEMVKLQEVFKLFYLGKHSGRK 551

Query: 717 LMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR 538
           L WQ +LGH VLK EF +G+KEL VS FQT+VL++FNE+++ S ++I+ A GIE+ EL+R
Sbjct: 552 LQWQPTLGHAVLKTEFKEGKKELQVSLFQTLVLLMFNESDECSVEEIRVATGIEEGELKR 611

Query: 537 TLQSLACGKVRVLQKIPKGRDVED 466
           TLQSLACGK RVL K P+G++VED
Sbjct: 612 TLQSLACGKARVLNKTPRGKEVED 635



>gb:AE017347_1758066 Cryptococcus neoformans var. neoformans JEC21
            chromosome 7, complete sequence.
          Length = 811

 Score =  177 bits (449), Expect = 2e-43
 Identities = 103/244 (42%), Positives = 145/244 (59%), Gaps = 8/244 (3%)
 Frame = -1

Query: 846  SVHVLTTGYWPTYPPM----DVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLK 679
            + +VLT   WP YP +    +  L   L    D F  +Y +++  R L W+  L    L 
Sbjct: 568  TANVLTESAWPAYPLLKDGWNFHLTPSLQSSIDDFTSWYTTQHKNRVLSWRFQLATVTLT 627

Query: 678  AEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGK--VR 505
            A FP GR E+ VS FQ VVL+L+NE E  +F +IKE  GIE+ EL RTLQSLA G+   R
Sbjct: 628  ARFPSGRYEVGVSLFQAVVLLLYNEIESLTFAEIKERTGIENNELVRTLQSLALGRKGTR 687

Query: 504  VLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVD 325
            VL K P G++V   D F +N  FT+   + K+N IQ   + EE+  T E+V  DR   ++
Sbjct: 688  VLLKKPSGKEVNPTDIFAWNKGFTSERIKFKINQIQQDMSAEESRKTNEQVALDRVSILE 747

Query: 324  AAIVRIMKTRKVLSHTLLIAELFQQL--KFPIKPADLKKRIESLIDREYLERDKSNPQIY 151
            A IVRIMK+RK L+  LLI  +   +  +FP    ++KKR+ESLI+RE++ RD+ +  I 
Sbjct: 748  ATIVRIMKSRKKLTLQLLIDGVVSDVSKRFPPDVKEIKKRVESLIEREFMARDEEDRSIL 807

Query: 150  NYLA 139
            +Y+A
Sbjct: 808  HYVA 811



>gb:AE014134_1129264 Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE014134_1129265 Drosophila melanogaster
            chromosome 2L, complete sequence.>gb:AE014134_1129266
            Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE003647_1219371 Drosophila melanogaster
            chromosome 2L, section 56 of 83 of the complete
            sequence.>gb:AE003647_1219372 Drosophila melanogaster
            chromosome 2L, section 56 of 83 of the complete
            sequence.>gb:AE003647_1219373 Drosophila melanogaster
            chromosome 2L, section 56 of 83 of the complete
            sequence.>gb:DROSADH06_1382813 Drosophila melanogaster,
            chromosome 2L, region 34C4-36A7 (Adh region), section 6
            of 10 of the complete sequence.
          Length = 773

 Score =  170 bits (431), Expect = 3e-41
 Identities = 105/275 (38%), Positives = 153/275 (55%), Gaps = 35/275 (12%)
 Frame = -1

Query: 858  GIEMSVHVLTTGYWPTYPPM-DVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVL 682
            G+E++V +LTTG+WPT     +  +P       DIFK FYL+K+SGR+L  Q  +G   +
Sbjct: 500  GVELTVRILTTGFWPTQTATPNCNIPAAPREAFDIFKNFYLNKHSGRQLTLQPQMGTAYI 559

Query: 681  KAEFPKGRKE---------------------------LAVSFFQTVVLMLFNEAEKFSFQ 583
             A F  GRK                            L VS +Q  VL+LFN  +  ++ 
Sbjct: 560  NAVF-YGRKAVESEKDKDAPSSSSSGCGVPTTTRKHILQVSTYQMCVLLLFNNRDVLTYD 618

Query: 582  DIKEAIGIEDKELRRTLQSLACGK----VRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRI 415
            DI +   I ++EL R LQSL+ GK    + V     K +D+E  D F  ND F +  +R+
Sbjct: 619  DIHQETDIPERELVRALQSLSMGKPAQRLLVRNSKTKTKDIEPTDEFYVNDAFNSKFHRV 678

Query: 414  KVNAIQMK-ETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLK-- 244
            K+  +  K E+  E   T  +V +DR+++++AAIVRIMK RK L+H LL++++  QLK  
Sbjct: 679  KIQTVAAKGESEPERKETRGKVDEDRKHEIEAAIVRIMKARKRLAHNLLVSDVTSQLKSR 738

Query: 243  FPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
            F   P  +KKRIE LI+REYL+R   + ++YNYLA
Sbjct: 739  FLPSPVFIKKRIEGLIEREYLQRSPEDRKVYNYLA 773



>gb:AE017347_1758096 Cryptococcus neoformans var. neoformans JEC21
            chromosome 7, complete sequence.
          Length = 808

 Score =  169 bits (429), Expect = 5e-41
 Identities = 106/260 (40%), Positives = 147/260 (56%), Gaps = 23/260 (8%)
 Frame = -1

Query: 849  MSVHVLTTGYWP--TYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA 676
            + V VLT+  WP  T   + +  P  L    + ++ FY S++SGRRL WQ  LG   LK 
Sbjct: 550  LHVSVLTSSNWPPSTLLSLPLTFPAPLLPALEHYQTFYDSRHSGRRLTWQGLLGSADLKV 609

Query: 675  EFPKGRKELAVSFFQTVVLMLFNE---AEKFSFQDIKEAIGIEDKELRRTLQSLACGKVR 505
               KG+ E+ +S    VVL+ F++    +  S+ ++K    + D EL RTLQSLACGK R
Sbjct: 610  RTRKGQWEVNLSTIGMVVLLAFSDLKPGDVLSYHELKAQTSLPDAELARTLQSLACGKHR 669

Query: 504  VLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMK----------------ETVEEN 373
            +L K PKGR+VE  DTF FN+ F++PL RIK+  I                   E  +E 
Sbjct: 670  LLVKHPKGREVEQGDTFEFNEAFSSPLARIKILQISSSSSAASTSTSSARGVGVENAQER 729

Query: 372  TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQL--KFPIKPADLKKRIESL 199
              T  ++ ++R++QV+A IVRIMK RK + H  L++E+  QL  +F      +KKRIE L
Sbjct: 730  EETERQIEEERKHQVEACIVRIMKDRKTMRHNDLVSEVAHQLAKRFMASVPMIKKRIEGL 789

Query: 198  IDREYLERDKSNPQIYNYLA 139
            IDREYLER +     Y YLA
Sbjct: 790  IDREYLERTEDMGS-YRYLA 808



>sp|Q17391|CUL3_CAEEL Cullin 3.>gb:AC024744_1204336 Caenorhabditis
            elegans cosmid Y108G3AL, complete sequence.
          Length = 777

 Score =  167 bits (424), Expect = 2e-40
 Identities = 107/274 (39%), Positives = 155/274 (56%), Gaps = 33/274 (12%)
 Frame = -1

Query: 861  MGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVL 682
            M I++S+ VLT G WPT     V LP EL+V  ++F ++Y  K++GR+L     LG+  +
Sbjct: 504  MSIDISLRVLTAGVWPTVQCNPVVLPQELSVAYEMFTQYYTEKHTGRKLTINTLLGNADV 563

Query: 681  KAEF---PKG------------------------RKELAVSFFQTVVLMLFNEAEKFSFQ 583
            KA F   PK                          K L V+  Q ++L+ FN   + S Q
Sbjct: 564  KATFYPPPKASMSNEENGPGPSSSGESMKERKPEHKILQVNTHQMIILLQFNHHNRISCQ 623

Query: 582  DIKEAIGIEDKELRRTLQSLACGKV--RVLQKIPKGRDVED-DDTFVFNDQFTAPLYRIK 412
             + + + I ++EL+R LQSLA GK   R+L +  KG+D  D  D F  ND F + L R+K
Sbjct: 624  QLMDELKIPERELKRNLQSLALGKASQRILVRKNKGKDAIDMSDEFAVNDNFQSKLTRVK 683

Query: 411  VNAIQMK-ETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQL--KF 241
            V  +  K E+  E   T ++V  DR+ +V+AAIVRIMK RK L+H  L+AE+ QQL  +F
Sbjct: 684  VQMVTGKVESEPEIRETRQKVEDDRKLEVEAAIVRIMKARKKLNHNNLVAEVTQQLRHRF 743

Query: 240  PIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
               P  +K+RIE+LI+REYL RD+ + + Y Y+A
Sbjct: 744  MPSPIIIKQRIETLIEREYLARDEHDHRAYQYIA 777



>gb:CEU58085_1368583 Caenorhabditis elegans cul-3 mRNA, complete cds.
          Length = 780

 Score =  160 bits (405), Expect = 3e-38
 Identities = 106/277 (38%), Positives = 154/277 (55%), Gaps = 36/277 (12%)
 Frame = -1

Query: 861  MGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVL 682
            M I++S+ VLT G WPT     V LP EL+V  ++F ++Y  K++GR+L     LG+  +
Sbjct: 504  MSIDISLRVLTAGVWPTVQCNPVVLPQELSVAYEMFTQYYTEKHTGRKLTINTLLGNADV 563

Query: 681  KAEF----------------PKG-----------RKELAVSFFQTVVLMLFNEAEKFSF- 586
            KA F                P G            K L V+  Q ++L+  N   + S  
Sbjct: 564  KATFYPPPKASMSNEENGPGPSGSGESMKERKPEHKILQVNTHQMIILLQLNHHNRISCQ 623

Query: 585  --QDIKEAIGIEDKELRRTLQSLACGKV--RVLQKIPKGRDVED-DDTFVFNDQFTAPLY 421
              Q + + + I ++EL+R LQSLA GK   R+L +  KG+D  D  D F  ND F + L 
Sbjct: 624  HEQQLMDELKIPERELKRNLQSLALGKASQRILVRKNKGKDAIDMSDEFAVNDNFQSKLT 683

Query: 420  RIKVNAIQMK-ETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQL- 247
            R+KV  +  K E+  E   T ++V  DR+ +V+AAIVRIMK RK L+H  L+AE+ QQL 
Sbjct: 684  RVKVQMVTGKVESEPEIRETRQKVEDDRKLEVEAAIVRIMKARKKLNHNNLVAEVTQQLR 743

Query: 246  -KFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
             +F   P  +K+RIE+LI+REYL RD+ + + Y Y+A
Sbjct: 744  HRFMPSPIIIKQRIETLIEREYLARDEHDHRAYQYIA 780



>gb:BX842631_1643970 Neurospora crassa DNA linkage group I BAC contig
            B1O14.
          Length = 838

 Score =  152 bits (385), Expect = 7e-36
 Identities = 104/271 (38%), Positives = 145/271 (53%), Gaps = 32/271 (11%)
 Frame = -1

Query: 855  IEMSVHVLTTGYWPTY-----------PPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMW 709
            ++++++VLTT  WP               +D   P E+   Q+ F ++YL   SGR L W
Sbjct: 568  VDLNINVLTTNNWPPEVMGGGTSKGEGAKLDCFYPPEIKRLQESFYKYYLKDRSGRVLTW 627

Query: 708  QNSLGHCVLKAEFPK------------GRKELAVSFFQTVVLMLFNE---AEKFSFQDIK 574
             +S G+  +K  FPK             R EL VS +  +VLMLFN+    E  SF +I+
Sbjct: 628  VSSAGNADIKCVFPKVPGKETGPLSKERRYELNVSTYGMIVLMLFNDLVDGESLSFDEIQ 687

Query: 573  EAIGIEDKELRRTLQSLAC-GKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIK---VN 406
                I   EL RTL SL+   K RVL K P  ++V++ D F +N QF +   RIK   ++
Sbjct: 688  AKTNIPAPELMRTLASLSSVPKCRVLLKEPATKNVKNTDKFSYNAQFVSKAIRIKAPVIS 747

Query: 405  AIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP- 229
            +I   E  EE   T  +  Q R + +DAA+VRIMK RK+L+HT L+ E+  QL    KP 
Sbjct: 748  SISKVEGDEERKETERKNDQTRAHVIDAAVVRIMKQRKLLAHTKLVNEVISQLMGRFKPD 807

Query: 228  -ADLKKRIESLIDREYLERDKSNPQIYNYLA 139
               +KKRIE L+ REYLER + +   Y YLA
Sbjct: 808  VPLIKKRIEDLLAREYLERVEGDSSTYRYLA 838



>gb:AX888127_1483580 Sequence 3990 from Patent EP1033401.
          Length = 166

 Score =  145 bits (367), Expect = 8e-34
 Identities = 77/166 (46%), Positives = 113/166 (68%), Gaps = 6/166 (3%)
 Frame = -1

Query: 618 MLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKV--RVLQKIPKGRDVEDDDTFVFN 445
           MLFN  EK++F++I++   I ++EL R LQSLACGK   RVL K P  +++E+   F  N
Sbjct: 1   MLFNNKEKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPXSKEIENGHIFTVN 60

Query: 444 DQFTAPLYRIKVNAIQMK--ETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLL 271
           DQFT+ L+R+K+  +  K  E+  E   T ++V  DR+++++AAIVRIMK+RK + H +L
Sbjct: 61  DQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVL 120

Query: 270 IAELFQQLK--FPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
           +AE+ QQLK  F   P  +KKRIE LI+REYL R   + ++Y Y+A
Sbjct: 121 VAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA 166



>gb:CR382128_1660486 Yarrowia lipolytica chromosome B of strain CLIB99
            of Yarrowia lipolytica.
          Length = 778

 Score =  145 bits (365), Expect = 1e-33
 Identities = 90/250 (36%), Positives = 147/250 (58%), Gaps = 11/250 (4%)
 Frame = -1

Query: 855  IEMSVHVLTTGYWPTYPPMDVR--LPH--ELNVYQDIFKEFYLSKYSGRRLMWQNSLGHC 688
            +E++V +L+  YWPT         L H  +    ++ F+++Y   +SGR+L W  +LG+ 
Sbjct: 529  VELTVALLSGTYWPTSIAQGANYTLIHCADAENAKEQFEQYYSKAHSGRKLEWVPNLGNA 588

Query: 687  VLKAEFPKGRKELAVSFFQTVVLMLFNEA--EKFSFQDIKEAIGIEDKELRRTLQSLACG 514
             ++ +F K   ++ V      +LMLF +   +  SF  I+   GI   +L+R LQS++  
Sbjct: 589  DIRIKFKKKFHDVNVPNPVMPILMLFQDVGDQSISFHRIQMETGIPIPDLKRHLQSVSVA 648

Query: 513  -KVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMK--ETVEENTSTTERVFQD 343
             K R+L+K+P  +DV + D F FN+ F AP+ +I+V AI     ET  E  +T  ++ + 
Sbjct: 649  PKTRLLKKVPMSKDVNETDEFFFNENFEAPMTKIRVLAINATRAETDVERDATMVQIDKS 708

Query: 342  RQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDK 169
            RQ ++DAAIVR+MK+RK L+H  L+ E+ +QL    KP    +K  IESL++REYL RD 
Sbjct: 709  RQNEIDAAIVRVMKSRKTLNHNNLVGEVTKQLASRFKPPIPTIKHCIESLLEREYLRRDD 768

Query: 168  SNPQIYNYLA 139
            ++  +++Y A
Sbjct: 769  NDTTLFHYEA 778



>gb:HSU83410_2026686 Human CUL-2 (cul-2) mRNA, complete cds.
          Length = 745

 Score =  139 bits (349), Expect = 1e-31
 Identities = 80/249 (32%), Positives = 137/249 (55%), Gaps = 4/249 (1%)
 Frame = -1

Query: 873  TKLPMGIEMSVHVLTTGYWPTY--PPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNS 700
            T + +GI   ++VL  G WP    P     +P EL     +F+ FY   +SGR+L W + 
Sbjct: 499  TVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHY 558

Query: 699  LGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLA 520
            L    +K  +        V+ +Q  VL+ FN +E  S+++++++  + +KEL +T++SL 
Sbjct: 559  LCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLL 618

Query: 519  CGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDR 340
               V+++    +  D++ + +F  N  F++   + K+     K+T +E   T   V +DR
Sbjct: 619  --DVKMINHDSEKEDIDAESSFSLNMNFSSKRTKFKITTSMQKDTPQEMEQTRSAVDEDR 676

Query: 339  QYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKS 166
            +  + AAIVRIMK RKVL H  LI E+  Q +    P  + +KK IE LID++Y+ER ++
Sbjct: 677  KMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQA 736

Query: 165  NPQIYNYLA 139
            +   Y+Y+A
Sbjct: 737  SADEYSYVA 745



>gb:AL392046_1927132 Human DNA sequence from clone RP11-297A16 on
            chromosome 10 Contains the gene for cullin 2 (CUL2), a
            novel gene and a CpG island, complete sequence.
          Length = 688

 Score =  139 bits (349), Expect = 1e-31
 Identities = 80/249 (32%), Positives = 137/249 (55%), Gaps = 4/249 (1%)
 Frame = -1

Query: 873  TKLPMGIEMSVHVLTTGYWPTY--PPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNS 700
            T + +GI   ++VL  G WP    P     +P EL     +F+ FY   +SGR+L W + 
Sbjct: 442  TVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHY 501

Query: 699  LGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLA 520
            L    +K  +        V+ +Q  VL+ FN +E  S+++++++  + +KEL +T++SL 
Sbjct: 502  LCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLL 561

Query: 519  CGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDR 340
               V+++    +  D++ + +F  N  F++   + K+     K+T +E   T   V +DR
Sbjct: 562  --DVKMINHDSEKEDIDAESSFSLNMNFSSKRTKFKITTSMQKDTPQEMEQTRSAVDEDR 619

Query: 339  QYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKS 166
            +  + AAIVRIMK RKVL H  LI E+  Q +    P  + +KK IE LID++Y+ER ++
Sbjct: 620  KMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQA 679

Query: 165  NPQIYNYLA 139
            +   Y+Y+A
Sbjct: 680  SADEYSYVA 688



>sp|Q13617|CUL2_HUMAN Cullin homolog 2 (CUL-2).>gb:CR858317_1182502
            Pongo pygmaeus mRNA; cDNA DKFZp468F155 (from clone
            DKFZp468F155).>gb:AF126404_1885165 Homo sapiens cullin 2
            (CUL2) mRNA, complete cds.>gb:AL392046_1927131 Human DNA
            sequence from clone RP11-297A16 on chromosome 10 Contains
            the gene for cullin 2 (CUL2), a novel gene and a CpG
            island, complete sequence.>gb:BC009591_1972122 Homo
            sapiens cullin 2, mRNA (cDNA clone MGC:14666
            IMAGE:4104375), complete cds.
          Length = 745

 Score =  139 bits (349), Expect = 1e-31
 Identities = 80/249 (32%), Positives = 137/249 (55%), Gaps = 4/249 (1%)
 Frame = -1

Query: 873  TKLPMGIEMSVHVLTTGYWPTY--PPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNS 700
            T + +GI   ++VL  G WP    P     +P EL     +F+ FY   +SGR+L W + 
Sbjct: 499  TVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHY 558

Query: 699  LGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLA 520
            L    +K  +        V+ +Q  VL+ FN +E  S+++++++  + +KEL +T++SL 
Sbjct: 559  LCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLL 618

Query: 519  CGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDR 340
               V+++    +  D++ + +F  N  F++   + K+     K+T +E   T   V +DR
Sbjct: 619  --DVKMINHDSEKEDIDAESSFSLNMNFSSKRTKFKITTSMQKDTPQEMEQTRSAVDEDR 676

Query: 339  QYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKS 166
            +  + AAIVRIMK RKVL H  LI E+  Q +    P  + +KK IE LID++Y+ER ++
Sbjct: 677  KMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQA 736

Query: 165  NPQIYNYLA 139
            +   Y+Y+A
Sbjct: 737  SADEYSYVA 745



>gb:BC025902_2095213 Mus musculus cullin 2, mRNA (cDNA clone
           IMAGE:5027958), partial cds.
          Length = 498

 Score =  138 bits (348), Expect = 1e-31
 Identities = 80/249 (32%), Positives = 137/249 (55%), Gaps = 4/249 (1%)
 Frame = -1

Query: 873 TKLPMGIEMSVHVLTTGYWPTY--PPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNS 700
           T + +GI   ++VL  G WP    P     +P EL     +F+ FY   +SGR+L W + 
Sbjct: 252 TVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHY 311

Query: 699 LGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLA 520
           L    +K  +        V+ +Q  VL+ FN +E  S+++++++  + +KEL +T++SL 
Sbjct: 312 LCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLL 371

Query: 519 CGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDR 340
              V+++    +  D++ + +F  N  F++   + K+     K+T +E   T   V +DR
Sbjct: 372 --DVKMINHDSEKEDIDAESSFSLNMSFSSKRTKFKITTSMQKDTPQELEQTRSAVDEDR 429

Query: 339 QYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKS 166
           +  + AAIVRIMK RKVL H  LI E+  Q +    P  + +KK IE LID++Y+ER ++
Sbjct: 430 KMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQA 489

Query: 165 NPQIYNYLA 139
           +   Y+Y+A
Sbjct: 490 SADEYSYVA 498



>gb:HSU58088_2025036 Human Hs-cul-2 mRNA, partial cds.
          Length = 651

 Score =  138 bits (348), Expect = 1e-31
 Identities = 80/249 (32%), Positives = 137/249 (55%), Gaps = 4/249 (1%)
 Frame = -1

Query: 873  TKLPMGIEMSVHVLTTGYWPTY--PPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNS 700
            T + +GI   ++VL  G WP    P     +P EL     +F+ FY   +SGR+L W + 
Sbjct: 405  TVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHY 464

Query: 699  LGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLA 520
            L    +K  +        V+ +Q  VL+ FN +E  S+++++++  + +KEL +T++SL 
Sbjct: 465  LCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLL 524

Query: 519  CGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDR 340
               V+++    +  D++ + +F  N  F++   + K+     K+T +E   T   V +DR
Sbjct: 525  --DVKMINHDSEKEDIDAESSFSLNMNFSSKRTKFKITTSMQKDTPQEMEQTRSAVDEDR 582

Query: 339  QYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKS 166
            +  + AAIVRIMK RKVL H  LI E+  Q +    P  + +KK IE LID++Y+ER ++
Sbjct: 583  KMYLHAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQA 642

Query: 165  NPQIYNYLA 139
            +   Y+Y+A
Sbjct: 643  SADEYSYVA 651



>sp|Q9D4H8|CUL2_MOUSE Cullin homolog 2 (CUL-2).>gb:BC026779_2095543
            Mus musculus cullin 2, mRNA (cDNA clone MGC:25783
            IMAGE:4018298), complete cds.>gb:BC027428_2095977 Mus
            musculus cullin 2, mRNA (cDNA clone MGC:36720
            IMAGE:3983461), complete cds.
          Length = 745

 Score =  138 bits (348), Expect = 1e-31
 Identities = 80/249 (32%), Positives = 137/249 (55%), Gaps = 4/249 (1%)
 Frame = -1

Query: 873  TKLPMGIEMSVHVLTTGYWPTY--PPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNS 700
            T + +GI   ++VL  G WP    P     +P EL     +F+ FY   +SGR+L W + 
Sbjct: 499  TVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHY 558

Query: 699  LGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLA 520
            L    +K  +        V+ +Q  VL+ FN +E  S+++++++  + +KEL +T++SL 
Sbjct: 559  LCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLL 618

Query: 519  CGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDR 340
               V+++    +  D++ + +F  N  F++   + K+     K+T +E   T   V +DR
Sbjct: 619  --DVKMINHDSEKEDIDAESSFSLNMSFSSKRTKFKITTSMQKDTPQELEQTRSAVDEDR 676

Query: 339  QYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKS 166
            +  + AAIVRIMK RKVL H  LI E+  Q +    P  + +KK IE LID++Y+ER ++
Sbjct: 677  KMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQA 736

Query: 165  NPQIYNYLA 139
            +   Y+Y+A
Sbjct: 737  SADEYSYVA 745



>gb:BC059348_2552383 Xenopus laevis hypothetical protein MGC69167,
            mRNA (cDNA clone MGC:69167 IMAGE:5048949), complete cds.
          Length = 745

 Score =  138 bits (347), Expect = 2e-31
 Identities = 81/249 (32%), Positives = 136/249 (54%), Gaps = 4/249 (1%)
 Frame = -1

Query: 873  TKLPMGIEMSVHVLTTGYWPTY--PPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNS 700
            T + +GI   ++VL  G WP    P     +P EL     +F+ FY   +SGR+L W + 
Sbjct: 499  TVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYNQHFSGRKLTWLHY 558

Query: 699  LGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLA 520
            L    +K  +        V+ +Q  VL+ FN +E  ++++++++  + +KEL +T++SL 
Sbjct: 559  LCTGEVKMNYLCKPYVAMVTTYQMAVLLAFNNSEIITYKELQDSTQMNEKELTKTIKSLL 618

Query: 519  CGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDR 340
               V+++       D+E + TF  N  F++   + K+     K+T +E   T   V +DR
Sbjct: 619  --DVKMINHDSDKEDIEGESTFSLNMNFSSKRTKFKITTPMQKDTPQEVEQTRSAVDEDR 676

Query: 339  QYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKS 166
            +  + AAIVRIMK RKVL H  LI E+  Q +    P  + +KK IE LID++Y+ER ++
Sbjct: 677  KMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQA 736

Query: 165  NPQIYNYLA 139
            +   Y+Y+A
Sbjct: 737  SADEYSYVA 745



>gb:AF020287_1233328 Dictyostelium discoideum CulA (culA) mRNA,
            complete cds.
          Length = 770

 Score =  137 bits (344), Expect = 4e-31
 Identities = 87/247 (35%), Positives = 137/247 (55%), Gaps = 6/247 (2%)
 Frame = -1

Query: 861  MGIEMSVHVLTTGYWPTYPPM-DVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCV 685
            + I+ SV VL TG WP  PP  +  +P EL   + +F++FY +++SGR+L W + L    
Sbjct: 524  LNIDFSVLVLATGSWPLQPPSTNFSIPKELQACEQLFQKFYQNQHSGRKLNWLHHLSKGE 583

Query: 684  LKAEFPKGRKE---LAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACG 514
            LK ++ +  K    L  S +Q  VL+ FN+ E  + ++I+E+  + D  L+ TL SLA  
Sbjct: 584  LKTKYLQTSKSGYTLQCSTYQIGVLLQFNQYETLTSEEIQESTQLIDSVLKGTLTSLAKS 643

Query: 513  KVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQY 334
            K+ +        ++     F  N QF     +I +N   + +  EE  S  + V +DR+ 
Sbjct: 644  KILLADPPLDDEEIAKTTKFSLNKQFKNKKTKIFINVPVLTQVKEEIDSIHKTVEEDRKL 703

Query: 333  QVDAAIVRIMKTRKVLSHTLLIAELFQQL--KFPIKPADLKKRIESLIDREYLERDKSNP 160
            Q+ AAIVRIMK RK L+H+ L+ E+  QL  +F  K   +KK I+ LI++EYL R +   
Sbjct: 704  QIQAAIVRIMKMRKQLAHSGLMTEVISQLQTRFNPKVNIIKKCIDILIEKEYLMRVEGKK 763

Query: 159  QIYNYLA 139
              Y+Y+A
Sbjct: 764  DHYSYVA 770



>gb:AE016819_1749333 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome VI, complete sequence.
          Length = 727

 Score =  127 bits (319), Expect = 3e-28
 Identities = 76/247 (30%), Positives = 130/247 (52%), Gaps = 7/247 (2%)
 Frame = -1

Query: 858  GIEMSVHVLTTGYWPTYP----PMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGH 691
            G    + VLT  +WP         D+ L  EL   +  ++  Y+S++SGRRL W+ +LG 
Sbjct: 483  GAAYQMDVLTPTFWPFQQVETLAQDITLSDELAAARSSYEGLYVSQHSGRRLKWEYNLGS 542

Query: 690  CVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACG- 514
              +  +F +   EL +  +   + +LF +  + + + I++   I D EL+R L SLA   
Sbjct: 543  VRIGHQFGQSYHELTMWTYGATIFLLFRDYAELTTEKIQDLTAIPDAELQRQLISLAVAP 602

Query: 513  KVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQY 334
            + R+L K P  R +   D F  N  FTAP  +++V  + +K   E+  +  + +   R  
Sbjct: 603  RTRILTKTPPSRTIAPSDHFAVNTAFTAPTTKVRVATVVVKS--EQAAALPDVLAASRVQ 660

Query: 333  QVDAAIVRIMKTRKVLSHTLL--IAELFQQLKFPIKPADLKKRIESLIDREYLERDKSNP 160
             + AA+VR +KT + ++HT L   A    Q  F +  +  K+ I+SL+++EY++RD  +P
Sbjct: 661  AISAAVVRQLKTERTMAHTELQDAAVRALQRHFAVSTSMFKRAIQSLLEKEYIQRDAHSP 720

Query: 159  QIYNYLA 139
              Y+YLA
Sbjct: 721  DRYHYLA 727



>gb:BX649606_1643414 Aspergillus fumigatus BAC pilot project
            supercontig; segment 2/3.
          Length = 769

 Score =  127 bits (319), Expect = 3e-28
 Identities = 79/233 (33%), Positives = 125/233 (53%), Gaps = 6/233 (2%)
 Frame = -1

Query: 855  IEMSVHVLTTGYWPTYPPMD-VRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLK 679
            ++    +L TG+WP  PP      P E+    + F+ FY  K++GR+L W   L    +K
Sbjct: 529  VDAHFQILGTGFWPLNPPTTGFSAPPEIVKTYERFQSFYYDKHNGRKLTWLWQLCKGEVK 588

Query: 678  AEFPKGRK---ELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKV 508
            A + K  K      VS FQ  +L+LFNE +  ++ DI++A  +  + L   L  L   K 
Sbjct: 589  ANYIKNTKVPYTFQVSTFQMGILLLFNENDTLTYSDIQKATSLAPEILDPNLAILL--KA 646

Query: 507  RVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQV 328
            +VL   P+G   E   +F  N  F     ++ +N     E   E+  T + + +DR+  +
Sbjct: 647  KVLLPSPEGAKPEPGTSFSLNYNFKNKKIKVNLNIQIKSEQKVESDDTHKTIEEDRKLLL 706

Query: 327  DAAIVRIMKTRKVLSHTLLIAELFQQLK--FPIKPADLKKRIESLIDREYLER 175
             +AIVRIMK+RK + H  L+ E+ QQ+K  FP K  D+KK IE+L++++Y+ER
Sbjct: 707  QSAIVRIMKSRKKMKHVQLVQEVIQQVKSRFPPKVQDIKKNIEALMEKDYIER 759



>gb:BC048370_2550044 Danio rerio zgc:55483, mRNA (cDNA clone MGC:55483
            IMAGE:2640445), complete cds.
          Length = 774

 Score =  126 bits (317), Expect = 5e-28
 Identities = 85/247 (34%), Positives = 121/247 (48%), Gaps = 5/247 (2%)
 Frame = -1

Query: 864  PMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCV 685
            P+ ++ S+ VL++G WP        LP EL      F  FY S++SGR+L W   L    
Sbjct: 528  PLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYGSRHSGRKLTWLYHLSKGE 587

Query: 684  LKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVR 505
            L     K R  L  S FQ  +L+ FN    +S Q + ++  I+   L + LQ L   K+ 
Sbjct: 588  LVTNCFKNRYTLQASTFQMAILLQFNTENCYSVQQLADSTQIKTDILVQVLQILLKSKLL 647

Query: 504  VLQKIPKGRDVED---DDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQY 334
            VL+      D  D   D        +     R+ +N     E  +E  +T + + +DR+ 
Sbjct: 648  VLEDENANIDEMDFKPDTLIKLFLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKL 707

Query: 333  QVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKSNP 160
             + AAIVRIMK RKVL H  L+AE+  QL    KP    +KK I+ LI++EYLER     
Sbjct: 708  LIQAAIVRIMKMRKVLKHQQLLAEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEK 767

Query: 159  QIYNYLA 139
              Y+YLA
Sbjct: 768  DTYSYLA 774



>gb:HSU58087_2025035 Human Hs-cul-1 mRNA, complete cds.
          Length = 752

 Score =  125 bits (314), Expect = 1e-27
 Identities = 81/247 (32%), Positives = 122/247 (49%), Gaps = 5/247 (2%)
 Frame = -1

Query: 864  PMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCV 685
            P+ ++ S+ VL++G WP        LP EL      F  FY S++SGR+L W   L    
Sbjct: 506  PLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGE 565

Query: 684  LKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVR 505
            L     K R  L  S FQ  +L+ +N  + ++ Q + ++  I+   L + LQ L   K+ 
Sbjct: 566  LVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLL 625

Query: 504  VLQKIPKGRD---VEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQY 334
            VL+      D   ++ D        +     R+ +N     E  +E  +T + + +DR+ 
Sbjct: 626  VLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKL 685

Query: 333  QVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKSNP 160
             + AAIVRIMK RKVL H  L+ E+  QL    KP    +KK I+ LI++EYLER     
Sbjct: 686  LIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEK 745

Query: 159  QIYNYLA 139
              Y+YLA
Sbjct: 746  DTYSYLA 752



>gb:AC006323_1875122 Homo sapiens PAC clone RP5-1151M5 from 7,
            complete sequence.
          Length = 513

 Score =  125 bits (314), Expect = 1e-27
 Identities = 81/247 (32%), Positives = 122/247 (49%), Gaps = 5/247 (2%)
 Frame = -1

Query: 864  PMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCV 685
            P+ ++ S+ VL++G WP        LP EL      F  FY S++SGR+L W   L    
Sbjct: 267  PLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGE 326

Query: 684  LKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVR 505
            L     K R  L  S FQ  +L+ +N  + ++ Q + ++  I+   L + LQ L   K+ 
Sbjct: 327  LVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLL 386

Query: 504  VLQKIPKGRD---VEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQY 334
            VL+      D   ++ D        +     R+ +N     E  +E  +T + + +DR+ 
Sbjct: 387  VLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKL 446

Query: 333  QVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKSNP 160
             + AAIVRIMK RKVL H  L+ E+  QL    KP    +KK I+ LI++EYLER     
Sbjct: 447  LIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEK 506

Query: 159  QIYNYLA 139
              Y+YLA
Sbjct: 507  DTYSYLA 513



>sp|Q9WTX6|CUL1_MOUSE Cullin homolog 1 (CUL-1).>gb:AF083216_2053884
            Mus musculus SCF complex protein cul-1 mRNA, complete
            cds.>gb:AF176910_2057868 Mus musculus cullin 1 (Cul1)
            mRNA, complete cds.>gb:BC029260_2096558 Mus musculus
            cullin 1, mRNA (cDNA clone MGC:35976 IMAGE:2812400),
            complete cds.
          Length = 776

 Score =  125 bits (314), Expect = 1e-27
 Identities = 81/247 (32%), Positives = 122/247 (49%), Gaps = 5/247 (2%)
 Frame = -1

Query: 864  PMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCV 685
            P+ ++ S+ VL++G WP        LP EL      F  FY S++SGR+L W   L    
Sbjct: 530  PLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGE 589

Query: 684  LKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVR 505
            L     K R  L  S FQ  +L+ +N  + ++ Q + ++  I+   L + LQ L   K+ 
Sbjct: 590  LVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLL 649

Query: 504  VLQKIPKGRD---VEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQY 334
            VL+      D   ++ D        +     R+ +N     E  +E  +T + + +DR+ 
Sbjct: 650  VLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKL 709

Query: 333  QVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKSNP 160
             + AAIVRIMK RKVL H  L+ E+  QL    KP    +KK I+ LI++EYLER     
Sbjct: 710  LIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEK 769

Query: 159  QIYNYLA 139
              Y+YLA
Sbjct: 770  DTYSYLA 776



>sp|Q13616|CUL1_HUMAN Cullin homolog 1 (CUL-1).>gb:CR861282_1185289
            Pongo pygmaeus mRNA; cDNA DKFZp459I053 (from clone
            DKFZp459I053).>gb:AF062536_1880197 Homo sapiens cullin 1
            mRNA, complete cds.
          Length = 776

 Score =  125 bits (314), Expect = 1e-27
 Identities = 81/247 (32%), Positives = 122/247 (49%), Gaps = 5/247 (2%)
 Frame = -1

Query: 864  PMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCV 685
            P+ ++ S+ VL++G WP        LP EL      F  FY S++SGR+L W   L    
Sbjct: 530  PLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGE 589

Query: 684  LKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVR 505
            L     K R  L  S FQ  +L+ +N  + ++ Q + ++  I+   L + LQ L   K+ 
Sbjct: 590  LVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLL 649

Query: 504  VLQKIPKGRD---VEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQY 334
            VL+      D   ++ D        +     R+ +N     E  +E  +T + + +DR+ 
Sbjct: 650  VLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKL 709

Query: 333  QVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKSNP 160
             + AAIVRIMK RKVL H  L+ E+  QL    KP    +KK I+ LI++EYLER     
Sbjct: 710  LIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEK 769

Query: 159  QIYNYLA 139
              Y+YLA
Sbjct: 770  DTYSYLA 776



>gb:HSM805708_2018008 Homo sapiens mRNA; cDNA DKFZp686G0852 (from
            clone DKFZp686G0852); complete cds.
          Length = 776

 Score =  125 bits (313), Expect = 1e-27
 Identities = 81/247 (32%), Positives = 122/247 (49%), Gaps = 5/247 (2%)
 Frame = -1

Query: 864  PMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCV 685
            P+ ++ S+ VL++G WP        LP EL      F  FY S++SGR+L W   L    
Sbjct: 530  PLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGE 589

Query: 684  LKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVR 505
            L     K R  L  S FQ  +L+ +N  + ++ Q + ++  I+   L + LQ L   K+ 
Sbjct: 590  LVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLL 649

Query: 504  VLQKIPKGRD---VEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQY 334
            VL+      D   ++ D        +     R+ +N     E  +E  +T + + +DR+ 
Sbjct: 650  VLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKL 709

Query: 333  QVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKSNP 160
             + AAIVRIMK RKVL H  L+ E+  QL    KP    +KK I+ LI++EYLER     
Sbjct: 710  LIQAAIVRIMKMRKVLRHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEK 769

Query: 159  QIYNYLA 139
              Y+YLA
Sbjct: 770  DTYSYLA 776



>gb:BC066480_2554369 Danio rerio zgc:77500, mRNA (cDNA clone MGC:77500
            IMAGE:6524889), complete cds.
          Length = 777

 Score =  124 bits (312), Expect = 2e-27
 Identities = 82/247 (33%), Positives = 122/247 (49%), Gaps = 5/247 (2%)
 Frame = -1

Query: 864  PMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCV 685
            P+ ++ S+ VL++G WP        LP EL      F  FY S++SGR+L W   L    
Sbjct: 531  PLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYHLSKGE 590

Query: 684  LKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVR 505
            L     K R  L  S FQ  +L+ +N  + ++ Q + ++  I+   L + LQ L   K+ 
Sbjct: 591  LVTNCFKNRYTLQASTFQMAILLQYNTEDVYTVQQLTDSTQIKIDILVQVLQILLKSKLL 650

Query: 504  VLQKIPKGRD---VEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQY 334
            VL+      D    + D        +     R+ +N     E  +E  +T + + +DR+ 
Sbjct: 651  VLEDENANVDEVEFKPDTLIKLFLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKL 710

Query: 333  QVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKSNP 160
             + AAIVRIMK RKVL H  L+AE+  QL    KP    +KK I+ LI++EYLER     
Sbjct: 711  LIQAAIVRIMKMRKVLKHQQLLAEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEK 770

Query: 159  QIYNYLA 139
              Y+YLA
Sbjct: 771  DTYSYLA 777



>gb:BC034318_1981233 Homo sapiens cullin 1, mRNA (cDNA clone
           MGC:42937 IMAGE:4837378), complete cds.
          Length = 462

 Score =  124 bits (311), Expect = 2e-27
 Identities = 81/247 (32%), Positives = 122/247 (49%), Gaps = 5/247 (2%)
 Frame = -1

Query: 864 PMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCV 685
           P+ ++ S+ VL++G WP        LP EL      F  FY S++SGR+L W   L    
Sbjct: 216 PLDLDFSIQVLSSGSWPFQQFCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGE 275

Query: 684 LKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVR 505
           L     K R  L  S FQ  +L+ +N  + ++ Q + ++  I+   L + LQ L   K+ 
Sbjct: 276 LVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLL 335

Query: 504 VLQKIPKGRD---VEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQY 334
           VL+      D   ++ D        +     R+ +N     E  +E  +T + + +DR+ 
Sbjct: 336 VLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKL 395

Query: 333 QVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKSNP 160
            + AAIVRIMK RKVL H  L+ E+  QL    KP    +KK I+ LI++EYLER     
Sbjct: 396 LIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEK 455

Query: 159 QIYNYLA 139
             Y+YLA
Sbjct: 456 DTYSYLA 462



>gb:CR382123_1656277 Kluyveromyces lactis strain NRRL Y-1140
            chromosome C of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 735

 Score =  123 bits (309), Expect = 4e-27
 Identities = 79/257 (30%), Positives = 131/257 (50%), Gaps = 10/257 (3%)
 Frame = -1

Query: 882  QARTKLPMGIEMSVHVLTTGYWPTYPP---MDVRLPHELNVYQDIFKEFYLSKYSGRRLM 712
            Q   KL    ++SV+VLT  +WP        DV +P      ++ ++  Y   +SGR L 
Sbjct: 478  QKNGKLSKTRDISVNVLTNMFWPLQGSDMNRDVIVPDSFAAIRNEYENRYAKTHSGRLLE 537

Query: 711  WQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTL 532
            W   L    +  +F     EL++  F  ++ MLF E E  +F +I E   +  +E+R+ L
Sbjct: 538  WNYHLSTVEIAYQFRNSYHELSMPMFSGIIFMLFKEHESLTFDEIVELTNLPQQEVRKNL 597

Query: 531  QSLACG-KVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQM----KETVEENTS 367
             S++   K ++LQK P G+ + + D F  N  FTAP  ++KV  + M      T +   S
Sbjct: 598  ISMSVAPKTKILQKSPPGKSISNTDMFSINQGFTAPQRKVKVLMVLMNTRPNATNDSTRS 657

Query: 366  TTERVFQDRQYQV-DAAIVRIMKTRKVLSHTLLIAELFQQLK-FPIKPADLKKRIESLID 193
            + E+   D +  V +AA+ RIMK  + L H+ L  ++   +  F + P+  K  +E L++
Sbjct: 658  SVEKKLLDSRLSVINAAVTRIMKQDRKLYHSELQDKVALSIPLFEMSPSLFKMSLEYLLN 717

Query: 192  REYLERDKSNPQIYNYL 142
             EY++RD  N  +Y+YL
Sbjct: 718  NEYIQRDFDNTTMYHYL 734



>gb:BC045445_2549282 Danio rerio zgc:77500, mRNA (cDNA clone MGC:55747
            IMAGE:3816432), complete cds.
          Length = 777

 Score =  122 bits (307), Expect = 7e-27
 Identities = 81/247 (32%), Positives = 121/247 (48%), Gaps = 5/247 (2%)
 Frame = -1

Query: 864  PMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCV 685
            P+ ++ S+ VL++G WP        LP EL      F  FY S++SGR+L W   L    
Sbjct: 531  PLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYHLSKGE 590

Query: 684  LKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVR 505
            L     K R  L  S FQ  +L+ +N  + ++ Q + ++  I+   L + LQ L   K+ 
Sbjct: 591  LVTNCFKNRYTLQASTFQMAILLQYNTEDVYTVQQLTDSTQIKIDILVQVLQILLKSKLL 650

Query: 504  VLQKIPKGRD---VEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQY 334
            VL+      D    + D        +     R+ +N     E  +E  +T + + +DR+ 
Sbjct: 651  VLEDENANVDEVEFKPDTLIKLFLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKL 710

Query: 333  QVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKSNP 160
             + AAIVR MK RKVL H  L+AE+  QL    KP    +KK I+ LI++EYLER     
Sbjct: 711  LIQAAIVRTMKMRKVLKHQQLLAEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEK 770

Query: 159  QIYNYLA 139
              Y+YLA
Sbjct: 771  DTYSYLA 777



>gb:CR382130_1662827 Yarrowia lipolytica chromosome D of strain CLIB99
            of Yarrowia lipolytica.
          Length = 788

 Score =  120 bits (300), Expect = 5e-26
 Identities = 74/247 (29%), Positives = 127/247 (51%), Gaps = 8/247 (3%)
 Frame = -1

Query: 855  IEMSVHVLTTGYWPTYPPMD-VRLPHELNVYQDIFKEFYLSKYSGRRL--MWQNSLGHCV 685
            ++ S  ++  G WP     D  RLP++L    + F ++Y +K+ GR+L  +W  + G   
Sbjct: 544  VDFSPTIIAEGCWPLPSVKDGFRLPNDLTKTYEAFTQYYQAKHQGRKLKWLWNFTKGDVK 603

Query: 684  LKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVR 505
            +  +  K    +  S +Q  +L+ +N+A+  S  D++E  G+ +  L  +L  +   K  
Sbjct: 604  IHTKGSKIGYSVTASIYQIAILLAYNDADVLSVADLQEITGLSNTYLHGSLHLILKSKFL 663

Query: 504  VLQKI---PKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQY 334
            +++ +   PK  ++  +   VFN  F +   RI +N +   E   E   T + + +DR++
Sbjct: 664  LVEGVSGDPKDVELTPETRIVFNQDFKSKKIRININGVIKTEAKAEAEETKKAIEEDRKW 723

Query: 333  QVDAAIVRIMKTRKVLSHTLLIAELFQQLK--FPIKPADLKKRIESLIDREYLERDKSNP 160
             + A IVR+MK RK L HT L+ E   Q K  F  K  ++KK I+ LI+REYL R + + 
Sbjct: 724  FLQATIVRVMKARKTLKHTALVQETIVQSKKRFHPKIGEIKKVIDDLIEREYLTRIEQDK 783

Query: 159  QIYNYLA 139
              Y Y A
Sbjct: 784  --YEYAA 788



>gb:AFA5C11_1810866 Aspergillus fumigatus BAC AFA5C11.
          Length = 747

 Score =  119 bits (298), Expect = 8e-26
 Identities = 80/233 (34%), Positives = 123/233 (52%), Gaps = 6/233 (2%)
 Frame = -1

Query: 855  IEMSVHVLTTGYWPTYPPMD-VRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLK 679
            ++    +L TG+WP  PP      P E+    + F+ FY  K++GR+L W   L    +K
Sbjct: 518  VDAHFQILGTGFWPLNPPTTGFSAPPEIVKTYERFQSFYYDKHNGRKLTWLWQLCKGEVK 577

Query: 678  AEFPKGRK---ELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKV 508
            A + K  K      VS FQ  +L+LFNE +  ++ DI++A  +  + L   L  L   K 
Sbjct: 578  ANYIKNTKVPYTFQVSTFQMGILLLFNENDTLTYSDIQKATSLAPEILDPNLAILL--KA 635

Query: 507  RVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQV 328
            +VL   P+G   E   +F  N  F     + KV +    +T+EE          DR+  +
Sbjct: 636  KVLLPSPEGAKPEPGTSFSLNYNFKNKKIK-KVESDDTHKTIEE----------DRKLLL 684

Query: 327  DAAIVRIMKTRKVLSHTLLIAELFQQLK--FPIKPADLKKRIESLIDREYLER 175
             +AIVRIMK+RK + H  L+ E+ QQ+K  FP K  D+KK IE+L++++Y+ER
Sbjct: 685  QSAIVRIMKSRKKMKHVQLVQEVIQQVKSRFPPKVQDIKKNIEALMEKDYIER 737



>gb:AF236663_1779597 Aspergillus nidulans SCF complex protein cul-1
            homolog (culA) gene, partial cds.
          Length = 771

 Score =  119 bits (298), Expect = 8e-26
 Identities = 75/233 (32%), Positives = 122/233 (52%), Gaps = 6/233 (2%)
 Frame = -1

Query: 855  IEMSVHVLTTGYWP-TYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLK 679
            ++    +L TG+WP T P      P E+    + F++FY  K++ R+L W   L    LK
Sbjct: 537  VDSHFQILGTGFWPLTAPSTSFLAPPEIVKTSERFQKFYCDKHNRRKLTWLWQLCKGELK 596

Query: 678  AEFPKGRK---ELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKV 508
            A + K  K      VS +Q  +L+LFNE++  ++ DI++A  +  + L   L      K 
Sbjct: 597  ANYIKNTKVPYTFLVSTYQMGILLLFNESDTLTYSDIQKATTLTPEILDPNLSIFL--KA 654

Query: 507  RVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQV 328
            +VL   P+G     D TF  N  F     ++ +N     E   E     + + +DR+  +
Sbjct: 655  KVLNISPEGSKPGPDSTFSLNYNFKNKKIKVNLNIQIKSEQKVETDDPHKTIEEDRKLLL 714

Query: 327  DAAIVRIMKTRKVLSHTLLIAELFQQLK--FPIKPADLKKRIESLIDREYLER 175
             +AIVRIMK+RK + H  L+ E+  Q+K  FP +  D+KK IE+L++++Y+ER
Sbjct: 715  QSAIVRIMKSRKKMKHVQLVQEVIHQVKSRFPPQVPDIKKNIEALMEKDYIER 767



>pir|T20365|T20365 hypothetical protein D2045.6 - Caenorhabditis
            elegans
          Length = 772

 Score =  119 bits (298), Expect = 8e-26
 Identities = 78/245 (31%), Positives = 129/245 (52%), Gaps = 6/245 (2%)
 Frame = -1

Query: 855  IEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMW--QNSLGHCVL 682
            +E +V VL++G WPT+P   + LP +L+   +IF +FY  K++GRRL W    S G  + 
Sbjct: 530  VEFNVLVLSSGSWPTFPTTPITLPQQLSKTIEIFGQFYNEKFNGRRLTWVYSQSRGE-IT 588

Query: 681  KAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKV-R 505
               FPK +     +  Q   ++LFNE + ++ + I  A  +++K     + SL    V +
Sbjct: 589  STAFPK-KYVFTATTAQMCTMLLFNEQDSYTVEQIAAATKMDEKSAPAIVGSLIKNLVLK 647

Query: 504  VLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTER-VFQDRQYQV 328
               ++ K  +V    T   N  +     R+ ++   MK+    +T   ++ V +DR+  +
Sbjct: 648  ADTELQKEDEVPMTATVSLNKAYMNKKVRVDLSKFTMKQDAVRDTENVQKNVEEDRKSVI 707

Query: 327  DAAIVRIMKTRKVLSHTLLIAELFQQL--KFPIKPADLKKRIESLIDREYLERDKSNPQI 154
             A IVRIMKTRK + H  L+ E+  QL  +F  K   +K+ I SLI++EY+ R +    +
Sbjct: 708  SACIVRIMKTRKRVQHQQLMTEVITQLSGRFKPKVEMIKRCIGSLIEKEYMLRTEGQKDL 767

Query: 153  YNYLA 139
            Y YLA
Sbjct: 768  YEYLA 772



>sp|Q17389|CUL1_CAEEL Cullin 1 (Abnormal cell lineage 19
            protein).>gb:CED2045_1361800 Caenorhabditis elegans
            cosmid D2045, complete sequence.>gb:CEU58083_1368581
            Caenorhabditis elegans cul-1 mRNA, complete cds.
          Length = 780

 Score =  119 bits (298), Expect = 8e-26
 Identities = 78/245 (31%), Positives = 129/245 (52%), Gaps = 6/245 (2%)
 Frame = -1

Query: 855  IEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMW--QNSLGHCVL 682
            +E +V VL++G WPT+P   + LP +L+   +IF +FY  K++GRRL W    S G  + 
Sbjct: 538  VEFNVLVLSSGSWPTFPTTPITLPQQLSKTIEIFGQFYNEKFNGRRLTWVYSQSRGE-IT 596

Query: 681  KAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKV-R 505
               FPK +     +  Q   ++LFNE + ++ + I  A  +++K     + SL    V +
Sbjct: 597  STAFPK-KYVFTATTAQMCTMLLFNEQDSYTVEQIAAATKMDEKSAPAIVGSLIKNLVLK 655

Query: 504  VLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTER-VFQDRQYQV 328
               ++ K  +V    T   N  +     R+ ++   MK+    +T   ++ V +DR+  +
Sbjct: 656  ADTELQKEDEVPMTATVSLNKAYMNKKVRVDLSKFTMKQDAVRDTENVQKNVEEDRKSVI 715

Query: 327  DAAIVRIMKTRKVLSHTLLIAELFQQL--KFPIKPADLKKRIESLIDREYLERDKSNPQI 154
             A IVRIMKTRK + H  L+ E+  QL  +F  K   +K+ I SLI++EY+ R +    +
Sbjct: 716  SACIVRIMKTRKRVQHQQLMTEVITQLSGRFKPKVEMIKRCIGSLIEKEYMLRTEGQKDL 775

Query: 153  YNYLA 139
            Y YLA
Sbjct: 776  YEYLA 780



>gb:DRODMPR_1381914 Drosophila melanogaster homologue of C.elegans
            lin19 protein mRNA, complete cds.
          Length = 773

 Score =  118 bits (295), Expect = 2e-25
 Identities = 84/259 (32%), Positives = 127/259 (49%), Gaps = 5/259 (1%)
 Frame = -1

Query: 900  SFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGR 721
            S+ +   A   L M I+  + VL++G WP     +  LP EL      F EFY +++SGR
Sbjct: 517  SYFKQYLAEKNLTMEIDFGIEVLSSGSWPFQLSNNFLLPSELERSVRQFNEFYAARHSGR 576

Query: 720  RLMW--QNSLGHCVLKAEFPKGRK-ELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDK 550
            +L W  Q   G  ++           L  S FQ  VL+ FN+   F+ Q +++    + +
Sbjct: 577  KLNWLYQMCKGELIMNVNRNNSSTYTLQASTFQMSVLLQFNDQLSFTVQQLQDNTQTQQE 636

Query: 549  ELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENT 370
             L + LQ L   K +VL        +  + T      +     RI +N     E   E  
Sbjct: 637  NLIQVLQILL--KAKVLTSSDNENSLTPESTVELFLDYKNKKRRININQPLKTELKVEQE 694

Query: 369  STTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLI 196
            +  + + +DR+  + AAIVRIMK RK L+HT LI+E+  QL    KP    +KK I+ LI
Sbjct: 695  TVHKHIEEDRKLLIQAAIVRIMKMRKRLNHTNLISEVLNQLSTRFKPKVPVIKKCIDILI 754

Query: 195  DREYLERDKSNPQIYNYLA 139
            ++EYLER + +   Y+YLA
Sbjct: 755  EKEYLERMEGHKDTYSYLA 773



>gb:AE014134_1130056 Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE014134_1130057 Drosophila melanogaster
            chromosome 2L, complete sequence.>gb:AE003781_1224428
            Drosophila melanogaster chromosome 2L, section 80 of 83
            of the complete sequence.>gb:AE003781_1224429 Drosophila
            melanogaster chromosome 2L, section 80 of 83 of the
            complete sequence.>gb:AY061434_1293237 Drosophila
            melanogaster LD36177 full length cDNA.
          Length = 753

 Score =  118 bits (295), Expect = 2e-25
 Identities = 71/249 (28%), Positives = 128/249 (51%), Gaps = 4/249 (1%)
 Frame = -1

Query: 873  TKLPMGIEMSVHVLTTGYWP--TYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNS 700
            + + +GI +++ VL  G WP  +   +   +P E      +F+++Y   +SGR+L W + 
Sbjct: 509  SNVDLGINLAIKVLQAGAWPLGSTQVIPFAVPQEFEKSIKMFEDYYHKLFSGRKLTWLHH 568

Query: 699  LGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLA 520
            + H  LK    K    + +  +Q  +++LF   +  S ++I+  + + D+  ++ +Q + 
Sbjct: 569  MCHGELKLSHLKKSYIVTMQTYQMAIILLFETCDSLSCREIQNTLQLNDETFQKHMQPII 628

Query: 519  CGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDR 340
              K+          ++  +     N  +T    + K+++   KET +E   T   V +DR
Sbjct: 629  ESKLLNASS----ENLAGETRIELNLDYTNKRTKFKISSALQKETPQEVEHTINSVDEDR 684

Query: 339  QYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKS 166
            +  + AAIVRIMK RKVL H  LI E+    K    P  A +KK +ESLID++Y+ER  +
Sbjct: 685  KLFLQAAIVRIMKARKVLKHNALIQEVLSLSKVSFTPNIAMIKKCVESLIDKQYIERTAN 744

Query: 165  NPQIYNYLA 139
            +   Y+Y+A
Sbjct: 745  SGDEYSYMA 753



>sp|Q24311|CUL1_DROME Cullin homolog 1 (Lin-19 homolog
            protein).>gb:AE013599_1130529 Drosophila melanogaster
            chromosome 2R, complete sequence.>gb:AE013599_1130530
            Drosophila melanogaster chromosome 2R, complete
            sequence.>gb:AE013599_1130531 Drosophila melanogaster
            chromosome 2R, complete sequence.>gb:AE013599_1130532
            Drosophila melanogaster chromosome 2R, complete
            sequence.>gb:AE003839_1227159 Drosophila melanogaster
            chromosome 2R, section 11 of 74 of the complete
            sequence.>gb:AE003839_1227160 Drosophila melanogaster
            chromosome 2R, section 11 of 74 of the complete
            sequence.>gb:AE003839_1227161 Drosophila melanogaster
            chromosome 2R, section 11 of 74 of the complete
            sequence.>gb:AE003839_1227162 Drosophila melanogaster
            chromosome 2R, section 11 of 74 of the complete
            sequence.>gb:AF136343_1244011 Drosophila melanogaster
            Cul-1 (cul-1) mRNA, complete cds.>gb:BT010290_1357581
            Drosophila melanogaster LD20253 full insert cDNA.
          Length = 774

 Score =  118 bits (295), Expect = 2e-25
 Identities = 84/259 (32%), Positives = 127/259 (49%), Gaps = 5/259 (1%)
 Frame = -1

Query: 900  SFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGR 721
            S+ +   A   L M I+  + VL++G WP     +  LP EL      F EFY +++SGR
Sbjct: 518  SYFKQYLAEKNLTMEIDFGIEVLSSGSWPFQLSNNFLLPSELERSVRQFNEFYAARHSGR 577

Query: 720  RLMW--QNSLGHCVLKAEFPKGRK-ELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDK 550
            +L W  Q   G  ++           L  S FQ  VL+ FN+   F+ Q +++    + +
Sbjct: 578  KLNWLYQMCKGELIMNVNRNNSSTYTLQASTFQMSVLLQFNDQLSFTVQQLQDNTQTQQE 637

Query: 549  ELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENT 370
             L + LQ L   K +VL        +  + T      +     RI +N     E   E  
Sbjct: 638  NLIQVLQILL--KAKVLTSSDNENSLTPESTVELFLDYKNKKRRININQPLKTELKVEQE 695

Query: 369  STTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLI 196
            +  + + +DR+  + AAIVRIMK RK L+HT LI+E+  QL    KP    +KK I+ LI
Sbjct: 696  TVHKHIEEDRKLLIQAAIVRIMKMRKRLNHTNLISEVLNQLSTRFKPKVPVIKKCIDILI 755

Query: 195  DREYLERDKSNPQIYNYLA 139
            ++EYLER + +   Y+YLA
Sbjct: 756  EKEYLERMEGHKDTYSYLA 774



>gb:AF136441_2055946 Mus musculus cullin 1 (Cul1) mRNA, complete cds.
          Length = 774

 Score =  117 bits (292), Expect = 4e-25
 Identities = 76/245 (31%), Positives = 119/245 (48%), Gaps = 3/245 (1%)
 Frame = -1

Query: 864  PMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCV 685
            P+ ++ S+ VL++G WP        LP EL      F  FY S++SGR+L W   L    
Sbjct: 530  PLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGE 589

Query: 684  LKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVR 505
            L     K R  L  S FQ  +L+ +N  + ++ Q + ++  I+   L +  +        
Sbjct: 590  LVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVYRFTEVEIAG 649

Query: 504  VLQKIPK-GRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQV 328
            +  ++P   R ++ D        +     R+ +N     E  +E  +T + + +DR+  +
Sbjct: 650  LRDEMPMLMRWMKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLI 709

Query: 327  DAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKSNPQI 154
             AAIVRIMK RKVL H  L+ E+  QL    KP    +KK I+ LI++EYLER       
Sbjct: 710  QAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDT 769

Query: 153  YNYLA 139
            Y+YLA
Sbjct: 770  YSYLA 774



>gb:CR382135_1668247 Debaryomyces hansenii chromosome C of strain
            CBS767 of Debaryomyces hansenii.
          Length = 896

 Score =  117 bits (292), Expect = 4e-25
 Identities = 70/246 (28%), Positives = 131/246 (53%), Gaps = 40/246 (16%)
 Frame = -1

Query: 756  FKEFYLS--KYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLF--------- 610
            F+EF+ +  +   + L W    G   L+  +P    ++++S +  ++++LF         
Sbjct: 651  FEEFWFTNKRNDNKSLFWCPKFGSMDLRITYPTKTYDISMSTYAGIIMLLFAPQSTDADG 710

Query: 609  ------NEAEKFSFQDIKEAIGIEDKELRRTLQSLACG-KVRVLQKIPKGRDVEDDDTFV 451
                  +E  + ++ +I+E  GI + +L+R LQS+A   ++R+L KIP  ++V + D F 
Sbjct: 711  NEVLAFDEMRELAYDEIRELTGIPEADLKRQLQSIAVAPRLRLLVKIPMTKEVNNSDVFK 770

Query: 450  FNDQFTAPLYRIKVNAIQMKETVEENTSTTER--------------------VFQDRQYQ 331
             N++F +P  ++KV  +    +    T  +                      + + R+ +
Sbjct: 771  LNEKFKSPSTKVKVLTVSASSSASSGTKVSSTNDTTLAKTVQEEEFEELQSSILEGRKIE 830

Query: 330  VDAAIVRIMKTRKVLSHTLLIAELFQQL--KFPIKPADLKKRIESLIDREYLERDKSNPQ 157
            V+AAIVRIMK+R+ ++H  LI+EL +QL  +F      +K+RIE LI++EYL+RD ++  
Sbjct: 831  VNAAIVRIMKSRRTINHNDLISELVKQLHNRFQTLTILIKQRIEDLIEKEYLKRDDNDKS 890

Query: 156  IYNYLA 139
            IY+Y+A
Sbjct: 891  IYHYVA 896



>sp|Q21346|CUL6_CAEEL Cullin 6.>pir|T23474|T23474 hypothetical protein
            K08E7.7 - Caenorhabditis elegans>gb:CEK08E7_1365521
            Caenorhabditis elegans cosmid K08E7, complete sequence.
          Length = 729

 Score =  117 bits (292), Expect = 4e-25
 Identities = 79/249 (31%), Positives = 122/249 (48%), Gaps = 5/249 (2%)
 Frame = -1

Query: 870  KLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGH 691
            K    I+ +V + TTG WP+   + + LP EL+     F  FY + ++GRRL W  S   
Sbjct: 481  KTEKSIDFNVILQTTGAWPSLDQIKIILPRELSTILKEFDTFYNASHNGRRLNWAYSQCR 540

Query: 690  CVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSL--AC 517
              + ++  + +    V+  Q   L LFNE + F+ + I +AI +  K     + SL    
Sbjct: 541  GEVNSKAFEKKYVFIVTASQLCTLYLFNEQDSFTIEQISKAIEMTAKSTSAIVGSLNPVI 600

Query: 516  GKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQ-DR 340
              V V+ K  +      D     N ++     R+ +     K T +  T   +   + DR
Sbjct: 601  DPVLVVDKGNEKDGYPPDAVVSLNTKYANKKVRVDLTTAIKKATADRETDAVQNTVESDR 660

Query: 339  QYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKS 166
            +Y++ A IVRIMKTRK L+HTLLI E+  QLK    P    +K  IE LI++ Y+ R ++
Sbjct: 661  KYEIKACIVRIMKTRKSLTHTLLINEIISQLKSRFTPNVQMIKICIEILIEQLYIRRSEN 720

Query: 165  NPQIYNYLA 139
               +Y YLA
Sbjct: 721  EHNVYEYLA 729



>gb:AB016896_1513270 Schizosaccharomyces pombe pcu1+ gene for Pcu1,
            partial cds.
          Length = 767

 Score =  116 bits (291), Expect = 5e-25
 Identities = 80/257 (31%), Positives = 131/257 (50%), Gaps = 6/257 (2%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPP-MDVRLPHELNVYQDIFKEFYLSKYS 727
            E+F Q  Q+R      I+ S  VL T +WP  P  ++  LP EL    + F+ +Y S ++
Sbjct: 514  EAFWQLPQSRAG---NIDFSALVLGTSFWPLSPNNVNFHLPEELVPLYEGFQNYYYSCHN 570

Query: 726  GRRLMWQNSLGHCVLKAEFPKGRKE---LAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIE 556
            GR+L W   L    +KA             VS +Q  VL+L+N  + ++++++ +  G+ 
Sbjct: 571  GRKLSWLFHLSKGEIKARINPQTNVTYVFQVSTYQMGVLLLYNHRDSYTYEELAKITGLS 630

Query: 555  DKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEE 376
               L   L      KV +L    K  D   + T+  N+ F     R+++N     E  +E
Sbjct: 631  TDFLTGILNIFLKAKVLLLGDNDKLGD--PNSTYKINENFRMKKIRVQLNLPIRSEQKQE 688

Query: 375  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLK--FPIKPADLKKRIES 202
            +  T + + +DR+  + +AIVRIMK R+ L H +L+ E   Q+K  F  K +D+K+ I+ 
Sbjct: 689  SLETHKTIEEDRKLLLQSAIVRIMKARRTLKHVVLVKETIDQIKSRFTPKVSDIKQCIDM 748

Query: 201  LIDREYLERDKSNPQIY 151
            LI++EYLER   +  IY
Sbjct: 749  LIEKEYLERQGRDEYIY 765



>pir|T43398|T43398 SCF complex protein cul-1 - fission yeast
            (Schizosaccharomyces pombe) (fragment)
          Length = 767

 Score =  116 bits (291), Expect = 5e-25
 Identities = 80/257 (31%), Positives = 131/257 (50%), Gaps = 6/257 (2%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPP-MDVRLPHELNVYQDIFKEFYLSKYS 727
            E+F Q  Q+R      I+ S  VL T +WP  P  ++  LP EL    + F+ +Y S ++
Sbjct: 514  EAFWQLPQSRAG---NIDFSALVLGTSFWPLSPNNVNFHLPEELVPLYEGFQNYYYSCHN 570

Query: 726  GRRLMWQNSLGHCVLKAEFPKGRKE---LAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIE 556
            GR+L W   L    +KA             VS +Q  VL+L+N  + ++++++ +  G+ 
Sbjct: 571  GRKLSWLFHLSKGEIKARINPQTNVTYVFQVSTYQMGVLLLYNHRDSYTYEELAKITGLS 630

Query: 555  DKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEE 376
               L   L      KV +L    K  D   + T+  N+ F     R+++N     E  +E
Sbjct: 631  TDFLTGILNIFLKAKVLLLGDNDKLGD--PNSTYKINENFRMKKIRVQLNLPIRSEQKQE 688

Query: 375  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLK--FPIKPADLKKRIES 202
            +  T + + +DR+  + +AIVRIMK R+ L H +L+ E   Q+K  F  K +D+K+ I+ 
Sbjct: 689  SLETHKTIEEDRKLLLQSAIVRIMKARRTLKHVVLVKETIDQIKSRFTPKVSDIKQCIDM 748

Query: 201  LIDREYLERDKSNPQIY 151
            LI++EYLER   +  IY
Sbjct: 749  LIEKEYLERQGRDEYIY 765



>sp|O13790|CUL1_SCHPO Cullin 1 homolog (Cul-1) (Cell division control
            53 homolog).>pir|T37844|T37844 SCF complex protein cul-1
            SPAC17G6.12 [similarity] - fission yeast
            (Schizosaccharomyces pombe)>gb:SPAC17G6_1716757 S.pombe
            chromosome I cosmid c17G6.
          Length = 767

 Score =  116 bits (291), Expect = 5e-25
 Identities = 80/257 (31%), Positives = 131/257 (50%), Gaps = 6/257 (2%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPP-MDVRLPHELNVYQDIFKEFYLSKYS 727
            E+F Q  Q+R      I+ S  VL T +WP  P  ++  LP EL    + F+ +Y S ++
Sbjct: 514  EAFWQLPQSRAG---NIDFSALVLGTSFWPLSPNNVNFHLPEELVPLYEGFQNYYYSCHN 570

Query: 726  GRRLMWQNSLGHCVLKAEFPKGRKE---LAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIE 556
            GR+L W   L    +KA             VS +Q  VL+L+N  + ++++++ +  G+ 
Sbjct: 571  GRKLSWLFHLSKGEIKARINPQTNVTYVFQVSTYQMGVLLLYNHRDSYTYEELAKITGLS 630

Query: 555  DKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEE 376
               L   L      KV +L    K  D   + T+  N+ F     R+++N     E  +E
Sbjct: 631  TDFLTGILNIFLKAKVLLLGDNDKLGD--PNSTYKINENFRMKKIRVQLNLPIRSEQKQE 688

Query: 375  NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLK--FPIKPADLKKRIES 202
            +  T + + +DR+  + +AIVRIMK R+ L H +L+ E   Q+K  F  K +D+K+ I+ 
Sbjct: 689  SLETHKTIEEDRKLLLQSAIVRIMKARRTLKHVVLVKETIDQIKSRFTPKVSDIKQCIDM 748

Query: 201  LIDREYLERDKSNPQIY 151
            LI++EYLER   +  IY
Sbjct: 749  LIEKEYLERQGRDEYIY 765



>gb:CR380952_1650594 Candida glabrata strain CBS138 chromosome F
            complete sequence.
          Length = 757

 Score =  115 bits (287), Expect = 2e-24
 Identities = 78/267 (29%), Positives = 129/267 (48%), Gaps = 13/267 (4%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDV----RLPHELNVYQDIFKEFYLS 736
            E +K       +   G      +LT   WP   P  V    +LP  L   QD F+ FY +
Sbjct: 490  ELYKTFQNTTKEAVAGFMFKPQILTPTSWPFQAPDRVDPNFKLPETLQGIQDSFETFYTN 549

Query: 735  KYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIE 556
            KY+ R L W + L    +  +F K   E+ +  +   +  LF   +  +  +I++  G+ 
Sbjct: 550  KYNQRILKWSHHLSSIEVGYQFAKTYHEIHLPIYAASIFFLFENHDSLTKDEIQDMTGLP 609

Query: 555  DKELRRTLQSLACG-KVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAI-----QM 394
            D EL + L S+    + ++L K P  + +   DTF  N+ FTAP  ++K+  I       
Sbjct: 610  DVELDKLLLSMTTAPRSKILVKSPPSKIINSTDTFAINEDFTAPTTKVKLQMIIGVVQPN 669

Query: 393  KETVEEN-TSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQL--KFPIKPAD 223
              T E N  S  + V ++RQ   +AAIVR+MK+ + L  + L  +   QL  +F +  A 
Sbjct: 670  NGTGEPNKASIMDNVERERQEVTNAAIVRLMKSERHLQFSELQEKTAVQLAQRFTLSLAT 729

Query: 222  LKKRIESLIDREYLERDKSNPQIYNYL 142
             K  IE+LI++EY++RD  + +  +Y+
Sbjct: 730  FKACIETLIEKEYIQRDVDDHEFLHYI 756



>gb:AF144717_1244549 Dictyostelium discoideum CulB mRNA, complete cds.
          Length = 771

 Score =  114 bits (286), Expect = 2e-24
 Identities = 81/291 (27%), Positives = 142/291 (48%), Gaps = 36/291 (12%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMG-IEMSVHVLTTGYWPTYPPMDVRL-PHELNVYQDIFKEFYLSKY 730
            E FK +   +  L +G I+ S+ VLT+G W  +      + P EL +    F+++Y +++
Sbjct: 482  EEFK-NHLIKNSLSIGKIDFSILVLTSGSWSLHSQTSSFIVPQELTLCISAFQQYYSTQH 540

Query: 729  SGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDK 550
             GR+L W + L     K+ F K   +  V+ FQ  +L++FN  E  S ++I +   + + 
Sbjct: 541  QGRKLNWLHHLCKAEAKSFFAKKSYDFQVTNFQLGILLIFNTQESVSLEEITKFTNLNEN 600

Query: 549  ELRRTLQSLACGKVRVLQK--------------------------IPKGRDVEDDDT--- 457
            EL RTLQSL   K+ + +K                          +    +++   +   
Sbjct: 601  ELSRTLQSLIEAKILISKKKDQNSINNNNNNNNNNNNNGEGNNSLVDSANNMQPSSSSSS 660

Query: 456  ---FVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVL 286
               +  N  ++    ++KV++   KET  +N  T + + +DR+  + A+IVRIMK RK +
Sbjct: 661  TQEYTVNSAYSNKRSKVKVSSSLQKETPLQNEETYKGIDEDRKLYLQASIVRIMKARKTM 720

Query: 285  SHTLLIAELFQ--QLKFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
            +H  LI E+ +  +L+F      +KK IE LI++EY+ R +     Y Y A
Sbjct: 721  NHVSLIQEVIEHSRLRFQPNIPMIKKCIEQLIEKEYITRAEGESDRYLYAA 771



>gb:CR382127_1659676 Yarrowia lipolytica chromosome A of strain CLIB99
            of Yarrowia lipolytica.
          Length = 755

 Score =  114 bits (285), Expect = 3e-24
 Identities = 72/249 (28%), Positives = 135/249 (54%), Gaps = 11/249 (4%)
 Frame = -1

Query: 852  EMSVHVLTTGYWPTYPPMD--VRLPHELNVYQDIFKEFYLS--KYSGRRLMWQNSLGHCV 685
            +++V++L+   WP +P     +RLP ++    D F +F     K + +++ WQ++L  C 
Sbjct: 514  DLNVNMLSQNAWPQFPASTSPIRLPSQMYSQLDNFSKFLSQDPKNTKKKVTWQHALSSCT 573

Query: 684  LKAEFPKGRKELAVSFFQTVVLMLFNEAEK---FSFQDIKEAIGIEDKELRRTLQSLACG 514
            ++A   +  KE  VS  Q +V+M F + +K    +F D+  A GI ++EL  +L SL   
Sbjct: 574  IRAHLNEDTKEFDVSLHQALVMMQFVDEKKRPHMTFADLLAATGISERELTMSLHSLMTP 633

Query: 513  KVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQM--KETVEENTSTTERVFQDR 340
            KV++L K     +  D+  + FN  F++ L R+KV ++     + +  + +  + + +DR
Sbjct: 634  KVKILIK-----EEGDETRYKFNWNFSSKLRRVKVPSVARGADDIMLPHKAIQDTLERDR 688

Query: 339  QYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFP--IKPADLKKRIESLIDREYLERDKS 166
              ++ A I+RIMK R+ + H  L+ E+  + K    ++ AD+KK I  LI  +++ R   
Sbjct: 689  NMEIQAVIIRIMKARRTVGHAELVMEVLDKTKSRGILEVADVKKNISKLITDDFISR--Q 746

Query: 165  NPQIYNYLA 139
               +Y+Y+A
Sbjct: 747  GRDVYDYVA 755



>gb:AY449460_1327338 Oikopleura dioica clone BACOIKO004 7xk22,
            complete sequence.
          Length = 770

 Score =  114 bits (284), Expect = 3e-24
 Identities = 78/264 (29%), Positives = 128/264 (48%), Gaps = 9/264 (3%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSG 724
            E FK++ Q    + +GI+ SV +L+TG WP      + LP  L+    +FKE Y  K   
Sbjct: 509  EKFKKALQEEG-IELGIDFSVKLLSTGSWPLTKAFSMELPGVLSNSLRVFKEHYDKKNPR 567

Query: 723  RRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKEL 544
            R L W  S     + A +      L  S  Q  VL+LFN   + +  +I   + ++   +
Sbjct: 568  RTLTWLCSQSKGEITANYQSKNYVLVASTIQMAVLLLFNNENQLTVAEISRRLAVDSTLM 627

Query: 543  RRTLQSLACGKVRVLQKIPKGRDVE-------DDDTFVFNDQFTAPLYRIKVNAIQMKET 385
            ++ +  L   ++  L   P   + E        +D   +N  F     +I +N     E+
Sbjct: 628  QQVVLVLLKHQLLCLGPYPSLPETEGCDKLPGKEDLLSYNKDFFNKRTKITINVTYKIES 687

Query: 384  VEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPA--DLKKR 211
              E+  TT+ +  DR+  + AAIVRIMKTRK ++H+ L++E    L    KP+   +K  
Sbjct: 688  HAEDPVTTKNIEADRKLLIQAAIVRIMKTRKQVNHSTLMSETINHLASRFKPSVQKIKAC 747

Query: 210  IESLIDREYLERDKSNPQIYNYLA 139
            +E+LI++EY+ER      +Y Y+A
Sbjct: 748  VETLIEKEYIER-VDGKDVYIYVA 770



>gb:AE017356_1760306 Cryptococcus neoformans var. neoformans JEC21
            chromosome 14, complete sequence.
          Length = 775

 Score =  107 bits (268), Expect = 2e-22
 Identities = 73/242 (30%), Positives = 114/242 (47%), Gaps = 3/242 (1%)
 Frame = -1

Query: 855  IEMSVHVLTTGYWPTYPPM-DVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLK 679
            I+    VL +  WP +P   D  +P E+    D F  F+   + GR L W   +    L+
Sbjct: 544  IDFQPLVLGSNSWPLHPQQTDFAIPREIQALYDRFNAFHGEVHQGRTLNWLWHISKNELR 603

Query: 678  AEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVL 499
              +   +  L  S +Q  +L  FN ++  S++DI+    +    L+  L  L   K+++L
Sbjct: 604  TTYLNQKYILMTSAYQMAILTQFNVSDTLSYKDIEAGTKLSPTVLKPQLGLLV--KLKIL 661

Query: 498  QKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAA 319
                    +  ++ +  N  F +   R+ +N     E   E       V +DR++   A 
Sbjct: 662  --------LNTNEEYSLNTGFKSKKIRVNLNQTIKSEARAEQKEVIAAVDEDRKFVYQAT 713

Query: 318  IVRIMKTRKVLSHTLLIAELFQQL--KFPIKPADLKKRIESLIDREYLERDKSNPQIYNY 145
            IVR+MK RK + H  LI E+  Q+  KF  K  ++KK IE LID+EYLER   +   YNY
Sbjct: 714  IVRLMKGRKTMQHQALIQEVTAQISSKFTPKIPEIKKAIEYLIDKEYLERAPDSNNTYNY 773

Query: 144  LA 139
            LA
Sbjct: 774  LA 775



>gb:CR382135_1668101 Debaryomyces hansenii chromosome C of strain
            CBS767 of Debaryomyces hansenii.
          Length = 784

 Score =  103 bits (258), Expect = 3e-21
 Identities = 72/239 (30%), Positives = 124/239 (51%), Gaps = 11/239 (4%)
 Frame = -1

Query: 855  IEMSVHVLTTGYWPTYPPMD---VRLPHELNVYQDIFKEFYLS---KYSGRRLMWQN-SL 697
            ++ +  VL   +WP  P +D   + LP +L    D F   Y +   K   R L W +  L
Sbjct: 545  VDFTALVLEQKHWPEMPKLDSDIILLP-QLTTILDSFTALYHNSDEKLKNRTLDWSHYPL 603

Query: 696  GHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLAC 517
                +KA F  G KEL V+  Q +V++LFN+   +++ +I     I DK L++ L SL+ 
Sbjct: 604  HQLTIKANFDNGEKELDVNLLQAIVILLFNDKNSYTYDEIFALSNISDKLLKKVLGSLSS 663

Query: 516  GKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKE--TVEENTSTTERVFQD 343
             K R+L K        D+ T+ FN +FT    +IK+   + +E  T   ++  T+ + ++
Sbjct: 664  DKYRILLK--------DNATYSFNSKFTDKATKIKITLSKDREISTGLFDSDATKALERN 715

Query: 342  RQYQVDAAIVRIMKTRKVLSHTLLIAELFQ--QLKFPIKPADLKKRIESLIDREYLERD 172
            R  +  +A+VR+MK+ K +S+  L+ +     +   P   ADLK  +E LI+ E+++R+
Sbjct: 716  RSVEFRSALVRVMKSAKRISYLDLLTQTLPLVEKNGPCTIADLKSNLEYLIENEFVKRE 774



>gb:CR380956_1652387 Candida glabrata strain CBS138 chromosome J
            complete sequence.
          Length = 822

 Score =  103 bits (256), Expect = 6e-21
 Identities = 84/281 (29%), Positives = 138/281 (49%), Gaps = 30/281 (10%)
 Frame = -1

Query: 891  QSSQARTKLPMGIEMSVHVLTTGYWP-TYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRL 715
            QS  +R K P   E+   VL    WP +Y  +D RLP EL       +  Y+ K++GR L
Sbjct: 548  QSDYSREKFP---ELQPFVLAENMWPFSYQEVDFRLPEELVASHKKLESMYIGKHNGRIL 604

Query: 714  MWQNSLGHCVLKAEFPK-GRKELA--VSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKEL 544
             W   L    LKA+  K GR      V+ FQ  +L+LFN+ +  +F++I+E   +  + +
Sbjct: 605  KWLWPLCRGELKADIGKPGRVPFVFTVTLFQMSILLLFNDKDVLTFEEIQEGTNLNIQNI 664

Query: 543  RRTLQSLACGKVRVLQKIPKGRD--VEDDDTFVFNDQFTAPLYRIKVNAIQMKETV---- 382
              ++      K +++Q++P G D  V+ D  F  N  + A   +I   A    + +    
Sbjct: 665  ASSMVPFI--KFKLVQQLPPGLDNLVKGDTQFKLNRPYKAVKTQINFAAGVKNDILGTIS 722

Query: 381  --------------EENTSTTERVFQD----RQYQVDAAIVRIMKTRKVLSHTLLIAELF 256
                          +E  S +E++ ++    RQ  ++A IVRIMKT++ L H+ L+ E  
Sbjct: 723  KSSNSVSNGVSGISDEKLSESEKIEKELNAERQMFLEACIVRIMKTKRNLPHSTLVNECI 782

Query: 255  QQ--LKFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
             Q   +F  K + +K+ I+SLI + YL+R +   + Y YLA
Sbjct: 783  AQSHQRFKAKISMIKRAIDSLIQKGYLQRGEDG-ESYTYLA 822



>sp|Q17390|CUL2_CAEEL Cullin 2.
          Length = 776

 Score =  102 bits (255), Expect = 8e-21
 Identities = 72/252 (28%), Positives = 119/252 (47%), Gaps = 19/252 (7%)
 Frame = -1

Query: 837  VLTTGYWPTYPPM--------------DVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNS 700
            +L  G WP   P               +  LP  L      F++FY  K++GR+L W  +
Sbjct: 530  ILQAGSWPLNAPQLSTNSNNQTAQDVANFHLPRILQPVIQEFEKFYTGKHNGRKLTWLFN 589

Query: 699  LGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLA 520
            +    ++  +   +    +  +Q   L+ F   +    +DI E IG+    L +T++++ 
Sbjct: 590  MSQGDVRLTYLDKQYVAQMYVYQMAALLCFERRDAILVKDIGEEIGVSGDYLLKTIRTI- 648

Query: 519  CGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVE---ENTSTTERVF 349
               + V       +++  D     N   T+   + ++ A Q+ + VE   E  + T +V 
Sbjct: 649  ---LDVTLLTCDDQNLTADSLVRLNMSMTSKRMKFRLQAPQVNKAVEKEQEAVANTFQVS 705

Query: 348  QDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLER 175
            QDR+Y ++ AIVRIMKTRKVL H  L+ E+  Q K    P    +KK IE LI++ Y++R
Sbjct: 706  QDRKYYMECAIVRIMKTRKVLKHNALVTEIMDQTKGRFSPDVPFIKKSIEDLIEKMYIQR 765

Query: 174  DKSNPQIYNYLA 139
               N + Y YLA
Sbjct: 766  TDQNDE-YQYLA 776



>gb:CEZK520_1371638 Caenorhabditis elegans cosmid ZK520, complete
            sequence.
          Length = 774

 Score =  102 bits (254), Expect = 1e-20
 Identities = 71/250 (28%), Positives = 117/250 (46%), Gaps = 17/250 (6%)
 Frame = -1

Query: 837  VLTTGYWPTYPPM--------------DVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNS 700
            +L  G WP   P               +  LP  L      F++FY  K++GR+L W  +
Sbjct: 530  ILQAGSWPLNAPQLSTNSNNQTAQDVANFHLPRILQPVIQEFEKFYTGKHNGRKLTWLFN 589

Query: 699  LGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLA 520
            +    ++  +   +    +  +Q   L+ F   +    +DI E IG+    L +T++++ 
Sbjct: 590  MSQGDVRLTYLDKQYVAQMYVYQMAALLCFERRDAILVKDIGEEIGVSGDYLLKTIRTI- 648

Query: 519  CGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVE-ENTSTTERVFQD 343
               + V       +++  D     N   T+   + ++ A Q+ + VE E  +    V QD
Sbjct: 649  ---LDVTLLTCDDQNLTADSLVRLNMSMTSKRMKFRLQAPQVNKAVEKEQEAVANTVSQD 705

Query: 342  RQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDK 169
            R+Y ++ AIVRIMKTRKVL H  L+ E+  Q K    P    +KK IE LI++ Y++R  
Sbjct: 706  RKYYMECAIVRIMKTRKVLKHNALVTEIMDQTKGRFSPDVPFIKKSIEDLIEKMYIQRTD 765

Query: 168  SNPQIYNYLA 139
             N + Y YLA
Sbjct: 766  QNDE-YQYLA 774



>gb:CEZK520_1371637 Caenorhabditis elegans cosmid ZK520, complete
            sequence.
          Length = 791

 Score =  102 bits (254), Expect = 1e-20
 Identities = 71/250 (28%), Positives = 117/250 (46%), Gaps = 17/250 (6%)
 Frame = -1

Query: 837  VLTTGYWPTYPPM--------------DVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNS 700
            +L  G WP   P               +  LP  L      F++FY  K++GR+L W  +
Sbjct: 547  ILQAGSWPLNAPQLSTNSNNQTAQDVANFHLPRILQPVIQEFEKFYTGKHNGRKLTWLFN 606

Query: 699  LGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLA 520
            +    ++  +   +    +  +Q   L+ F   +    +DI E IG+    L +T++++ 
Sbjct: 607  MSQGDVRLTYLDKQYVAQMYVYQMAALLCFERRDAILVKDIGEEIGVSGDYLLKTIRTI- 665

Query: 519  CGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVE-ENTSTTERVFQD 343
               + V       +++  D     N   T+   + ++ A Q+ + VE E  +    V QD
Sbjct: 666  ---LDVTLLTCDDQNLTADSLVRLNMSMTSKRMKFRLQAPQVNKAVEKEQEAVANTVSQD 722

Query: 342  RQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDK 169
            R+Y ++ AIVRIMKTRKVL H  L+ E+  Q K    P    +KK IE LI++ Y++R  
Sbjct: 723  RKYYMECAIVRIMKTRKVLKHNALVTEIMDQTKGRFSPDVPFIKKSIEDLIEKMYIQRTD 782

Query: 168  SNPQIYNYLA 139
             N + Y YLA
Sbjct: 783  QNDE-YQYLA 791



>gb:CEZK520_1371636 Caenorhabditis elegans cosmid ZK520, complete
            sequence.
          Length = 850

 Score =  102 bits (254), Expect = 1e-20
 Identities = 71/250 (28%), Positives = 117/250 (46%), Gaps = 17/250 (6%)
 Frame = -1

Query: 837  VLTTGYWPTYPPM--------------DVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNS 700
            +L  G WP   P               +  LP  L      F++FY  K++GR+L W  +
Sbjct: 606  ILQAGSWPLNAPQLSTNSNNQTAQDVANFHLPRILQPVIQEFEKFYTGKHNGRKLTWLFN 665

Query: 699  LGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLA 520
            +    ++  +   +    +  +Q   L+ F   +    +DI E IG+    L +T++++ 
Sbjct: 666  MSQGDVRLTYLDKQYVAQMYVYQMAALLCFERRDAILVKDIGEEIGVSGDYLLKTIRTI- 724

Query: 519  CGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVE-ENTSTTERVFQD 343
               + V       +++  D     N   T+   + ++ A Q+ + VE E  +    V QD
Sbjct: 725  ---LDVTLLTCDDQNLTADSLVRLNMSMTSKRMKFRLQAPQVNKAVEKEQEAVANTVSQD 781

Query: 342  RQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDK 169
            R+Y ++ AIVRIMKTRKVL H  L+ E+  Q K    P    +KK IE LI++ Y++R  
Sbjct: 782  RKYYMECAIVRIMKTRKVLKHNALVTEIMDQTKGRFSPDVPFIKKSIEDLIEKMYIQRTD 841

Query: 168  SNPQIYNYLA 139
             N + Y YLA
Sbjct: 842  QNDE-YQYLA 850



>gb:AY071504_1295588 Drosophila melanogaster RE55959 full length cDNA.
          Length = 636

 Score =  100 bits (248), Expect = 5e-20
 Identities = 78/269 (28%), Positives = 132/269 (49%), Gaps = 19/269 (7%)
 Frame = -1

Query: 888  SSQARTKLPMGIEMSVHVLTTGYWPTYPP-MDVRLPHELNVYQDIFKEFYLSKYSGRRLM 712
            ++Q RT +     +++ +L  G W      + V LP EL  Y    +EFY  K+SGR+L 
Sbjct: 368  NTQFRTSISRHDAINIKILNAGAWARCSERVSVSLPIELEDYIPDVEEFYKKKHSGRKLQ 427

Query: 711  WQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEA--EKFSFQDIKEAIGIEDKELRR 538
            W + + +  +      GR +L V+ FQ  VL  +N+   +K S+++++ A  + D ELRR
Sbjct: 428  WYHHMSNGTITFVNNFGRYDLDVTTFQMAVLFAWNQRQHDKISYENLRLATELPDPELRR 487

Query: 537  TLQSLACG---KVRVLQKIPKG----RDVEDDDTFVFNDQFT-----APLYRIKVNAIQM 394
            TL SL      K ++L   P      +D  ++  F  N +F          R K+N I  
Sbjct: 488  TLWSLVAFPKIKKQILLMEPAAISSPKDFAENTMFYINQEFAIVKNGKSQRRGKLNLIGR 547

Query: 393  KE--TVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPAD- 223
             +  T        + + Q R  +   AI++IMK RK +++  L  EL   LK    P+  
Sbjct: 548  LQLSTERSQQEDNQSIVQLRILRTQEAIIKIMKVRKRMNNAALQGELIDILKNMFLPSKK 607

Query: 222  -LKKRIESLIDREYLERDKSNPQIYNYLA 139
             +K+++E LI+ +Y+ RD  +  ++ Y+A
Sbjct: 608  MIKEQLEWLIENKYMRRDDDDINMFIYVA 636



>gb:AE014297_1141905 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003768_1223898 Drosophila melanogaster
            chromosome 3R, section 106 of 118 of the complete
            sequence.
          Length = 852

 Score =  100 bits (248), Expect = 5e-20
 Identities = 78/269 (28%), Positives = 132/269 (49%), Gaps = 19/269 (7%)
 Frame = -1

Query: 888  SSQARTKLPMGIEMSVHVLTTGYWPTYPP-MDVRLPHELNVYQDIFKEFYLSKYSGRRLM 712
            ++Q RT +     +++ +L  G W      + V LP EL  Y    +EFY  K+SGR+L 
Sbjct: 584  NTQFRTSISRHDAINIKILNAGAWARCSERVSVSLPIELEDYIPDVEEFYKKKHSGRKLQ 643

Query: 711  WQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEA--EKFSFQDIKEAIGIEDKELRR 538
            W + + +  +      GR +L V+ FQ  VL  +N+   +K S+++++ A  + D ELRR
Sbjct: 644  WYHHMSNGTITFVNNFGRYDLDVTTFQMAVLFAWNQRQHDKISYENLRLATELPDPELRR 703

Query: 537  TLQSLACG---KVRVLQKIPKG----RDVEDDDTFVFNDQFT-----APLYRIKVNAIQM 394
            TL SL      K ++L   P      +D  ++  F  N +F          R K+N I  
Sbjct: 704  TLWSLVAFPKIKKQILLMEPAAISSPKDFAENTMFYINQEFAIVKNGKSQRRGKLNLIGR 763

Query: 393  KE--TVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPAD- 223
             +  T        + + Q R  +   AI++IMK RK +++  L  EL   LK    P+  
Sbjct: 764  LQLSTERSQQEDNQSIVQLRILRTQEAIIKIMKVRKRMNNAALQGELIDILKNMFLPSKK 823

Query: 222  -LKKRIESLIDREYLERDKSNPQIYNYLA 139
             +K+++E LI+ +Y+ RD  +  ++ Y+A
Sbjct: 824  MIKEQLEWLIENKYMRRDDDDINMFIYVA 852



>pir|T27884|T27884 hypothetical protein ZK520.4 - Caenorhabditis
            elegans
          Length = 728

 Score =  100 bits (248), Expect = 5e-20
 Identities = 66/220 (30%), Positives = 110/220 (50%), Gaps = 3/220 (1%)
 Frame = -1

Query: 789  LPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLF 610
            LP  L      F++FY  K++GR+L W  ++    ++  +   +    +  +Q   L+ F
Sbjct: 514  LPRILQPVIQEFEKFYTGKHNGRKLTWLFNMSQGDVRLTYLDKQYVAQMYVYQMAALLCF 573

Query: 609  NEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTA 430
               +    +DI E IG+    L +T++++    + V       +++  D     N   T+
Sbjct: 574  ERRDAILVKDIGEEIGVSGDYLLKTIRTI----LDVTLLTCDDQNLTADSLVRLNMSMTS 629

Query: 429  PLYRIKVNAIQMKETVE-ENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQ 253
               + ++ A Q+ + VE E  +    V QDR+Y ++ AIVRIMKTRKVL H  L+ E+  
Sbjct: 630  KRMKFRLQAPQVNKAVEKEQEAVANTVSQDRKYYMECAIVRIMKTRKVLKHNALVTEIMD 689

Query: 252  QLKFPIKP--ADLKKRIESLIDREYLERDKSNPQIYNYLA 139
            Q K    P    +KK IE LI++ Y++R   N + Y YLA
Sbjct: 690  QTKGRFSPDVPFIKKSIEDLIEKMYIQRTDQNDE-YQYLA 728



>pir|C88618|C88618 protein ZK520.4 [imported] - Caenorhabditis elegans
          Length = 745

 Score =  100 bits (248), Expect = 5e-20
 Identities = 66/220 (30%), Positives = 110/220 (50%), Gaps = 3/220 (1%)
 Frame = -1

Query: 789  LPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLF 610
            LP  L      F++FY  K++GR+L W  ++    ++  +   +    +  +Q   L+ F
Sbjct: 531  LPRILQPVIQEFEKFYTGKHNGRKLTWLFNMSQGDVRLTYLDKQYVAQMYVYQMAALLCF 590

Query: 609  NEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTA 430
               +    +DI E IG+    L +T++++    + V       +++  D     N   T+
Sbjct: 591  ERRDAILVKDIGEEIGVSGDYLLKTIRTI----LDVTLLTCDDQNLTADSLVRLNMSMTS 646

Query: 429  PLYRIKVNAIQMKETVE-ENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQ 253
               + ++ A Q+ + VE E  +    V QDR+Y ++ AIVRIMKTRKVL H  L+ E+  
Sbjct: 647  KRMKFRLQAPQVNKAVEKEQEAVANTVSQDRKYYMECAIVRIMKTRKVLKHNALVTEIMD 706

Query: 252  QLKFPIKP--ADLKKRIESLIDREYLERDKSNPQIYNYLA 139
            Q K    P    +KK IE LI++ Y++R   N + Y YLA
Sbjct: 707  QTKGRFSPDVPFIKKSIEDLIEKMYIQRTDQNDE-YQYLA 745



>gb:CEU58084_1368582 Caenorhabditis elegans cul-2 mRNA, complete cds.
          Length = 743

 Score = 99.8 bits (247), Expect = 7e-20
 Identities = 64/211 (30%), Positives = 109/211 (51%), Gaps = 5/211 (2%)
 Frame = -1

Query: 756  FKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDI 577
            F++FY  K++GR+L W  ++    ++  +   +    +  +Q   L+ F   +    +DI
Sbjct: 538  FEKFYTGKHNGRKLTWLFNMSQGDVRLTYLDKQHVAQMYVYQMAALLCFERRDAILVKDI 597

Query: 576  KEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQ 397
             E IG+    L +T++++    + V       +++  D     N   T+   + ++ A Q
Sbjct: 598  GEEIGVSGDYLLKTIRTI----LDVTLLTCDDQNLTADSLVRLNMSMTSKRMKFRLQAPQ 653

Query: 396  MKETVE---ENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP- 229
            + + VE   E  + T +V QDR+Y ++ AIVRIMKTRKVL H  L+ E+  Q K    P 
Sbjct: 654  VNKAVEKEQEAVANTFQVSQDRKYYMECAIVRIMKTRKVLKHNALVTEIMDQTKGRFSPD 713

Query: 228  -ADLKKRIESLIDREYLERDKSNPQIYNYLA 139
               +KK IE LI++ Y++R   N + Y YLA
Sbjct: 714  VPFIKKSIEDLIEKMYIQRTDQNDE-YQYLA 743



>gb:AF017061_1876725 Homo sapiens vasopressin-activated calcium
            mobilizing putative receptor protein (VACM-1) mRNA,
            complete cds.
          Length = 781

 Score = 99.4 bits (246), Expect = 9e-20
 Identities = 81/273 (29%), Positives = 135/273 (49%), Gaps = 18/273 (6%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWP-TYPPMDVRLPHELNVYQDIFKEFYLSKYS 727
            ++FK+  +          +++ +L  G W  +   + V LP EL       +EFY   +S
Sbjct: 509  QAFKEMHKNNKLALPADSVNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHS 568

Query: 726  GRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE--AEKFSFQDIKEAIGIED 553
            GR+L W + + + ++  +   G+ +L V+ FQ  VL  +N+   EK SF+++K A  + D
Sbjct: 569  GRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATELPD 628

Query: 552  KELRRTLQSLACG---KVRVL---QKIPKGRDVEDDDTFVFNDQFT-----APLYRIKVN 406
             ELRRTL SL      K +VL    ++   +D  +   F  N +F+         R K+N
Sbjct: 629  AELRRTLWSLVAFPKLKRQVLLYEPQVNSPKDFTEGTLFSVNQEFSLIKNAKVQKRGKIN 688

Query: 405  AIQMKETVEE--NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIK 232
             I   +   E       E + Q R  +   AI++IMK RK +S+  L  EL + LK    
Sbjct: 689  LIGRLQLTTERMREEENEGIVQLRILRTQEAIIQIMKMRKKISNAQLQTELVEILKNMFL 748

Query: 231  PAD--LKKRIESLIDREYLERDKSNPQIYNYLA 139
            P    +K++IE LI+ +Y+ RD+S+   + Y+A
Sbjct: 749  PQKKMIKEQIEWLIEHKYIRRDESDINTFIYMA 781



>gb:CEZK520_1371639 Caenorhabditis elegans cosmid ZK520, complete
            sequence.
          Length = 743

 Score = 99.4 bits (246), Expect = 9e-20
 Identities = 64/211 (30%), Positives = 109/211 (51%), Gaps = 5/211 (2%)
 Frame = -1

Query: 756  FKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDI 577
            F++FY  K++GR+L W  ++    ++  +   +    +  +Q   L+ F   +    +DI
Sbjct: 538  FEKFYTGKHNGRKLTWLFNMSQGDVRLTYLDKQYVAQMYVYQMAALLCFERRDAILVKDI 597

Query: 576  KEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQ 397
             E IG+    L +T++++    + V       +++  D     N   T+   + ++ A Q
Sbjct: 598  GEEIGVSGDYLLKTIRTI----LDVTLLTCDDQNLTADSLVRLNMSMTSKRMKFRLQAPQ 653

Query: 396  MKETVE---ENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKP- 229
            + + VE   E  + T +V QDR+Y ++ AIVRIMKTRKVL H  L+ E+  Q K    P 
Sbjct: 654  VNKAVEKEQEAVANTFQVSQDRKYYMECAIVRIMKTRKVLKHNALVTEIMDQTKGRFSPD 713

Query: 228  -ADLKKRIESLIDREYLERDKSNPQIYNYLA 139
               +KK IE LI++ Y++R   N + Y YLA
Sbjct: 714  VPFIKKSIEDLIEKMYIQRTDQNDE-YQYLA 743



>gb:CR858821_1182969 Pongo pygmaeus mRNA; cDNA DKFZp469O0710 (from
            clone DKFZp469O0710).
          Length = 780

 Score = 99.4 bits (246), Expect = 9e-20
 Identities = 81/273 (29%), Positives = 135/273 (49%), Gaps = 18/273 (6%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWP-TYPPMDVRLPHELNVYQDIFKEFYLSKYS 727
            ++FK+  +          +++ +L  G W  +   + V LP EL       +EFY   +S
Sbjct: 508  QAFKEMHKNNKLALPADSVNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHS 567

Query: 726  GRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE--AEKFSFQDIKEAIGIED 553
            GR+L W + + + ++  +   G+ +L V+ FQ  VL  +N+   EK SF+++K A  + D
Sbjct: 568  GRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATELPD 627

Query: 552  KELRRTLQSLACG---KVRVL---QKIPKGRDVEDDDTFVFNDQFT-----APLYRIKVN 406
             ELRRTL SL      K +VL    ++   +D  +   F  N +F+         R K+N
Sbjct: 628  AELRRTLWSLVAFPKLKRQVLLYEPQVNSPKDFTEGTLFSVNQEFSLIKNAKVQKRGKIN 687

Query: 405  AIQMKETVEE--NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIK 232
             I   +   E       E + Q R  +   AI++IMK RK +S+  L  EL + LK    
Sbjct: 688  LIGRLQLTTERMREEENEGIVQLRILRTQEAIIQIMKMRKKISNAQLQTELVEILKNMFL 747

Query: 231  PAD--LKKRIESLIDREYLERDKSNPQIYNYLA 139
            P    +K++IE LI+ +Y+ RD+S+   + Y+A
Sbjct: 748  PQKKMIKEQIEWLIEHKYIRRDESDINTFIYMA 780



>sp|Q93034|CUL5_HUMAN Cullin homolog 5 (CUL-5) (Vasopressin-activated
            calcium-mobilizing receptor)
            (VACM-1).>gb:AF327710_1896905 Homo sapiens cullin 5 mRNA,
            complete cds.>gb:BC063306_1986145 Homo sapiens cullin 5,
            mRNA (cDNA clone MGC:71728 IMAGE:30331132), complete cds.
          Length = 780

 Score = 99.4 bits (246), Expect = 9e-20
 Identities = 81/273 (29%), Positives = 135/273 (49%), Gaps = 18/273 (6%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWP-TYPPMDVRLPHELNVYQDIFKEFYLSKYS 727
            ++FK+  +          +++ +L  G W  +   + V LP EL       +EFY   +S
Sbjct: 508  QAFKEMHKNNKLALPADSVNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHS 567

Query: 726  GRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE--AEKFSFQDIKEAIGIED 553
            GR+L W + + + ++  +   G+ +L V+ FQ  VL  +N+   EK SF+++K A  + D
Sbjct: 568  GRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATELPD 627

Query: 552  KELRRTLQSLACG---KVRVL---QKIPKGRDVEDDDTFVFNDQFT-----APLYRIKVN 406
             ELRRTL SL      K +VL    ++   +D  +   F  N +F+         R K+N
Sbjct: 628  AELRRTLWSLVAFPKLKRQVLLYEPQVNSPKDFTEGTLFSVNQEFSLIKNAKVQKRGKIN 687

Query: 405  AIQMKETVEE--NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIK 232
             I   +   E       E + Q R  +   AI++IMK RK +S+  L  EL + LK    
Sbjct: 688  LIGRLQLTTERMREEENEGIVQLRILRTQEAIIQIMKMRKKISNAQLQTELVEILKNMFL 747

Query: 231  PAD--LKKRIESLIDREYLERDKSNPQIYNYLA 139
            P    +K++IE LI+ +Y+ RD+S+   + Y+A
Sbjct: 748  PQKKMIKEQIEWLIEHKYIRRDESDINTFIYMA 780



>gb:HSVACM1_2027971 H.sapiens mRNA for for vasopressin activated
            calcium mobilizing receptor-like protein.
          Length = 780

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 79/273 (28%), Positives = 132/273 (48%), Gaps = 18/273 (6%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWP-TYPPMDVRLPHELNVYQDIFKEFYLSKYS 727
            ++FK+  +          +++ +L  G W  +   + V LP EL       +EFY   +S
Sbjct: 508  QAFKEMHKNNKLALPADSVNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHS 567

Query: 726  GRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE--AEKFSFQDIKEAIGIED 553
            GR+L W + + + ++  +   G+ +L V+ FQ  VL  +N+   EK SF+++K A  + D
Sbjct: 568  GRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATELPD 627

Query: 552  KELRRTLQSLACGKVRVLQ------KIPKGRDVEDDDTFVFNDQFT-----APLYRIKVN 406
             ELRRTL SL        Q      ++   +D  +   F  N +F+         R K+N
Sbjct: 628  AELRRTLWSLVAFPKLKRQVFLYDPQVNSPKDFTEGTLFSVNQEFSLIKNAKVQKRGKIN 687

Query: 405  AIQMKETVEE--NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIK 232
             I   +   E       E + Q R  +   AI++IMK RK +S+  L  EL + LK    
Sbjct: 688  LIGRLQLTTERMREEENEGIVQLRILRTQEAIIQIMKMRKKISNAQLQTELVEILKNMFL 747

Query: 231  PAD--LKKRIESLIDREYLERDKSNPQIYNYLA 139
            P    +K++IE LI+ +Y+ RD+S+   + Y+A
Sbjct: 748  PQKKMIKEQIEWLIEHKYIRRDESDINTFIYMA 780



>sp|Q9JJ31|CUL5_RAT Cullin homolog 5 (CUL-5) (Vasopressin-activated
            calcium-mobilizing receptor)
            (VACM-1).>gb:AF135115_2055909 Rattus norvegicus
            vasopressin-activated calcium-mobilizing receptor protein
            mRNA, complete cds.
          Length = 780

 Score = 97.4 bits (241), Expect = 3e-19
 Identities = 80/273 (29%), Positives = 134/273 (49%), Gaps = 18/273 (6%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWP-TYPPMDVRLPHELNVYQDIFKEFYLSKYS 727
            ++FK+  +          +++ +L  G W  +   + V LP EL       +EFY   +S
Sbjct: 508  QAFKEMHKNNKLALPADSVNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHS 567

Query: 726  GRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE--AEKFSFQDIKEAIGIED 553
            GR+L W + + + ++  +   G+ +L V+ FQ  VL  +N+   EK SF+++K A  + D
Sbjct: 568  GRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATELPD 627

Query: 552  KELRRTLQSLACG---KVRVL---QKIPKGRDVEDDDTFVFNDQFT-----APLYRIKVN 406
             ELRRTL SL      K +VL    ++   +D  +   F  N  F+         R K+N
Sbjct: 628  AELRRTLWSLVAFPKLKRQVLLYDPQVNSPKDFTEGTLFSVNQDFSLIKNAKVQKRGKIN 687

Query: 405  AIQMKETVEE--NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIK 232
             I   +   E       E + Q R  +   AI++IMK RK +S+  L  EL + LK    
Sbjct: 688  LIGRLQLTTERMREEENEGIVQLRILRTQEAIIQIMKMRKKISNAQLQTELVEILKNMFL 747

Query: 231  PAD--LKKRIESLIDREYLERDKSNPQIYNYLA 139
            P    +K++IE LI+ +Y+ RD+++   + Y+A
Sbjct: 748  PQKKMIKEQIEWLIEHKYIRRDEADINTFIYMA 780



>gb:AK038873_1165202 Mus musculus adult male hypothalamus cDNA,
           RIKEN full-length enriched library, clone:A230070I21
           product:VASOPRESSIN-ACTIVATED CALCIUM-MOBILIZING
           RECEPTOR (VACM-1) (CULLIN HOMOLOG 5) (CUL-5) homolog
           [Rattus norvegicus], full insert sequence.
          Length = 340

 Score = 95.9 bits (237), Expect = 9e-19
 Identities = 79/273 (28%), Positives = 133/273 (48%), Gaps = 18/273 (6%)
 Frame = -1

Query: 903 ESFKQSSQARTKLPMGIEMSVHVLTTGYWP-TYPPMDVRLPHELNVYQDIFKEFYLSKYS 727
           ++FK+  +          +++ +L  G W  +   + V LP EL       +EFY   +S
Sbjct: 68  QAFKEMHKNNKLALPADSVNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHS 127

Query: 726 GRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE--AEKFSFQDIKEAIGIED 553
           GR+L W + + + ++  +   G+ +L V+ FQ  VL  +N+   EK SF+++K A  + D
Sbjct: 128 GRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATELPD 187

Query: 552 KELRRTLQSLACG---KVRVL---QKIPKGRDVEDDDTFVFNDQFT-----APLYRIKVN 406
            ELRRTL SL      K +VL    ++   +D  +   F  N  F+         R K+N
Sbjct: 188 AELRRTLWSLVAFPKLKRQVLLYDPQVNSPKDFTEGTLFSVNQDFSLIKNAKVQKRGKIN 247

Query: 405 AIQMKETVEE--NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIK 232
            I   +   E       E + Q R  +   AI++IMK RK +S+  L  EL + LK    
Sbjct: 248 LIGRLQLTTERMREEENEGIVQLRILRTQEAIIQIMKMRKKISNAQLQTELVEILKNMFL 307

Query: 231 PAD--LKKRIESLIDREYLERDKSNPQIYNYLA 139
           P    +K+++E LI+  Y+ RD+++   + Y+A
Sbjct: 308 PQKKMIKEQMEWLIEHRYIRRDEADINTFIYMA 340



>sp|Q9D5V5|CUL5_MOUSE Cullin homolog 5 (CUL-5).>gb:AK014894_1158184
            Mus musculus adult male testis cDNA, RIKEN full-length
            enriched library, clone:4921514I20
            product:VASOPRESSIN-ACTIVATED CALCIUM-MOBILIZING RECEPTOR
            (VACM-1) (CULLIN HOMOLOG 5) (CUL-5) homolog [Rattus
            norvegicus], full insert sequence.>gb:AK046030_1167622
            Mus musculus adult male corpora quadrigemina cDNA, RIKEN
            full-length enriched library, clone:B230334O19
            product:VASOPRESSIN-ACTIVATED CALCIUM-MOBILIZING RECEPTOR
            (VACM-1) (CULLIN HOMOLOG 5) (CUL-5) homolog [Rattus
            norvegicus], full insert sequence.>gb:BC075710_2106725
            Mus musculus cullin 5, mRNA (cDNA clone MGC:78070
            IMAGE:6312416), complete cds.
          Length = 780

 Score = 95.9 bits (237), Expect = 9e-19
 Identities = 79/273 (28%), Positives = 133/273 (48%), Gaps = 18/273 (6%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWP-TYPPMDVRLPHELNVYQDIFKEFYLSKYS 727
            ++FK+  +          +++ +L  G W  +   + V LP EL       +EFY   +S
Sbjct: 508  QAFKEMHKNNKLALPADSVNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHS 567

Query: 726  GRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE--AEKFSFQDIKEAIGIED 553
            GR+L W + + + ++  +   G+ +L V+ FQ  VL  +N+   EK SF+++K A  + D
Sbjct: 568  GRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATELPD 627

Query: 552  KELRRTLQSLACG---KVRVL---QKIPKGRDVEDDDTFVFNDQFT-----APLYRIKVN 406
             ELRRTL SL      K +VL    ++   +D  +   F  N  F+         R K+N
Sbjct: 628  AELRRTLWSLVAFPKLKRQVLLYDPQVNSPKDFTEGTLFSVNQDFSLIKNAKVQKRGKIN 687

Query: 405  AIQMKETVEE--NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIK 232
             I   +   E       E + Q R  +   AI++IMK RK +S+  L  EL + LK    
Sbjct: 688  LIGRLQLTTERMREEENEGIVQLRILRTQEAIIQIMKMRKKISNAQLQTELVEILKNMFL 747

Query: 231  PAD--LKKRIESLIDREYLERDKSNPQIYNYLA 139
            P    +K+++E LI+  Y+ RD+++   + Y+A
Sbjct: 748  PQKKMIKEQMEWLIEHRYIRRDEADINTFIYMA 780



>gb:AE016817_1747490 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome IV, complete sequence.
          Length = 798

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 75/255 (29%), Positives = 125/255 (49%), Gaps = 17/255 (6%)
 Frame = -1

Query: 852  EMSVHVLTTGYWP-TYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA 676
            E    VL    WP  Y  ++ +LP EL        + Y+ K+SGR L W   L    L+A
Sbjct: 547  EFQPFVLAETMWPFPYQEVEFKLPQELVAEHQKLVDLYVKKHSGRVLKWLWPLSRSELRA 606

Query: 675  EFPK-GRK--ELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVR 505
            +  + GR      V+ FQ  +L++FNE +  SF+ I+E   +  + +   L  L   K++
Sbjct: 607  DIGRPGRPPFHFTVTLFQMAILLMFNENDTLSFEQIQEGTNLTTQHI--ILSMLPFIKMK 664

Query: 504  VLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVN-AIQMKETVE----------ENTSTTE 358
            +L + P G +        +       L + KVN A  +K  V           ++ +  +
Sbjct: 665  LLHQSPPGLESMGLLGTQYKLNLPYKLAKSKVNFAAGVKGDVSLSGSGKADNMDSDNINK 724

Query: 357  RVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQ--LKFPIKPADLKKRIESLIDREY 184
             + ++RQ  ++A IVRIMK ++V+SH  L+ E   +   +F  K + +KK I++LI +EY
Sbjct: 725  ELNKERQLFLEACIVRIMKAKRVVSHATLVNECIAESHQRFNAKVSLIKKAIDNLISKEY 784

Query: 183  LERDKSNPQIYNYLA 139
            L+R +   + Y YLA
Sbjct: 785  LQRSRDG-ESYEYLA 798



>gb:CR382136_1669315 Debaryomyces hansenii chromosome D of strain
            CBS767 of Debaryomyces hansenii.
          Length = 782

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 68/243 (27%), Positives = 124/243 (51%), Gaps = 10/243 (4%)
 Frame = -1

Query: 837  VLTTGYWPTYPPMD---VRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFP 667
            +L    WP +  +D   ++L  EL    +  +E Y  K++GR+L W  + G   +KA   
Sbjct: 545  ILAQSMWP-FKHLDDYKLKLAPELMPSFNKVQEIYNKKHTGRQLQWLWNHGKSEVKANLS 603

Query: 666  KGRKE---LAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQ 496
            +  K      VS  Q ++L+ FN++  FSF+++ + +G+        L  L   K +++ 
Sbjct: 604  RKGKPPFLFTVSNVQLMILLAFNKSNTFSFKELFDTVGVAKHTFEAHL--LPFTKYKLID 661

Query: 495  KIPKGRDV--EDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDA 322
            + P G ++  +DD  F   +++ +   R+   +    E  +E  +T + + + R+  + A
Sbjct: 662  QSPPGAELFNKDDTKFTIVEEYKSKKLRVNFVSSIKTEQKQEEENTNKEIDESRRNYLSA 721

Query: 321  AIVRIMKTRKVLSHTLLIAELFQQ--LKFPIKPADLKKRIESLIDREYLERDKSNPQIYN 148
             IVRIMK RK + H  L+ ++  Q   +F  K  D+K+ I+ LI++EYL R  ++   Y 
Sbjct: 722  CIVRIMKARKQMKHNELVNDVATQSLSRFRAKIIDIKRVIDYLIEKEYLRRIDND--TYE 779

Query: 147  YLA 139
            YLA
Sbjct: 780  YLA 782



>sp|Q29425|CUL5_RABIT Cullin homolog 5 (CUL-5) (Vasopressin-activated
            calcium-mobilizing receptor) (VACM-1).>pir|I47038|I47038
            vasopressin-activated calcium-mobilizing protein VACM-1 -
            rabbit>gb:OCU30380_1442577 Oryctolagus cuniculus
            vasopressin-activated calcium-mobilizing protein mRNA,
            complete cds.
          Length = 780

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 79/273 (28%), Positives = 133/273 (48%), Gaps = 18/273 (6%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWP-TYPPMDVRLPHELNVYQDIFKEFYLSKYS 727
            ++FK+  +          +++ +L  G W  +   + V LP EL       +EFY   +S
Sbjct: 508  QAFKEMHKNNKLALPADSVNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHS 567

Query: 726  GRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE--AEKFSFQDIKEAIGIED 553
            GR+L W + + + ++  +   G+ +L V+ FQ  VL  +N+   EK SF+++K A  + D
Sbjct: 568  GRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATELPD 627

Query: 552  KELRRTLQSLACG---KVRVL---QKIPKGRDVEDDDTFVFNDQFT-----APLYRIKVN 406
             ELRRTL SL      K +VL    ++   +D  +   F  N +F+         R K+N
Sbjct: 628  AELRRTLWSLVAFPKLKRQVLLYEPQVNSPKDFTEGTLFSVNQEFSLIKNAKVQKRGKIN 687

Query: 405  AIQMKETVEE--NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIK 232
             I   +   E       E + Q R  +     ++IMK RK +S+  L  EL + LK    
Sbjct: 688  LIGRLQLTTERMREEENEGIVQLRILRTRKLYIQIMKMRKKISNAQLQTELVEILKNMFL 747

Query: 231  PAD--LKKRIESLIDREYLERDKSNPQIYNYLA 139
            P    +K++IE LI+ +Y+ RD+S+   + Y+A
Sbjct: 748  PQKKMIKEQIEWLIEHKYIRRDESDINTFIYMA 780



>gb:AK031955_1162664 Mus musculus adult male medulla oblongata cDNA,
            RIKEN full-length enriched library, clone:6330509I08
            product:VASOPRESSIN-ACTIVATED CALCIUM-MOBILIZING RECEPTOR
            (VACM-1) (CULLIN HOMOLOG 5) (CUL-5) homolog [Rattus
            norvegicus], full insert sequence.
          Length = 780

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 78/273 (28%), Positives = 132/273 (48%), Gaps = 18/273 (6%)
 Frame = -1

Query: 903  ESFKQSSQARTKLPMGIEMSVHVLTTGYWP-TYPPMDVRLPHELNVYQDIFKEFYLSKYS 727
            ++FK+  +          +++ +L  G W  +   + V LP EL       +EFY   +S
Sbjct: 508  QAFKEMHKNNKLALPADSVNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHS 567

Query: 726  GRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNE--AEKFSFQDIKEAIGIED 553
            GR+L   + + + ++  +   G+ +L V+ FQ  VL  +N+   EK SF+++K A  + D
Sbjct: 568  GRKLHCHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATELPD 627

Query: 552  KELRRTLQSLACG---KVRVL---QKIPKGRDVEDDDTFVFNDQFT-----APLYRIKVN 406
             ELRRTL SL      K +VL    ++   +D  +   F  N  F+         R K+N
Sbjct: 628  AELRRTLWSLVAFPKLKRQVLLYDPQVNSPKDFTEGTLFSVNQDFSLIKNAKVQKRGKIN 687

Query: 405  AIQMKETVEE--NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIK 232
             I   +   E       E + Q R  +   AI++IMK RK +S+  L  EL + LK    
Sbjct: 688  LIGRLQLTTERMREEENEGIVQLRILRTQEAIIQIMKMRKKISNAQLQTELVEILKNMFL 747

Query: 231  PAD--LKKRIESLIDREYLERDKSNPQIYNYLA 139
            P    +K+++E LI+  Y+ RD+++   + Y+A
Sbjct: 748  PQKKMIKEQMEWLIEHRYIRRDEADINTFIYMA 780



>gb:CR382126_1658592 Kluyveromyces lactis strain NRRL Y-1140
            chromosome F of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 812

 Score = 90.1 bits (222), Expect = 5e-17
 Identities = 74/269 (27%), Positives = 128/269 (47%), Gaps = 23/269 (8%)
 Frame = -1

Query: 876  RTKLPMGIEMSVHVLTTGYWP-TYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNS 700
            R+K+P   E+   +L    WP +Y P +  LP  L   ++  +  Y  K+SGR L W   
Sbjct: 550  RSKVP---ELEPLILADNVWPFSYQPTEFALPPVLEHSKNKLETMYTDKHSGRILKWLWP 606

Query: 699  LGHCVLKAEFPKGRK---ELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQ 529
            +    +KA   K  K   +  V+ FQ  +L LFN+    +F+ I+E   ++  ++   + 
Sbjct: 607  MSRGEIKAHIGKPGKPPFQFTVTIFQMAILTLFNDISTLTFEQIQERTNLKATQIASNMY 666

Query: 528  SLACGKVRVLQKIPKGRD--VEDDDTFVFND---------QFTAPL-----YRIKVNAIQ 397
                 K+++L + P+G +  ++ D  +  N           F A +     +   VN   
Sbjct: 667  PFV--KMKLLIQSPEGVESMIKLDTKYTLNKPYRLSKTSVNFAAAVKNDLTFTATVNGSA 724

Query: 396  MKET-VEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELF--QQLKFPIKPA 226
            + ET   E     + + Q R   + A IVRIMK ++ L H+ L+ E     Q +F  K +
Sbjct: 725  LDETEASEQKKAEKELNQQRLMFLRACIVRIMKAKRKLPHSSLMNECIAESQQRFNAKVS 784

Query: 225  DLKKRIESLIDREYLERDKSNPQIYNYLA 139
             +KK +++LI++EYL+R   + + Y YLA
Sbjct: 785  MIKKAVDNLIEQEYLKR-TDDGECYEYLA 812



>gb:AE014296_1136092 Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE003539_1214588 Drosophila melanogaster
            chromosome 3L, section 46 of 83 of the complete
            sequence.>gb:AY069566_1294296 Drosophila melanogaster
            LD29662 full length cDNA.
          Length = 670

 Score = 90.1 bits (222), Expect = 5e-17
 Identities = 74/230 (32%), Positives = 123/230 (53%), Gaps = 6/230 (2%)
 Frame = -1

Query: 813  TYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQ--NSLGHCVLKAEFPKGRKELAVS 640
            ++   ++ LP EL      F+ FY ++    + + Q  N L    +     +    L VS
Sbjct: 453  SFENFNLTLPDELQQAWKEFRIFYEARKLQSKAIIQLNNELSSGEITCHLNQSVYILEVS 512

Query: 639  FFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDD 460
              Q  VLMLFN  E+F+ Q++  A+G+E + L+  L+ +   K  V  ++ K   +E   
Sbjct: 513  TLQMAVLMLFNRHERFTEQELVTALGVELETLQEALKQI---KFLVYIEVNKVNYIE--- 566

Query: 459  TFVFNDQFTAPLYRIKVNAIQMKET--VEENTSTTERVFQDRQYQVDAAIVRIMKTRKVL 286
                N  FT    R+  N    ++   +EE +    ++ +D+Q  VDAAIVRIMK +K L
Sbjct: 567  ---INMDFTNRKRRLFCNEPLPRKMRKIEEKSEIELKIRRDKQ--VDAAIVRIMKGQKQL 621

Query: 285  SHTLLIAELFQQLKFPIKP--ADLKKRIESLIDREYLERDKSNPQIYNYL 142
             ++ LI+ ++++LK  +KP  + +KKR++ L++REYLERD +   IY YL
Sbjct: 622  EYSELISLVYEELKDRVKPQVSFIKKRLDYLVEREYLERD-NYYNIYRYL 670



>sp|P53202|CUL3_YEAST Cullin B.>pir|S64292|S64292 hypothetical protein
            YGR003w - yeast (Saccharomyces
            cerevisiae)>gb:AY387706_1604298 Saccharomyces cerevisiae
            ubiquitin ligase Cul3 (CUL3) gene, complete
            cds.>gb:SCYGR003W_1712203 S.cerevisiae chromosome VII
            reading frame ORF YGR003w.
          Length = 744

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 66/251 (26%), Positives = 124/251 (49%), Gaps = 12/251 (4%)
 Frame = -1

Query: 855  IEMSVHVLTTGYWP--TYPPMD--VRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHC 688
            +  +  VLT   WP  +  P+D  + LP  ++     F+ +Y  KY  R L W + L   
Sbjct: 498  LSFAPQVLTRTSWPFQSTNPIDEGISLPPRMSQILAGFEGYYSLKYKERVLKWAHHLSVI 557

Query: 687  VLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLA-CGK 511
             +  +F  G  E++ S +  V+ +LF + E+ +  +I E   I   +++  + S++   +
Sbjct: 558  EIGCQFNSGYYEISFSVYAGVIFLLFEDYEELTLGEIYELTHIPIDDVKSLVMSMSTIPR 617

Query: 510  VRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAI-----QMKETVEENTSTTERVFQ 346
             ++L+K     +++    F  N  F++P  ++KV  I       K       S+ +    
Sbjct: 618  CKILKKSSSSGNMK----FSVNYFFSSPNRKVKVPVIACPLPSQKSDNLATASSVDTYDN 673

Query: 345  DRQYQVDAAIVRIMKTRKVLSHTLLIAELFQ--QLKFPIKPADLKKRIESLIDREYLERD 172
            +   ++ A IVRIMKT   LSH  L+    +  Q +  + P+ LK+ I+ LI++EY++R+
Sbjct: 674  EIVMELSAIIVRIMKTEGKLSHQQLLERTTKRTQSRLSLTPSILKRSIQLLIEKEYIQRN 733

Query: 171  KSNPQIYNYLA 139
              +P  Y+YL+
Sbjct: 734  ADDPSYYHYLS 744



>gb:AK016520_1158756 Mus musculus adult male testis cDNA, RIKEN
            full-length enriched library, clone:4932411N15
            product:cullin 2, full insert sequence.
          Length = 706

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 61/247 (24%), Positives = 116/247 (46%), Gaps = 2/247 (0%)
 Frame = -1

Query: 873  TKLPMGIEMSVHVLTTGYWPTY--PPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNS 700
            T + +GI   ++VL  G WP    P     +P EL     +F+ FY   +SGR+L W + 
Sbjct: 499  TVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHY 558

Query: 699  LGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLA 520
            L    +K  +        V+ +Q  VL+ FN +E  S+++++++  + +KEL RT++SL 
Sbjct: 559  LCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTRTIKSLL 618

Query: 519  CGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDR 340
               V+++    +  D++ + +F  N  F++   + K+     K+T +             
Sbjct: 619  --DVKMINHDSEKEDIDAESSFSLNMSFSSKRTKFKITTSMQKDTPQ------------- 663

Query: 339  QYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLERDKSNP 160
                            V+S +        + +F    + +KK IE LID++Y+ER +++ 
Sbjct: 664  ----------------VISQS--------RARFNPSISMIKKCIEVLIDKQYIERSQASA 699

Query: 159  QIYNYLA 139
              Y+Y+A
Sbjct: 700  DEYSYVA 706



>sp|Q12018|CC53_YEAST Cell division control protein 53 (Cullin
            A).>pir|S67675|S67675 probable membrane protein YDL132w -
            yeast (Saccharomyces cerevisiae)>gb:SCCHRIVFY_1706984
            S.cerevisiae DNA of cosmid from chromosome IV, strain FY
            1679.>gb:SCU43564_1710360 Saccharomyces cerevisiae CDC53
            gene, complete cds.>gb:SCYDL132W_1711703 S.cerevisiae
            chromosome IV reading frame ORF YDL132w.
          Length = 815

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 77/271 (28%), Positives = 131/271 (48%), Gaps = 33/271 (12%)
 Frame = -1

Query: 852  EMSVHVLTTGYWP-TYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKA 676
            ++   VL    WP +Y  ++ +LP EL    +  KE Y  K++GR L W   L    LKA
Sbjct: 553  DLQPFVLAENMWPFSYQEVEFKLPKELVPSHEKLKESYSQKHNGRILKWLWPLCRGELKA 612

Query: 675  EFPK-GRK--ELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACG--- 514
            +  K GR      V+ FQ  +L+L+N+A+  + ++I+E   +       T+Q +A     
Sbjct: 613  DIGKPGRMPFNFTVTLFQMAILLLYNDADVLTLENIQEGTSL-------TIQHIAAAMVP 665

Query: 513  --KVRVLQKIPKGRD--VEDDDTFVFNDQFTAPLYRI------KVNAIQM---------- 394
              K +++Q++P G D  V+ +  F  +  + A    I      K + +Q           
Sbjct: 666  FIKFKLIQQVPPGLDALVKPETQFKLSRPYKALKTNINFASGVKNDILQSLSGGGHDNHG 725

Query: 393  ----KETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQ--LKFPIK 232
                 + + E+    + +  +RQ  ++A IVRIMK ++ L HT L+ E   Q   +F  K
Sbjct: 726  NKLGNKRLTEDERIEKELNTERQIFLEACIVRIMKAKRNLPHTTLVNECIAQSHQRFNAK 785

Query: 231  PADLKKRIESLIDREYLERDKSNPQIYNYLA 139
             + +K+ I+SLI + YL+R   + + Y YLA
Sbjct: 786  VSMVKRAIDSLIQKGYLQRG-DDGESYAYLA 815



>gb:AL392046_1927130 Human DNA sequence from clone RP11-297A16 on
            chromosome 10 Contains the gene for cullin 2 (CUL2), a
            novel gene and a CpG island, complete sequence.
          Length = 706

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 60/247 (24%), Positives = 116/247 (46%), Gaps = 2/247 (0%)
 Frame = -1

Query: 873  TKLPMGIEMSVHVLTTGYWPTY--PPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNS 700
            T + +GI   ++VL  G WP    P     +P EL     +F+ FY   +SGR+L W + 
Sbjct: 499  TVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHY 558

Query: 699  LGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLA 520
            L    +K  +        V+ +Q  VL+ FN +E  S+++++++  + +KEL +T++SL 
Sbjct: 559  LCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLL 618

Query: 519  CGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDR 340
               V+++    +  D++ + +F  N  F++   + K+     K+T +             
Sbjct: 619  --DVKMINHDSEKEDIDAESSFSLNMNFSSKRTKFKITTSMQKDTPQ------------- 663

Query: 339  QYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLERDKSNP 160
                            V+S +        + +F    + +KK IE LID++Y+ER +++ 
Sbjct: 664  ----------------VISQS--------RARFNPSISMIKKCIEVLIDKQYIERSQASA 699

Query: 159  QIYNYLA 139
              Y+Y+A
Sbjct: 700  DEYSYVA 706



>gb:AK003885_1152123 Mus musculus 18-day embryo whole body cDNA,
           RIKEN full-length enriched library, clone:1110021B17
           product:cullin 3, full insert sequence.
          Length = 91

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 42/91 (46%), Positives = 62/91 (68%), Gaps = 2/91 (2%)
 Frame = -1

Query: 405 AIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLK--FPIK 232
           A +  E+  E   T ++V  DR+++++AAIVRIMK+RK + H +L+AE+ QQLK  F   
Sbjct: 1   AAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPS 60

Query: 231 PADLKKRIESLIDREYLERDKSNPQIYNYLA 139
           P  +KKRIE LI+REYL R   + ++Y Y+A
Sbjct: 61  PVVIKKRIEGLIEREYLARTPEDRKVYTYVA 91



>gb:AF126814_1243258 Strongyloides stercoralis cullin-like protein
           mRNA, partial cds.
          Length = 148

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 42/120 (35%), Positives = 71/120 (59%), Gaps = 5/120 (4%)
 Frame = -1

Query: 483 GRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVE---ENTSTTERVFQDRQYQVDAAIV 313
           G++++    F+ ND  T+   +I++  +  K  VE   E   T E +  DR+ ++DAAIV
Sbjct: 29  GKEIQQTGEFIINDNSTSKFAKIRITNVTGKTEVENENERRKTKEVLETDRKAEIDAAIV 88

Query: 312 RIMKTRKVLSHTLLIAELFQQL--KFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
           R+MK RK L+H  LI E+   L  +F  +   +KK IE LI+R++ +R++ + + Y Y+A
Sbjct: 89  RVMKARKTLNHNNLITEVTNVLCKRFRPEILTIKKCIEXLIERDFXKRNEKDNKTYEYVA 148



>gb:PFMAL8P1_1192230 Plasmodium falciparum 3D7 chromosome 8, ***
            SEQUENCING IN PROGRESS ***, 25 ordered pieces.
          Length = 804

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 50/189 (26%), Positives = 86/189 (45%), Gaps = 2/189 (1%)
 Frame = -1

Query: 846  SVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFP 667
            SV +L  GYWPT   + ++L    N Y  +F+E+Y S+   R+L W   L   +L  EF 
Sbjct: 601  SVKILNKGYWPTLEKIHIQLNEPFNKYIQVFEEYYKSENKNRKLEWIYELSEVILHYEFN 660

Query: 666  KGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIP 487
                 L  +     +L+LFN+ +  ++  +K  + I+ K     + +         + I 
Sbjct: 661  NILYNLYCNVVNAQILLLFNKYKYINYDIVKNELQIDLKSFTDHMYT----SFYHFKLIT 716

Query: 486  KGRDVED--DDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAIV 313
                + D  +  F  N+ F+ P   + +     K+T    +   E+  +DR   ++AAIV
Sbjct: 717  SNDQIPDWTNSNFYINNNFSYPNKNVYI-----KKTTALLSKEHEKTKEDRTMAIEAAIV 771

Query: 312  RIMKTRKVL 286
            R+MK  K L
Sbjct: 772  RVMKMHKKL 780



>gb:AK080305_1172923 Mus musculus 3 days neonate thymus cDNA, RIKEN
           full-length enriched library, clone:A630047B19
           product:VASOPRESSIN-ACTIVATED CALCIUM-MOBILIZING
           RECEPTOR (VACM-1) (CULLIN HOMOLOG 5) (CUL-5) homolog
           [Rattus norvegicus], full insert sequence.
          Length = 174

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 53/169 (31%), Positives = 83/169 (49%), Gaps = 15/169 (8%)
 Frame = -1

Query: 600 EKFSFQDIKEAIGIEDKELRRTLQSLACG---KVRVL---QKIPKGRDVEDDDTFVFNDQ 439
           EK SF+++K A  + D ELRRTL SL      K +VL    ++   +D  +   F  N  
Sbjct: 6   EKISFENLKLATELPDAELRRTLWSLVAFPKLKRQVLLYDPQVNSPKDFTEGTLFSVNQD 65

Query: 438 FT-----APLYRIKVNAIQMKETVEE--NTSTTERVFQDRQYQVDAAIVRIMKTRKVLSH 280
           F+         R K+N I   +   E       E + Q R  +   AI++IMK RK +S+
Sbjct: 66  FSLIKNAKVQKRGKINLIGRLQLTTERMREEENEGIVQLRILRTQEAIIQIMKMRKKISN 125

Query: 279 TLLIAELFQQLKFPIKPAD--LKKRIESLIDREYLERDKSNPQIYNYLA 139
             L  EL + LK    P    +K+++E LI+  Y+ RD+++   + Y+A
Sbjct: 126 AQLQTELVEILKNMFLPQKKMIKEQMEWLIEHRYIRRDEADINTFIYMA 174



>gb:CR382401_1375119 Plasmodium falciparum chromosome 6, complete
            sequence; segment 4/5.
          Length = 1129

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 44/179 (24%), Positives = 87/179 (48%), Gaps = 5/179 (2%)
 Frame = -1

Query: 666  KGRKEL--AVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSL-ACGKVRVLQ 496
            KG+K++   V+  Q +VL+LFN+  ++   +IKE  GI  + + R L+++   G+  +L 
Sbjct: 957  KGKKKIYITVTILQALVLLLFNKKNEYHINEIKELTGISTENIIRYLKTIYTIGETHILI 1016

Query: 495  KIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTS--TTERVFQDRQYQVDA 322
                   ++ + +F    +F      +  N +  K+ +   TS    +   +D+   +DA
Sbjct: 1017 YDKANEILKLNFSFRSKKKFLI----VNYNDVLYKDDMGPTTSLLNEDNEIEDKTLHIDA 1072

Query: 321  AIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLERDKSNPQIYNY 145
            AIV+ +KT    S   + + +  ++        +K RI SL+ RE++    +N   Y+Y
Sbjct: 1073 AIVKFLKTNGKSSERKICSFIKDKMDIS-SNEQIKNRISSLLSREFIFFKNNN---YHY 1127



>gb:AK118453_1816430 Arabidopsis thaliana At2g04660 mRNA for unknown
           protein, complete cds, clone: RAFL19-69-M18.
          Length = 865

 Score = 52.8 bits (125), Expect = 9e-06
 Identities = 34/126 (26%), Positives = 60/126 (47%), Gaps = 5/126 (3%)
 Frame = -1

Query: 900 SFKQSSQARTKLPMGIEMSVHVLT-----TGYWPTYPPMDVRLPHELNVYQDIFKEFYLS 736
           + K++SQ   +L    E+SV  LT     T +WP      + LP  ++     +   Y  
Sbjct: 611 NIKKASQTGAELREN-ELSVDTLTSTILSTNFWPPIQDEPLELPGPVDKLLSDYANRYHE 669

Query: 735 KYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIE 556
             + R+L+W+ +LG   L+ +F     +  VS     ++M F E + ++++D+ E IGI 
Sbjct: 670 IKTPRKLLWKKNLGTVKLELQFEDRAMQFTVSPTHAAIIMQFQEKKSWTYKDLAEVIGIP 729

Query: 555 DKELRR 538
              L R
Sbjct: 730 IDALNR 735



>gb:AY138228_1582270 Arabidopsis thaliana APC2 mRNA, complete cds.
          Length = 865

 Score = 52.8 bits (125), Expect = 9e-06
 Identities = 34/126 (26%), Positives = 60/126 (47%), Gaps = 5/126 (3%)
 Frame = -1

Query: 900 SFKQSSQARTKLPMGIEMSVHVLT-----TGYWPTYPPMDVRLPHELNVYQDIFKEFYLS 736
           + K++SQ   +L    E+SV  LT     T +WP      + LP  ++     +   Y  
Sbjct: 611 NIKKASQTGAELREN-ELSVDTLTSTILSTNFWPPIQDEPLELPGPVDKLLSDYANRYHE 669

Query: 735 KYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIE 556
             + R+L+W+ +LG   L+ +F     +  VS     ++M F E + ++++D+ E IGI 
Sbjct: 670 IKTPRKLLWKKNLGTVKLELQFEDRAMQFTVSPTHAAIIMQFQEKKSWTYKDLAEVIGIP 729

Query: 555 DKELRR 538
              L R
Sbjct: 730 IDALNR 735



>gb:BC085675_2564551 Danio rerio cDNA clone MGC:92577 IMAGE:5912857,
           complete cds.
          Length = 566

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 29/94 (30%), Positives = 45/94 (47%), Gaps = 2/94 (2%)
 Frame = -1

Query: 873 TKLPMGIEMSVHVLTTGYWPT--YPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNS 700
           T + +GI   ++VL  G WP    P     +P EL     +F+ FY   +SGR+L W + 
Sbjct: 459 TVVDLGISFQIYVLQAGAWPLTHVPSSTFAIPQELEKSVQMFELFYNQHFSGRKLTWLHY 518

Query: 699 LGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAE 598
           L    +K  +        V+ +Q  VL+ FN +E
Sbjct: 519 LCTGEVKMNYLSKPYVAVVTTYQMAVLLAFNNSE 552



>sp|P47050|YJE7_YEAST Hypothetical 99.3 kDa protein in MTR4-GYP6
            intergenic region.>pir|S56819|S56819 hypothetical protein
            YJL047c - yeast (Saccharomyces
            cerevisiae)>gb:AY387707_1604299 Saccharomyces cerevisiae
            ubiquitin ligase Cul8 (CUL8) gene, complete
            cds.>gb:SCYJL047C_1712606 S.cerevisiae chromosome X
            reading frame ORF YJL047c.
          Length = 842

 Score = 49.7 bits (117), Expect = 8e-05
 Identities = 63/261 (24%), Positives = 112/261 (42%), Gaps = 17/261 (6%)
 Frame = -1

Query: 897  FKQSSQARTKLPMGIEMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRR 718
            F+QS++ +    +  EM         W  +    +R  HE N  +D       S  S + 
Sbjct: 603  FQQSNEVKKNFVLPQEMD------DTWNQF----LRNYHEQNKVED-------SDASKKE 645

Query: 717  LMWQNSLGHCVLKAEF--PKGRKEL-AVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKE 547
            L    +L HC +++ +    G   +  ++ FQT VL LFNE++  + Q I E   +  K+
Sbjct: 646  LYPMWNLHHCEVESPYIIQDGTNLIFELTLFQTCVLTLFNESDHLTLQVISEQTKLAYKD 705

Query: 546  LRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRIK----------VNAIQ 397
            L   L+S    K+         RD+  D+T+  N+ F   + ++K            ++Q
Sbjct: 706  LALVLKSFCNYKILT-------RDI--DNTYSINESFKPDMKKVKNGKLRVVLPRTASLQ 756

Query: 396  MKETVEENTSTTERVFQDRQYQ---VDAAIVRIMKT-RKVLSHTLLIAELFQQLKFPIKP 229
               T  E TS+      + Q+    + A I R +K+ R  L +  L   + QQ+K     
Sbjct: 757  SSNTGGERTSSAHHEGSNSQWTQELLKACITRSVKSERNGLDYDHLFETVKQQIK-GFSV 815

Query: 228  ADLKKRIESLIDREYLERDKS 166
             + K  +  L+  +++ RD+S
Sbjct: 816  GEFKDALAKLLRDKFITRDES 836



>pir|H84459|H84459 hypothetical protein At2g04660 [imported] -
           Arabidopsis thaliana>gb:AC006955_1534941 Arabidopsis
           thaliana chromosome 2 clone F28I8 map RNS1, complete
           sequence.
          Length = 873

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 29/103 (28%), Positives = 50/103 (48%), Gaps = 3/103 (2%)
 Frame = -1

Query: 837 VLTTGYWPTYP---PMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFP 667
           +L+T +WP      P+D  L    N Y +I         + R+L+W+ +LG   L+ +F 
Sbjct: 649 ILSTNFWPPIQLPGPVDKLLSDYANRYHEI--------KTPRKLLWKKNLGTVKLELQFE 700

Query: 666 KGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR 538
               +  VS     ++M F E + ++++D+ E IGI    L R
Sbjct: 701 DRAMQFTVSPTHAAIIMQFQEKKSWTYKDLAEVIGIPIDALNR 743



>gb:AY675111_1621933 Ostreococcus tauri anaphase promoting complex
           subunit 2 (APC2) gene, complete cds.
          Length = 851

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 25/104 (24%), Positives = 51/104 (49%), Gaps = 2/104 (1%)
 Frame = -1

Query: 837 VLTTGYWPTYPP--MDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPK 664
           ++++ +WP +     D +LP E+    D++ + Y    + R++ W+ +LG  V+      
Sbjct: 627 IVSSMFWPAFSTDVTDFKLPQEIQEQMDLYAKRYHQIKAPRKMEWRPALGIVVMDVTHND 686

Query: 663 GRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTL 532
              E++V+  Q  +L  F  AE +   D+   +G+    LRR +
Sbjct: 687 RTFEVSVNPLQATILHHFQRAESWRASDLAHEVGVSVDALRRRI 730



>gb:BC027351_2095920 Mus musculus anaphase promoting complex subunit
           2, mRNA (cDNA clone IMAGE:3966453), partial cds.
          Length = 836

 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 22/102 (21%), Positives = 51/102 (50%)
 Frame = -1

Query: 837 VLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGR 658
           +L++ +WP +    + +P ++    D++ + Y    + R L W+++LG   +  E     
Sbjct: 609 ILSSEFWPPFKDEKLEVPEDIRAALDVYCKKYEKLKAMRTLSWKHTLGLVTMDVELADRT 668

Query: 657 KELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTL 532
             +AV+  Q VVL+ F     ++ +++ + + +    LRR +
Sbjct: 669 LSVAVTPVQAVVLLYFQNQASWTLEELSKVVKMPVALLRRRM 710



>gb:AK129351_2069582 Mus musculus mRNA for mKIAA1406 protein.
          Length = 838

 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 22/102 (21%), Positives = 51/102 (50%)
 Frame = -1

Query: 837 VLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGR 658
           +L++ +WP +    + +P ++    D++ + Y    + R L W+++LG   +  E     
Sbjct: 611 ILSSEFWPPFKDEKLEVPEDIRAALDVYCKKYEKLKAMRTLSWKHTLGLVTMDVELADRT 670

Query: 657 KELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTL 532
             +AV+  Q VVL+ F     ++ +++ + + +    LRR +
Sbjct: 671 LSVAVTPVQAVVLLYFQNQASWTLEELSKVVKMPVALLRRRM 712



>gb:AC150162_1745054 Solanum demissum chromosome 5 clone PGEC160O2
           map MAP_LOC, complete sequence.
          Length = 884

 Score = 46.2 bits (108), Expect = 9e-04
 Identities = 21/106 (19%), Positives = 53/106 (50%)
 Frame = -1

Query: 849 MSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEF 670
           ++  ++++ +WP      V LP  +    + + + Y    + R+L+W+ +LG   L+ +F
Sbjct: 646 LNATIISSNFWPPIQDEAVNLPEPVEQLLNDYAKRYTEVKTPRKLIWKKNLGSVKLELQF 705

Query: 669 PKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTL 532
                +  V+     ++M F + +K++ +++  A+G+    L R +
Sbjct: 706 EDRAMQFNVTPLHASIIMQFQDQKKWTSKNLAAAVGVPVDVLNRRI 751



>gb:AK030306_1161932 Mus musculus 11 days pregnant adult female
           ovary and uterus cDNA, RIKEN full-length enriched
           library, clone:5031417J01 product:VASOPRESSIN-ACTIVATED
           CALCIUM-MOBILIZING RECEPTOR (VACM-1) (CULLIN HOMOLOG 5)
           (CUL-5) homolog [Rattus norvegicus], full insert
           sequence.
          Length = 128

 Score = 46.2 bits (108), Expect = 9e-04
 Identities = 32/96 (33%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = -1

Query: 420 RIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQLKF 241
           R+++   +M+E  EEN    E + Q R  +   AI++IMK RK +S+  L  EL + LK 
Sbjct: 39  RLQLTTERMRE--EEN----EGIVQLRILRTQEAIIQIMKMRKKISNAQLQTELVEILKN 92

Query: 240 PIKPAD--LKKRIESLIDREYLERDKSNPQIYNYLA 139
              P    +K+++E LI+  Y+ RD+++   + Y+A
Sbjct: 93  MFLPQKKMIKEQMEWLIEHRYIRRDEADINTFIYMA 128



>gb:BC001579_1967688 Homo sapiens anaphase promoting complex subunit
           2, mRNA (cDNA clone IMAGE:3458521), partial cds.
          Length = 577

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 21/102 (20%), Positives = 52/102 (50%)
 Frame = -1

Query: 837 VLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGR 658
           +L++ +WP +    + +P ++    + + + Y    + R L W+++LG   +  E     
Sbjct: 350 ILSSEFWPPFKDEKLEVPEDIRAALEAYCKKYEQLKAMRTLSWKHTLGLVTMDVELADRT 409

Query: 657 KELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTL 532
             +AV+  Q V+L+ F +   ++ +++ +A+ +    LRR +
Sbjct: 410 LSVAVTPVQAVILLYFQDQASWTLEELSKAVKMPVALLRRRM 451



>gb:AB037827_1866618 Homo sapiens mRNA for KIAA1406 protein, partial
           cds.
          Length = 571

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 21/102 (20%), Positives = 52/102 (50%)
 Frame = -1

Query: 837 VLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGR 658
           +L++ +WP +    + +P ++    + + + Y    + R L W+++LG   +  E     
Sbjct: 344 ILSSEFWPPFKDEKLEVPEDIRAALEAYCKKYEQLKAMRTLSWKHTLGLVTMDVELADRT 403

Query: 657 KELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTL 532
             +AV+  Q V+L+ F +   ++ +++ +A+ +    LRR +
Sbjct: 404 LSVAVTPVQAVILLYFQDQASWTLEELSKAVKMPVALLRRRM 445



>gb:OSJN00053_1693965 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0081L15, complete
            sequence.>gb:OSJN00125_1695287 Oryza sativa genomic DNA,
            chromosome 4, BAC clone: OJ000223_09, complete sequence.
          Length = 920

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 33/133 (24%), Positives = 64/133 (48%), Gaps = 1/133 (0%)
 Frame = -1

Query: 837  VLTTGYWPTYPPMDVRLPHELN-VYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKG 661
            ++++ +WP     D+ +P  ++ +  D  K F+  K + R+L+W+ +LG   L+ +F   
Sbjct: 686  IISSNFWPPIQTEDLTVPASVDQLLSDYAKRFHQIK-TPRKLLWKKNLGTVKLELQFEDR 744

Query: 660  RKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKG 481
              +  V+     ++M F E   ++ + +  AIG+    L R + S    K  + + +  G
Sbjct: 745  SMQFTVAPVHAAIIMQFQEKPSWTSKTLATAIGVPVDSLNRKI-SFWTSKGVLTESV--G 801

Query: 480  RDVEDDDTFVFND 442
             D  DD TF   D
Sbjct: 802  PDA-DDPTFTVVD 813



>sp|Q8BZQ7|ANC2_MOUSE Anaphase promoting complex subunit 2 (APC2)
           (Cyclosome subunit 2).>gb:AK033784_1163517 Mus musculus
           adult male epididymis cDNA, RIKEN full-length enriched
           library, clone:9230107K09 product:ANAPHASE-PROMOTING
           COMPLEX SUBUNIT 2 homolog [Homo sapiens], full insert
           sequence.
          Length = 837

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 21/102 (20%), Positives = 51/102 (50%)
 Frame = -1

Query: 837 VLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGR 658
           +L++ +WP +    + +P ++    D++ + Y    + R L W+++LG   +  E     
Sbjct: 610 ILSSEFWPPFKDEKLEVPEDIRAALDVYCKKYEKLKAMRTLSWKHTLGLVTMDVELADRT 669

Query: 657 KELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTL 532
             +AV+  Q +VL+ F     ++ +++ + + +    LRR +
Sbjct: 670 LSVAVTPVQALVLLYFQNQASWTLEELSKVVKMPVALLRRRM 711



>sp|Q9UJX6|ANC2_HUMAN Anaphase promoting complex subunit 2 (APC2)
           (Cyclosome subunit 2).>gb:AF191337_1889066 Homo sapiens
           anaphase-promoting complex subunit 2 (APC2) mRNA,
           complete cds.>gb:AL929554_1933295 Human DNA sequence
           from clone RP11-350O14 on chromosome 9 Contains the 3'
           end of the MAN1B1 gene for mannosidase alpha class 1B
           member 1, the DPP7 gene for dipeptidylpeptidase 7, the
           GRIN1 gene for glutamate receptor ionotropic N-methyl
           D-aspartate 1, a novel gene, the gene for
           anaphase-promoting complex subunit 2 (ANAPC2), the SSNA1
           gene for Sjogren's syndrome nuclear autoantigen 1, three
           novel genes (FLJ90254), a novel pseudogene, the 5' end
           of the gene for NADPH-dependent FMN and FAD containing
           oxidoreductase (NR1) and thirteen CpG islands, complete
           sequence.>gb:BC032503_1980503 Homo sapiens anaphase
           promoting complex subunit 2, mRNA (cDNA clone MGC:45143
           IMAGE:5243107), complete cds.
          Length = 822

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 21/102 (20%), Positives = 52/102 (50%)
 Frame = -1

Query: 837 VLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGR 658
           +L++ +WP +    + +P ++    + + + Y    + R L W+++LG   +  E     
Sbjct: 595 ILSSEFWPPFKDEKLEVPEDIRAALEAYCKKYEQLKAMRTLSWKHTLGLVTMDVELADRT 654

Query: 657 KELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTL 532
             +AV+  Q V+L+ F +   ++ +++ +A+ +    LRR +
Sbjct: 655 LSVAVTPVQAVILLYFQDQASWTLEELSKAVKMPVALLRRRM 696



>pir|S44845|S44845 K06H7.5 protein - Caenorhabditis elegans
          Length = 378

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 29/129 (22%), Positives = 57/129 (44%), Gaps = 2/129 (1%)
 Frame = -1

Query: 903 ESFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPP--MDVRLPHELNVYQDIFKEFYLSKY 730
           E   + S     +P+ I +S  ++++ YWP       +  +P  L    D+++E YL   
Sbjct: 122 EDMSERSAGNYDVPI-IPISACIISSHYWPKLETEKTEALMPQPLQAAMDVYQETYLDVK 180

Query: 729 SGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDK 550
             R+L W  S+G   +         +  +     ++L LF E E ++  ++ E +G+   
Sbjct: 181 RDRKLEWLRSVGCVEVSINIDGVEVDRTIPNMYALLLFLFLEKETWTTAEVVEKMGMSVV 240

Query: 549 ELRRTLQSL 523
             R+ L+ L
Sbjct: 241 VTRKRLEWL 249



>sp|P34514|ANC2_CAEEL Anaphase-promoting complex subunit 2 (APC2)
           (Cyclosome subunit 2).>gb:L15314_1386935 Caenorhabditis
           elegans cosmid K06H7, complete sequence.
          Length = 728

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 29/129 (22%), Positives = 57/129 (44%), Gaps = 2/129 (1%)
 Frame = -1

Query: 903 ESFKQSSQARTKLPMGIEMSVHVLTTGYWPTYPP--MDVRLPHELNVYQDIFKEFYLSKY 730
           E   + S     +P+ I +S  ++++ YWP       +  +P  L    D+++E YL   
Sbjct: 472 EDMSERSAGNYDVPI-IPISACIISSHYWPKLETEKTEALMPQPLQAAMDVYQETYLDVK 530

Query: 729 SGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDK 550
             R+L W  S+G   +         +  +     ++L LF E E ++  ++ E +G+   
Sbjct: 531 RDRKLEWLRSVGCVEVSINIDGVEVDRTIPNMYALLLFLFLEKETWTTAEVVEKMGMSVV 590

Query: 549 ELRRTLQSL 523
             R+ L+ L
Sbjct: 591 VTRKRLEWL 599



>gb:BC065421_2105603 Mus musculus cDNA clone IMAGE:5057899, partial
           cds.
          Length = 224

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 21/97 (21%), Positives = 47/97 (48%)
 Frame = -1

Query: 822 YWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAV 643
           +WP +    + +P ++    D++ + Y    + R L W+++LG   +  E       +AV
Sbjct: 2   FWPPFKDEKLEVPEDIRAALDVYCKKYEKLKAMRTLSWKHTLGLVTMDVELADRTLSVAV 61

Query: 642 SFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTL 532
           +  Q VVL+ F     ++ +++ + + +    LRR +
Sbjct: 62  TPVQAVVLLYFQNQASWTLEELSKVVKMPVALLRRRM 98



>gb:AC154033_1745269 Solanum demissum chromosome 5 clone PGEC132D05
           map MAP_LOC, complete sequence.
          Length = 309

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 21/106 (19%), Positives = 51/106 (48%)
 Frame = -1

Query: 849 MSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEF 670
           ++  ++++ +WP      V LP  +      + + Y    + R+L+W+ +LG   L+ +F
Sbjct: 71  LNATIISSNFWPPIQDEAVNLPEPVEQLLTDYAKRYTEVKTPRKLIWKKNLGSVKLELQF 130

Query: 669 PKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTL 532
                +  V+     ++M F + +K+  +++  A+G+    L R +
Sbjct: 131 EDRAMQFNVTPLHASIIMQFQDQKKWISKNLAAAVGVPVDVLNRRI 176



>gb:AY226099_2079940 Rattus norvegicus swan mRNA, complete cds.
          Length = 1032

 Score = 21.6 bits (44), Expect(9) = 0.020
 Identities = 7/9 (77%), Positives = 9/9 (100%)
 Frame = -3

Query: 355 SIPGPAIPG 329
           ++PGPAIPG
Sbjct: 791 ALPGPAIPG 799



 Score = 21.6 bits (44), Expect(9) = 0.020
 Identities = 7/9 (77%), Positives = 9/9 (100%)
 Frame = -3

Query: 355 SIPGPAIPG 329
           +IPGPA+PG
Sbjct: 786 AIPGPALPG 794



 Score = 21.2 bits (43), Expect(9) = 0.020
 Identities = 7/9 (77%), Positives = 9/9 (100%)
 Frame = -3

Query: 355 SIPGPAIPG 329
           ++PGPAIPG
Sbjct: 781 AMPGPAIPG 789



 Score = 21.2 bits (43), Expect(9) = 0.020
 Identities = 7/9 (77%), Positives = 9/9 (100%)
 Frame = -3

Query: 355 SIPGPAIPG 329
           S+PGPA+PG
Sbjct: 766 SMPGPAMPG 774



 Score = 20.4 bits (41), Expect(9) = 0.020
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 352 IPGPAIPG 329
           IPGP IPG
Sbjct: 742 IPGPGIPG 749



 Score = 20.4 bits (41), Expect(9) = 0.020
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 352 IPGPAIPG 329
           IPGP IPG
Sbjct: 737 IPGPGIPG 744



 Score = 20.4 bits (41), Expect(9) = 0.020
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 352 IPGPAIPG 329
           IPGP IPG
Sbjct: 722 IPGPGIPG 729



 Score = 20.4 bits (41), Expect(9) = 0.020
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 352 IPGPAIPG 329
           IPGP IPG
Sbjct: 717 IPGPGIPG 724



 Score = 20.4 bits (41), Expect(9) = 0.020
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 352 IPGPAIPG 329
           IPGP IPG
Sbjct: 712 IPGPGIPG 719



>gb:CNS07EGE_1373673 chromosome VII of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 742

 Score = 41.2 bits (95), Expect = 0.028
 Identities = 30/112 (26%), Positives = 53/112 (47%), Gaps = 1/112 (0%)
 Frame = -1

Query: 855 IEMSVHVLTTGYWPTYPP-MDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLK 679
           ++  V +LT  YWP        R+P  L    ++ K+ Y SK++ +RL W   LG   ++
Sbjct: 531 VDRFVWILTQAYWPMQAESQSTRIPAPL----EMIKKVYDSKFNKKRLHWVWHLGSVCVE 586

Query: 678 AEFPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSL 523
                   E+ ++  Q  V+ LFN+ E+  F+ +   + +  K     L+SL
Sbjct: 587 IR----GVEIQMNVLQYSVVDLFNKHEEIDFEKVLGLVKMGTKTTDDVLRSL 634



>gb:AY058717_1291871 Drosophila melanogaster LD45730 full length
           cDNA.
          Length = 449

 Score = 41.2 bits (95), Expect = 0.028
 Identities = 22/107 (20%), Positives = 48/107 (44%)
 Frame = -1

Query: 852 EMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAE 673
           ++S  +++  +WP++    ++LP E+      + + Y +    R L W+   G   ++ E
Sbjct: 219 DISSLIVSAQFWPSFNKESLQLPEEIENEFKKYTKAYEAYKGNRTLNWRTVTGRVNIEIE 278

Query: 672 FPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTL 532
                 E+ VS    V++  F    +++ +D+     +    LRR L
Sbjct: 279 IGDRTMEMVVSPILAVIIYHFQTKNEWTIEDLSSITKVPASALRRRL 325



>gb:AE013599_1133667 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003462_1210966 Drosophila melanogaster
           chromosome 2R, section 70 of 74 of the complete
           sequence.>gb:AY129297_1302180 Drosophila melanogaster
           anaphase-promoting complex subunit 2 (mr) mRNA, complete
           cds.
          Length = 802

 Score = 41.2 bits (95), Expect = 0.028
 Identities = 22/107 (20%), Positives = 48/107 (44%)
 Frame = -1

Query: 852 EMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAE 673
           ++S  +++  +WP++    ++LP E+      + + Y +    R L W+   G   ++ E
Sbjct: 572 DISSLIVSAQFWPSFNKESLQLPEEIENEFKKYTKAYEAYKGNRTLNWRTVTGRVNIEIE 631

Query: 672 FPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTL 532
                 E+ VS    V++  F    +++ +D+     +    LRR L
Sbjct: 632 IGDRTMEMVVSPILAVIIYHFQTKNEWTIEDLSSITKVPASALRRRL 678



>gb:CR380956_1652192 Candida glabrata strain CBS138 chromosome J
            complete sequence.
          Length = 799

 Score = 39.3 bits (90), Expect = 0.11
 Identities = 50/230 (21%), Positives = 92/230 (40%), Gaps = 30/230 (13%)
 Frame = -1

Query: 798  DVRLPHELNVYQDIFKEFY---LSKYSGRRLMWQNSLGHCVLKAEF-PKGRKELAVSF-- 637
            +V LP  L        E+Y   L   + R L+   +L HC ++ EF  +G ++  V+F  
Sbjct: 565  NVILPEILQRQWGKLVEYYNSTLKTSASRTLVPAYALQHCDVETEFLVEGTRDKYVTFNI 624

Query: 636  --FQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDD 463
              +QT VL LFN+ +K     I +  G+ ++            K  +   +  G   ED 
Sbjct: 625  SVYQTCVLNLFNDHDKLDIAKIMQLTGLSER----------MSKAVITSYLSAGIFKEDK 674

Query: 462  DTFVFNDQFTAPLYRIKVNAIQM-----------KETVEENTSTTERVFQDRQYQ----- 331
             T+  +  F A   ++K   +++           ++T   +++ +  V     +      
Sbjct: 675  GTYTIDSSFKADPRKLKDGKLRIPMAPGPPSRLRRDTSSSSSTASATVSTSASHNEGYSS 734

Query: 330  ------VDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESL 199
                  + AAIVR +K        +    LF+Q+K  I    + +  ES+
Sbjct: 735  LWIQEVIKAAIVRTLKAN---GKPMNFDTLFEQIKTGINGVSVGECKESI 781



>gb:AF345334_2063778 Mus musculus SWAN mRNA, complete
           cds.>gb:AF393215_2064749 Mus musculus swan mRNA,
           complete cds; alternatively spliced.>gb:AF393216_2064750
           Mus musculus swan mRNA, complete cds; alternatively
           spliced.
          Length = 1003

 Score = 22.3 bits (46), Expect(6) = 0.22
 Identities = 8/9 (88%), Positives = 9/9 (100%)
 Frame = -3

Query: 355 SIPGPAIPG 329
           +IPGPAIPG
Sbjct: 756 AIPGPAIPG 764



 Score = 22.3 bits (46), Expect(6) = 0.22
 Identities = 8/9 (88%), Positives = 9/9 (100%)
 Frame = -3

Query: 355 SIPGPAIPG 329
           +IPGPAIPG
Sbjct: 751 AIPGPAIPG 759



 Score = 22.3 bits (46), Expect(6) = 0.22
 Identities = 8/9 (88%), Positives = 9/9 (100%)
 Frame = -3

Query: 355 SIPGPAIPG 329
           +IPGPAIPG
Sbjct: 746 AIPGPAIPG 754



 Score = 21.2 bits (43), Expect(6) = 0.22
 Identities = 7/9 (77%), Positives = 9/9 (100%)
 Frame = -3

Query: 355 SIPGPAIPG 329
           ++PGPAIPG
Sbjct: 741 AMPGPAIPG 749



 Score = 20.8 bits (42), Expect(6) = 0.22
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -3

Query: 355 SIPGPAIPG 329
           +IPGP IPG
Sbjct: 761 AIPGPTIPG 769



 Score = 20.8 bits (42), Expect(6) = 0.22
 Identities = 7/8 (87%), Positives = 8/8 (100%)
 Frame = -3

Query: 352 IPGPAIPG 329
           IPGPA+PG
Sbjct: 702 IPGPAMPG 709



>sp|Q8R4X3|RBMC_MOUSE RNA-binding protein 12 (RNA binding motif
           protein 12) (SH3/WW domain anchor protein in the
           nucleus) (SWAN).
          Length = 1002

 Score = 22.3 bits (46), Expect(6) = 0.22
 Identities = 8/9 (88%), Positives = 9/9 (100%)
 Frame = -3

Query: 355 SIPGPAIPG 329
           +IPGPAIPG
Sbjct: 756 AIPGPAIPG 764



 Score = 22.3 bits (46), Expect(6) = 0.22
 Identities = 8/9 (88%), Positives = 9/9 (100%)
 Frame = -3

Query: 355 SIPGPAIPG 329
           +IPGPAIPG
Sbjct: 751 AIPGPAIPG 759



 Score = 22.3 bits (46), Expect(6) = 0.22
 Identities = 8/9 (88%), Positives = 9/9 (100%)
 Frame = -3

Query: 355 SIPGPAIPG 329
           +IPGPAIPG
Sbjct: 746 AIPGPAIPG 754



 Score = 21.2 bits (43), Expect(6) = 0.22
 Identities = 7/9 (77%), Positives = 9/9 (100%)
 Frame = -3

Query: 355 SIPGPAIPG 329
           ++PGPAIPG
Sbjct: 741 AMPGPAIPG 749



 Score = 20.8 bits (42), Expect(6) = 0.22
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -3

Query: 355 SIPGPAIPG 329
           +IPGP IPG
Sbjct: 761 AIPGPTIPG 769



 Score = 20.8 bits (42), Expect(6) = 0.22
 Identities = 7/8 (87%), Positives = 8/8 (100%)
 Frame = -3

Query: 352 IPGPAIPG 329
           IPGPA+PG
Sbjct: 702 IPGPAMPG 709



>gb:BC027810_2096128 Mus musculus RNA binding motif protein 12, mRNA
           (cDNA clone IMAGE:5342328), complete cds.
          Length = 346

 Score = 22.3 bits (46), Expect(6) = 0.27
 Identities = 8/9 (88%), Positives = 9/9 (100%)
 Frame = -3

Query: 355 SIPGPAIPG 329
           +IPGPAIPG
Sbjct: 100 AIPGPAIPG 108



 Score = 22.3 bits (46), Expect(6) = 0.27
 Identities = 8/9 (88%), Positives = 9/9 (100%)
 Frame = -3

Query: 355 SIPGPAIPG 329
           +IPGPAIPG
Sbjct: 95  AIPGPAIPG 103



 Score = 22.3 bits (46), Expect(6) = 0.27
 Identities = 8/9 (88%), Positives = 9/9 (100%)
 Frame = -3

Query: 355 SIPGPAIPG 329
           +IPGPAIPG
Sbjct: 90  AIPGPAIPG 98



 Score = 21.2 bits (43), Expect(6) = 0.27
 Identities = 7/9 (77%), Positives = 9/9 (100%)
 Frame = -3

Query: 355 SIPGPAIPG 329
           ++PGPAIPG
Sbjct: 85  AMPGPAIPG 93



 Score = 20.8 bits (42), Expect(6) = 0.27
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -3

Query: 355 SIPGPAIPG 329
           +IPGP IPG
Sbjct: 105 AIPGPTIPG 113



 Score = 20.8 bits (42), Expect(6) = 0.27
 Identities = 7/8 (87%), Positives = 8/8 (100%)
 Frame = -3

Query: 352 IPGPAIPG 329
           IPGPA+PG
Sbjct: 46  IPGPAMPG 53



>gb:AY653733_2371187 Mimivirus, complete genome.
          Length = 281

 Score = 37.7 bits (86), Expect = 0.31
 Identities = 22/94 (23%), Positives = 42/94 (44%), Gaps = 1/94 (1%)
 Frame = -1

Query: 801 MDVRLPHELNVYQDIFKEFYLSKYSGR-RLMWQNSLGHCVLKAEFPKGRKELAVSFFQTV 625
           +DV+ P EL  Y +I ++ Y   Y  +  + W  ++G    +A        +  +  Q +
Sbjct: 52  IDVQYPLELECYLNIVEKSYNIIYENKFSINWLPTMGTACFRAILGDKNVTITCNILQAI 111

Query: 624 VLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSL 523
           ++ LFN+    S   +    GI+     + L+SL
Sbjct: 112 IISLFNDTNNLSASSVYNKTGIQYDLSEKILESL 145



>gb:AC115592_1205726 Dictyostelium discoideum chromosome 2 map
           1-125959 strain AX4, complete sequence.
          Length = 2084

 Score = 37.0 bits (84), Expect = 0.52
 Identities = 26/111 (23%), Positives = 45/111 (40%)
 Frame = -1

Query: 852 EMSVHVLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAE 673
           E    +L+  +WPT    + + P  +     I+ + Y    + R+L+W+  LG   L  E
Sbjct: 656 EFETLILSQLFWPTLKGDEFKYPKSIEKKMQIYSKEYERIKTPRQLIWKQHLGLVDLDLE 715

Query: 672 FPKGRKELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRRTLQSLA 520
                +   VS     ++MLF   +           G +D E   TL+ L+
Sbjct: 716 IGNNIQSFQVSPIHATLIMLFESDD-----------GDDDDEKELTLEYLS 755



>gb:AK029180_1161381 Mus musculus 0 day neonate head cDNA, RIKEN
           full-length enriched library, clone:4831409I16
           product:DJ309K20.4 (KIAA0765, PUTATIVE BRAIN NUCLEARLY
           TARGETED PROTEIN (HRIHFB2091, RNA RECOGNITION MOTIF
           (RNP, RRM OR RBD DOMAIN) CONTAINING PROTEIN)) (RNA
           BINDING MOTIF PROTEIN 12) homolog [Homo sapiens], full
           insert sequence.
          Length = 841

 Score = 22.3 bits (46), Expect(5) = 1.3
 Identities = 8/9 (88%), Positives = 9/9 (100%)
 Frame = -3

Query: 355 SIPGPAIPG 329
           +IPGPAIPG
Sbjct: 600 AIPGPAIPG 608



 Score = 22.3 bits (46), Expect(5) = 1.3
 Identities = 8/9 (88%), Positives = 9/9 (100%)
 Frame = -3

Query: 355 SIPGPAIPG 329
           +IPGPAIPG
Sbjct: 595 AIPGPAIPG 603



 Score = 22.3 bits (46), Expect(5) = 1.3
 Identities = 8/9 (88%), Positives = 9/9 (100%)
 Frame = -3

Query: 355 SIPGPAIPG 329
           +IPGPAIPG
Sbjct: 590 AIPGPAIPG 598



 Score = 21.2 bits (43), Expect(5) = 1.3
 Identities = 7/9 (77%), Positives = 9/9 (100%)
 Frame = -3

Query: 355 SIPGPAIPG 329
           ++PGPAIPG
Sbjct: 585 AMPGPAIPG 593



 Score = 20.8 bits (42), Expect(5) = 1.3
 Identities = 7/8 (87%), Positives = 8/8 (100%)
 Frame = -3

Query: 352 IPGPAIPG 329
           IPGPA+PG
Sbjct: 546 IPGPAMPG 553



>gb:AP004031_1836628 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0432C03.
          Length = 449

 Score = 35.4 bits (80), Expect = 1.5
 Identities = 20/47 (42%), Positives = 30/47 (63%), Gaps = 1/47 (2%)
 Frame = -1

Query: 615 LFNEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVR-VLQKIPKGR 478
           L+  A   ++ DI++A GI   +L+R LQSLAC K + VL+K P  +
Sbjct: 34  LYIVANGLTYGDIEQATGIPHADLKRCLQSLACVKSKNVLRKEPMSK 80



>gb:CR382131_1663663 Yarrowia lipolytica chromosome E of strain CLIB99
            of Yarrowia lipolytica.
          Length = 712

 Score = 35.4 bits (80), Expect = 1.5
 Identities = 42/232 (18%), Positives = 89/232 (38%), Gaps = 12/232 (5%)
 Frame = -1

Query: 837  VLTTGYWPTYPPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGR 658
            +L+   WP     +  LP  +     ++   +      R+L W  SLG+  ++ E     
Sbjct: 492  ILSKLCWPQLKSEEFLLPSAIESQLSLYGTGFSKLKQRRKLKWLRSLGNVDVELELEDRT 551

Query: 657  KELAVSFFQTVVLMLFNEAEKFSFQDIKEAIGIEDKELRR---------TLQSLACGKVR 505
              L V+      +  F++  + S + ++E + +  +  RR          LQ  + G  R
Sbjct: 552  VALTVAPEMASFIHAFHDTTENSLEYVQEKLKMSPEMARRCAAFWVKEGVLQEKSEGVFR 611

Query: 504  VLQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQD-RQY-- 334
            VL++  + ++V   D F                     E  E   S  ++  +  RQY  
Sbjct: 612  VLERKSEAQNVVVADAF---------------------EASEAGQSAEDKAIESIRQYWS 650

Query: 333  QVDAAIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLE 178
             + A +        +  H+ L   + ++  +     +LK+ +++++D E L+
Sbjct: 651  YIHAMLTNRGSLPVIQMHSFLKMLVPKETPYTATQDELKQFLQAMVDEEKLD 702



>gb:BX897700_828607 Bartonella quintana str. Toulouse, complete
           genome.
          Length = 424

 Score = 34.7 bits (78), Expect = 2.6
 Identities = 23/67 (34%), Positives = 32/67 (47%), Gaps = 3/67 (4%)
 Frame = -1

Query: 504 VLQKIPKGRDVEDDDTFVFNDQFTAPLYR---IKVNAIQMKETVEENTSTTERVFQDRQY 334
           V Q+I   RD+ DD  F   D FT   +R   +  + +   +TV+  TS     F D+QY
Sbjct: 124 VFQEIGAARDIPDDIVF---DHFTETAFRHQSLGRSILGTPKTVQSFTSADLHSFMDKQY 180

Query: 333 QVDAAIV 313
             D  IV
Sbjct: 181 SADRMIV 187



>sp|Q57836|CBIT_METJA Probable cobalt-precorrin-6Y
           C(15)-methyltransferase [decarboxylating] (EC
           2.1.1.-).>pir|G64348|G64348 precorrin-8W decarboxylase
           homolog - Methanococcus jannaschii>gb:U67491_206485
           Methanocaldococcus jannaschii DSM 2661 section 33 of 150
           of the complete genome.>gb:L77117_1099243
           Methanocaldococcus jannaschii DSM 2661, complete genome.
          Length = 183

 Score = 34.7 bits (78), Expect = 2.6
 Identities = 34/113 (30%), Positives = 47/113 (41%), Gaps = 10/113 (8%)
 Frame = -1

Query: 570 AIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYRI-------- 415
           AI   D  +  T Q+LA   ++  Q I KGR  +  D   FN  F      I        
Sbjct: 62  AIDYLDGAIEVTKQNLAKFNIKNCQII-KGRAEDVLDKLEFNKAFIGGTKNIEKIIEILD 120

Query: 414 --KVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAE 262
             K+N I     V EN +     F+ R Y VDA  V I   +K+ S  + +A+
Sbjct: 121 KKKINHIVANTIVLENAAKIINEFESRGYNVDAVNVFISYAKKIPSGHMFLAK 173



>gb:SAG766845_169913 Streptococcus agalactiae NEM316 complete
           genome, segment 3.>gb:SAG766846_170243 Streptococcus
           agalactiae NEM316 complete genome, segment
           4.>gb:SAG766848_170520 Streptococcus agalactiae NEM316
           complete genome, segment 6.
          Length = 1576

 Score = 34.3 bits (77), Expect = 3.4
 Identities = 27/98 (27%), Positives = 49/98 (50%), Gaps = 1/98 (1%)
 Frame = -1

Query: 597 KFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYR 418
           K  F+++K A+G  DK             ++VL  +P   ++ + DTFVFND  +     
Sbjct: 659 KGHFKNLKFALGTPDK-------------LKVLNLLP---EIIESDTFVFNDLSSVQ--- 699

Query: 417 IKVNAIQMKETVEENTSTTERVFQDR-QYQVDAAIVRI 307
            K+N + + + +    S    +F+D   +QV A+++RI
Sbjct: 700 -KLNNLDLSQALNPEDSDLLLLFRDEGLHQVPASLMRI 736



>gb:AB042935_1519954 Oryza sativa (japonica cultivar-group) Os-RelA1
           mRNA for chloroplast RelA homologue 1, complete cds.
          Length = 892

 Score = 33.9 bits (76), Expect = 4.4
 Identities = 48/221 (21%), Positives = 85/221 (38%), Gaps = 6/221 (2%)
 Frame = -1

Query: 807 PPMDVRLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKAEFPKGRKELAVSFFQT 628
           P +    P ELN   D  K  Y +    +R   +  + H V  A    G  EL       
Sbjct: 149 PAISYLQPEELNFVHDALKLAYEAHNGQKRRSGEPFIIHPVEVARI-LGEHELDWESIAA 207

Query: 627 VVLM-LFNEAEKFSFQDIKEAIGIEDKELRRTLQS-LACGKVRVLQKIPKGRDVEDDDTF 454
            +L     + +  +F+ I+   G+    +RR ++      K+  LQ   +G   +D    
Sbjct: 208 GLLHDTVEDTDMVTFERIENEFGVT---VRRIVEGETKVSKLGKLQCKNEGNSKQDVKAE 264

Query: 453 VFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTL 274
                F A    ++V  +++ + +  N  T   + Q +QY +    +++      L    
Sbjct: 265 DLRQMFLAMTEEVRVIIVKLADRLH-NMRTLTHMPQHKQYAIAMETLQVFAPLAKLLGMY 323

Query: 273 LIAELFQQLKF----PIKPADLKKRIESLIDREYLERDKSN 163
            I    + L F    P   A+LKKR+E L      E +++N
Sbjct: 324 RIKSELEYLSFMYMNPGDFAELKKRVEDLYKAHEQELEEAN 364



>pir|A75127|A75127 hypothetical protein PAB1818 - Pyrococcus abyssi
           (strain Orsay)>gb:CNSPAX03_849577 Pyrococcus abyssi
           complete genome; segment 3/6.
          Length = 694

 Score = 33.9 bits (76), Expect = 4.4
 Identities = 28/116 (24%), Positives = 50/116 (43%)
 Frame = -1

Query: 501 LQKIPKGRDVEDDDTFVFNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDA 322
           L+K+ +G  +E+ D++ F+  F  P Y+IKV  +      E   +          Y    
Sbjct: 117 LKKLEEGLVLEEGDSYKFSSPF--PSYKIKVTDVPSDSAAEFEIT----------YPNGQ 164

Query: 321 AIVRIMKTRKVLSHTLLIAELFQQLKFPIKPADLKKRIESLIDREYLERDKSNPQI 154
            + R ++    LS +  + EL Q     +K    +K  + ++D    +   SNPQI
Sbjct: 165 TVKREIEVNSALSISYKVGELTQSSYIVVKLIKAEKNNKVVVDIYGAKVTFSNPQI 220



>gb:AF132669_2200789 White spot syndrome virus ribonucleotide
           reductase large subunit RR1 gene, complete cds.
          Length = 848

 Score = 33.5 bits (75), Expect = 5.8
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 3/84 (3%)
 Frame = -1

Query: 450 FNDQFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLL 271
           F   F  P  R  V+  +MK  V+  T   ++V     Y VD   +  MKTR +      
Sbjct: 477 FVKYFPIPSLRPYVDYREMKRVVKIMTRNLDKVIDVNFYAVDKTRISNMKTRPMGLGVQG 536

Query: 270 IAELFQQLKFPIKPAD---LKKRI 208
           +A+LF +L+ P +  +   + KRI
Sbjct: 537 LADLFFKLRIPFESEEAALINKRI 560



>gb:CR380950_1649691 Candida glabrata strain CBS138 chromosome D
            complete sequence.
          Length = 1980

 Score = 33.5 bits (75), Expect = 5.8
 Identities = 34/152 (22%), Positives = 69/152 (45%), Gaps = 4/152 (2%)
 Frame = -1

Query: 609  NEAEKFSFQDIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTA 430
            N+      +D    I  +D+EL+    ++A  K ++L+   K +D+ED    +F D   +
Sbjct: 1321 NKELNLRLEDYSAKIDAKDEELKLANDAVASTKKKMLKLEEKIKDLEDTQ-HIFKDSENS 1379

Query: 429  PLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLIAELFQQ 250
                ++  A++M E   +N +   ++  + Q   D  I    +T + L     +A+L  +
Sbjct: 1380 LKSELEKTALEMNELRSDNDNII-KLKNELQRTNDKLIEENKRTEEKLRSE--VAKLKDE 1436

Query: 249  LKFPIKPADLKKRI----ESLIDREYLERDKS 166
            LK      + ++++     S I +EY E+  S
Sbjct: 1437 LKTKSDTFEKERKLMNEDSSTIIKEYSEKISS 1468



>gb:AE014291_307934 Brucella suis 1330 chromosome I, complete
           sequence.
          Length = 430

 Score = 33.5 bits (75), Expect = 5.8
 Identities = 30/93 (32%), Positives = 39/93 (41%), Gaps = 3/93 (3%)
 Frame = -1

Query: 582 DIKEAIGIEDKELRRTLQSLACGKVRVLQKIPKGRDVEDDDTFVFNDQFTAPLYR---IK 412
           DI  A   ++ EL R  Q        ++Q+I    D  DD  F   D+FT   YR   I 
Sbjct: 105 DILTASKFDEGELEREKQV-------IMQEIGAAHDTPDDIVF---DRFTETAYRHQPIG 154

Query: 411 VNAIQMKETVEENTSTTERVFQDRQYQVDAAIV 313
              +   ETV   TS   R +   QY VD  +V
Sbjct: 155 RAILGEPETVMSFTSDDLRQYMQEQYSVDRMVV 187



>pir|F96977|F96977 probable phosphatase [imported] - Clostridium
           acetobutylicum>gb:AE007578_227970 Clostridium
           acetobutylicum ATCC 824 section 66 of 356 of the
           complete genome.>gb:AE001437_1090925 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 215

 Score = 32.7 bits (73), Expect = 9.8
 Identities = 14/37 (37%), Positives = 22/37 (59%)
 Frame = -1

Query: 249 LKFPIKPADLKKRIESLIDREYLERDKSNPQIYNYLA 139
           +K+ I   +L K+   L+  +Y+ER K NP I+ Y A
Sbjct: 118 IKYIINNFELAKQFNELVTGDYVERSKPNPDIFLYAA 154


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 958,948,465
Number of Sequences: 1806583
Number of extensions: 20051988
Number of successful extensions: 55781
Number of sequences better than 10.0: 196
Number of HSP's better than 10.0 without gapping: 53685
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 55443
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 62990696208
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)