BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig9766
         (719 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY730335_1625407 Solanum tuberosum strain P6/210 clone BAC BA...   320   1e-86   
gb:AB090881_1524972 Aster tripolium mRNA for serine/threonine pr...   266   3e-70   
pir|T51453|T51453 serine/threonine specific protein kinase-like ...   256   2e-67   Arabidopsis thaliana [mouse-ear cress]
gb:AY087034_1572070 Arabidopsis thaliana clone 30775 mRNA, compl...   251   9e-66   
gb:AY057584_1563997 Arabidopsis thaliana AT3g01300/T22N4_7 mRNA,...   251   9e-66   
gb:ATAC008261_1542788 Arabidopsis thaliana chromosome III BAC T4...   251   9e-66   
gb:AP003300_1827660 Oryza sativa (japonica cultivar-group) genom...   247   2e-64   
gb:AP005508_1853071 Oryza sativa (japonica cultivar-group) genom...   241   7e-63   
gb:AP000420_1820165 Arabidopsis thaliana genomic DNA, chromosome...   233   2e-60   
gb:AB023482_1515614 Oryza sativa (japonica cultivar-group) genom...   171   1e-41   
gb:AK117952_1815959 Arabidopsis thaliana At5g01020 mRNA for puta...   154   2e-36   
gb:ATF7J8_1550981 Arabidopsis thaliana DNA chromosome 5, BAC clo...   154   2e-36   
gb:AY220481_1590515 Nicotiana tabacum Avr9/Cf-9 induced kinase 1...   153   3e-36   
gb:AF332960_1787292 Lycopersicon esculentum auxin-regulated dual...   147   2e-34   
gb:AP003277_1827082 Oryza sativa (japonica cultivar-group) genom...   146   4e-34   
pir|C84473|C84473 probable protein kinase [imported] - Arabidops...   146   4e-34   Arabidopsis thaliana [mouse-ear cress]
gb:AP004744_1844232 Oryza sativa (japonica cultivar-group) genom...   145   7e-34   
gb:AC079022_1541726 Oryza sativa chromosome 5 clone P0574H01, co...   145   9e-34   
gb:AC125472_1740503 Oryza sativa (japonica cultivar-group) chrom...   144   1e-33   
gb:AE016959_1022408 Oryza sativa (japonica cultivar-group) chrom...   140   2e-32   
gb:AC093018_1735842 Oryza sativa chromosome 3 BAC OSJNBb0081B07 ...   139   5e-32   
gb:AB009049_1510614 Arabidopsis thaliana genomic DNA, chromosome...   138   1e-31   
sp|Q06548|APKA_ARATH|APKA_ARATH Protein kinase APK1A (EC 2.7.1.-).>pir|S286...   138   1e-31   Arabidopsis thaliana [mouse-ear cress]
pir|C96641|C96641 hypothetical protein T25B24.6 [imported] - Ara...   137   1e-31   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00055_1693993 Oryza sativa genomic DNA, chromosome 4, BAC...   137   3e-31   
sp|P43293|NAK_ARATH|NAK_ARATH Probable serine/threonine-protein kinase NAK...   136   3e-31   Arabidopsis thaliana [mouse-ear cress]
gb:AP005198_1849311 Oryza sativa (japonica cultivar-group) genom...   136   4e-31   
gb:AP004586_1841916 Oryza sativa (japonica cultivar-group) genom...   135   7e-31   
gb:AP004084_1837460 Oryza sativa (japonica cultivar-group) genom...   134   1e-30   
gb:AP004858_1846106 Oryza sativa (japonica cultivar-group) genom...   134   2e-30   
gb:AP004685_1843366 Oryza sativa (japonica cultivar-group) genom...   133   3e-30   
gb:AC135288_1742197 Solanum demissum chromosome 5 BAC PGEC219 ge...   133   4e-30   
gb:ATHPRKINA_1553318 Arabidopsis thaliana Columbia protein kinas...   133   4e-30   
gb:AC099401_1737157 Oryza sativa (japonica cultivar-group) chrom...   132   5e-30   
gb:AP004991_1846842 Oryza sativa (japonica cultivar-group) genom...   132   6e-30   
gb:AC145120_1744276 Solanum demissum chromosome 5 BAC PGEC446O19...   132   6e-30   
gb:AY150474_1585039 Arabidopsis thaliana putative protein kinase...   132   6e-30   
gb:AY080806_1568505 Arabidopsis thaliana putative protein kinase...   132   6e-30   
gb:AC073556_1541104 Oryza sativa chromosome 3 BAC OSJNBa0091P11 ...   132   6e-30   
pir|A84483|A84483 probable protein kinase [imported] - Arabidops...   132   6e-30   Arabidopsis thaliana [mouse-ear cress]
gb:AP005419_1851480 Oryza sativa (japonica cultivar-group) genom...   132   8e-30   
pir|G96749|G96749 hypothetical protein F28P22.27 [imported] - Ar...   131   1e-29   Arabidopsis thaliana [mouse-ear cress]
gb:ATAC015985_1543577 Arabidopsis thaliana chromosome III BAC F8...   130   2e-29   
sp|P46573|APKB_ARATH|APKB_ARATH Protein kinase APK1B (EC 2.7.1.-).>pir|T027...   130   2e-29   Arabidopsis thaliana [mouse-ear cress]
gb:AP005299_1850138 Oryza sativa (japonica cultivar-group) genom...   130   2e-29   
pir|T02726|T02726 probable protein kinase [imported] - Arabidops...   129   5e-29   Arabidopsis thaliana [mouse-ear cress]
gb:AE005172_889763 Arabidopsis thaliana chromosome 1, top arm co...   129   7e-29   
pir|T48353|T48353 protein kinase-like - Arabidopsis thaliana>gb:...   128   9e-29   Arabidopsis thaliana [mouse-ear cress]
gb:BT010769_1640715 Arabidopsis thaliana At2g26290 gene, complet...   128   1e-28   
gb:AY085132_1570213 Arabidopsis thaliana clone 13257 mRNA, compl...   128   1e-28   
gb:ATHSTPK_1553403 Arabidopsis thaliana protein kinase (ARSK1) g...   128   1e-28   
pir|F84658|F84658 probable protein kinase [imported] - Arabidops...   128   1e-28   Arabidopsis thaliana [mouse-ear cress]
gb:BT004631_1637665 Arabidopsis thaliana At2g39110 gene, complet...   127   2e-28   
pir|C84813|C84813 probable protein kinase [imported] - Arabidops...   127   2e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AB023031_1515321 Arabidopsis thaliana genomic DNA, chromosome...   127   2e-28   
gb:AY536850_1612404 Arabidopsis thaliana putative protein kinase...   127   3e-28   
gb:AC007127_1535275 Arabidopsis thaliana chromosome 2 clone T23A...   127   3e-28   
pir|E84549|E84549 probable protein kinase [imported] - Arabidops...   127   3e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AF131222_1770837 Lophopyrum elongatum protein serine/threonin...   126   3e-28   
gb:AE016959_1022495 Oryza sativa (japonica cultivar-group) chrom...   126   3e-28   
gb:AP004048_1836910 Oryza sativa (japonica cultivar-group) genom...   126   4e-28   
gb:ATHAPK1B_1553001 A. thaliana APK1b gene for protein kinase, p...   124   1e-27   
gb:AE016959_1022718 Oryza sativa (japonica cultivar-group) chrom...   124   2e-27   
gb:AE016959_1022791 Oryza sativa (japonica cultivar-group) chrom...   124   2e-27   
pir|T00848|T00848 probable serine/threonine-specific protein kin...   124   2e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AC134886_1741831 Oryza sativa chromosome 3 BAC OSJNBa0002D18 ...   123   3e-27   
gb:AC098693_1736830 Oryza sativa (japonica cultivar-group) chrom...   123   3e-27   
gb:AK117389_1815427 Arabidopsis thaliana At2g02800 mRNA for puta...   122   5e-27   
gb:AP005111_1848028 Oryza sativa (japonica cultivar-group) genom...   122   6e-27   
gb:AP005111_1848027 Oryza sativa (japonica cultivar-group) genom...   122   6e-27   
gb:OSJN00112_1695130 Oryza sativa genomic DNA, chromosome 4, BAC...   122   6e-27   
gb:BT003347_1636770 Arabidopsis thaliana serine/threonine-specif...   122   6e-27   
gb:BT000431_1634709 Arabidopsis thaliana serine/threonine-specif...   122   6e-27   
pir|T47684|T47684 serine/threonine-specific protein kinase-like ...   122   6e-27   Arabidopsis thaliana [mouse-ear cress]
gb:BT015737_1642355 Arabidopsis thaliana At1g69790 mRNA, complet...   121   1e-26   
pir|A96720|A96720 hypothetical protein T6C23.1 [imported] - Arab...   121   1e-26   Arabidopsis thaliana [mouse-ear cress]
gb:AK118934_1816884 Arabidopsis thaliana At1g76360 mRNA for puta...   120   2e-26   
pir|T52285|T52285 serine/threonine-specific protein kinase APK2a...   120   2e-26   Arabidopsis thaliana [mouse-ear cress]
pir|B96791|B96791 hypothetical protein F15M4.14 [imported] - Ara...   120   2e-26   Arabidopsis thaliana [mouse-ear cress]
gb:AP004868_1846287 Oryza sativa (japonica cultivar-group) genom...   120   2e-26   
gb:AP005092_1847661 Oryza sativa (japonica cultivar-group) genom...   119   5e-26   
gb:AP003280_1827145 Oryza sativa (japonica cultivar-group) genom...   119   5e-26   
gb:AC119289_1739641 Oryza sativa (japonica cultivar-group) chrom...   119   5e-26   
gb:AY395743_1604832 Vitis aestivalis protein kinase-like protein...   119   7e-26   
pir|T48301|T48301 protein kinase-like - Arabidopsis thaliana>gb:...   119   7e-26   Arabidopsis thaliana [mouse-ear cress]
gb:AP000410_1820018 Arabidopsis thaliana genomic DNA, chromosome...   118   9e-26   
gb:AC104280_1737456 Oryza sativa (japonica cultivar-group) chrom...   118   9e-26   
gb:BT003881_1637008 Arabidopsis thaliana clone RAFL15-23-A08 (R2...   118   9e-26   
gb:AY091071_1574298 Arabidopsis thaliana putative protein kinase...   118   9e-26   
pir|E84587|E84587 probable protein kinase [imported] - Arabidops...   118   9e-26   Arabidopsis thaliana [mouse-ear cress]
sp|Q9FE20|PBS1_ARATH|PBS1_ARATH Serine/threonine-protein kinase PBS1 (EC 2....   118   9e-26   Arabidopsis thaliana [mouse-ear cress]
gb:AP004570_1841747 Oryza sativa (japonica cultivar-group) genom...   118   1e-25   
gb:AP003266_1826760 Oryza sativa (japonica cultivar-group) genom...   117   2e-25   
gb:BT020268_1642663 Arabidopsis thaliana At1g26970 mRNA, complet...   117   2e-25   
pir|G86396|G86396 protein T7N9.2 [imported] - Arabidopsis thalia...   117   2e-25   Arabidopsis thaliana [mouse-ear cress]
gb:AB041504_1519670 Populus nigra PnPK2 mRNA for protein kinase ...   117   3e-25   
gb:AB041503_1519669 Populus nigra PnPK1 mRNA for protein kinase ...   117   3e-25   
pir|T00574|T00574 probable protein kinase [imported] - Arabidops...   116   4e-25   Arabidopsis thaliana [mouse-ear cress]
gb:AP005199_1849344 Oryza sativa (japonica cultivar-group) genom...   115   6e-25   
gb:AP002525_1822425 Oryza sativa (japonica cultivar-group) genom...   115   6e-25   
gb:AP003614_1831401 Oryza sativa (japonica cultivar-group) genom...   115   8e-25   
gb:AY007545_1558031 Brassica napus protein serine/threonine kina...   115   8e-25   
gb:BT004627_1637661 Arabidopsis thaliana At3g07070 gene, complet...   115   1e-24   
gb:ATAC012395_1543484 Arabidopsis thaliana chromosome III BAC T1...   115   1e-24   
gb:AK117450_1815484 Arabidopsis thaliana At3g58690 mRNA for puta...   114   1e-24   
gb:AB025609_1516337 Arabidopsis thaliana genomic DNA, chromosome...   114   1e-24   
pir|T49152|T49152 serine/threonine-specific protein kinase-like ...   114   1e-24   Arabidopsis thaliana [mouse-ear cress]
sp|Q9LQQ8|RCK7_ARATH|RCK7_ARATH Putative serine/threonine-protein kinase RL...   112   5e-24   Arabidopsis thaliana [mouse-ear cress]
pir|G84686|G84686 probable protein kinase [imported] - Arabidops...   112   7e-24   Arabidopsis thaliana [mouse-ear cress]
gb:AP003418_1829222 Oryza sativa (japonica cultivar-group) genom...   112   9e-24   
pir|T07699|T07699 hypothetical protein F17N18.80 - Arabidopsis t...   112   9e-24   Arabidopsis thaliana [mouse-ear cress]
gb:ATAC018363_1543686 Arabidopsis thaliana chromosome III BAC F1...   111   1e-23   
gb:AB028609_1517917 Arabidopsis thaliana genomic DNA, chromosome...   111   1e-23   
gb:AP006756_1862889 Oryza sativa (japonica cultivar-group) genom...   111   1e-23   
gb:AP006162_1861144 Oryza sativa (japonica cultivar-group) genom...   111   1e-23   
gb:F11A17_1677318 Arabidopsis thaliana chromosome 1 BAC F11A17 s...   110   2e-23   
gb:BT008338_1639555 Arabidopsis thaliana At1g74490 mRNA, complet...   110   2e-23   
gb:AY125515_1580323 Arabidopsis thaliana AT4g02010/T10M13_2 mRNA...   110   2e-23   
pir|T01502|T01502 probable serine/threonine-specific protein kin...   110   2e-23   Arabidopsis thaliana [mouse-ear cress]
pir|A96522|A96522 protein F21D18.6 [imported] - Arabidopsis thal...   110   2e-23   Arabidopsis thaliana [mouse-ear cress]
pir|H96773|H96773 hypothetical protein F1M20.17 [imported] - Ara...   110   2e-23   Arabidopsis thaliana [mouse-ear cress]
gb:AP000816_1820640 Oryza sativa (japonica cultivar-group) genom...   110   3e-23   
gb:AP002953_1823973 Oryza sativa (japonica cultivar-group) genom...   109   4e-23   
gb:AF249318_1780697 Glycine max Pti1 kinase-like protein (Pti1b)...   109   4e-23   
gb:AC092852_1735770 Oryza sativa chromosome 3 BAC OSJNBa0032G11 ...   109   4e-23   
gb:AY263347_1593758 Glycine max protein kinase Pti1 (Pti1) mRNA,...   109   4e-23   
gb:AY708048_1623886 Zea mays salt-inducible putative protein ser...   109   6e-23   
gb:AF249317_1780696 Glycine max Pti1 kinase-like protein (Pti1a)...   108   7e-23   
gb:AY054639_1563293 Arabidopsis thaliana protein kinase-like pro...   108   7e-23   
gb:AC004450_1531709 Arabidopsis thaliana chromosome 2 clone F14B...   108   7e-23   
gb:AB121973_1528021 Brassica rapa MLPK mRNA for protein kinase, ...   108   7e-23   
pir|F84863|F84863 probable protein kinase [imported] - Arabidops...   108   7e-23   Arabidopsis thaliana [mouse-ear cress]
pir|T49003|T49003 protein kinase-like protein - Arabidopsis thal...   108   7e-23   Arabidopsis thaliana [mouse-ear cress]
pir|B84712|B84712 probable protein kinase [imported] - Arabidops...   108   7e-23   Arabidopsis thaliana [mouse-ear cress]
gb:AP003864_1834495 Oryza sativa (japonica cultivar-group) genom...   108   1e-22   
gb:AC113332_1738903 Oryza sativa (japonica cultivar-group) chrom...   108   1e-22   
gb:AC098693_1736831 Oryza sativa (japonica cultivar-group) chrom...   107   2e-22   
pir|T02132|T02132 probable serine/threonine-specific protein kin...   107   2e-22   Arabidopsis thaliana [mouse-ear cress]
pir|D84848|D84848 probable protein kinase [imported] - Arabidops...   107   2e-22   Arabidopsis thaliana [mouse-ear cress]
gb:ATF8D20_1551119 Arabidopsis thaliana DNA chromosome 4, BAC cl...   107   3e-22   
gb:AB005242_1509517 Arabidopsis thaliana genomic DNA, chromosome...   107   3e-22   
pir|T04665|T04665 probable serine/threonine-specific protein kin...   107   3e-22   Arabidopsis thaliana [mouse-ear cress]
pir|C85420|C85420 protein kinase-like protein [imported] - Arabi...   107   3e-22   Arabidopsis thaliana [mouse-ear cress]
sp|P27450|CX32_ARATH|CX32_ARATH Probable serine/threonine-protein kinase Cx...   107   3e-22   Arabidopsis thaliana [mouse-ear cress]
gb:AP002537_1822501 Oryza sativa (japonica cultivar-group) genom...   106   4e-22   
gb:AJ608156_1811970 Nicotiana tabacum mRNA for protein kinase 1 ...   106   4e-22   
gb:AC132492_1741212 Oryza sativa (japonica cultivar-group) chrom...   106   4e-22   
gb:AY494981_1608865 Triticum turgidum A genome HMW glutenin A ge...   106   4e-22   
gb:AY150374_1584939 Arabidopsis thaliana putative kinase interac...   106   4e-22   
gb:AC007592_1535979 Genomic sequence for Arabidopsis thaliana BA...   106   4e-22   
pir|F86201|F86201 probable protein kinase [imported] - Arabidops...   106   4e-22   Arabidopsis thaliana [mouse-ear cress]
pir|C96791|C96791 hypothetical protein F15M4.13 [imported] - Ara...   106   4e-22   Arabidopsis thaliana [mouse-ear cress]
gb:AC134931_1741948 Oryza sativa (japonica cultivar-group) chrom...   105   6e-22   
gb:AJ608157_1811971 Nicotiana tabacum mRNA for protein kinase 2 ...   105   8e-22   
gb:AC087552_1734100 Oryza sativa (japonica cultivar-group) chrom...   105   8e-22   
gb:AY224476_1590678 Oryza sativa (japonica cultivar-group) isola...   105   8e-22   
gb:AX093394_1461117 Sequence 13 from Patent WO0118061.                105   8e-22   
pir|A84712|A84712 probable protein kinase [imported] - Arabidops...   105   8e-22   Arabidopsis thaliana [mouse-ear cress]
gb:AF370260_1792145 Arabidopsis thaliana putative protein kinase...   105   1e-21   
pir|T02181|T02181 probable protein kinase [imported] - Arabidops...   105   1e-21   Arabidopsis thaliana [mouse-ear cress]
gb:AF023164_1762043 Zea mays leucine-rich repeat transmembrane p...   104   1e-21   
gb:AY094451_1575749 Arabidopsis thaliana At5g56885 mRNA, complet...   104   1e-21   
gb:AC069144_1540630 Arabidopsis thaliana chromosome 1 BAC F14C21...   104   1e-21   
pir|B96590|B96590 hypothetical protein T22H22.21 [imported] - Ar...   104   1e-21   Arabidopsis thaliana [mouse-ear cress]
pir|T01267|T01267 leucine-rich repeat transmembrane protein kina...   104   1e-21   Zea mays [maize]
pir|T01268|T01268 leucine-rich repeat transmembrane protein kina...   104   1e-21   Zea mays [maize]
gb:AP005839_1858834 Oryza sativa (japonica cultivar-group) genom...   104   2e-21   
gb:AC079633_1732639 Genomic Sequence for Oryza sativa, Nipponbar...   104   2e-21   
gb:AY368673_1602937 Triticum turgidum HMW-glutenin locus, comple...   104   2e-21   
gb:AY054678_1563332 Arabidopsis thaliana similar to Pto kinase i...   104   2e-21   
pir|T48014|T48014 serine/threonine protein kinase-like protein -...   104   2e-21   Arabidopsis thaliana [mouse-ear cress]
gb:AC147426_1744672 Oryza sativa chromosome 3 B1377B10 genomic s...   103   2e-21   
gb:AY268139_1593945 Hordeum vulgare BAC 184G9, complete sequece.      103   2e-21   
gb:AK176466_1818454 Arabidopsis thaliana mRNA, complete cds, clo...   103   3e-21   
gb:AE005172_891020 Arabidopsis thaliana chromosome 1, top arm co...   103   3e-21   
gb:OSJN00068_1694248 Oryza sativa genomic DNA, chromosome 4, BAC...   103   4e-21   
gb:AB022216_1515058 Arabidopsis thaliana genomic DNA, chromosome...   103   4e-21   
pir|G86239|G86239 protein F20B24.6 [imported] - Arabidopsis thal...   103   4e-21   Arabidopsis thaliana [mouse-ear cress]
gb:AP004865_1846234 Oryza sativa (japonica cultivar-group) genom...   102   5e-21   
gb:AP002901_1823734 Oryza sativa (japonica cultivar-group) genom...   101   1e-20   
gb:AP002901_1823733 Oryza sativa (japonica cultivar-group) genom...   101   1e-20   
gb:AC108500_1738477 Oryza sativa (japonica cultivar-group) chrom...   101   1e-20   
gb:LEU28007_1684726 Lycopersicon esculentum Pto kinase interacto...   101   1e-20   
gb:AY026759_1559033 Arabidopsis thaliana protein kinase AtSIK mR...   101   2e-20   
gb:AC012562_1537733 Arabidopsis thaliana chromosome 3 BAC F17O14...   101   2e-20   
gb:AB013392_1512117 Arabidopsis thaliana genomic DNA, chromosome...   101   2e-20   
gb:AC129720_1740666 Oryza sativa (japonica cultivar-group) chrom...   100   2e-20   
gb:BT000971_1635226 Arabidopsis thaliana clone C104780 unknown p...   100   2e-20   
gb:AY056259_1563577 Arabidopsis thaliana unknown protein (At5g56...   100   2e-20   
gb:AP002972_1824065 Oryza sativa (japonica cultivar-group) genom...   100   3e-20   
gb:OSJN00051_1693921 Oryza sativa genomic DNA, chromosome 4, BAC...   100   4e-20   
pir|E71446|E71446 probable protein kinase - Arabidopsis thaliana...   100   4e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AP003302_1827705 Oryza sativa (japonica cultivar-group) genom...    99   8e-20   
gb:AP005849_1859071 Oryza sativa (japonica cultivar-group) genom...    99   1e-19   
gb:AC091787_1735101 Oryza sativa (japonica cultivar-group) chrom...    99   1e-19   
pir|G96593|G96593 probable protein kinase, 86372-89112 [imported...    98   1e-19   Arabidopsis thaliana [mouse-ear cress]
pir|F96577|F96577 hypothetical protein F22G10.3 [imported] - Ara...    98   1e-19   Arabidopsis thaliana [mouse-ear cress]
gb:AP004308_1839999 Oryza sativa (japonica cultivar-group) genom...    98   2e-19   
gb:AY224517_1590714 Oryza sativa (japonica cultivar-group) isola...    98   2e-19   
gb:AB022220_1515144 Arabidopsis thaliana genomic DNA, chromosome...    98   2e-19   
gb:AB005231_1509264 Arabidopsis thaliana genomic DNA, chromosome...    98   2e-19   
gb:AE016959_1022362 Oryza sativa (japonica cultivar-group) chrom...    98   2e-19   
gb:AP001307_1821106 Arabidopsis thaliana genomic DNA, chromosome...    97   2e-19   
gb:AC107226_1738418 Oryza sativa (japonica cultivar-group) chrom...    97   2e-19   
gb:AY664415_1620622 Zea mays cultivar B73 locus 9009, complete s...    97   2e-19   
gb:AY139778_1582395 Arabidopsis thaliana AT3g13690/MMM17_12 mRNA...    97   2e-19   
pir|D96728|D96728 hypothetical protein F24J13.3 [imported] - Ara...    97   2e-19   Arabidopsis thaliana [mouse-ear cress]
gb:AY518293_1610795 Arabidopsis thaliana strubbelig receptor fam...    97   4e-19   
pir|T49120|T49120 serine/threonine protein kinase like protein -...    97   4e-19   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00054_1693976 Oryza sativa genomic DNA, chromosome 4, BAC...    96   5e-19   
gb:ATF2I11_1550489 Arabidopsis thaliana DNA chromosome 5, BAC cl...    96   5e-19   
gb:AP005386_1850809 Oryza sativa (japonica cultivar-group) genom...    96   6e-19   
pir|C96728|C96728 hypothetical protein F24J13.2 [imported] - Ara...    96   6e-19   Arabidopsis thaliana [mouse-ear cress]
gb:AP003518_1830289 Oryza sativa (japonica cultivar-group) genom...    95   1e-18   
gb:AC084405_1733619 Oryza sativa chromosome 3 BAC OSJNBa0044H10 ...    95   1e-18   
gb:AB110953_1527050 Nicotiana tabacum NtPERK1 mRNA for PERK1-lik...    94   2e-18   
gb:AC006234_1533809 Arabidopsis thaliana chromosome 2 clone F5H1...    94   2e-18   
pir|D96711|D96711 hypothetical protein F24J5.8 [imported] - Arab...    94   2e-18   Arabidopsis thaliana [mouse-ear cress]
pir|B84594|B84594 probable LRR receptor protein kinase [imported...    94   2e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AP002882_1823607 Oryza sativa (japonica cultivar-group) genom...    94   3e-18   
gb:AC084319_1733485 Oryza sativa chromosome 3 BAC OSJNBa0004B24 ...    94   3e-18   
gb:AY065457_1566562 Arabidopsis thaliana putative protein kinase...    94   3e-18   
gb:AC137001_1743353 Oryza sativa (japonica cultivar-group) chrom...    93   4e-18   
gb:AY224526_1590723 Oryza sativa (japonica cultivar-group) isola...    93   4e-18   
gb:AY518290_1610792 Arabidopsis thaliana strubbelig receptor fam...    92   7e-18   
gb:AP004324_1840160 Oryza sativa (japonica cultivar-group) genom...    92   9e-18   
pir|F86387|F86387 probable Pto kinase interactor [imported] - Ar...    92   9e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AY518288_1610790 Arabidopsis thaliana strubbelig receptor fam...    92   1e-17   
pir|A85043|A85043 probable LRR receptor-like protein kinase [imp...    92   1e-17   Arabidopsis thaliana [mouse-ear cress]
pir|F84682|F84682 probable protein kinase [imported] - Arabidops...    91   2e-17   Arabidopsis thaliana [mouse-ear cress]
gb:ATT30N20_1555820 Arabidopsis thaliana DNA chromosome 5, BAC c...    91   2e-17   
pir|T50811|T50811 ser/thr specific protein kinase-like protein -...    91   2e-17   Arabidopsis thaliana [mouse-ear cress]
pir|T51791|T51791 ser/thr specific protein kinase-like protein -...    91   2e-17   Arabidopsis thaliana [mouse-ear cress]
pir|T01477|T01477 protein kinase homolog F17O7.1 - Arabidopsis t...    91   2e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AP003705_1832164 Oryza sativa (japonica cultivar-group) genom...    91   3e-17   
gb:AY518289_1610791 Arabidopsis thaliana strubbelig receptor fam...    91   3e-17   
gb:AP004082_1837433 Oryza sativa (japonica cultivar-group) genom...    90   4e-17   
gb:AP003992_1836055 Oryza sativa (japonica cultivar-group) genom...    90   4e-17   
gb:AC134344_1741747 Oryza sativa (japonica cultivar-group) chrom...    90   4e-17   
gb:AC007945_1536371 Genomic sequence for Arabidopsis thaliana BA...    90   4e-17   
pir|B86369|B86369 hypothetical protein F5O8.10 - Arabidopsis tha...    90   4e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AP002953_1823972 Oryza sativa (japonica cultivar-group) genom...    90   5e-17   
pir|T01711|T01711 probable serine/threonine-specific protein kin...    90   5e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AY518287_1610789 Arabidopsis thaliana strubbelig receptor fam...    89   6e-17   
gb:AC091532_1734806 Oryza sativa chromosome 3 BAC OSJNBa0078A17 ...    89   8e-17   
pir|A96574|A96574 protein F12M16.30 [imported] - Arabidopsis tha...    89   8e-17   Arabidopsis thaliana [mouse-ear cress]
pir|A96563|A96563 probable protein kinase 60711-62822 [imported]...    89   8e-17   Arabidopsis thaliana [mouse-ear cress]
pir|T04124|T04124 receptor-like protein kinase (EC 2.7.1.-) - ri...    89   8e-17   Oryza sativa [red rice]
gb:AY093964_1575470 Arabidopsis thaliana At1g01540/F22L4_6 mRNA,...    89   1e-16   
gb:ATY12776_1557476 Arabidopsis thaliana DNA, 40 kb surrounding ...    89   1e-16   
pir|A86146|A86146 hypothetical protein F22L4.8 - Arabidopsis tha...    89   1e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AP005769_1857548 Oryza sativa (japonica cultivar-group) genom...    88   1e-16   
gb:AP003866_1834552 Oryza sativa (japonica cultivar-group) genom...    88   1e-16   
gb:BT008409_1639626 Arabidopsis thaliana At3g24600 gene, complet...    88   1e-16   
gb:AY536856_1612410 Arabidopsis thaliana putative protein kinase...    88   1e-16   
gb:AB020746_1514623 Arabidopsis thaliana genomic DNA, chromosome...    88   1e-16   
gb:AX088876_1461047 Sequence 1 from Patent WO0114563.>gb:AX82570...    88   1e-16   
gb:AP004087_1837530 Oryza sativa (japonica cultivar-group) genom...    88   2e-16   
gb:AP003434_1829307 Oryza sativa (japonica cultivar-group) genom...    88   2e-16   
pir|D84860|D84860 probable protein kinase [imported] - Arabidops...    88   2e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AP000377_1819848 Arabidopsis thaliana genomic DNA, chromosome...    87   2e-16   
gb:AP003813_1833725 Oryza sativa (japonica cultivar-group) genom...    87   3e-16   
gb:AP004752_1844393 Oryza sativa (japonica cultivar-group) genom...    87   4e-16   
gb:AP004752_1844391 Oryza sativa (japonica cultivar-group) genom...    87   4e-16   
gb:AP003579_1831218 Oryza sativa (japonica cultivar-group) genom...    87   4e-16   
gb:AC104473_1737654 Oryza sativa (japonica cultivar-group) chrom...    87   4e-16   
gb:U95973_1726577 Arabidopsis thaliana chromosome 1 BAC T19D16 g...    87   4e-16   
gb:AY091019_1574250 Arabidopsis thaliana unknown protein (At1g11...    87   4e-16   
gb:AB020746_1514621 Arabidopsis thaliana genomic DNA, chromosome...    87   4e-16   
gb:AE016959_1023261 Oryza sativa (japonica cultivar-group) chrom...    87   4e-16   
pir|D86245|D86245 hypothetical protein [imported] - Arabidopsis ...    87   4e-16   Arabidopsis thaliana [mouse-ear cress]
pir|G86227|G86227 hypothetical protein [imported] - Arabidopsis ...    87   4e-16   Arabidopsis thaliana [mouse-ear cress]
pir|T47793|T47793 receptor-like protein kinase - Arabidopsis tha...    86   5e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AB099698_1526154 Arabidopsis thaliana CDG1 mRNA for protein k...    86   7e-16   
gb:AB026649_1517226 Arabidopsis thaliana genomic DNA, chromosome...    86   7e-16   
gb:AB012242_1511712 Arabidopsis thaliana genomic DNA, chromosome...    86   7e-16   
gb:AC104473_1737662 Oryza sativa (japonica cultivar-group) chrom...    86   9e-16   
gb:OSJN00174_1696192 Oryza sativa genomic DNA, chromosome 4, BAC...    86   9e-16   
gb:OSA243961_1692387 Oryza sativa chromosome 4 BAC l1332 genomic...    86   9e-16   
gb:AY163905_1586045 Glycine max receptor-like kinase RHG4 (Rhg4)...    86   9e-16   
pir|E96602|E96602 hypothetical protein T6H22.9 [imported] - Arab...    86   9e-16   
gb:AF142596_1771635 Nicotiana tabacum LRR receptor-like protein ...    85   1e-15   
gb:AC084817_1733839 Oryza sativa (japonica cultivar-group) chrom...    85   1e-15   
gb:AC079288_1732514 Arabidopsis thaliana chromosome 1 BAC T3M22 ...    85   1e-15   
gb:BT008322_1639539 Arabidopsis thaliana At1g56720 gene, complet...    85   1e-15   
gb:BT006178_1639070 Arabidopsis thaliana clone RAFL16-01-D23 (R2...    85   1e-15   
gb:AY087491_1572522 Arabidopsis thaliana clone 36000 mRNA, compl...    85   1e-15   
gb:AC000103_1530024 Genomic sequence for Arabidopsis thaliana BA...    85   1e-15   
gb:AB011476_1511391 Arabidopsis thaliana genomic DNA, chromosome...    85   1e-15   
gb:AE005172_891418 Arabidopsis thaliana chromosome 1, top arm co...    85   1e-15   
pir|T04455|T04455 hypothetical protein F4D11.90 - Arabidopsis th...    85   1e-15   
pir|G84543|G84543 probable protein kinase [imported] - Arabidops...    85   1e-15   
pir|B96609|B96609 probable protein kinase F25P12.84 [imported] -...    85   1e-15   
pir|H86420|H86420 probable receptor-like serine/threonine kinase...    85   1e-15   
gb:AC119292_1739707 Oryza sativa (japonica cultivar-group) chrom...    85   1e-15   
gb:AY536858_1612412 Arabidopsis thaliana putative protein kinase...    85   1e-15   
gb:AP005633_1855149 Oryza sativa (japonica cultivar-group) genom...    84   2e-15   
gb:BT011239_1640989 Arabidopsis thaliana At4g34500 gene, complet...    84   2e-15   
gb:AC009894_1536870 Arabidopsis thaliana chromosome I BAC T6H22 ...    84   2e-15   
gb:AE016959_1023612 Oryza sativa (japonica cultivar-group) chrom...    84   2e-15   
pir|T05270|T05270 probable serine/threonine-specific protein kin...    84   2e-15   
pir|G96602|G96602 probable receptor protein kinase F14G9.24 [imp...    84   2e-15   
gb:AP005474_1852533 Oryza sativa (japonica cultivar-group) genom...    84   3e-15   
gb:AP003222_1825524 Oryza sativa (japonica cultivar-group) genom...    84   3e-15   
sp|P43298|TMK1_ARATH|TMK1_ARATH Putative receptor protein kinase TMK1 precu...    84   3e-15   
gb:AP000382_1819890 Arabidopsis thaliana genomic DNA, chromosome...    84   3e-15   
gb:AX196340_1463947 Sequence 47 from Patent WO0151627.                 84   3e-15   
gb:AX196339_1463946 Sequence 46 from Patent WO0151627.                 84   3e-15   
gb:AX196297_1463927 Sequence 4 from Patent WO0151627.>gb:AX19633...    84   3e-15   
gb:AE016959_1023603 Oryza sativa (japonica cultivar-group) chrom...    84   3e-15   
gb:AF491997_1804885 Pisum sativum SYM19 mRNA, complete cds.            83   4e-15   
gb:PSA418376_1701991 Pisum sativum mRNA for nodulation receptor ...    83   4e-15   
gb:PSA418375_1701990 Pisum sativum mRNA for nodulation receptor ...    83   4e-15   
gb:PSA418367_1701989 Pisum sativum mRNA for nodulation receptor ...    83   4e-15   
gb:AY751547_1626695 Sesbania rostrata nodulation receptor kinase...    83   4e-15   
gb:AE016959_1020597 Oryza sativa (japonica cultivar-group) chrom...    83   4e-15   
gb:AF436829_1799881 Arabidopsis thaliana AT4g26540/M3E9_30 mRNA,...    83   6e-15   
gb:AF285172_1783120 Phaseolus vulgaris leaf senescence-associate...    83   6e-15   
gb:AC136220_1743061 Oryza sativa (japonica cultivar-group) chrom...    83   6e-15   
pir|F96602|F96602 hypothetical protein T6H22.8.2 [imported] - Ar...    83   6e-15   
gb:AP005090_1847614 Oryza sativa (japonica cultivar-group) genom...    82   7e-15   
gb:BT005955_1638877 Arabidopsis thaliana At4g34440 gene, complet...    82   7e-15   
pir|B96690|B96690 probable protein kinase F28G11.10 [imported] -...    82   7e-15   
gb:AP002818_1822874 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
gb:AP002818_1822873 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
gb:AY085517_1570586 Arabidopsis thaliana clone 15535 mRNA, compl...    82   1e-14   
pir|F84564|F84564 probable protein kinase [imported] - Arabidops...    82   1e-14   
gb:AP005469_1852408 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
gb:AC130603_1740791 Oryza sativa (japonica cultivar-group) chrom...    82   1e-14   
gb:VHI428990_1727225 Vicia hirsuta mRNA for nodulation receptor ...    82   1e-14   
gb:AY484588_1608321 Musa acuminata clone MuG9, genomic sequence.       82   1e-14   
gb:AP003022_1824288 Oryza sativa (japonica cultivar-group) genom...    81   2e-14   
gb:AF491998_1804886 Medicago truncatula SYMRK mRNA, complete cds.      81   2e-14   
gb:OSJN00033_1693630 Oryza sativa genomic DNA, chromosome 4, BAC...    81   2e-14   
gb:MTR418371_1687643 Medicago truncatula mRNA for nodulation rec...    81   2e-14   
gb:MTR418369_1687641 Medicago truncatula mRNA for nodulation rec...    81   2e-14   
gb:MSA418368_1687040 Medicago sativa mRNA for nodulation recepto...    81   2e-14   
gb:MAL428991_1685575 Melilotus albus mRNA for nodulation recepto...    81   2e-14   
gb:BT006463_1639350 Arabidopsis thaliana At1g24030 gene, complet...    80   3e-14   
gb:AY064978_1566153 Arabidopsis thaliana At1g21590/F24J8_9 mRNA,...    80   3e-14   
gb:ATU53501_1557079 Arabidopsis thaliana chromosome I cosmid g82...    80   3e-14   
pir|G86348|G86348 hypothetical protein F24J8.18 - Arabidopsis th...    80   3e-14   
pir|T01086|T01086 probable serine/threonine-specific protein kin...    80   3e-14   
pir|F96838|F96838 hypothetical protein T21F11.3 [imported] - Ara...    80   3e-14   
pir|A86374|A86374 protein T23E23.18 [imported] - Arabidopsis tha...    80   3e-14   
gb:AC091494_1734784 Oryza sativa chromosome 3 BAC OSJNBa0070N04 ...    80   4e-14   
gb:AB026654_1517312 Arabidopsis thaliana genomic DNA, chromosome...    80   4e-14   
pir|H86430|H86430 T5I8.2 protein - Arabidopsis thaliana>gb:AE005...    80   4e-14   
pir|T05050|T05050 protein kinase homolog M3E9.30 - Arabidopsis t...    80   4e-14   
pir|E84429|E84429 probable receptor-like protein kinase [importe...    80   4e-14   
gb:AP002865_1823339 Oryza sativa (japonica cultivar-group) genom...    80   5e-14   
gb:AC079288_1732515 Arabidopsis thaliana chromosome 1 BAC T3M22 ...    80   5e-14   
gb:AC007789_1536200 Oryza sativa BAC OSJNBa0049B20 genomic seque...    80   5e-14   
gb:AB019227_1514080 Arabidopsis thaliana genomic DNA, chromosome...    80   5e-14   
pir|G86420|G86420 probable receptor-like serine/threonine kinase...    80   5e-14   
gb:AP004762_1844627 Oryza sativa (japonica cultivar-group) genom...    79   6e-14   
gb:AF492655_1804962 Lotus japonicus receptor-like kinase SYMRK m...    79   6e-14   
gb:AY084363_1569454 Arabidopsis thaliana clone 105458 mRNA, comp...    79   6e-14   
gb:AB028620_1518053 Arabidopsis thaliana genomic DNA, chromosome...    79   6e-14   
gb:AB016873_1512931 Arabidopsis thaliana genomic DNA, chromosome...    79   6e-14   
gb:AP003278_1827097 Oryza sativa (japonica cultivar-group) genom...    79   8e-14   
gb:AP003237_1825950 Oryza sativa (japonica cultivar-group) genom...    79   8e-14   
gb:AC109596_1738727 Oryza sativa (japonica cultivar-group) chrom...    79   8e-14   
gb:AE005172_889761 Arabidopsis thaliana chromosome 1, top arm co...    79   8e-14   
pir|H96533|H96533 hypothetical protein F14J22.6 [imported] - Ara...    79   8e-14   
pir|T45699|T45699 hypothetical protein F18L15.140 - Arabidopsis ...    79   8e-14   
sp|O24585|CRI4_MAIZE|CRI4_MAIZE Putative receptor protein kinase CRINKLY4 p...    79   8e-14   
gb:AP003990_1836012 Oryza sativa (japonica cultivar-group) genom...    79   1e-13   
gb:OSJN00076_1694417 Oryza sativa genomic DNA, chromosome 4, BAC...    79   1e-13   
gb:BT005900_1638822 Arabidopsis thaliana At5g18910 gene, complet...    79   1e-13   
pir|T00546|T00546 serine/threonine-specific protein kinase homol...    79   1e-13   
pir|T45691|T45691 receptor-like protein kinase homolog - Arabido...    79   1e-13   
sp|Q8LPB4|PSKR_DAUCA|PSKR_DAUCA Phytosulfokine receptor precursor (EC 2.7.1...    79   1e-13   
gb:AP004314_1840053 Oryza sativa (japonica cultivar-group) genom...    78   1e-13   
gb:MTR418373_1687644 Medicago truncatula mRNA for nodulation rec...    78   1e-13   
gb:AB025624_1516458 Arabidopsis thaliana genomic DNA, chromosome...    78   1e-13   
gb:AB016879_1513023 Arabidopsis thaliana genomic DNA, chromosome...    78   1e-13   
pir|G86345|G86345 F16F4.7 protein - Arabidopsis thaliana>gb:AE00...    78   1e-13   
gb:AP003770_1833323 Oryza sativa (japonica cultivar-group) genom...    78   2e-13   
gb:AP003282_1827213 Oryza sativa (japonica cultivar-group) genom...    78   2e-13   
gb:AY632360_1618711 Gossypium hirsutum BAC 106I22, complete sequ...    78   2e-13   
gb:AY632359_1618697 Gossypium hirsutum BAC 155C17, complete sequ...    78   2e-13   
gb:AB057787_1521711 Oryza sativa OsCR4 gene, complete cds.>gb:AC...    78   2e-13   
pir|T47532|T47532 protein kinase-like - Arabidopsis thaliana>gb:...    78   2e-13   
pir|T45690|T45690 receptor-like protein kinase homolog - Arabido...    78   2e-13   
gb:AP004263_1839379 Oryza sativa (japonica cultivar-group) genom...    77   2e-13   
gb:AB026643_1517126 Arabidopsis thaliana genomic DNA, chromosome...    77   2e-13   
gb:AF474072_1803107 Hordeum vulgare sp. vulgare cultivar Morex B...    77   3e-13   
pir|F86345|F86345 F16F4.8 protein - Arabidopsis thaliana>gb:AE00...    77   3e-13   
gb:OSJN00084_1694600 Oryza sativa genomic DNA, chromosome 4, BAC...    77   4e-13   
gb:AY224496_1590698 Oryza sativa (japonica cultivar-group) isola...    77   4e-13   
gb:AC025294_1539381 Arabidopsis thaliana chromosome 1 BAC F19C24...    77   4e-13   
pir|A96529|A96529 hypothetical protein F13F21.28 [imported] - Ar...    77   4e-13   
pir|T05264|T05264 probable serine/threonine-specific protein kin...    77   4e-13   
pir|T45697|T45697 hypothetical protein F18L15.120 - Arabidopsis ...    77   4e-13   
pir|D96557|D96557 probable protein kinase [imported] - Arabidops...    77   4e-13   
gb:AP006523_1862133 Oryza sativa (japonica cultivar-group) genom...    76   5e-13   
gb:AF384969_1794544 Arabidopsis thaliana somatic embryogenesis r...    76   5e-13   
gb:AF363827_1791582 Phaseolus vulgaris Pto-like kinase SG5-3d mR...    76   5e-13   
gb:AF338813_1787678 Glycine max putative receptor-like protein k...    76   5e-13   
gb:AB101228_1526290 Arabidopsis thaliana gene for receptor-like ...    76   5e-13   
pir|T08973|T08973 probable serine/threonine-specific protein kin...    76   5e-13   
gb:AP005637_1855222 Oryza sativa (japonica cultivar-group) genom...    76   7e-13   
gb:AP003225_1825607 Oryza sativa (japonica cultivar-group) genom...    76   7e-13   
gb:AP000366_1819746 Oryza sativa (japonica cultivar-group) genom...    76   7e-13   
gb:AY535423_1612313 Lycopersicon esculentum WAK-like kinase mRNA...    76   7e-13   
gb:AY086096_1571154 Arabidopsis thaliana clone 21250 mRNA, compl...    76   7e-13   
gb:AB101213_1526275 Arabidopsis thaliana gene for receptor-like ...    76   7e-13   
pir|T49010|T49010 hypothetical protein F25L23.280 - Arabidopsis ...    76   7e-13   
pir|T02729|T02729 serine/threonine-specific protein kinase (EC 2...    76   7e-13   
pir|A96566|A96566 hypothetical protein F6D8.24 [imported] - Arab...    76   7e-13   
gb:AJ586512_1811828 Fagus sylvatica partial pk9 mRNA for recepto...    75   9e-13   
gb:AC135916_1742802 Genomic sequence for Oryza sativa, Nipponbar...    75   9e-13   
gb:AC007166_1535410 Arabidopsis thaliana chromosome 2 clone F14P...    75   9e-13   
gb:AB012245_1511781 Arabidopsis thaliana genomic DNA, chromosome...    75   9e-13   
gb:AX138094_1462211 Sequence 40 from Patent EP1094113.                 75   9e-13   
gb:AX120059_1461709 Sequence 42 from Patent WO0129240.                 75   9e-13   
gb:CQ768553_1451794 Sequence 48 from Patent WO2004007712.              75   9e-13   
pir|A84498|A84498 probable protein kinase [imported] - Arabidops...    75   9e-13   
pir|T45692|T45692 receptor-like protein kinase homolog - Arabido...    75   9e-13   
pir|T51545|T51545 receptor protein kinase-like protein - Arabido...    75   9e-13   
gb:AF363826_1791581 Phaseolus vulgaris Pto-like kinase SG5-3e mR...    75   1e-12   
gb:BT005388_1638328 Arabidopsis thaliana At5g65530 mRNA, complet...    75   1e-12   
gb:AB101230_1526292 Arabis gemmifera gene for receptor-like prot...    75   1e-12   
gb:AB101229_1526291 Arabidopsis thaliana gene for receptor-like ...    75   1e-12   
gb:AB101226_1526288 Arabidopsis thaliana gene for receptor-like ...    75   1e-12   
gb:AB101218_1526280 Arabidopsis thaliana gene for receptor-like ...    75   1e-12   
gb:AB101217_1526279 Arabidopsis thaliana gene for receptor-like ...    75   1e-12   
gb:AB101216_1526278 Arabidopsis thaliana gene for receptor-like ...    75   1e-12   
gb:AB026639_1517079 Arabidopsis thaliana genomic DNA, chromosome...    75   1e-12   
pir|C96557|C96557 probable receptor protein kinase [imported] - ...    75   1e-12   
gb:AP004680_1843268 Oryza sativa (japonica cultivar-group) genom...    75   2e-12   
gb:AB101227_1526289 Arabidopsis thaliana gene for receptor-like ...    75   2e-12   
gb:AB101225_1526287 Arabidopsis thaliana gene for receptor-like ...    75   2e-12   
gb:AB101215_1526277 Arabidopsis thaliana gene for receptor-like ...    75   2e-12   
gb:AB101214_1526276 Arabidopsis thaliana gene for receptor-like ...    75   2e-12   
pir|T45698|T45698 hypothetical protein F18L15.130 - Arabidopsis ...    75   2e-12   
gb:AP005495_1852859 Oryza sativa (japonica cultivar-group) genom...    74   2e-12   
gb:AF288545_1783476 Solanum berthaultii berS1 putative Pto-like ...    74   2e-12   
gb:ZMA277702_1731487 Zea mays mRNA for SERK1 protein.>gb:ZMA4008...    74   2e-12   
gb:SBRLK1_1704899 Sorghum bicolor mRNA for protein serine/threon...    74   2e-12   
gb:OSJN00007_1693173 Oryza sativa genomic DNA, chromosome 4, BAC...    74   2e-12   
gb:AY563141_1615012 Medicago sativa calcium/calmodulin-regulated...    74   2e-12   
gb:AB101222_1526284 Arabidopsis thaliana gene for receptor-like ...    74   2e-12   
pir|A96557|A96557 probable receptor protein kinase [imported] - ...    74   2e-12   
gb:AP003876_1834687 Oryza sativa (japonica cultivar-group) genom...    74   3e-12   
gb:AC107226_1738413 Oryza sativa (japonica cultivar-group) chrom...    74   3e-12   
gb:AY568379_1615451 Arabidopsis thaliana calmodulin-binding rece...    74   3e-12   
gb:AY081340_1568686 Arabidopsis thaliana putative serine/threoni...    74   3e-12   
gb:ATAC009177_1542852 Arabidopsis thaliana chromosome III BAC T1...    74   3e-12   
gb:AB101224_1526286 Arabidopsis thaliana gene for receptor-like ...    74   3e-12   
gb:AB016886_1513145 Arabidopsis thaliana genomic DNA, chromosome...    74   3e-12   
gb:AB016885_1513120 Arabidopsis thaliana genomic DNA, chromosome...    74   3e-12   
gb:AE005173_894394 Arabidopsis thaliana chromosome 1, bottom arm...    74   3e-12   
gb:AE005172_891084 Arabidopsis thaliana chromosome 1, top arm co...    74   3e-12   
pir|T00512|T00512 serine/threonine-specific protein kinase homol...    74   3e-12   
pir|T14354|T14354 probable somatic embryogenesis receptor-like k...    74   3e-12   
pir|F85343|F85343 hypothetical protein AT4g29450 [imported] - Ar...    74   3e-12   
pir|D86466|D86466 69.4K hypothetical protein F23M19.11 - Arabido...    74   3e-12   
pir|T52588|T52588 wall-associated serine/threonine kinase (EC 2....    74   3e-12   
gb:AP003228_1825697 Oryza sativa (japonica cultivar-group) genom...    74   3e-12   
gb:AF384970_1794545 Arabidopsis thaliana somatic embryogenesis r...    74   3e-12   
gb:AY048200_1561662 Arabidopsis thaliana At1g71830/F14O23_24 mRN...    74   3e-12   
gb:AX120065_1461712 Sequence 48 from Patent WO0129240.                 74   3e-12   
gb:A67827_1450282 Sequence 32 from Patent WO9743427.>gb:CQ768543...    74   3e-12   
gb:AE005173_892850 Arabidopsis thaliana chromosome 1, bottom arm...    74   3e-12   
pir|C96563|C96563 probable protein kinase, 54672-52611 [imported...    74   3e-12   
pir|T05994|T05994 protein kinase homolog F17M5.190 - Arabidopsis...    74   3e-12   
pir|H96740|H96740 hypothetical protein F14O23.21 [imported] - Ar...    74   3e-12   
pir|C96574|C96574 hypothetical protein T3F20.25 [imported] - Ara...    74   3e-12   
pir|A96558|A96558 probable protein kinase [imported] - Arabidops...    74   3e-12   
pir|D96574|D96574 hypothetical protein T3F20.24 [imported] - Ara...    74   3e-12   
sp|Q94F62|BAK1_ARATH|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated re...    74   3e-12   
gb:AP003858_1834409 Oryza sativa (japonica cultivar-group) genom...    73   4e-12   
gb:AP003858_1834408 Oryza sativa (japonica cultivar-group) genom...    73   4e-12   
gb:AK117901_1815909 Arabidopsis thaliana At5g49660 mRNA for puta...    73   4e-12   
gb:AJ841697_1814400 Poa pratensis serk2 gene for somatic embryog...    73   4e-12   
gb:AC087553_1734111 Oryza sativa (japonica cultivar-group) chrom...    73   4e-12   
gb:AY224497_1590699 Oryza sativa (japonica cultivar-group) isola...    73   4e-12   
gb:AY078961_1568114 Arabidopsis thaliana At1g79670/F20B17_27 mRN...    73   4e-12   
pir|A86211|A86211 hypothetical protein [imported] - Arabidopsis ...    73   4e-12   
pir|G96827|G96827 protein F20B17.10 [imported] - Arabidopsis tha...    73   4e-12   
pir|T02731|T02731 serine/threonine-specific protein kinase (EC 2...    73   4e-12   
pir|H96557|H96557 probable protein kinase [imported] - Arabidops...    73   4e-12   
pir|C96558|C96558 probable protein kinase [imported] - Arabidops...    73   4e-12   
pir|B86210|B86210 protein F22G5.6 [imported] - Arabidopsis thali...    73   4e-12   
gb:AP004342_1840507 Oryza sativa (japonica cultivar-group) genom...    73   6e-12   
gb:AP003858_1834406 Oryza sativa (japonica cultivar-group) genom...    73   6e-12   
gb:AJ841698_1814401 Poa pratensis serk1 gene for somatic embryog...    73   6e-12   
gb:BT004165_1637263 Arabidopsis thaliana clone RAFL15-11-G01 (R2...    73   6e-12   
gb:AP005303_1850199 Oryza sativa (japonica cultivar-group) genom...    72   8e-12   
gb:AP004744_1844245 Oryza sativa (japonica cultivar-group) genom...    72   8e-12   
gb:AP004744_1844243 Oryza sativa (japonica cultivar-group) genom...    72   8e-12   
gb:AC137612_1743549 Oryza sativa (japonica cultivar-group) chrom...    72   8e-12   
gb:AC105734_1738070 Oryza sativa (japonica cultivar-group) chrom...    72   8e-12   
gb:PSY250467_1702600 Pinus sylvestris mRNA for receptor protein ...    72   8e-12   
gb:AC069158_1540649 Genomic Sequence for Oryza sativa, Nipponbar...    72   8e-12   
gb:AY088361_1573381 Arabidopsis thaliana clone 6166 mRNA, comple...    72   1e-11   
gb:AY052245_1562618 Arabidopsis thaliana At1g25390/F2J7_14 mRNA,...    72   1e-11   
gb:AB115767_1527521 Citrus unshiu SERK mRNA for somatic embryoge...    72   1e-11   


>gb:AY730335_1625407 Solanum tuberosum strain P6/210 clone BAC
           BA151m8, complete sequence.
          Length = 603

 Score =  320 bits (821), Expect = 1e-86
 Identities = 159/178 (89%), Positives = 168/178 (94%), Gaps = 5/178 (2%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGE NLVEWARPHL E+RRFYRL
Sbjct: 425 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGEHNLVEWARPHLGERRRFYRL 484

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           +DPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMS+VVEALKPLPNLKDMASSSYYFQT
Sbjct: 485 VDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSDVVEALKPLPNLKDMASSSYYFQT 544

Query: 359 MQADRIASSPNTKNGI----VFSKNGQQNPRSLSIPNGSHASPY-RQFSQNSPKPNGK 201
           MQADR+ SSP+TKNG+     FS+NGQQ+PRSLSIPNGSHASPY +QF QNSPKPNGK
Sbjct: 545 MQADRVGSSPSTKNGVRTQGSFSRNGQQHPRSLSIPNGSHASPYHQQFPQNSPKPNGK 602



>gb:AB090881_1524972 Aster tripolium mRNA for serine/threonine
           protein kinase, complete cds.
          Length = 439

 Score =  266 bits (680), Expect = 3e-70
 Identities = 136/176 (77%), Positives = 150/176 (85%), Gaps = 3/176 (1%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYVMTGHL+SKSDVYSFGVVLLEM+TGRRSMDK RPNGE NLVEWARPHL E+RRFYRL
Sbjct: 266 PEYVMTGHLSSKSDVYSFGVVLLEMLTGRRSMDKKRPNGEHNLVEWARPHLGERRRFYRL 325

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           IDPRLEGHFSIKGAQKAAQLA+RCLSRDPKARP+MSEVV+ LKPLP LKDMA  SYY QT
Sbjct: 326 IDPRLEGHFSIKGAQKAAQLASRCLSRDPKARPLMSEVVDCLKPLPALKDMAGPSYYLQT 385

Query: 359 MQADRIASSPNTKNGIV--FSKNGQQNPRSLSIPNGSHASP-YRQFSQNSPKPNGK 201
           +Q +R  SSP+     V  FS+NG Q+PR+LSIPN   ASP + QF Q+SP PNGK
Sbjct: 386 VQPERAGSSPDPNRTRVGSFSRNGSQHPRTLSIPN---ASPRHNQFLQDSPNPNGK 438



>pir|T51453|T51453 serine/threonine specific protein kinase-like -
           Arabidopsis thaliana>gb:ATF2G14_1550456 Arabidopsis
           thaliana DNA chromosome 5, BAC clone F2G14 (ESSA
           project).>gb:AY062520_1565176 Arabidopsis thaliana
           serine/threonine specific protein kinase-like
           (At5g15080; F2G14_200) mRNA, complete
           cds.>gb:BT002577_1636180 Arabidopsis thaliana
           serine/threonine specific protein kinase-like
           (At5g15080) mRNA, complete cds.
          Length = 493

 Score =  256 bits (655), Expect = 2e-67
 Identities = 133/174 (76%), Positives = 145/174 (83%), Gaps = 2/174 (1%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYVMTGHLTSKSDVYSFGVVLLEM+TGRRSMDKNRPNGE NLVEWARPHL +KRRFYRL
Sbjct: 321 PEYVMTGHLTSKSDVYSFGVVLLEMLTGRRSMDKNRPNGEHNLVEWARPHLLDKRRFYRL 380

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           +DPRLEGHFSIKGAQK  QLAA+CLSRDPK RP MS+VVEALKPLP+LKDMASSSYYFQT
Sbjct: 381 LDPRLEGHFSIKGAQKVTQLAAQCLSRDPKIRPKMSDVVEALKPLPHLKDMASSSYYFQT 440

Query: 359 MQADRIASSPNTKNGIVFSKNGQQNP--RSLSIPNGSHASPYRQFSQNSPKPNG 204
           MQA+R+ +      G   S+NGQ  P  R+LS P+GS  SPYR     SPKP G
Sbjct: 441 MQAERLKNGSGRSQGF-GSRNGQHQPVFRTLSSPHGS--SPYRH-QIPSPKPKG 490



>gb:AY087034_1572070 Arabidopsis thaliana clone 30775 mRNA, complete
           sequence.
          Length = 482

 Score =  251 bits (641), Expect = 9e-66
 Identities = 129/174 (74%), Positives = 146/174 (83%), Gaps = 2/174 (1%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYVMTGHLTSKSDVYSFGVVLLEM+TGRRSMDKNRPNGE NLVEWARPHL +KRRFYRL
Sbjct: 307 PEYVMTGHLTSKSDVYSFGVVLLEMLTGRRSMDKNRPNGEHNLVEWARPHLLDKRRFYRL 366

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           +DPRLEGHFS+KGAQK  QLAA+CLSRD K RP MSEVVE LKPLP+LKDMAS+SYYFQT
Sbjct: 367 LDPRLEGHFSVKGAQKVTQLAAQCLSRDSKIRPKMSEVVEVLKPLPHLKDMASASYYFQT 426

Query: 359 MQADRIASSPNTKNGIVF-SKNGQQNPRSLSIPNG-SHASPYRQFSQNSPKPNG 204
           MQA+R+ +   + +G  F S+NGQ   R+LS P+G + +SPYR     SPKP G
Sbjct: 427 MQAERLKAGSGSGSGRGFGSRNGQPVFRTLSSPHGQAGSSPYRH-QIPSPKPKG 479



>gb:AY057584_1563997 Arabidopsis thaliana AT3g01300/T22N4_7 mRNA,
           complete cds.
          Length = 184

 Score =  251 bits (641), Expect = 9e-66
 Identities = 129/174 (74%), Positives = 146/174 (83%), Gaps = 2/174 (1%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYVMTGHLTSKSDVYSFGVVLLEM+TGRRSMDKNRPNGE NLVEWARPHL +KRRFYRL
Sbjct: 9   PEYVMTGHLTSKSDVYSFGVVLLEMLTGRRSMDKNRPNGEHNLVEWARPHLLDKRRFYRL 68

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           +DPRLEGHFS+KGAQK  QLAA+CLSRD K RP MSEVVE LKPLP+LKDMAS+SYYFQT
Sbjct: 69  LDPRLEGHFSVKGAQKVTQLAAQCLSRDSKIRPKMSEVVEVLKPLPHLKDMASASYYFQT 128

Query: 359 MQADRIASSPNTKNGIVF-SKNGQQNPRSLSIPNG-SHASPYRQFSQNSPKPNG 204
           MQA+R+ +   + +G  F S+NGQ   R+LS P+G + +SPYR     SPKP G
Sbjct: 129 MQAERLKAGSGSGSGRGFGSRNGQPVFRTLSSPHGQAGSSPYRH-QIPSPKPKG 181



>gb:ATAC008261_1542788 Arabidopsis thaliana chromosome III BAC T4P13
           genomic sequence, complete
           sequence.>gb:ATAC010676_1543139 Arabidopsis thaliana
           chromosome III BAC T22N4 genomic sequence, complete
           sequence.
          Length = 490

 Score =  251 bits (641), Expect = 9e-66
 Identities = 129/174 (74%), Positives = 146/174 (83%), Gaps = 2/174 (1%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYVMTGHLTSKSDVYSFGVVLLEM+TGRRSMDKNRPNGE NLVEWARPHL +KRRFYRL
Sbjct: 315 PEYVMTGHLTSKSDVYSFGVVLLEMLTGRRSMDKNRPNGEHNLVEWARPHLLDKRRFYRL 374

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           +DPRLEGHFS+KGAQK  QLAA+CLSRD K RP MSEVVE LKPLP+LKDMAS+SYYFQT
Sbjct: 375 LDPRLEGHFSVKGAQKVTQLAAQCLSRDSKIRPKMSEVVEVLKPLPHLKDMASASYYFQT 434

Query: 359 MQADRIASSPNTKNGIVF-SKNGQQNPRSLSIPNG-SHASPYRQFSQNSPKPNG 204
           MQA+R+ +   + +G  F S+NGQ   R+LS P+G + +SPYR     SPKP G
Sbjct: 435 MQAERLKAGSGSGSGRGFGSRNGQPVFRTLSSPHGQAGSSPYRH-QIPSPKPKG 487



>gb:AP003300_1827660 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0700A11.
          Length = 494

 Score =  247 bits (630), Expect = 2e-64
 Identities = 129/177 (72%), Positives = 146/177 (82%), Gaps = 6/177 (3%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYVMTGHLTSKSDVYSFGVVLLEM++GRRSMDKNRPNGE NLVEWARP+L E+RRFYRL
Sbjct: 319 PEYVMTGHLTSKSDVYSFGVVLLEMMSGRRSMDKNRPNGEHNLVEWARPYLGERRRFYRL 378

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           +DPRLEG+FSI+GAQK AQLA  CL+RDPKARP+MS+VVE LKPL NLKDMASSSY+FQ+
Sbjct: 379 VDPRLEGNFSIRGAQKTAQLACACLNRDPKARPLMSQVVEVLKPLLNLKDMASSSYFFQS 438

Query: 359 MQADRIAS------SPNTKNGIVFSKNGQQNPRSLSIPNGSHASPYRQFSQNSPKPN 207
           MQ +R AS      S + K    F++NGQQ  RSLS   G HASPYRQ    SP+PN
Sbjct: 439 MQQERAASLGNPIGSQSMKAQGTFARNGQQPMRSLSY--GPHASPYRQ----SPRPN 489



>gb:AP005508_1853071 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0711F01.
          Length = 326

 Score =  241 bits (616), Expect = 7e-63
 Identities = 129/180 (71%), Positives = 150/180 (83%), Gaps = 7/180 (3%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYVMTGHLTSKSDVYSFGVVLLEM++GRRSMDKNRPNGE NLVEWARP L E++RFY+L
Sbjct: 153 PEYVMTGHLTSKSDVYSFGVVLLEMMSGRRSMDKNRPNGEHNLVEWARPLLGERQRFYKL 212

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           IDPRLEG+FS+KGAQKAAQLA  CL+RDPKARP+MS+VVE LKPL NLKDMASSSY++QT
Sbjct: 213 IDPRLEGNFSVKGAQKAAQLARACLNRDPKARPLMSQVVEVLKPLLNLKDMASSSYFYQT 272

Query: 359 MQADRIA--SSPNTKNGIV-----FSKNGQQNPRSLSIPNGSHASPYRQFSQNSPKPNGK 201
           MQA+R+A  SS N ++  +     F++NGQQ  RSLS  +G  ASP+R     SPKPN K
Sbjct: 273 MQAERMAHSSSMNGRSHALKVQGSFARNGQQPMRSLS--DGPRASPFRY----SPKPNVK 326



>gb:AP000420_1820165 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MZN14.
          Length = 483

 Score =  233 bits (595), Expect = 2e-60
 Identities = 122/173 (70%), Positives = 141/173 (81%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYVMTGHLT+KSDVYSFGVVLLE++TGRRS+DK+RPNGE+NLVEW RPHL +K+RFYRL
Sbjct: 312 PEYVMTGHLTTKSDVYSFGVVLLEILTGRRSVDKSRPNGEQNLVEWVRPHLLDKKRFYRL 371

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           +DPRLEGH+SIKGAQKA Q+AA+CL+RD KARP MSEVVEALKPLPNLKD ASSS  FQT
Sbjct: 372 LDPRLEGHYSIKGAQKATQVAAQCLNRDSKARPKMSEVVEALKPLPNLKDFASSSSSFQT 431

Query: 359 MQADRIASSPNTKNGIVFSKNGQQNPRSLSIPNGSHASPYRQFSQNSPKPNGK 201
           MQ     +   T+ G   S+NG    RSLS  N   ASPYR +++ SPKP GK
Sbjct: 432 MQ-PVAKNGVRTQGGGFVSRNGPP-MRSLSSLNLPQASPYR-YARQSPKPKGK 481



>gb:AB023482_1515614 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, clone P0680A03.>gb:AP002864_1823321
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 6, BAC clone:OSJNBa0033B09.
          Length = 411

 Score =  171 bits (433), Expect = 1e-41
 Identities = 81/116 (69%), Positives = 97/116 (83%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYVMTGHLTSKSDVYSFGVVLLEM+TGRRSMDK RP GE+NLV WARP+L ++RR Y+L
Sbjct: 284 PEYVMTGHLTSKSDVYSFGVVLLEMLTGRRSMDKKRPTGEQNLVAWARPYLSDRRRLYQL 343

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSY 372
           +DPRL  ++S++G QK AQ+   CLSRD K+RP M EVV+ L PL +L DMAS+SY
Sbjct: 344 VDPRLGLNYSVRGVQKVAQICYHCLSRDTKSRPTMDEVVKHLTPLQDLNDMASASY 399



>gb:AK117952_1815959 Arabidopsis thaliana At5g01020 mRNA for
           putative protein kinase, complete cds, clone:
           RAFL19-14-C10.
          Length = 410

 Score =  154 bits (388), Expect = 2e-36
 Identities = 71/105 (67%), Positives = 91/105 (86%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYVMTGHLT++SDVYSFGVVLLEM+TGR+S+DK RP+ E+NLV+WARP L +KR+  ++
Sbjct: 245 PEYVMTGHLTARSDVYSFGVVLLEMLTGRKSVDKTRPSKEQNLVDWARPKLNDKRKLLQI 304

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           IDPRLE  +S++ AQKA  LA  CLS++PKARP+MS+VVE L+PL
Sbjct: 305 IDPRLENQYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPL 349



>gb:ATF7J8_1550981 Arabidopsis thaliana DNA chromosome 5, BAC clone
           F7J8 (ESSA project).
          Length = 410

 Score =  154 bits (388), Expect = 2e-36
 Identities = 71/105 (67%), Positives = 91/105 (86%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYVMTGHLT++SDVYSFGVVLLEM+TGR+S+DK RP+ E+NLV+WARP L +KR+  ++
Sbjct: 245 PEYVMTGHLTARSDVYSFGVVLLEMLTGRKSVDKTRPSKEQNLVDWARPKLNDKRKLLQI 304

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           IDPRLE  +S++ AQKA  LA  CLS++PKARP+MS+VVE L+PL
Sbjct: 305 IDPRLENQYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETLEPL 349



>gb:AY220481_1590515 Nicotiana tabacum Avr9/Cf-9 induced kinase 1
           (ACIK1) mRNA, complete cds.
          Length = 442

 Score =  153 bits (387), Expect = 3e-36
 Identities = 73/118 (61%), Positives = 96/118 (81%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+MTGHLT+ SDVYSFGVVLLE++TGRRS+DK RPN E+NLV+WARP L + R+  R+
Sbjct: 251 PEYLMTGHLTAASDVYSFGVVLLELLTGRRSVDKTRPNREQNLVDWARPQLKDPRKLRRI 310

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYF 366
           +DPRLEG +S +GAQKAA +A +CLS  PKARP MS VV+ L+PL + KD+++  + +
Sbjct: 311 MDPRLEGLYSEEGAQKAALVAYQCLSHRPKARPEMSSVVKTLEPLKDYKDISNMIFVY 368



>gb:AF332960_1787292 Lycopersicon esculentum auxin-regulated dual
           specificity cytosolic kinase mRNA, complete cds.
          Length = 464

 Score =  147 bits (370), Expect = 2e-34
 Identities = 69/118 (58%), Positives = 92/118 (77%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+MTGHLTSKSDVYSFGVVLLE+ITGRR+MDK RP  ER LV+WARP L +  +  R+
Sbjct: 261 PEYIMTGHLTSKSDVYSFGVVLLELITGRRAMDKKRPLKERILVDWARPMLRDPHKLDRI 320

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYF 366
           +DPRLEG +S +GA+K A LA +CLS  P++RP MS +V+ L+P+ ++KD+    + +
Sbjct: 321 MDPRLEGQYSTQGAKKVAALAYQCLSHHPRSRPTMSNIVKILEPVLDMKDIPMGPFVY 378



>gb:AP003277_1827082 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0518C01.>gb:AP003298_1827601 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0698H10.
          Length = 408

 Score =  146 bits (368), Expect = 4e-34
 Identities = 75/159 (47%), Positives = 110/159 (69%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ TGHL++KSDVYSFGVV++EM++GRR++DKNRP GE NLVEWARP+L  +RR +R+
Sbjct: 256 PEYLATGHLSAKSDVYSFGVVMVEMLSGRRALDKNRPAGEHNLVEWARPYLSSRRRIFRI 315

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           +D RL G +S+ GA KAA LA +CLS D K RP M +VV AL+    L++  ++S++ ++
Sbjct: 316 LDARLAGQYSLAGAHKAAALALQCLSADAKNRPTMHQVVAALE---QLQETTTTSHHHRS 372

Query: 359 MQADRIASSPNTKNGIVFSKNGQQNPRSLSIPNGSHASP 243
            Q+  +        G  F+ +G+ +  + + P    ASP
Sbjct: 373 PQSRMLL------GGRGFNASGRSSAGAGARPRRLSASP 405



>pir|C84473|C84473 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AC005970_1533296 Arabidopsis thaliana
           chromosome 2 clone T6P5 map mi310, complete
           sequence.>gb:AY056245_1563565 Arabidopsis thaliana
           putative protein kinase (At2g05940) mRNA, complete
           cds.>gb:AY113963_1578374 Arabidopsis thaliana putative
           protein kinase (At2g05940) mRNA, complete cds.
          Length = 462

 Score =  146 bits (368), Expect = 4e-34
 Identities = 80/175 (45%), Positives = 107/175 (61%), Gaps = 8/175 (4%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+MTGHLT++SDVYSFGVVLLE++TGRRS+DK R + E+NLV+WARP L + R+  R+
Sbjct: 263 PEYIMTGHLTARSDVYSFGVVLLELLTGRRSVDKKRSSREQNLVDWARPMLNDPRKLSRI 322

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           +DPRLEG +S  GA+KAA LA +CLS  PK RP MS VV  L  L +  D+   ++ +  
Sbjct: 323 MDPRLEGQYSETGARKAATLAYQCLSHRPKNRPCMSAVVSILNDLKDYNDIPMGTFTYTV 382

Query: 359 MQA-------DRIASSPNTKNGIVFSKNGQQN-PRSLSIPNGSHASPYRQFSQNS 219
                      R+ + P   +     +  Q N PRS   P     SP  +  +NS
Sbjct: 383 PNTPDNKEDDGRVGNKPRKSSHHHHHQQQQSNHPRSSPSPTTKSPSPTAKSPRNS 437



>gb:AP004744_1844232 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBb0065C04.
          Length = 469

 Score =  145 bits (366), Expect = 7e-34
 Identities = 68/110 (61%), Positives = 87/110 (79%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYVMTGHLT++SDVY FGVVLLEMI GRR++DK+RP+ E NLVEWARP L   R+ +R+
Sbjct: 246 PEYVMTGHLTARSDVYGFGVVLLEMIIGRRAVDKSRPSREHNLVEWARPLLVHNRKLFRI 305

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKD 390
           IDPR+EG +S K A + A LA RCLS++PK RP MS+VVE  + + N+ +
Sbjct: 306 IDPRMEGQYSTKAAIEVAGLAYRCLSQNPKGRPTMSQVVETFEAVQNMPE 355



>gb:AC079022_1541726 Oryza sativa chromosome 5 clone P0574H01,
           complete sequence.>gb:AC079356_1732528 Oryza sativa
           (japonica cultivar-group) chromosome 5 clone P0016H04,
           complete sequence.
          Length = 395

 Score =  145 bits (365), Expect = 9e-34
 Identities = 76/144 (52%), Positives = 100/144 (69%), Gaps = 1/144 (0%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ TGHLT+KSDVYSFGVVLLEM++GRR++DKNRP GE NLVEWARP+L  KRR +R+
Sbjct: 251 PEYLATGHLTTKSDVYSFGVVLLEMLSGRRALDKNRPTGEHNLVEWARPYLMSKRRIFRI 310

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           +D RL G +S+  AQKAA LA +C+S + K RP M +VV  L+ L + K+  ++      
Sbjct: 311 LDARLGGQYSLAKAQKAATLALQCISVEAKNRPNMEQVVAVLEQLQDSKETGANP----- 365

Query: 359 MQADRIASSPNT-KNGIVFSKNGQ 291
            Q  + +SS N   NG   S  G+
Sbjct: 366 -QLQKKSSSKNAGSNGSKPSSKGK 388



>gb:AC125472_1740503 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBa0050H14, complete sequence.
          Length = 444

 Score =  144 bits (364), Expect = 1e-33
 Identities = 72/129 (55%), Positives = 94/129 (72%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+MTGHLT+KSDVY FGVVLLE+++GR+S+DK+RP  E+NLVEWARP+L + RR  R+
Sbjct: 287 PEYIMTGHLTAKSDVYGFGVVLLELLSGRKSVDKSRPAREQNLVEWARPYLTDARRLGRV 346

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           +D  L G +  K AQKAA LA RC+S +PK+RP MS VVEAL+PL  L D      +   
Sbjct: 347 MDRNLAGQYPAKAAQKAAALAHRCVSLNPKSRPHMSAVVEALEPLLALDDDCLVGTFVYV 406

Query: 359 MQADRIASS 333
              D +A++
Sbjct: 407 APPDDVAAN 415



>gb:AE016959_1022408 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC092388_1735318
           Oryza sativa chromosome 10 BAC OSJNBa0011L09 genomic
           sequence, complete sequence.>gb:AC122144_1740242 Oryza
           sativa (japonica cultivar-group) chromosome 10 clone
           OSJNAa0011L09, complete sequence.>gb:AE017090_1752227
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 44 of 77 of the complete sequence.
          Length = 389

 Score =  140 bits (354), Expect = 2e-32
 Identities = 68/110 (61%), Positives = 86/110 (78%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+MTGHLT+KSDVYS+GVVLLE++TGR+++DK RP  E+NLVEWARP L + RR  R+
Sbjct: 265 PEYIMTGHLTTKSDVYSYGVVLLELLTGRKAVDKKRPPREQNLVEWARPCLHDSRRLNRV 324

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKD 390
           ID  L G +S +  QKAA +A +CLS  PK+RP MS VVEAL+PL  + D
Sbjct: 325 IDKSLNGQYSTRAVQKAAAIAYQCLSVSPKSRPRMSAVVEALEPLLAMDD 374



>gb:AC093018_1735842 Oryza sativa chromosome 3 BAC OSJNBb0081B07
           genomic sequence, complete sequence.
          Length = 416

 Score =  139 bits (350), Expect = 5e-32
 Identities = 67/105 (63%), Positives = 81/105 (77%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ TGHLT+KSDVYSFGVVLLEM++GRR++DKNRP GE NLVEWARP+L  KR+ +R+
Sbjct: 259 PEYLSTGHLTAKSDVYSFGVVLLEMMSGRRAIDKNRPQGEHNLVEWARPYLTHKRKIFRV 318

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +D RLEG +S  GAQ  A LA  CLS + K RP M  VV  L+ L
Sbjct: 319 LDTRLEGQYSHVGAQTVATLALECLSYEAKMRPSMEAVVTILEEL 363



>gb:AB009049_1510614 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MCD7.>gb:AY128371_1580670 Arabidopsis thaliana
           protein kinase-like protein (At5g56460) mRNA, complete
           cds.>gb:BT008507_1639724 Arabidopsis thaliana At5g56460
           gene, complete cds.
          Length = 408

 Score =  138 bits (347), Expect = 1e-31
 Identities = 61/112 (54%), Positives = 88/112 (78%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+MTGHLT  SDVYSFGVVLLE++TGR+S+DK+RP  E+NL++WA P L EK++   +
Sbjct: 255 PEYIMTGHLTPGSDVYSFGVVLLELLTGRKSLDKSRPTREQNLIDWALPLLKEKKKVLNI 314

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMA 384
           +DP++   + +K  QKAA LA  CL+R+PKARP+M ++V++L+PL   ++ A
Sbjct: 315 VDPKMNCEYPVKAVQKAAMLAYHCLNRNPKARPLMRDIVDSLEPLQATEEEA 366



>sp|Q06548|APKA_ARATH Protein kinase APK1A (EC
           2.7.1.-).>pir|S28615|S28615
           serine/threonine/tyrosine-specific protein kinase APK1
           (EC 2.7.1.-) [validated] - Arabidopsis
           thaliana>gb:ATHAPK1A_1553000 Arabidopsis thaliana APK1
           gene for protein tyrosine-serine-threonine
           kinase.>gb:BT004055_1637164 Arabidopsis thaliana clone
           RAFL15-21-H23 (R20468) putative protein kinase APK1A
           (At1g07570) mRNA, complete cds.>gb:BT005112_1638058
           Arabidopsis thaliana clone U20468 putative protein
           kinase APK1A (At1g07570) mRNA, complete cds.
          Length = 410

 Score =  138 bits (347), Expect = 1e-31
 Identities = 65/108 (60%), Positives = 88/108 (81%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ TGHLT+KSDVYSFGVVLLE+++GRR++DKNRP+GERNLVEWA+P+L  KR+ +R+
Sbjct: 249 PEYLATGHLTTKSDVYSFGVVLLELLSGRRAVDKNRPSGERNLVEWAKPYLVNKRKIFRV 308

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNL 396
           ID RL+  +S++ A K A L+ RCL+ + K RP MSEVV  L+ + +L
Sbjct: 309 IDNRLQDQYSMEEACKVATLSLRCLTTEIKLRPNMSEVVSHLEHIQSL 356



>pir|C96641|C96641 hypothetical protein T25B24.6 [imported] -
           Arabidopsis thaliana>gb:AE005173_893829 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC005850_1533094 Arabidopsis thaliana
           chromosome I BAC T25B24 genomic sequence, complete
           sequence.>gb:AY064142_1566023 Arabidopsis thaliana
           At1g61590/T25B24_6 mRNA, complete
           cds.>gb:AY097413_1576408 Arabidopsis thaliana
           At1g61590/T25B24_6 mRNA, complete cds.
          Length = 424

 Score =  137 bits (346), Expect = 1e-31
 Identities = 69/140 (49%), Positives = 98/140 (70%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYV TGHLT+KSDVYS+GVVLLE++TGRR+ +K+RP  ++N+++W++P+L   RR   +
Sbjct: 275 PEYVSTGHLTTKSDVYSYGVVLLELLTGRRATEKSRPKNQQNIIDWSKPYLTSSRRLRCV 334

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           +DPRL G +S+K A+  A LA +C+S +PK RP M  VVEAL+ L + KDMA SS ++  
Sbjct: 335 MDPRLAGQYSVKAAKDTALLALQCVSPNPKDRPKMLAVVEALESLIHYKDMAVSSGHWPL 394

Query: 359 MQADRIASSPNTKNGIVFSK 300
                   SP ++ G V  K
Sbjct: 395 --------SPKSQGGKVSPK 406



>gb:OSJN00055_1693993 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0017B10, complete sequence.
          Length = 475

 Score =  137 bits (344), Expect = 3e-31
 Identities = 63/109 (57%), Positives = 84/109 (77%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYV TGHL  KSDVY FGVVLLEM+TG R++D  RP  + +LVEWA+P+L ++R+  RL
Sbjct: 316 PEYVATGHLYVKSDVYGFGVVLLEMLTGMRALDTGRPAPQHSLVEWAKPYLADRRKLARL 375

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLK 393
           +DPRLEG +  + AQ+AAQL  RCLS DP++RP M+EVV+AL  +  ++
Sbjct: 376 VDPRLEGQYPSRAAQQAAQLTLRCLSGDPRSRPSMAEVVQALVEIERIR 424



>sp|P43293|NAK_ARATH Probable serine/threonine-protein kinase NAK
           (EC 2.7.1.37).>pir|T48250|T48250
           serine/threonine-specific protein kinase NAK (EC
           2.7.1.-) - Arabidopsis thaliana>gb:ATT1E22_1554875
           Arabidopsis thaliana DNA chromosome 5, BAC clone T1E22
           (ESSA project).>gb:AY086765_1571808 Arabidopsis thaliana
           clone 27477 mRNA, complete sequence.
          Length = 389

 Score =  136 bits (343), Expect = 3e-31
 Identities = 68/134 (50%), Positives = 93/134 (69%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ TGHL+ KSDVYSFGVVLLE+++GRR++DKN+P GE NLV+WARP+L  KRR  R+
Sbjct: 249 PEYLATGHLSVKSDVYSFGVVLLELLSGRRAIDKNQPVGEHNLVDWARPYLTNKRRLLRV 308

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           +DPRL+G +S+  A K A LA  C+S D K+RP M+E+V+ ++ L   K+ +      Q 
Sbjct: 309 MDPRLQGQYSLTRALKIAVLALDCISIDAKSRPTMNEIVKTMEELHIQKEASKEQQNPQI 368

Query: 359 MQADRIASSPNTKN 318
              + I  SP   N
Sbjct: 369 SIDNIINKSPQAVN 382



>gb:AP005198_1849311 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0616D06.
          Length = 471

 Score =  136 bits (342), Expect = 4e-31
 Identities = 67/105 (63%), Positives = 85/105 (80%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+MTGHLT+KSDVYSFGVVLLE++TGRR++DK RPN E++LVE+ARP L +  R  R+
Sbjct: 279 PEYIMTGHLTAKSDVYSFGVVLLEILTGRRAVDKTRPNREQSLVEYARPCLRDPLRLIRI 338

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +DP LEG +S   A++AA +A RCLS  PK RP MS VV+AL+PL
Sbjct: 339 MDPALEGRYSPAAAREAAAVAYRCLSGSPKNRPDMSAVVDALEPL 383



>gb:AP004586_1841916 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0493A04.>gb:AP005483_1852674 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:B1144B06.
          Length = 478

 Score =  135 bits (340), Expect = 7e-31
 Identities = 73/170 (42%), Positives = 110/170 (64%), Gaps = 3/170 (1%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+MTGHLT KSDVYSFGVVLLE+++GR S+D++R + E++LV+W R +L +  + +R+
Sbjct: 273 PEYIMTGHLTDKSDVYSFGVVLLELLSGRHSVDRSRRHREQSLVDWTRKYLKKPDQLHRV 332

Query: 539 I-DPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQ 363
           + DP +EG +S KGAQ+AA +A +CLS  PK+RP M EVV+AL+P+ ++ D      +  
Sbjct: 333 VMDPAMEGQYSYKGAQEAALVAYKCLSPSPKSRPSMREVVKALEPILDMNDYLQIGTFVF 392

Query: 362 TMQADRIASSPNTKNGIVFSKN--GQQNPRSLSIPNGSHASPYRQFSQNS 219
           T+  +       TK   V  +N    +   ++   + SH   YRQ + NS
Sbjct: 393 TVVVEDNKKDDVTKTKQVDGENKVDMRIEATVEEKHQSHHDRYRQKNPNS 442



>gb:AP004084_1837460 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1217_F02.
          Length = 427

 Score =  134 bits (338), Expect = 1e-30
 Identities = 60/112 (53%), Positives = 87/112 (77%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYV TGHL  KSDVY FGVV+LEM++G+R++D NRPNG+ +LV+WA+P+L ++R+  RL
Sbjct: 273 PEYVATGHLYVKSDVYGFGVVMLEMMSGQRALDPNRPNGQLSLVDWAKPYLADRRKLARL 332

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMA 384
           +DPR EG ++ K A +AAQL   CL+ +P++RP M EV+E L+ + ++K  A
Sbjct: 333 MDPRFEGQYNSKQAVQAAQLTLNCLAGEPRSRPSMKEVLETLERIESMKSRA 384



>gb:AP004858_1846106 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1725_H08.>gb:AP005055_1847351 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0684A08.
          Length = 454

 Score =  134 bits (336), Expect = 2e-30
 Identities = 62/108 (57%), Positives = 83/108 (76%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYV TGHL  KSDVY FGVVLLE++TG R++D  RP+G+ +LV+WA+P L ++R+  RL
Sbjct: 294 PEYVATGHLYVKSDVYGFGVVLLELLTGLRALDAGRPSGQHHLVDWAKPFLSDRRKLARL 353

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNL 396
           +DPRLEG +S +GAQ+AAQL  RCL+ D K RP M EVV  L+ + ++
Sbjct: 354 MDPRLEGQYSSRGAQRAAQLTLRCLAADHKNRPSMREVVAVLEEIESM 401



>gb:AP004685_1843366 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0017G10.
          Length = 414

 Score =  133 bits (335), Expect = 3e-30
 Identities = 63/109 (57%), Positives = 85/109 (77%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYV TGHL  KSDVY FGVVLLEM++G R++D +RP+G+ NLV+WA+P L ++R+  +L
Sbjct: 274 PEYVATGHLYVKSDVYGFGVVLLEMLSGLRALDPSRPSGKLNLVDWAKPLLADRRKLSQL 333

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLK 393
           +D RLEG +  +GA +AAQL  +CLS DPK+RP M EVVEAL+ +  +K
Sbjct: 334 MDSRLEGQYHSRGALQAAQLTLKCLSGDPKSRPSMKEVVEALEKIKLIK 382



>gb:AC135288_1742197 Solanum demissum chromosome 5 BAC PGEC219
           genomic sequence, complete sequence.
          Length = 420

 Score =  133 bits (334), Expect = 4e-30
 Identities = 66/130 (50%), Positives = 93/130 (71%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYV TG LT+KSDVYSFGVVLLE+++GRR++D  +   E+NLV+WA+P+L +KR+ +R+
Sbjct: 264 PEYVATGRLTAKSDVYSFGVVLLELLSGRRAVDNTKVGIEQNLVDWAKPYLGDKRKLFRI 323

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           +D +LEG +  KGA  AA LA +CLS +PK RP MSEV+ AL+ L + K ++  S+    
Sbjct: 324 MDTKLEGQYPQKGAYTAANLAWQCLSNEPKLRPKMSEVLTALEELQSPKGVSKLSHTEHR 383

Query: 359 MQADRIASSP 330
                +A SP
Sbjct: 384 AIPSPVAVSP 393



>gb:ATHPRKINA_1553318 Arabidopsis thaliana Columbia protein kinase
           mRNA, complete cds.
          Length = 389

 Score =  133 bits (334), Expect = 4e-30
 Identities = 67/134 (50%), Positives = 92/134 (68%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ TGHL+ KSDVYSFGVVLLE+++GRR++DKN+P  E NLV+WARP+L  KRR  R+
Sbjct: 249 PEYLATGHLSVKSDVYSFGVVLLELLSGRRAIDKNQPVVEHNLVDWARPYLTNKRRLLRV 308

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           +DPRL+G +S+  A K A LA  C+S D K+RP M+E+V+ ++ L   K+ +      Q 
Sbjct: 309 MDPRLQGQYSLTRALKIAVLALDCISIDAKSRPTMNEIVKTMEELHIQKEASKEQQNPQI 368

Query: 359 MQADRIASSPNTKN 318
              + I  SP   N
Sbjct: 369 SIDNIINKSPQAVN 382



>gb:AC099401_1737157 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1134F05, complete sequence.
          Length = 350

 Score =  132 bits (333), Expect = 5e-30
 Identities = 60/115 (52%), Positives = 86/115 (74%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+MTGHLT+ SDVYS+GVVLLE++TGR+S+DK+RP  E+ L +WA P L +K++   +
Sbjct: 229 PEYIMTGHLTAMSDVYSYGVVLLELLTGRKSLDKSRPVREQTLADWAFPMLIQKKKVLGI 288

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSS 375
           +DPRL   + +K  QK A LA  CL+R+PKARP+M ++V  L+PL  +++  S S
Sbjct: 289 VDPRLAEDYPVKAVQKTAMLAYHCLNRNPKARPLMRDIVATLEPLQQMEEDPSIS 343



>gb:AP004991_1846842 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0016O19.
          Length = 426

 Score =  132 bits (332), Expect = 6e-30
 Identities = 64/129 (49%), Positives = 92/129 (71%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY++TGHLT++SDVYSFGVVLLE++TGRRS+DK R   E+NLV+WARP+L    R +R+
Sbjct: 243 PEYILTGHLTARSDVYSFGVVLLELLTGRRSVDKRRRGREQNLVDWARPYLRRADRLHRI 302

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           +DP LE  +S + A  AA++A +CL   PK+RP M +VV+AL+PL  + D      +  T
Sbjct: 303 MDPSLELQYSARAAHAAAKVAHQCLQSVPKSRPCMRDVVDALEPLLAVDDDVPMGPFVFT 362

Query: 359 MQADRIASS 333
           +  +  A++
Sbjct: 363 VGGEEAAAA 371



>gb:AC145120_1744276 Solanum demissum chromosome 5 BAC PGEC446O19
           genomic sequence, complete sequence.
          Length = 420

 Score =  132 bits (332), Expect = 6e-30
 Identities = 66/130 (50%), Positives = 93/130 (71%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYV TG LT+KSDVYSFGVVLLE+++GRR++D  +   E+NLV+WA+P+L +KR+ +R+
Sbjct: 264 PEYVATGRLTAKSDVYSFGVVLLELLSGRRAVDNAKVGIEQNLVDWAKPYLGDKRKLFRI 323

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           +D +LEG +  KGA  AA LA +CLS +PK RP MSEV+ AL+ L + K ++  S+    
Sbjct: 324 MDTKLEGQYPQKGAYTAANLAWQCLSNEPKLRPKMSEVLTALEELQSPKGVSKLSHTEHR 383

Query: 359 MQADRIASSP 330
                +A SP
Sbjct: 384 AIPSPVAVSP 393



>gb:AY150474_1585039 Arabidopsis thaliana putative protein kinase
           (At2g07180) mRNA, complete cds.
          Length = 442

 Score =  132 bits (332), Expect = 6e-30
 Identities = 62/105 (59%), Positives = 80/105 (76%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYVMTGHLTS+SDVY FGV+LLEM+ G+R+MDK+R   E NLVEWARP L   ++  R+
Sbjct: 266 PEYVMTGHLTSRSDVYGFGVLLLEMLLGKRAMDKSRACREHNLVEWARPLLNHNKKLLRI 325

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           IDPR++G +  K   K A LA +CLS++PK RP+M+ VVE L+ L
Sbjct: 326 IDPRMDGQYGTKALMKVAGLAYQCLSQNPKGRPLMNHVVEVLETL 370



>gb:AY080806_1568505 Arabidopsis thaliana putative protein kinase
           (At2g07180) mRNA, complete cds.
          Length = 442

 Score =  132 bits (332), Expect = 6e-30
 Identities = 62/105 (59%), Positives = 80/105 (76%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYVMTGHLTS+SDVY FGV+LLEM+ G+R+MDK+R   E NLVEWARP L   ++  R+
Sbjct: 266 PEYVMTGHLTSRSDVYGFGVLLLEMLLGKRAMDKSRACREHNLVEWARPLLNHNKKLLRI 325

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           IDPR++G +  K   K A LA +CLS++PK RP+M+ VVE L+ L
Sbjct: 326 IDPRMDGQYGTKALMKVAGLAYQCLSQNPKGRPLMNHVVEVLETL 370



>gb:AC073556_1541104 Oryza sativa chromosome 3 BAC OSJNBa0091P11
           genomic sequence, complete sequence.
          Length = 422

 Score =  132 bits (332), Expect = 6e-30
 Identities = 63/114 (55%), Positives = 88/114 (77%), Gaps = 1/114 (0%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ TG L++K+DVYSFGVVLLE++TGRR++DK++P  E+NLV+WA+PHL +KRR YR+
Sbjct: 266 PEYIATGRLSAKADVYSFGVVLLELLTGRRALDKSKPGIEQNLVDWAKPHLGDKRRLYRV 325

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLK-DMAS 381
           +D +L G +  KGA   A +A +C+  D K RP MSEV+E L+ L + K +MAS
Sbjct: 326 MDTKLGGQYPKKGAHAIANIALQCICNDAKMRPRMSEVLEELEQLQDSKYNMAS 379



>pir|A84483|A84483 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AC005693_1532893 Arabidopsis thaliana
           chromosome 2 clone T25N22 map mi310, complete sequence.
          Length = 423

 Score =  132 bits (332), Expect = 6e-30
 Identities = 62/105 (59%), Positives = 80/105 (76%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYVMTGHLTS+SDVY FGV+LLEM+ G+R+MDK+R   E NLVEWARP L   ++  R+
Sbjct: 247 PEYVMTGHLTSRSDVYGFGVLLLEMLLGKRAMDKSRACREHNLVEWARPLLNHNKKLLRI 306

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           IDPR++G +  K   K A LA +CLS++PK RP+M+ VVE L+ L
Sbjct: 307 IDPRMDGQYGTKALMKVAGLAYQCLSQNPKGRPLMNHVVEVLETL 351



>gb:AP005419_1851480 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0046G12.
          Length = 458

 Score =  132 bits (331), Expect = 8e-30
 Identities = 61/110 (55%), Positives = 89/110 (80%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+MTGHLT+KSDVYSFGVVLLE+++GR+S+D++R   E++LV+WARP+L    + Y++
Sbjct: 261 PEYIMTGHLTAKSDVYSFGVVLLELLSGRKSVDRSRRPREQSLVDWARPYLKWADKLYKV 320

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKD 390
           +DP LE  +S +GA+ AA +A +CLS +PK+RP M EVV+AL+P+  + D
Sbjct: 321 MDPALECQYSCQGAEVAALVAYKCLSENPKSRPTMREVVKALEPVLGMDD 370



>pir|G96749|G96749 hypothetical protein F28P22.27 [imported] -
           Arabidopsis thaliana>gb:AE005173_894801 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010926_1537167 Arabidopsis thaliana
           chromosome 1 BAC F28P22 genomic sequence, complete
           sequence.
          Length = 450

 Score =  131 bits (329), Expect = 1e-29
 Identities = 61/118 (51%), Positives = 89/118 (75%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+  G+LT+ SDV+SFGVVLLEM+T R++++K R    RNLVEWARP L +  +  R+
Sbjct: 260 PEYISAGNLTTMSDVFSFGVVLLEMLTARKAVEKYRAQRGRNLVEWARPMLKDPNKLERI 319

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYF 366
           IDP LEG +S++G +KAA LA +CLS +PK+RP M+ VV+ L+P+ +LKD+ +  + +
Sbjct: 320 IDPSLEGKYSVEGIRKAAALAYQCLSHNPKSRPTMTTVVKTLEPILDLKDIQNGPFVY 377



>gb:ATAC015985_1543577 Arabidopsis thaliana chromosome III BAC F8A24
           genomic sequence, complete sequence.>gb:AY091117_1574341
           Arabidopsis thaliana putative protein kinase (At3g09830)
           mRNA, complete cds.>gb:AY122981_1579859 Arabidopsis
           thaliana putative protein kinase (At3g09830) mRNA,
           complete cds.
          Length = 418

 Score =  130 bits (328), Expect = 2e-29
 Identities = 66/137 (48%), Positives = 88/137 (64%), Gaps = 2/137 (1%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ TG LTSKSDV+ +GV L E+ITGRR +D+NRP GE+ L+EW RP+L + R+F  +
Sbjct: 264 PEYIQTGRLTSKSDVWGYGVFLYELITGRRPVDRNRPKGEQKLLEWVRPYLSDTRKFKLI 323

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYY--F 366
           +DPRLEG + IK  QK A +A RCL R+ KARP MSEV+E +  +        S      
Sbjct: 324 LDPRLEGKYPIKSVQKLAVVANRCLVRNSKARPKMSEVLEMVNKIVEASSGNGSPQLVPL 383

Query: 365 QTMQADRIASSPNTKNG 315
            +++A R A   N   G
Sbjct: 384 NSVKASRDARGKNNGGG 400



>sp|P46573|APKB_ARATH Protein kinase APK1B (EC
           2.7.1.-).>pir|T02725|T02725 probable
           serine/threonine/tyrosine-specific protein kinase  (EC
           2.7.1.-) T9I4.1 - Arabidopsis
           thaliana>gb:AC005315_1532587 Arabidopsis thaliana
           chromosome 2 clone T9I4 map mi54, complete
           sequence.>gb:AC005727_1532983 Arabidopsis thaliana
           chromosome 2 clone F8N16 map mi54, complete sequence.
          Length = 412

 Score =  130 bits (328), Expect = 2e-29
 Identities = 63/110 (57%), Positives = 85/110 (77%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ TGHLT+KSDVYS+GVVLLE+++GRR++DKNRP GE+ LVEWARP L  KR+ +R+
Sbjct: 250 PEYLATGHLTTKSDVYSYGVVLLEVLSGRRAVDKNRPPGEQKLVEWARPLLANKRKLFRV 309

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKD 390
           ID RL+  +S++ A K A LA RCL+ + K RP M+EVV  L+ +  L +
Sbjct: 310 IDNRLQDQYSMEEACKVATLALRCLTFEIKLRPNMNEVVSHLEHIQTLNE 359



>gb:AP005299_1850138 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1789_D08.
          Length = 526

 Score =  130 bits (327), Expect = 2e-29
 Identities = 71/172 (41%), Positives = 101/172 (58%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LT KSDVYSFGVVLLE+ITGRR++D  RP+GE+NLV WARP   ++R+  ++
Sbjct: 295 PEYAMTGQLTVKSDVYSFGVVLLELITGRRAIDSTRPHGEQNLVSWARPLFNDRRKLPKM 354

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
            DPRLEG + ++G  +A  +A+ C+  +  +RP++++VV AL  L      AS SY    
Sbjct: 355 ADPRLEGRYPMRGLYQALAVASMCIQSEAASRPLIADVVTALSYL------ASQSYDPNA 408

Query: 359 MQADRIASSPNTKNGIVFSKNGQQNPRSLSIPNGSHASPYRQFSQNSPKPNG 204
             A R    P         +NG+   R+    +  H SP +    +  +P G
Sbjct: 409 AHASR---KPGGDQRSKVGENGRVVSRNDEASSSGHKSPNKDREDSPKEPPG 457



>pir|T02726|T02726 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AC005315_1532588 Arabidopsis thaliana
           chromosome 2 clone T9I4 map mi54, complete
           sequence.>gb:AC005727_1532984 Arabidopsis thaliana
           chromosome 2 clone F8N16 map mi54, complete sequence.
          Length = 462

 Score =  129 bits (324), Expect = 5e-29
 Identities = 58/103 (56%), Positives = 82/103 (79%), Gaps = 1/103 (0%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYV TG LT+KSDV+SFGVVL E+ITGRR++D+NRP GE+ L+EW +P++ + ++F+ +
Sbjct: 285 PEYVQTGKLTAKSDVWSFGVVLYELITGRRAVDRNRPRGEQKLLEWVKPYVSDSKKFHLI 344

Query: 539 IDPRLEG-HFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
           +DPRLEG ++ +K  Q+ A LA +CL + PK+RP MSEVV  L
Sbjct: 345 VDPRLEGQYYCMKSVQRVAALANKCLMKQPKSRPKMSEVVSLL 387



>gb:AE005172_889763 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC022464_1538996 Genomic sequence
           for Arabidopsis thaliana BAC F22G5 from chromosome I,
           complete sequence.
          Length = 464

 Score =  129 bits (323), Expect = 7e-29
 Identities = 61/102 (59%), Positives = 83/102 (81%)
 Frame = -1

Query: 701 GHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRLIDPRLE 522
           GHLT+KSDVYSFGVVLLE+++GRR++DKNRP+GERNLVEWA+P+L  KR+ +R+ID RL+
Sbjct: 283 GHLTTKSDVYSFGVVLLELLSGRRAVDKNRPSGERNLVEWAKPYLVNKRKIFRVIDNRLQ 342

Query: 521 GHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNL 396
             +S++ A K A L+ RCL+ + K RP MSEVV  L+ + +L
Sbjct: 343 DQYSMEEACKVATLSLRCLTTEIKLRPNMSEVVSHLEHIQSL 384



>pir|T48353|T48353 protein kinase-like - Arabidopsis
           thaliana>gb:AB005240_1509480 Arabidopsis thaliana
           genomic DNA, chromosome 5, P1
           clone:MOK16.>gb:ATF12E4_1548345 Arabidopsis thaliana DNA
           chromosome 5, BAC clone F12E4 (ESSA project).
          Length = 420

 Score =  128 bits (322), Expect = 9e-29
 Identities = 58/100 (58%), Positives = 77/100 (77%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ TG LTSKSDV+ +GV + E+ITGRR +D+N+P GE+ L+EW RP+L + RRF  +
Sbjct: 261 PEYIQTGRLTSKSDVWGYGVFIYELITGRRPLDRNKPKGEQKLLEWVRPYLSDTRRFRLI 320

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVE 420
           +DPRLEG + IK  QK A +A  CL+R+ KARP MSEV+E
Sbjct: 321 VDPRLEGKYMIKSVQKLAVVANLCLTRNAKARPKMSEVLE 360



>gb:BT010769_1640715 Arabidopsis thaliana At2g26290 gene, complete
           cds.>gb:BT011654_1641176 Arabidopsis thaliana At2g26290
           mRNA, complete cds.
          Length = 254

 Score =  128 bits (321), Expect = 1e-28
 Identities = 62/105 (59%), Positives = 79/105 (75%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+MTGHLT+ +DVYSFGVVLLE+ITG+RSMD  R   E++LVEWARP L ++R+  R+
Sbjct: 94  PEYIMTGHLTTMNDVYSFGVVLLELITGKRSMDNTRTRREQSLVEWARPMLRDQRKLERI 153

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           IDPRL      + AQ AA LA +CLS+ PK RP M EVV+ L+ +
Sbjct: 154 IDPRLANQHKTEAAQVAASLAYKCLSQHPKYRPTMCEVVKVLESI 198



>gb:AY085132_1570213 Arabidopsis thaliana clone 13257 mRNA, complete
           sequence.
          Length = 414

 Score =  128 bits (321), Expect = 1e-28
 Identities = 65/123 (52%), Positives = 79/123 (64%), Gaps = 8/123 (6%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYV TGHL  KSDVY FGVVL E++TG  ++D  RP G+ NL EW +PHL EKR+   +
Sbjct: 266 PEYVATGHLYVKSDVYGFGVVLAEILTGLHALDPTRPTGQHNLTEWIKPHLSEKRKLRSI 325

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL--------KPLPNLKDMA 384
           +DPRLEG +  K A + AQLA +CL  +PK RP M EVVE+L        KPL      A
Sbjct: 326 MDPRLEGKYPFKSAFRVAQLALKCLGPEPKNRPSMKEVVESLELIEAANEKPLERRTTRA 385

Query: 383 SSS 375
           S S
Sbjct: 386 SPS 388



>gb:ATHSTPK_1553403 Arabidopsis thaliana protein kinase (ARSK1)
           gene, complete cds.
          Length = 425

 Score =  128 bits (321), Expect = 1e-28
 Identities = 62/105 (59%), Positives = 79/105 (75%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+MTGHLT+ +DVYSFGVVLLE+ITG+RSMD  R   E++LVEWARP L ++R+  R+
Sbjct: 265 PEYIMTGHLTTMNDVYSFGVVLLELITGKRSMDNTRTRREQSLVEWARPMLRDQRKLERI 324

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           IDPRL      + AQ AA LA +CLS+ PK RP M EVV+ L+ +
Sbjct: 325 IDPRLANQHKTEAAQVAASLAYKCLSQHPKYRPTMCEVVKVLESI 369



>pir|F84658|F84658 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AC004484_1531785 Arabidopsis thaliana
           chromosome 2 clone T1D16 map B68, complete sequence.
          Length = 424

 Score =  128 bits (321), Expect = 1e-28
 Identities = 62/105 (59%), Positives = 79/105 (75%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+MTGHLT+ +DVYSFGVVLLE+ITG+RSMD  R   E++LVEWARP L ++R+  R+
Sbjct: 264 PEYIMTGHLTTMNDVYSFGVVLLELITGKRSMDNTRTRREQSLVEWARPMLRDQRKLERI 323

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           IDPRL      + AQ AA LA +CLS+ PK RP M EVV+ L+ +
Sbjct: 324 IDPRLANQHKTEAAQVAASLAYKCLSQHPKYRPTMCEVVKVLESI 368



>gb:BT004631_1637665 Arabidopsis thaliana At2g39110 gene, complete
           cds.
          Length = 435

 Score =  127 bits (320), Expect = 2e-28
 Identities = 58/103 (56%), Positives = 78/103 (75%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ TGHLT+KSDV+S+G+ L E+ITGRR  D+NRP  E+N++EW RPHL + ++F  +
Sbjct: 271 PEYIQTGHLTAKSDVWSYGIFLYELITGRRPFDRNRPRNEQNILEWIRPHLSDIKKFKMI 330

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALK 411
           IDPRLEG++ +K A K A +A RCL    KARP MS+V E L+
Sbjct: 331 IDPRLEGNYYLKSALKLAAVANRCLMVKAKARPTMSQVSEMLE 373



>pir|C84813|C84813 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AC005770_1533012 Arabidopsis thaliana
           chromosome 2 clone T7F6 map CIC10A06, complete sequence.
          Length = 419

 Score =  127 bits (320), Expect = 2e-28
 Identities = 58/103 (56%), Positives = 78/103 (75%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ TGHLT+KSDV+S+G+ L E+ITGRR  D+NRP  E+N++EW RPHL + ++F  +
Sbjct: 255 PEYIQTGHLTAKSDVWSYGIFLYELITGRRPFDRNRPRNEQNILEWIRPHLSDIKKFKMI 314

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALK 411
           IDPRLEG++ +K A K A +A RCL    KARP MS+V E L+
Sbjct: 315 IDPRLEGNYYLKSALKLAAVANRCLMVKAKARPTMSQVSEMLE 357



>gb:AB023031_1515321 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K2K18.
          Length = 464

 Score =  127 bits (319), Expect = 2e-28
 Identities = 63/110 (57%), Positives = 82/110 (74%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+MTGHLT+KSDVYSFGVVLLE++TGR+S+D  R + +  LVEWARP L + R+  R+
Sbjct: 264 PEYIMTGHLTAKSDVYSFGVVLLELLTGRKSVDIARSSRKETLVEWARPMLNDARKLGRI 323

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKD 390
           +DPRLE  +S  GA+KAA LA +CL   PK RP +S VV  L+ + + KD
Sbjct: 324 MDPRLEDQYSETGARKAATLAYQCLRYRPKTRPDISTVVSVLQDIKDYKD 373



>gb:AY536850_1612404 Arabidopsis thaliana putative protein kinase
           (At2g17220) mRNA, partial cds.
          Length = 230

 Score =  127 bits (318), Expect = 3e-28
 Identities = 64/123 (52%), Positives = 79/123 (64%), Gaps = 8/123 (6%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYV TGHL  KSDVY FGVVL E++TG  ++D  RP G+ NL EW +PHL E+R+   +
Sbjct: 89  PEYVATGHLYVKSDVYGFGVVLAEILTGLHALDPTRPTGQHNLTEWIKPHLSERRKLRSI 148

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL--------KPLPNLKDMA 384
           +DPRLEG +  K A + AQLA +CL  +PK RP M EVVE+L        KPL      A
Sbjct: 149 MDPRLEGKYPFKSAFRVAQLALKCLGPEPKNRPSMKEVVESLELIEAANEKPLERRTTRA 208

Query: 383 SSS 375
           S S
Sbjct: 209 SPS 211



>gb:AC007127_1535275 Arabidopsis thaliana chromosome 2 clone T23A1
           map mi398, complete sequence.>gb:AY049263_1561905
           Arabidopsis thaliana At2g17220/T23A1.8 mRNA, complete
           cds.>gb:AY149966_1584915 Arabidopsis thaliana
           At2g17220/T23A1.8 mRNA, complete
           cds.>gb:AF370585_1792368 Arabidopsis thaliana putative
           protein kinase (At2g17220; T23A1.8) mRNA, complete cds.
          Length = 414

 Score =  127 bits (318), Expect = 3e-28
 Identities = 64/123 (52%), Positives = 79/123 (64%), Gaps = 8/123 (6%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYV TGHL  KSDVY FGVVL E++TG  ++D  RP G+ NL EW +PHL E+R+   +
Sbjct: 266 PEYVATGHLYVKSDVYGFGVVLAEILTGLHALDPTRPTGQHNLTEWIKPHLSERRKLRSI 325

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL--------KPLPNLKDMA 384
           +DPRLEG +  K A + AQLA +CL  +PK RP M EVVE+L        KPL      A
Sbjct: 326 MDPRLEGKYPFKSAFRVAQLALKCLGPEPKNRPSMKEVVESLELIEAANEKPLERRTTRA 385

Query: 383 SSS 375
           S S
Sbjct: 386 SPS 388



>pir|E84549|E84549 probable protein kinase [imported] - Arabidopsis
           thaliana
          Length = 413

 Score =  127 bits (318), Expect = 3e-28
 Identities = 64/123 (52%), Positives = 79/123 (64%), Gaps = 8/123 (6%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYV TGHL  KSDVY FGVVL E++TG  ++D  RP G+ NL EW +PHL E+R+   +
Sbjct: 265 PEYVATGHLYVKSDVYGFGVVLAEILTGLHALDPTRPTGQHNLTEWIKPHLSERRKLRSI 324

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL--------KPLPNLKDMA 384
           +DPRLEG +  K A + AQLA +CL  +PK RP M EVVE+L        KPL      A
Sbjct: 325 MDPRLEGKYPFKSAFRVAQLALKCLGPEPKNRPSMKEVVESLELIEAANEKPLERRTTRA 384

Query: 383 SSS 375
           S S
Sbjct: 385 SPS 387



>gb:AF131222_1770837 Lophopyrum elongatum protein serine/threonine
           kinase (ESI47) mRNA, complete cds.>gb:AF339747_1787776
           Lophopyrum elongatum protein kinase (ESI47) gene,
           complete cds.
          Length = 433

 Score =  126 bits (317), Expect = 3e-28
 Identities = 54/113 (47%), Positives = 86/113 (76%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ TG L+SK+D++S+GVVL E++TGRR +D+NRP GE+NLVEW +P+  + ++F  +
Sbjct: 269 PEYIHTGRLSSKNDIWSYGVVLYELLTGRRPLDRNRPRGEQNLVEWVKPYSSDTKKFETI 328

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMAS 381
           +DPRLEG++++K A + A LA +CL R  + RP MSEV+E ++ + +  D+ +
Sbjct: 329 MDPRLEGNYNLKSAARIASLANKCLVRHARYRPKMSEVLEMVQKIVDSSDLGT 381



>gb:AE016959_1022495 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC021893_1538815
           Genomic Sequence for Oryza sativa, Nipponbare strain,
           clone OSJNBa0060A14, from chromosome 10, complete
           sequence.>gb:AC090487_1734358 Genomic Sequence for Oryza
           sativa, Nipponbare strain, clone OSJNBb0044I14, from
           Chromosome 10, complete sequence.>gb:AE017092_1752314
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 46 of 77 of the complete sequence.
          Length = 428

 Score =  126 bits (317), Expect = 3e-28
 Identities = 59/109 (54%), Positives = 82/109 (75%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYV TG L+ K+DVYSFGVVLLE++TGRR++DK++P  E+NLV+W RP+L +KRR YR+
Sbjct: 264 PEYVATGRLSVKADVYSFGVVLLELLTGRRALDKSKPASEQNLVDWTRPYLGDKRRLYRI 323

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLK 393
           +D +L G +  KGA   A +A +C+  + K RP MSEV+E L+ L + K
Sbjct: 324 MDMKLGGQYPKKGAHAIATIALQCIRSEAKMRPQMSEVLEKLQQLQDPK 372



>gb:AP004048_1836910 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1202_E07.>gb:AP004878_1846453 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0474F11.
          Length = 427

 Score =  126 bits (316), Expect = 4e-28
 Identities = 55/105 (52%), Positives = 81/105 (77%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ TG LT+KSD++ +GV+L E+ITGRR +D+NRP GE+ L++W +P++ + +RF  +
Sbjct: 264 PEYMQTGRLTAKSDIWGYGVLLYELITGRRPIDRNRPKGEQKLLDWVKPYISDIKRFPII 323

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           IDPRLEGH+++K   K A +A RCL R PK+RP MSEV E ++ +
Sbjct: 324 IDPRLEGHYNLKSMTKLASVANRCLVRLPKSRPKMSEVYEMVQKI 368



>gb:ATHAPK1B_1553001 A. thaliana APK1b gene for protein kinase,
           partial sequence.
          Length = 205

 Score =  124 bits (312), Expect = 1e-27
 Identities = 59/97 (60%), Positives = 78/97 (80%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ TGHLT+KSDVYS+GVVLLE+++GRR++DKNRP GE+ LVEWARP L  KR+ +R+
Sbjct: 108 PEYLATGHLTTKSDVYSYGVVLLEVLSGRRAVDKNRPPGEQKLVEWARPLLANKRKLFRV 167

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSE 429
           ID RL+  +S++ A K A LA RCL+ + K RP M+E
Sbjct: 168 IDNRLQDQYSMEEACKVATLALRCLTFEIKLRPNMNE 204



>gb:AE016959_1022718 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017097_1752537
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 51 of 77 of the complete sequence.
          Length = 331

 Score =  124 bits (311), Expect = 2e-27
 Identities = 60/114 (52%), Positives = 80/114 (70%), Gaps = 9/114 (7%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYVMTGHLT+ SDVYS+GVVLLE++TGR+S+DK+RP  E+ L +WA P L  KR+   +
Sbjct: 206 PEYVMTGHLTAMSDVYSYGVVLLELLTGRKSLDKSRPPREQTLADWALPLLTHKRKVMSI 265

Query: 539 IDPRLE---------GHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +DPRL          G    +   KAA LA  CL+R+PKARP+M ++V +L+PL
Sbjct: 266 VDPRLSAAAAAAGAGGELPARAVHKAAMLAYHCLNRNPKARPLMRDIVASLEPL 319



>gb:AE016959_1022791 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017099_1752610
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 53 of 77 of the complete sequence.
          Length = 445

 Score =  124 bits (310), Expect = 2e-27
 Identities = 53/116 (45%), Positives = 85/116 (73%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ TG L+SK+D++S+GVVL E++TGRR +D+NRP GE+NL+EW +P+  + ++   +
Sbjct: 280 PEYIHTGRLSSKNDIWSYGVVLYELLTGRRPLDRNRPRGEQNLIEWVKPYSTDSKKLEII 339

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSY 372
           +DPRLEG +S+K A K A +A +CL R  + RP MSEV+E ++ + +  D+ +  +
Sbjct: 340 MDPRLEGSYSLKSAAKLASVANKCLVRHARHRPKMSEVLEMVQKIVDSTDLGTPEH 395



>pir|T00848|T00848 probable serine/threonine-specific protein kinase
           T20F6.6  (EC 2.7.1.-) - Arabidopsis
           thaliana>gb:AC002521_1530800 Arabidopsis thaliana
           chromosome 2 clone T20F6 map CIC11A04, complete
           sequence.>gb:AY125559_1580364 Arabidopsis thaliana
           At2g02800/T20F6.6 mRNA, complete cds.>gb:D88207_1675097
           Arabidopsis thaliana APK2b mRNA for protein kinase,
           complete cds.>gb:AF428432_1799362 Arabidopsis thaliana
           At2g02800/T20F6.6 mRNA, complete cds.
          Length = 426

 Score =  124 bits (310), Expect = 2e-27
 Identities = 67/141 (47%), Positives = 93/141 (65%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYV TG LT+KSDVYSFGVVLLE+++GRR++DK++   E++LV+WA P+L +KR+ +R+
Sbjct: 262 PEYVATGRLTAKSDVYSFGVVLLELLSGRRAVDKSKVGMEQSLVDWATPYLGDKRKLFRI 321

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           +D RL G +  KGA  AA LA +CL+ D K RP MSEV+  L  L + K    +    + 
Sbjct: 322 MDTRLGGQYPQKGAYTAASLALQCLNPDAKLRPKMSEVLAKLDQLESTK--PGTGVGNRQ 379

Query: 359 MQADRIASSPNTKNGIVFSKN 297
            Q D    SP   NG +  K+
Sbjct: 380 AQID----SPRGSNGSIVQKS 396



>gb:AC134886_1741831 Oryza sativa chromosome 3 BAC OSJNBa0002D18
           genomic sequence, complete sequence.>gb:AC135559_1742526
           Oryza sativa chromosome 3 BAC OSJNBa0030J19 genomic
           sequence, complete sequence.
          Length = 448

 Score =  123 bits (309), Expect = 3e-27
 Identities = 61/113 (53%), Positives = 85/113 (75%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY++TGHLT+KSDVYSFGVVLLE+++GRR++DK RP+ E++LVE  R  L + ++  R+
Sbjct: 269 PEYILTGHLTAKSDVYSFGVVLLEILSGRRAVDKTRPSREQHLVEHMRSWLKDPQKLSRV 328

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMAS 381
           +DP LEG +    A KAA +A +CLS +PK RP M +VV+ L+PL N+ D  S
Sbjct: 329 MDPALEGQYFATAAHKAALVAYKCLSGNPKNRPDMCQVVKDLEPLLNVTDDVS 381



>gb:AC098693_1736830 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1004C08, complete sequence.
          Length = 390

 Score =  123 bits (309), Expect = 3e-27
 Identities = 59/108 (54%), Positives = 80/108 (74%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYV TGHL  KSDVY FGVVLLE++TG R+ D NRP+ ++NLVEWARP++   ++   L
Sbjct: 251 PEYVATGHLYVKSDVYCFGVVLLELLTGLRAHDLNRPSHQQNLVEWARPYIAGGKKLAGL 310

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNL 396
           +DPRL G +  K A +AA+LA +CL  DPK+RP M +VV AL+ + ++
Sbjct: 311 MDPRLAGDYPAKAAARAAKLADKCLCGDPKSRPSMDDVVVALQEIESV 358



>gb:AK117389_1815427 Arabidopsis thaliana At2g02800 mRNA for
           putative protein kinase, complete cds, clone:
           RAFL16-97-F04.
          Length = 426

 Score =  122 bits (307), Expect = 5e-27
 Identities = 66/141 (46%), Positives = 93/141 (65%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYV TG LT+KSDVYSFGVVLLE+++GRR++D+++   E++LV+WA P+L +KR+ +R+
Sbjct: 262 PEYVATGRLTAKSDVYSFGVVLLELLSGRRAVDRSKVGMEQSLVDWATPYLGDKRKLFRI 321

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           +D RL G +  KGA  AA LA +CL+ D K RP MSEV+  L  L + K    +    + 
Sbjct: 322 MDTRLGGQYPQKGAYTAASLALQCLNPDAKLRPKMSEVLAKLDQLESTK--PGTGVGNRQ 379

Query: 359 MQADRIASSPNTKNGIVFSKN 297
            Q D    SP   NG +  K+
Sbjct: 380 AQID----SPRGSNGSIVQKS 396



>gb:AP005111_1848028 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0643F09.
          Length = 685

 Score =  122 bits (306), Expect = 6e-27
 Identities = 60/117 (51%), Positives = 76/117 (64%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTGHL  KSDVYS+GVVLLE+++GR+ +  +  NG +NLV WARP LC K    RL
Sbjct: 461 PEYAMTGHLLVKSDVYSYGVVLLELLSGRKPVCMSDTNGPQNLVTWARPLLCHKEGLERL 520

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYY 369
           IDP L G+F+     K A +A+ C+  DP  RP M EVV+ALK + N  + A    Y
Sbjct: 521 IDPSLNGNFNFDDVAKVASIASMCVHNDPSQRPFMGEVVQALKLIYNDAEAACDDSY 577



>gb:AP005111_1848027 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0643F09.
          Length = 739

 Score =  122 bits (306), Expect = 6e-27
 Identities = 60/117 (51%), Positives = 76/117 (64%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTGHL  KSDVYS+GVVLLE+++GR+ +  +  NG +NLV WARP LC K    RL
Sbjct: 515 PEYAMTGHLLVKSDVYSYGVVLLELLSGRKPVCMSDTNGPQNLVTWARPLLCHKEGLERL 574

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYY 369
           IDP L G+F+     K A +A+ C+  DP  RP M EVV+ALK + N  + A    Y
Sbjct: 575 IDPSLNGNFNFDDVAKVASIASMCVHNDPSQRPFMGEVVQALKLIYNDAEAACDDSY 631



>gb:OSJN00112_1695130 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0103I08, complete sequence.
          Length = 458

 Score =  122 bits (306), Expect = 6e-27
 Identities = 57/103 (55%), Positives = 79/103 (76%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           P+YV TGHLT+KSDV+SFGVVL E++ GRRS+DK+RP  E+ L+EW R H     RF R+
Sbjct: 279 PDYVRTGHLTTKSDVWSFGVVLYEILAGRRSIDKSRPKDEQKLLEWVRRHPAGSPRFGRI 338

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALK 411
           +D RL+G +S++ A++ A+LAA CL++  K RP M+EVVE L+
Sbjct: 339 MDGRLQGRYSVRAAREVAELAAGCLAKHGKDRPAMAEVVERLR 381



>gb:BT003347_1636770 Arabidopsis thaliana serine/threonine-specific
           protein kinase -like (At3g55450) mRNA, complete cds.
          Length = 389

 Score =  122 bits (306), Expect = 6e-27
 Identities = 56/105 (53%), Positives = 78/105 (74%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYV TGHL ++SDVYSFGVVLLE++ GR+++D NRP  E+NLV+WARP+L  +R+   +
Sbjct: 243 PEYVSTGHLNARSDVYSFGVVLLELLCGRQALDHNRPAKEQNLVDWARPYLTSRRKVLLI 302

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +D RL   +  +GA + A +A +CLS +PK+RP M +VV AL  L
Sbjct: 303 VDTRLNSQYKPEGAVRLASIAVQCLSFEPKSRPTMDQVVRALVQL 347



>gb:BT000431_1634709 Arabidopsis thaliana serine/threonine-specific
           protein kinase -like (At3g55450) mRNA, complete cds.
          Length = 389

 Score =  122 bits (306), Expect = 6e-27
 Identities = 56/105 (53%), Positives = 78/105 (74%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYV TGHL ++SDVYSFGVVLLE++ GR+++D NRP  E+NLV+WARP+L  +R+   +
Sbjct: 243 PEYVSTGHLNARSDVYSFGVVLLELLCGRQALDHNRPAKEQNLVDWARPYLTSRRKVLLI 302

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +D RL   +  +GA + A +A +CLS +PK+RP M +VV AL  L
Sbjct: 303 VDTRLNSQYKPEGAVRLASIAVQCLSFEPKSRPTMDQVVRALVQL 347



>pir|T47684|T47684 serine/threonine-specific protein kinase-like -
           Arabidopsis thaliana>gb:ATT22E16_1555249 Arabidopsis
           thaliana DNA chromosome 3, BAC clone T22E16.
          Length = 392

 Score =  122 bits (306), Expect = 6e-27
 Identities = 56/105 (53%), Positives = 78/105 (74%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYV TGHL ++SDVYSFGVVLLE++ GR+++D NRP  E+NLV+WARP+L  +R+   +
Sbjct: 246 PEYVSTGHLNARSDVYSFGVVLLELLCGRQALDHNRPAKEQNLVDWARPYLTSRRKVLLI 305

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +D RL   +  +GA + A +A +CLS +PK+RP M +VV AL  L
Sbjct: 306 VDTRLNSQYKPEGAVRLASIAVQCLSFEPKSRPTMDQVVRALVQL 350



>gb:BT015737_1642355 Arabidopsis thaliana At1g69790 mRNA, complete
           cds.>gb:BT020520_1642914 Arabidopsis thaliana At1g69790
           gene, complete cds.
          Length = 387

 Score =  121 bits (304), Expect = 1e-26
 Identities = 56/105 (53%), Positives = 81/105 (77%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ TG LTSKSDVYSFGVVLLE+++GR ++DK++   ERNLV+WA P+L ++R+ +R+
Sbjct: 261 PEYIATGRLTSKSDVYSFGVVLLELLSGRPTLDKSKVGVERNLVDWAIPYLVDRRKVFRI 320

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +D +L G +  KGA  AA +A RCL+ +PK RP M++V+  L+ L
Sbjct: 321 MDTKLGGQYPHKGACAAANIALRCLNTEPKLRPDMADVLSTLQQL 365



>pir|A96720|A96720 hypothetical protein T6C23.1 [imported] -
           Arabidopsis thaliana>gb:AE005173_894563 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC013289_1537870 Arabidopsis thaliana
           chromosome 1 BAC T6C23 genomic sequence, complete
           sequence.
          Length = 376

 Score =  121 bits (304), Expect = 1e-26
 Identities = 56/105 (53%), Positives = 81/105 (77%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ TG LTSKSDVYSFGVVLLE+++GR ++DK++   ERNLV+WA P+L ++R+ +R+
Sbjct: 250 PEYIATGRLTSKSDVYSFGVVLLELLSGRPTLDKSKVGVERNLVDWAIPYLVDRRKVFRI 309

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +D +L G +  KGA  AA +A RCL+ +PK RP M++V+  L+ L
Sbjct: 310 MDTKLGGQYPHKGACAAANIALRCLNTEPKLRPDMADVLSTLQQL 354



>gb:AK118934_1816884 Arabidopsis thaliana At1g76360 mRNA for
           putative protein kinase, complete cds, clone:
           RAFL21-27-E13.
          Length = 335

 Score =  120 bits (302), Expect = 2e-26
 Identities = 54/110 (49%), Positives = 79/110 (71%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ TGHL  +SDVY FGVVLLE++TG R++D NRP+ ++NLVEWA+P L +K++  ++
Sbjct: 193 PEYMATGHLYVRSDVYGFGVVLLELLTGLRALDPNRPSAQQNLVEWAKPGLNQKKKVQKM 252

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKD 390
           +DPRLE  + +    K A+L  RCL  DPK RP M +V+  L+ +  ++D
Sbjct: 253 MDPRLEQKYPLLAVTKTAELILRCLEADPKNRPPMDDVLRELEVVRTIRD 302



>pir|T52285|T52285 serine/threonine-specific protein kinase APK2a
           (EC 2.7.1.-) [imported] - Arabidopsis
           thaliana>gb:AE005172_890430 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AY059894_1564738 Arabidopsis thaliana
           Strong similarity to APK2a protein (At1g14370;
           F14L17.14) mRNA, complete cds.>gb:D88206_1675096
           Arabidopsis thaliana APK2a mRNA for protein kinase,
           complete cds.>gb:F14L17_1677455 Sequence of BAC F14L17
           from Arabidopsis thaliana chromosome 1, complete
           sequence.>gb:AF334731_1787471 Arabidopsis thaliana clone
           C00152 (e) putative protein kinase (At1g14370) mRNA,
           complete cds.
          Length = 426

 Score =  120 bits (302), Expect = 2e-26
 Identities = 59/108 (54%), Positives = 80/108 (74%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYV TG LT+KSDVYSFGVVLLE+I+GRR+MD +    E +LV+WA P+L +KR+ +R+
Sbjct: 265 PEYVATGRLTAKSDVYSFGVVLLELISGRRAMDNSNGGNEYSLVDWATPYLGDKRKLFRI 324

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNL 396
           +D +L G +  KGA  AA LA +CL+ D K RP MSEV+  L+ L ++
Sbjct: 325 MDTKLGGQYPQKGAFTAANLALQCLNPDAKLRPKMSEVLVTLEQLESV 372



>pir|B96791|B96791 hypothetical protein F15M4.14 [imported] -
           Arabidopsis thaliana>gb:AE005173_895167 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC012394_1537628 Arabidopsis thaliana
           chromosome 1 BAC F15M4 genomic sequence, complete
           sequence.
          Length = 442

 Score =  120 bits (302), Expect = 2e-26
 Identities = 54/110 (49%), Positives = 79/110 (71%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ TGHL  +SDVY FGVVLLE++TG R++D NRP+ ++NLVEWA+P L +K++  ++
Sbjct: 300 PEYMATGHLYVRSDVYGFGVVLLELLTGLRALDPNRPSAQQNLVEWAKPGLNQKKKVQKM 359

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKD 390
           +DPRLE  + +    K A+L  RCL  DPK RP M +V+  L+ +  ++D
Sbjct: 360 MDPRLEQKYPLLAVTKTAELILRCLEADPKNRPPMDDVLRELEVVRTIRD 409



>gb:AP004868_1846287 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0048B08.>gb:AP007203_1863195 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBb0012J10.
          Length = 465

 Score =  120 bits (301), Expect = 2e-26
 Identities = 57/103 (55%), Positives = 79/103 (76%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           P+YV TGHLT+KSDV+SFGVVL E++TGRRSM++NRP  E+ L+EW R +  E +RF R+
Sbjct: 291 PDYVETGHLTNKSDVWSFGVVLYEILTGRRSMERNRPKNEQKLLEWVRQYPVETKRFSRI 350

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALK 411
           ID RL  ++S +G ++ A+LA  CL++  K RP M EVVE++K
Sbjct: 351 IDIRLRHNYSKQGTREIAKLANSCLAKHAKDRPTMREVVESIK 393



>gb:AP005092_1847661 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC
           clone:OJ1112_E07.>gb:AP005314_1850460 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, PAC
           clone:P0515E01.
          Length = 406

 Score =  119 bits (298), Expect = 5e-26
 Identities = 54/103 (52%), Positives = 76/103 (73%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           P+Y+ TGHLT KSDV+SFGVVL E++TGRR++D++RP GE+ L+EW      + R F  +
Sbjct: 268 PDYIETGHLTVKSDVWSFGVVLYEILTGRRTLDRHRPQGEQKLLEWVAQFAPDSRNFRMI 327

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALK 411
           +DPRL G +S+K A+  A+LA  CL ++ K RP MSEVV+ L+
Sbjct: 328 MDPRLRGEYSVKAARDIAKLAESCLLKNAKERPTMSEVVDVLR 370



>gb:AP003280_1827145 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0557A01.
          Length = 467

 Score =  119 bits (298), Expect = 5e-26
 Identities = 60/109 (55%), Positives = 76/109 (69%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LT  SD+YSFGVVLLE+ITGRR++D +RP  E+ LV+WA P + +K+RF RL
Sbjct: 318 PEYAMTGKLTKTSDIYSFGVVLLEIITGRRAIDTSRPTHEQVLVQWAAPLVKDKKRFVRL 377

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLK 393
            DP LE  F +KG  +A  +A+ CL  D   RPM+S+VV AL  L   K
Sbjct: 378 ADPLLEEKFPLKGLYQALAIASMCLQEDASNRPMISDVVAALSFLAEQK 426



>gb:AC119289_1739641 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0025P09, complete sequence.
          Length = 491

 Score =  119 bits (298), Expect = 5e-26
 Identities = 70/156 (44%), Positives = 94/156 (60%), Gaps = 10/156 (6%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LT KSDVYSFGVV LE+ITGR+++D  +P GE+NLV WARP   ++R+F ++
Sbjct: 252 PEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDNTKPLGEQNLVAWARPLFKDRRKFPKM 311

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
            DP L G F ++G  +A  +AA CL      RP + +VV AL  L      AS +Y   T
Sbjct: 312 ADPLLAGRFPMRGLYQALAVAAMCLQEQAATRPFIGDVVTALSYL------ASQTYDPNT 365

Query: 359 -MQADRI-ASSPNTKNGI--------VFSKNGQQNP 282
            +Q  R  AS+P  +N +        + S N QQ+P
Sbjct: 366 PVQHSRSNASTPRARNRVGANFDQRRLHSPNHQQSP 401



>gb:AY395743_1604832 Vitis aestivalis protein kinase-like protein
           mRNA, complete cds.
          Length = 376

 Score =  119 bits (297), Expect = 7e-26
 Identities = 60/129 (46%), Positives = 86/129 (66%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LT KSDVYSFGVVLLE+ITGR+++D ++  GE NLV WARP   ++R+F ++
Sbjct: 244 PEYAMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSKAAGEHNLVAWARPLFKDRRKFSQM 303

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
            DP L G + ++G  +A  +AA C+   P  RP++++VV AL  L + K    +    Q 
Sbjct: 304 ADPMLHGQYPLRGLYQALAVAAMCVQEQPNMRPLIADVVTALTYLASQKYDPET----QP 359

Query: 359 MQADRIASS 333
           +Q+ R+ SS
Sbjct: 360 VQSSRMGSS 368



>pir|T48301|T48301 protein kinase-like - Arabidopsis
           thaliana>gb:ATF9G14_1551383 Arabidopsis thaliana DNA
           chromosome 5, BAC clone F9G14 (ESSA project).
          Length = 395

 Score =  119 bits (297), Expect = 7e-26
 Identities = 56/109 (51%), Positives = 78/109 (71%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LT KSDVYSFGVVLLE+ITGR+++D +R  GE+NLV WARP   ++R+F ++
Sbjct: 246 PEYAMTGQLTLKSDVYSFGVVLLEIITGRKAIDSSRSTGEQNLVAWARPLFKDRRKFSQM 305

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLK 393
            DP L+G +  +G  +A  +AA C+   P  RP++++VV AL  L + K
Sbjct: 306 ADPMLQGQYPPRGLYQALAVAAMCVQEQPNLRPLIADVVTALSYLASQK 354



>gb:AP000410_1820018 Arabidopsis thaliana genomic DNA, chromosome 3,
           TAC clone: K10D20.
          Length = 377

 Score =  118 bits (296), Expect = 9e-26
 Identities = 59/105 (56%), Positives = 73/105 (69%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY +TG LT KSDVYSFGVV LEMITGRR +D  +P  E+NLV WA P   ++R+F  +
Sbjct: 247 PEYALTGQLTVKSDVYSFGVVFLEMITGRRVIDTTKPTEEQNLVTWASPLFKDRRKFTLM 306

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
            DP LEG + IKG  +A  +AA CL  +   RPMMS+VV AL+ L
Sbjct: 307 ADPLLEGKYPIKGLYQALAVAAMCLQEEAATRPMMSDVVTALEYL 351



>gb:AC104280_1737456 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1430_B02, complete sequence.
          Length = 424

 Score =  118 bits (296), Expect = 9e-26
 Identities = 54/105 (51%), Positives = 78/105 (74%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY +TGHLT+KSDVYS+GVVLLE++TGR  +D  RP GE  LV WA P L ++ +  ++
Sbjct: 304 PEYALTGHLTTKSDVYSYGVVLLELLTGRVPVDMKRPPGEGVLVNWALPMLTDREKVVQI 363

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +DP LEG +S+K A + A +AA C+ ++   RP+M++VV++L PL
Sbjct: 364 LDPALEGQYSLKDAVQVAAIAAMCVQQEADYRPLMADVVQSLVPL 408



>gb:BT003881_1637008 Arabidopsis thaliana clone RAFL15-23-A08
           (R20598) putative protein kinase (At3g20530) mRNA,
           complete cds.
          Length = 386

 Score =  118 bits (296), Expect = 9e-26
 Identities = 59/105 (56%), Positives = 73/105 (69%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY +TG LT KSDVYSFGVV LEMITGRR +D  +P  E+NLV WA P   ++R+F  +
Sbjct: 256 PEYALTGQLTVKSDVYSFGVVFLEMITGRRVIDTTKPTEEQNLVTWASPLFKDRRKFTLM 315

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
            DP LEG + IKG  +A  +AA CL  +   RPMMS+VV AL+ L
Sbjct: 316 ADPLLEGKYPIKGLYQALAVAAMCLQEEAATRPMMSDVVTALEYL 360



>gb:AY091071_1574298 Arabidopsis thaliana putative protein kinase
           (At2g20300) mRNA, complete cds.>gb:AY133858_1581678
           Arabidopsis thaliana clone U19358 putative protein
           kinase (At2g20300) mRNA, complete cds.
          Length = 744

 Score =  118 bits (296), Expect = 9e-26
 Identities = 58/119 (48%), Positives = 77/119 (64%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTGHL  KSDVYS+GVVLLE++TGRR +D ++P+GE NLV WARP L  +    +L
Sbjct: 515 PEYAMTGHLLVKSDVYSYGVVLLELLTGRRPVDMSQPSGEENLVTWARPLLANREGLEQL 574

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQ 363
           +DP L G ++     K A +A+ C+ ++   RP M EVV+ALK + N  D     Y  Q
Sbjct: 575 VDPALAGTYNFDDMAKVAAIASMCVHQEVSHRPFMGEVVQALKLIYNDADETCGDYCSQ 633



>pir|E84587|E84587 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AC006569_1534470 Arabidopsis thaliana
           chromosome 2 clone F11A3 map mi148, complete sequence.
          Length = 435

 Score =  118 bits (296), Expect = 9e-26
 Identities = 58/119 (48%), Positives = 77/119 (64%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTGHL  KSDVYS+GVVLLE++TGRR +D ++P+GE NLV WARP L  +    +L
Sbjct: 206 PEYAMTGHLLVKSDVYSYGVVLLELLTGRRPVDMSQPSGEENLVTWARPLLANREGLEQL 265

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQ 363
           +DP L G ++     K A +A+ C+ ++   RP M EVV+ALK + N  D     Y  Q
Sbjct: 266 VDPALAGTYNFDDMAKVAAIASMCVHQEVSHRPFMGEVVQALKLIYNDADETCGDYCSQ 324



>sp|Q9FE20|PBS1_ARATH Serine/threonine-protein kinase PBS1 (EC
           2.7.1.37) (AvrPphB susceptible protein
           1).>gb:ATT19L5_1554847 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T19L5 (ESSA
           project).>gb:AY078037_1568006 Arabidopsis thaliana
           AT5g13160/T19L5_120 mRNA, complete
           cds.>gb:AF314176_1785302 Arabidopsis thaliana protein
           serine/threonine kinase PBS1 (PBS1) mRNA, complete
           cds.>gb:AF372927_1792642 Arabidopsis thaliana
           AT5g13160/T19L5_120 mRNA, complete cds.
          Length = 456

 Score =  118 bits (296), Expect = 9e-26
 Identities = 55/107 (51%), Positives = 75/107 (70%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LT KSDVYSFGVV LE+ITGR+++D   P+GE+NLV WARP   ++R+F +L
Sbjct: 259 PEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSEMPHGEQNLVAWARPLFNDRRKFIKL 318

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPN 399
            DPRL+G F  +   +A  +A+ C+      RP++++VV AL  L N
Sbjct: 319 ADPRLKGRFPTRALYQALAVASMCIQEQAATRPLIADVVTALSYLAN 365



>gb:AP004570_1841747 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0625E02.
          Length = 479

 Score =  118 bits (295), Expect = 1e-25
 Identities = 63/158 (39%), Positives = 96/158 (60%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LT KSDVYSFGVV LE+ITGR+++D  +P GE+NLV WARP   ++R+F ++
Sbjct: 251 PEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDHTQPAGEQNLVAWARPLFRDRRKFCQM 310

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
            DP L+G +  +G  +A  +A+ CL  +  +RP+++++V AL  L      AS+ Y    
Sbjct: 311 ADPSLQGCYPKRGLYQALAVASMCLQENATSRPLIADIVTALSYL------ASNHYDPNA 364

Query: 359 MQADRIASSPNTKNGIVFSKNGQQNPRSLSIPNGSHAS 246
             A    + P+T          + + R+ S+P+  HA+
Sbjct: 365 PSAKSSRTCPST-------PKAKAHRRTTSVPDAQHAA 395



>gb:AP003266_1826760 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0492G09.
          Length = 491

 Score =  117 bits (294), Expect = 2e-25
 Identities = 68/161 (42%), Positives = 94/161 (58%), Gaps = 2/161 (1%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LT KSDVYSFGVV LE+ITGR+++D  +P GE+NLV WARP   ++R+F ++
Sbjct: 255 PEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDNTKPQGEQNLVAWARPLFKDRRKFPKM 314

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSY--YF 366
            DP L+G F ++G  +A  +AA CL      RP + +VV AL  L      AS +Y    
Sbjct: 315 ADPMLQGRFPMRGLYQALAVAAMCLQEQATTRPHIGDVVTALSYL------ASQTYDPNA 368

Query: 365 QTMQADRIASSPNTKNGIVFSKNGQQNPRSLSIPNGSHASP 243
               +   +S+P  +N         ++ RS+  PN  H SP
Sbjct: 369 PVQHSRSNSSTPRARN----LAGWNEDRRSVRSPN--HHSP 403



>gb:BT020268_1642663 Arabidopsis thaliana At1g26970 mRNA, complete
           cds.>gb:BT020441_1642836 Arabidopsis thaliana At1g26970
           mRNA, complete cds.
          Length = 412

 Score =  117 bits (294), Expect = 2e-25
 Identities = 55/105 (52%), Positives = 79/105 (75%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYV TG +T+KSDVYSFGVVLLE+++GR ++DK +   ERNLV+WA P+L +KR+ +R+
Sbjct: 261 PEYVATGRITAKSDVYSFGVVLLELLSGRLTVDKTKVGVERNLVDWAIPYLGDKRKVFRI 320

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +D +L G +  KGA   A  A +CL+++PK RP MS+V+  L+ L
Sbjct: 321 MDTKLGGQYPHKGACLTANTALQCLNQEPKLRPKMSDVLSTLEEL 365



>pir|G86396|G86396 protein T7N9.2 [imported] - Arabidopsis
           thaliana>gb:AE005172_891575 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC000348_1530054 Genomic sequence for
           Arabidopsis thaliana BAC T7N9 from chromosome I,
           complete sequence.
          Length = 453

 Score =  117 bits (294), Expect = 2e-25
 Identities = 55/105 (52%), Positives = 79/105 (75%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYV TG +T+KSDVYSFGVVLLE+++GR ++DK +   ERNLV+WA P+L +KR+ +R+
Sbjct: 302 PEYVATGRITAKSDVYSFGVVLLELLSGRLTVDKTKVGVERNLVDWAIPYLGDKRKVFRI 361

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +D +L G +  KGA   A  A +CL+++PK RP MS+V+  L+ L
Sbjct: 362 MDTKLGGQYPHKGACLTANTALQCLNQEPKLRPKMSDVLSTLEEL 406



>gb:AB041504_1519670 Populus nigra PnPK2 mRNA for protein kinase 2,
           complete cds.
          Length = 406

 Score =  117 bits (292), Expect = 3e-25
 Identities = 56/109 (51%), Positives = 76/109 (69%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           P+Y MTG LT KSDVYSFGVVLLE+ITGR+++D+ +   E+NLV WARP   ++R F  +
Sbjct: 271 PDYAMTGQLTFKSDVYSFGVVLLELITGRKAIDQTKERSEQNLVAWARPMFKDRRNFSGM 330

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLK 393
           +DP L+G + IKG  +A  +AA C+   P  RP +S+VV AL  L + K
Sbjct: 331 VDPFLQGQYPIKGLYQALAIAAMCVQEQPNMRPAVSDVVLALNYLASHK 379



>gb:AB041503_1519669 Populus nigra PnPK1 mRNA for protein kinase 1,
           complete cds.
          Length = 405

 Score =  117 bits (292), Expect = 3e-25
 Identities = 54/109 (49%), Positives = 77/109 (70%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           P+Y MTG LT KSD+YSFGVVLLE+ITGR+++D+ +  GE+NLV WARP   ++R F  +
Sbjct: 271 PDYAMTGQLTFKSDIYSFGVVLLELITGRKAIDQRKERGEQNLVAWARPMFKDRRNFSCM 330

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLK 393
           +DP L+G + I+G  +A  +AA C+   P  RP +S++V AL  L + K
Sbjct: 331 VDPLLQGQYPIRGLYQALAIAAMCVQEQPNMRPAVSDLVMALNYLASHK 379



>pir|T00574|T00574 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AC003674_1531173 Arabidopsis thaliana
           chromosome 2 clone F17A14 map CIC10A06, complete
           sequence.>gb:AC004218_1531549 Arabidopsis thaliana
           chromosome 2 clone F12L6 map CIC10A06, complete
           sequence.>gb:AY062493_1565149 Arabidopsis thaliana
           putative protein kinase (At2g39660; F17A14.3) mRNA,
           complete cds.>gb:AY065029_1566188 Arabidopsis thaliana
           At2g39660/F12L6.32 mRNA, complete
           cds.>gb:AY093278_1575232 Arabidopsis thaliana putative
           protein kinase (At2g39660) mRNA, complete
           cds.>gb:AY093997_1575503 Arabidopsis thaliana
           At2g39660/F12L6.32 mRNA, complete
           cds.>gb:AF325086_1786540 Arabidopsis thaliana putative
           protein kinase (At2g39660) mRNA, complete cds.
          Length = 395

 Score =  116 bits (291), Expect = 4e-25
 Identities = 53/105 (50%), Positives = 79/105 (75%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ +GHL ++SDVYSFGV+LLE+++G+R++D NRP  E NLV+WARP+L  KR+   +
Sbjct: 248 PEYMSSGHLNARSDVYSFGVLLLEILSGKRALDHNRPAKEENLVDWARPYLTSKRKVLLI 307

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +D RL+  +  + A + A +A +CLS +PK+RP M +VV AL+ L
Sbjct: 308 VDNRLDTQYLPEEAVRMASVAVQCLSFEPKSRPTMDQVVRALQQL 352



>gb:AP005199_1849344 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0627E10.
          Length = 390

 Score =  115 bits (289), Expect = 6e-25
 Identities = 55/102 (53%), Positives = 72/102 (70%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LT KSDVYSFGVVLLE+ITGRR++D  R  GE+NLV WARP   ++R+F ++
Sbjct: 260 PEYAMTGQLTLKSDVYSFGVVLLEIITGRRAIDNTRAAGEQNLVAWARPLFKDRRKFPQM 319

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
            DP L G +  +G  +A  +AA C+   P  RP++ +VV AL
Sbjct: 320 ADPALHGQYPSRGLYQALAVAAMCVQEQPTMRPLIGDVVTAL 361



>gb:AP002525_1822425 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0462H08.
          Length = 455

 Score =  115 bits (289), Expect = 6e-25
 Identities = 67/159 (42%), Positives = 88/159 (55%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ TG LT KSD+YSFGVV LE+ITGRR++D NRP  E++LV WARP   ++R+F ++
Sbjct: 248 PEYLSTGKLTIKSDIYSFGVVFLELITGRRALDSNRPPDEQDLVAWARPLFKDQRKFPKM 307

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
            DP L GHF  +G  +A  +AA CL    K RP + EV  AL  L      AS ++  Q 
Sbjct: 308 ADPSLHGHFPKRGLFQALAIAAMCLQEKAKNRPSIREVAVALSYL------ASQTHESQN 361

Query: 359 MQADRIASSPNTKNGIVFSKNGQQNPRSLSIPNGSHASP 243
             A      P+    +    N      SL   +G H  P
Sbjct: 362 TAARHTLPGPSVPRVL---DNQINQDTSLPSQHGVHMPP 397



>gb:AP003614_1831401 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0481E08.
          Length = 381

 Score =  115 bits (288), Expect = 8e-25
 Identities = 54/103 (52%), Positives = 76/103 (73%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           P+Y+ TGHLT+KSDV+SFGVVL E++TGRRS++++RP  E+ L+ W R H  E + F  +
Sbjct: 253 PDYIETGHLTTKSDVWSFGVVLYEILTGRRSLERSRPAEEQKLLGWVRRHPPESQSFRSI 312

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALK 411
           +DPRL G +    A++ A+LA RCL ++PK RP M EVVE L+
Sbjct: 313 MDPRLGGRYPAAAARQVARLADRCLVKNPKERPAMREVVEELE 355



>gb:AY007545_1558031 Brassica napus protein serine/threonine kinase
           BNK1 mRNA, complete cds.
          Length = 376

 Score =  115 bits (288), Expect = 8e-25
 Identities = 53/102 (51%), Positives = 75/102 (73%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LT KSDVYSFGVVLLE+ITGR+++D +R  GE+NLV WARP   ++R+F ++
Sbjct: 243 PEYAMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSRCTGEQNLVAWARPLFKDRRKFSQM 302

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
            DP ++G +  +G  +A  +AA C+   P  RP++++VV AL
Sbjct: 303 ADPMIQGQYPPRGLYQALAVAAMCVQEQPNLRPVIADVVTAL 344



>gb:BT004627_1637661 Arabidopsis thaliana At3g07070 gene, complete
           cds.
          Length = 414

 Score =  115 bits (287), Expect = 1e-24
 Identities = 59/102 (57%), Positives = 69/102 (67%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY  TG LT+KSDVYSFGVVLLE+ITGRR +D  RP  E+NLV WA+P   E  RF  L
Sbjct: 252 PEYQRTGQLTTKSDVYSFGVVLLELITGRRVIDTTRPKDEQNLVTWAQPVFKEPSRFPEL 311

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
            DP LEG F  K   +A  +AA CL  +   RP+MS+VV AL
Sbjct: 312 ADPSLEGVFPEKALNQAVAVAAMCLQEEATVRPLMSDVVTAL 353



>gb:ATAC012395_1543484 Arabidopsis thaliana chromosome III BAC T1B9
           genomic sequence, complete sequence.
          Length = 414

 Score =  115 bits (287), Expect = 1e-24
 Identities = 59/102 (57%), Positives = 69/102 (67%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY  TG LT+KSDVYSFGVVLLE+ITGRR +D  RP  E+NLV WA+P   E  RF  L
Sbjct: 252 PEYQRTGQLTTKSDVYSFGVVLLELITGRRVIDTTRPKDEQNLVTWAQPVFKEPSRFPEL 311

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
            DP LEG F  K   +A  +AA CL  +   RP+MS+VV AL
Sbjct: 312 ADPSLEGVFPEKALNQAVAVAAMCLQEEATVRPLMSDVVTAL 353



>gb:AK117450_1815484 Arabidopsis thaliana At3g58690 mRNA for
           putative serine/threonine-specific protein kinase,
           complete cds, clone: RAFL17-05-P15.
          Length = 271

 Score =  114 bits (286), Expect = 1e-24
 Identities = 58/132 (43%), Positives = 86/132 (65%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY +TGHLT+KSDVYS+GVVLLE++TGR  +D  R  GE  LV WA P L ++ +   +
Sbjct: 133 PEYALTGHLTTKSDVYSYGVVLLELLTGRVPVDMKRATGEGVLVSWALPQLADRDKVVDI 192

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           +DP LEG +S K   + A +AA C+  +   RP+M++VV++L PL  +++  S+S     
Sbjct: 193 MDPTLEGQYSTKEVVQVAAIAAMCVQAEADYRPLMADVVQSLVPL--VRNRRSASKLSGC 250

Query: 359 MQADRIASSPNT 324
             +  +A SPN+
Sbjct: 251 SSSFSLARSPNS 262



>gb:AB025609_1516337 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K14A3.>gb:BT005677_1638617 Arabidopsis
           thaliana clone U50474 putative protein serine threonine
           kinase (At5g47070) mRNA, complete
           cds.>gb:AK117556_1815586 Arabidopsis thaliana At5g47070
           mRNA for putative protein serine/threonine kinase,
           complete cds, clone: RAFL17-20-O04.
          Length = 410

 Score =  114 bits (286), Expect = 1e-24
 Identities = 56/120 (46%), Positives = 80/120 (66%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYV TGHL  KSDVYSFGVVL E+ITGRR++++N+P  ER L++W + +  + +RF  +
Sbjct: 264 PEYVQTGHLRLKSDVYSFGVVLYEIITGRRTIERNKPVAERRLLDWVKEYPADSQRFSMI 323

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           +DPRL  ++   GA+  A+LA  CL ++ K RP M  VVE LK +  +++  S  Y   T
Sbjct: 324 VDPRLRNNYPAAGARSLAKLADLCLKKNDKERPTMEIVVERLKKI--IEESDSEDYPMAT 381



>pir|T49152|T49152 serine/threonine-specific protein kinase-like
           protein - Arabidopsis thaliana>gb:ATT20N10_1555052
           Arabidopsis thaliana DNA chromosome 3, BAC clone T20N10.
          Length = 386

 Score =  114 bits (286), Expect = 1e-24
 Identities = 58/132 (43%), Positives = 86/132 (65%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY +TGHLT+KSDVYS+GVVLLE++TGR  +D  R  GE  LV WA P L ++ +   +
Sbjct: 248 PEYALTGHLTTKSDVYSYGVVLLELLTGRVPVDMKRATGEGVLVSWALPQLADRDKVVDI 307

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           +DP LEG +S K   + A +AA C+  +   RP+M++VV++L PL  +++  S+S     
Sbjct: 308 MDPTLEGQYSTKEVVQVAAIAAMCVQAEADYRPLMADVVQSLVPL--VRNRRSASKLSGC 365

Query: 359 MQADRIASSPNT 324
             +  +A SPN+
Sbjct: 366 SSSFSLARSPNS 377



>sp|Q9LQQ8|RCK7_ARATH Putative serine/threonine-protein kinase
           RLCKVII (EC 2.7.1.37).>pir|B86214|B86214 hypothetical
           protein [imported] - Arabidopsis
           thaliana>gb:AE005172_889796 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AY072186_1567076 Arabidopsis thaliana
           putative protein kinase (At1g07870) mRNA, complete
           cds.>gb:AY096744_1576279 Arabidopsis thaliana putative
           protein kinase (At1g07870) mRNA, complete
           cds.>gb:F24B9_1677960 Arabidopsis thaliana chromosome 1
           BAC F24B9 sequence, complete sequence.
          Length = 423

 Score =  112 bits (281), Expect = 5e-24
 Identities = 51/109 (46%), Positives = 77/109 (70%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           P+Y MTG LT KSD+YSFGVVLLE+ITGR+++D  +   ++NLV WARP   ++R F ++
Sbjct: 276 PDYAMTGQLTFKSDIYSFGVVLLELITGRKAIDNTKTRKDQNLVGWARPLFKDRRNFPKM 335

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLK 393
           +DP L+G + ++G  +A  ++A C+   P  RP++S+VV AL  L + K
Sbjct: 336 VDPLLQGQYPVRGLYQALAISAMCVQEQPTMRPVVSDVVLALNFLASSK 384



>pir|G84686|G84686 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AC006587_1534554 Arabidopsis thaliana
           chromosome 2 clone T17D12 map mi54, complete
           sequence.>gb:AC007171_1535471 Arabidopsis thaliana
           chromosome 2 clone T8O18 map mi54, complete sequence.
          Length = 424

 Score =  112 bits (280), Expect = 7e-24
 Identities = 51/109 (46%), Positives = 75/109 (68%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           P+Y +TG LT KSDVYSFGVVLLE+ITGR++ D  R    ++LVEWA P   +++ F ++
Sbjct: 271 PDYALTGQLTFKSDVYSFGVVLLELITGRKAYDNTRTRNHQSLVEWANPLFKDRKNFKKM 330

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLK 393
           +DP LEG + ++G  +A  +AA C+   P  RP++++VV AL  L + K
Sbjct: 331 VDPLLEGDYPVRGLYQALAIAAMCVQEQPSMRPVIADVVMALDHLASSK 379



>gb:AP003418_1829222 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0506A10.
          Length = 369

 Score =  112 bits (279), Expect = 9e-24
 Identities = 57/105 (54%), Positives = 72/105 (68%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LT KSDVYSFGVVLLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 250 PEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLTED-KVKQC 308

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           IDPRL G +  KG  K A +AA C+  + + RP MS VV+AL PL
Sbjct: 309 IDPRLNGEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALSPL 353



>pir|T07699|T07699 hypothetical protein F17N18.80 - Arabidopsis
           thaliana>gb:ATCHRIV35_1545083 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           35.>gb:ATF17N18_1549039 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F17N18 (ESSA project).
          Length = 405

 Score =  112 bits (279), Expect = 9e-24
 Identities = 57/102 (55%), Positives = 69/102 (67%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY  TG LT KSDVYSFGVVLLE+ITG+R +D  RP  E+NLV WA+P   E  RF  L
Sbjct: 260 PEYHKTGQLTVKSDVYSFGVVLLELITGKRVIDTTRPCHEQNLVTWAQPIFREPNRFPEL 319

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
            DP L+G F  K   +A  +AA CL  +P  RP++S+VV AL
Sbjct: 320 ADPLLQGEFPEKSLNQAVAIAAMCLQEEPIVRPLISDVVTAL 361



>gb:ATAC018363_1543686 Arabidopsis thaliana chromosome III BAC F13E7
           genomic sequence, complete sequence.>gb:BT004041_1637152
           Arabidopsis thaliana clone RAFL15-02-J08 (R20396)
           putative protein kinase (At3g02810) mRNA, complete
           cds.>gb:BT004942_1637888 Arabidopsis thaliana clone
           U20396 putative protein kinase (At3g02810) mRNA,
           complete cds.
          Length = 558

 Score =  111 bits (278), Expect = 1e-23
 Identities = 53/102 (51%), Positives = 73/102 (71%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY   G+LT KSDVYSFGVVLLE+ITGRR++D  RPN E+NLV WA+P   + +R+  +
Sbjct: 239 PEYTRGGNLTLKSDVYSFGVVLLELITGRRALDTTRPNDEQNLVSWAQPIFRDPKRYPDM 298

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
            DP LE  FS +G  +A  +A+ C+  +  ARP++S+V+ AL
Sbjct: 299 ADPVLENKFSERGLNQAVAIASMCVQEEASARPLISDVMVAL 340



>gb:AB028609_1517917 Arabidopsis thaliana genomic DNA, chromosome 3,
           TAC clone:K7P8.
          Length = 381

 Score =  111 bits (278), Expect = 1e-23
 Identities = 54/102 (52%), Positives = 72/102 (70%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY  TG+LT+KSDVYSFGVVLLE+I+GRR +D  RP+ E+NLV WA P   +  R+++L
Sbjct: 238 PEYQRTGYLTNKSDVYSFGVVLLELISGRRVIDTMRPSHEQNLVTWALPIFRDPTRYWQL 297

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
            DP L G +  K   +A  +AA CL  +P  RP+MS+V+ AL
Sbjct: 298 ADPLLRGDYPEKSLNQAIAVAAMCLHEEPTVRPLMSDVITAL 339



>gb:AP006756_1862889 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0450E05.
          Length = 372

 Score =  111 bits (277), Expect = 1e-23
 Identities = 56/105 (53%), Positives = 72/105 (68%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LT KSDVYSFGVVLLE++TGR+ +D   P G+++LV WA P L E     + 
Sbjct: 254 PEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLTED-TVKQC 312

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +DPRL+G +  KG  K A +AA C+  + + RP MS VV+AL PL
Sbjct: 313 VDPRLKGEYPPKGVAKLAAVAALCVQYESEFRPSMSIVVKALSPL 357



>gb:AP006162_1861144 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC
           clone:B1331F11.>gb:AP006450_1861835 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:B1130E07.
          Length = 419

 Score =  111 bits (277), Expect = 1e-23
 Identities = 55/105 (52%), Positives = 72/105 (68%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY +TG LT+ SDVYSFGVV LE+ITGRR++D  RP+ E+NLV+WA P   +K+ F  +
Sbjct: 285 PEYALTGKLTTCSDVYSFGVVFLEIITGRRAIDMARPHDEQNLVQWAAPRFKDKKLFADM 344

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
            DP L G +  KG  +A  +AA CL  D   RP +S+VV AL+ L
Sbjct: 345 ADPLLRGAYPTKGLYQALAIAAMCLQEDATMRPAISDVVTALEYL 389



>gb:F11A17_1677318 Arabidopsis thaliana chromosome 1 BAC F11A17
           sequence, complete sequence.
          Length = 364

 Score =  110 bits (276), Expect = 2e-23
 Identities = 57/107 (53%), Positives = 75/107 (70%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PE+ MTG LT+KSDVYSFGVVLLE++TGR+ +D+  P G++NLV WA P L  K +  + 
Sbjct: 245 PEHAMTGILTTKSDVYSFGVVLLELLTGRKPVDRTLPRGQQNLVTWATPKL-SKDKVKQC 303

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPN 399
           +D RL G +  K   K A ++ARC+  DP  RP MS VV+AL+PL N
Sbjct: 304 VDARLLGEYPPKAVAKLAAVSARCVHYDPDFRPDMSIVVKALQPLLN 350



>gb:BT008338_1639555 Arabidopsis thaliana At1g74490 mRNA, complete
           cds.
          Length = 399

 Score =  110 bits (276), Expect = 2e-23
 Identities = 57/118 (48%), Positives = 80/118 (67%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ TGHLT+K DVYSFGVVLLE+++GRR +DK++   E NLV+WA P+L +KR+ +R+
Sbjct: 264 PEYLATGHLTTKCDVYSFGVVLLEILSGRRVIDKSKSREEENLVDWATPYLRDKRKVFRI 323

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYF 366
           +D +L G +  K A   + LA +C+  D K RP M EVV  L+ +P  +   S S  F
Sbjct: 324 MDTKLVGQYPQKAAFMMSFLALQCIG-DVKVRPSMLEVVSLLEKVPIPRHRKSRSKGF 380



>gb:AY125515_1580323 Arabidopsis thaliana AT4g02010/T10M13_2 mRNA,
           complete cds.>gb:BT009694_1640155 Arabidopsis thaliana
           At4g02010/T10M13_2 gene, complete cds.
          Length = 725

 Score =  110 bits (276), Expect = 2e-23
 Identities = 52/103 (50%), Positives = 72/103 (69%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTGHL  KSDVYS+GVVLLE++TGR+ +D ++P+G+ NLV W RP L +K R   L
Sbjct: 554 PEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDMSQPSGQENLVTWTRPVLRDKDRLEEL 613

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALK 411
           +D RLEG +  +   +   +AA C++ +   RP M EVV++LK
Sbjct: 614 VDSRLEGKYPKEDFIRVCTIAAACVAPEASQRPTMGEVVQSLK 656



>pir|T01502|T01502 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) T10M13.2 - Arabidopsis
           thaliana>gb:ATAF001308_1543828 Arabidopsis thaliana BAC
           T10M13 from chromosome IV, from 10.8 cM to 11.6 cM,
           complete sequence.>gb:ATCHRIV5_1545724 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No. 5.
          Length = 707

 Score =  110 bits (276), Expect = 2e-23
 Identities = 52/103 (50%), Positives = 72/103 (69%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTGHL  KSDVYS+GVVLLE++TGR+ +D ++P+G+ NLV W RP L +K R   L
Sbjct: 536 PEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDMSQPSGQENLVTWTRPVLRDKDRLEEL 595

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALK 411
           +D RLEG +  +   +   +AA C++ +   RP M EVV++LK
Sbjct: 596 VDSRLEGKYPKEDFIRVCTIAAACVAPEASQRPTMGEVVQSLK 638



>pir|A96522|A96522 protein F21D18.6 [imported] - Arabidopsis
           thaliana>gb:AE005173_892782 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC023673_1539204 Genomic sequence for
           Arabidopsis thaliana BAC F21D18 from chromosome I,
           complete sequence.
          Length = 732

 Score =  110 bits (276), Expect = 2e-23
 Identities = 57/107 (53%), Positives = 75/107 (70%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PE+ MTG LT+KSDVYSFGVVLLE++TGR+ +D+  P G++NLV WA P L  K +  + 
Sbjct: 613 PEHAMTGILTTKSDVYSFGVVLLELLTGRKPVDRTLPRGQQNLVTWATPKL-SKDKVKQC 671

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPN 399
           +D RL G +  K   K A ++ARC+  DP  RP MS VV+AL+PL N
Sbjct: 672 VDARLLGEYPPKAVAKLAAVSARCVHYDPDFRPDMSIVVKALQPLLN 718



 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 49/103 (47%), Positives = 67/103 (65%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG L+SKSDVYSFGVVLLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 244 PEYAMTGTLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSED-KVKQC 302

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALK 411
           +D RL G +  K   K A +AA C+  +   RP MS V+  ++
Sbjct: 303 VDARLLGEYPPKAVGKLAAVAALCVQYEANFRPNMSIVLARVR 345



>pir|H96773|H96773 hypothetical protein F1M20.17 [imported] -
           Arabidopsis thaliana>gb:AE005173_894994 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC011765_1537398 Arabidopsis thaliana
           chromosome 1 BAC F1M20 genomic sequence, complete
           sequence.
          Length = 378

 Score =  110 bits (276), Expect = 2e-23
 Identities = 57/118 (48%), Positives = 80/118 (67%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ TGHLT+K DVYSFGVVLLE+++GRR +DK++   E NLV+WA P+L +KR+ +R+
Sbjct: 243 PEYLATGHLTTKCDVYSFGVVLLEILSGRRVIDKSKSREEENLVDWATPYLRDKRKVFRI 302

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYF 366
           +D +L G +  K A   + LA +C+  D K RP M EVV  L+ +P  +   S S  F
Sbjct: 303 MDTKLVGQYPQKAAFMMSFLALQCIG-DVKVRPSMLEVVSLLEKVPIPRHRKSRSKGF 359



>gb:AP000816_1820640 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0503G09.
          Length = 708

 Score =  110 bits (274), Expect = 3e-23
 Identities = 53/103 (51%), Positives = 70/103 (67%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTGHL  KSDVYS+GVVLLE++TGRR +D ++P+G+ NLV WARP L +K     L
Sbjct: 541 PEYAMTGHLLVKSDVYSYGVVLLELLTGRRPVDMSQPSGQENLVTWARPILRDKDTLEEL 600

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALK 411
            DP+L G +      +   +AA C+S +   RP M EVV++LK
Sbjct: 601 ADPKLGGQYPKDDFVRVCTIAAACVSPEASQRPTMGEVVQSLK 643



>gb:AP002953_1823973 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0426D06.>gb:AP003211_1825254 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OSJNBa0011P19.
          Length = 371

 Score =  109 bits (273), Expect = 4e-23
 Identities = 56/107 (52%), Positives = 73/107 (68%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG L++KSDVYSFGVVLLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 247 PEYAMTGQLSTKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSED-KVKQC 305

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPN 399
           +DPRLEG +  K   K A +AA C+  +   RP MS VV+AL PL N
Sbjct: 306 VDPRLEGDYPPKAVAKMAAVAALCVQYEADFRPNMSIVVKALNPLLN 352



>gb:AF249318_1780697 Glycine max Pti1 kinase-like protein (Pti1b)
           mRNA, complete cds.
          Length = 360

 Score =  109 bits (273), Expect = 4e-23
 Identities = 55/113 (48%), Positives = 77/113 (68%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LTSKSDVYSFGV+LLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 243 PEYAMTGQLTSKSDVYSFGVILLELLTGRKPVDHTLPRGQQSLVTWATPKLSED-KVKQC 301

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMAS 381
           +D RL+G +  K   K A +AA C+  + + RP MS +V+AL+PL N + + S
Sbjct: 302 VDVRLKGEYPSKSVAKMAAVAALCVQYEAEFRPNMSIIVKALQPLLNTRSVHS 354



>gb:AC092852_1735770 Oryza sativa chromosome 3 BAC OSJNBa0032G11
           genomic sequence, complete sequence.
          Length = 368

 Score =  109 bits (273), Expect = 4e-23
 Identities = 55/105 (52%), Positives = 72/105 (68%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LT KSDVYSFGVVLLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 246 PEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSED-KVKQC 304

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +DPRL+  +  KG  K A +AA C+  + + RP MS VV+AL PL
Sbjct: 305 VDPRLKSEYPPKGVAKLAAVAALCVQYEAEFRPNMSIVVKALSPL 349



>gb:AY263347_1593758 Glycine max protein kinase Pti1 (Pti1) mRNA,
           complete cds.
          Length = 366

 Score =  109 bits (273), Expect = 4e-23
 Identities = 54/105 (51%), Positives = 73/105 (69%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LT KSDVYSFGVVLLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 249 PEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSED-KVKQC 307

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +DP+L+G +  KG  K   +AA C+  + + RP MS VV+AL+PL
Sbjct: 308 VDPKLKGEYPPKGVAKLGAVAALCVQYEAEFRPNMSIVVKALQPL 352



>gb:AY708048_1623886 Zea mays salt-inducible putative protein
           serine/threonine/tyrosine kinase mRNA, complete cds.
          Length = 364

 Score =  109 bits (272), Expect = 6e-23
 Identities = 55/105 (52%), Positives = 71/105 (67%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY M G LT KSDVYSFGVVLLE++TGR+ +D   P G+++LV WA P L E     + 
Sbjct: 241 PEYAMAGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLTED-TVKQC 299

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +DPRL+G +  KG  K A +AA C+  + + RP MS VV+AL PL
Sbjct: 300 VDPRLKGEYPPKGVAKLAAVAALCVQYESEFRPSMSIVVKALSPL 344



>gb:AF249317_1780696 Glycine max Pti1 kinase-like protein (Pti1a)
           mRNA, complete cds.
          Length = 360

 Score =  108 bits (271), Expect = 7e-23
 Identities = 55/113 (48%), Positives = 76/113 (67%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LTSKSDVYSFGV+LLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 243 PEYAMTGQLTSKSDVYSFGVILLELLTGRKPVDHTLPRGQQSLVTWATPKLSED-KVKQC 301

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMAS 381
           +D RL+G +  K   K A +AA C+  + + RP MS +V+AL+PL N +   S
Sbjct: 302 VDVRLKGEYPSKSVAKMAAVAALCVQYEAEFRPNMSIIVKALQPLLNTRSSHS 354



>gb:AY054639_1563293 Arabidopsis thaliana protein kinase-like
           protein (At3g59350; F25L23_210) mRNA, complete
           cds.>gb:BT008449_1639666 Arabidopsis thaliana At3g59350
           gene, complete cds.
          Length = 366

 Score =  108 bits (271), Expect = 7e-23
 Identities = 54/105 (51%), Positives = 73/105 (69%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LT KSDVYSFGVVLLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 249 PEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSED-KVKQC 307

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +DP+L+G +  K   K A +AA C+  + + RP MS VV+AL+PL
Sbjct: 308 VDPKLKGEYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQPL 352



>gb:AC004450_1531709 Arabidopsis thaliana chromosome 2 clone F14B2
           map CIC10F02, complete sequence.>gb:AY054533_1563187
           Arabidopsis thaliana putative protein kinase (At2g43230;
           F14B2.17) mRNA, complete cds.>gb:BT000153_1634431
           Arabidopsis thaliana putative protein kinase (At2g43230)
           mRNA, complete cds.
          Length = 406

 Score =  108 bits (271), Expect = 7e-23
 Identities = 54/105 (51%), Positives = 73/105 (69%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LT KSDVYSFGVVLLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 289 PEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSED-KVKQC 347

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +DP+L+G +  K   K A +AA C+  + + RP MS VV+AL+PL
Sbjct: 348 VDPKLKGEYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQPL 392



>gb:AB121973_1528021 Brassica rapa MLPK mRNA for protein kinase,
           complete cds.
          Length = 404

 Score =  108 bits (271), Expect = 7e-23
 Identities = 51/99 (51%), Positives = 69/99 (69%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           P Y++ GHLT+KSDVYS+GVVLLEM++GR+ +D NRP  E+ LV+WA+P L  K++  R+
Sbjct: 255 PGYLLNGHLTTKSDVYSYGVVLLEMLSGRKVVDNNRPPREQKLVDWAKPLLANKKKVSRV 314

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVV 423
           ID R+    S+K A K A    RCL  D   RP M+E+V
Sbjct: 315 IDNRIRDQISVKEAHKVATQVFRCLDVDKNQRPNMNEIV 353



>pir|F84863|F84863 probable protein kinase [imported] - Arabidopsis
           thaliana
          Length = 367

 Score =  108 bits (271), Expect = 7e-23
 Identities = 54/105 (51%), Positives = 73/105 (69%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LT KSDVYSFGVVLLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 250 PEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSED-KVKQC 308

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +DP+L+G +  K   K A +AA C+  + + RP MS VV+AL+PL
Sbjct: 309 VDPKLKGEYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQPL 353



>pir|T49003|T49003 protein kinase-like protein - Arabidopsis
           thaliana>gb:ATF25L23_1550060 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F25L23.
          Length = 403

 Score =  108 bits (271), Expect = 7e-23
 Identities = 54/105 (51%), Positives = 73/105 (69%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LT KSDVYSFGVVLLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 286 PEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSED-KVKQC 344

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +DP+L+G +  K   K A +AA C+  + + RP MS VV+AL+PL
Sbjct: 345 VDPKLKGEYPPKAVAKLAAVAALCVQYESEFRPNMSIVVKALQPL 389



>pir|B84712|B84712 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AC002340_1530532 Arabidopsis thaliana
           chromosome 2 BAC T11J7 genomic sequence, complete
           sequence.>gb:ATH303007_1552435 Arabidopsis thaliana mRNA
           for putative PTI1-like protein tyrosine kinase (t11J7.13
           gene).
          Length = 366

 Score =  108 bits (271), Expect = 7e-23
 Identities = 54/105 (51%), Positives = 73/105 (69%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LT KSDVYSFGVVLLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 249 PEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSED-KVKQC 307

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +DP+L+G +  K   K A +AA C+  + + RP MS VV+AL+PL
Sbjct: 308 VDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMSIVVKALQPL 352



>gb:AP003864_1834495 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1058_B11.>gb:AP003956_1835687 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OJ1457_D07.
          Length = 457

 Score =  108 bits (270), Expect = 1e-22
 Identities = 54/103 (52%), Positives = 71/103 (68%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           P+YV TG LT++SDV+SFGVVLLE++TG R+ D++RP  ++ LV+WAR H    R F RL
Sbjct: 268 PDYVETGRLTARSDVWSFGVVLLELLTGHRAFDRSRPRPDQKLVDWARRHPAGTRWFSRL 327

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALK 411
            DPRL G +S + AQ  A LA RCL+     RP M+E   AL+
Sbjct: 328 PDPRLAGRYSHRAAQDVAALAWRCLADRAGERPSMAEAARALE 370



>gb:AC113332_1738903 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1057_B02, complete
           sequence.>gb:AC130605_1740834 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone P0010D04, complete
           sequence.
          Length = 484

 Score =  108 bits (270), Expect = 1e-22
 Identities = 50/102 (49%), Positives = 72/102 (70%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LT  SD+YSFGVVLLE+ITGRR++D  +P  E+ LV WA P   +K++F ++
Sbjct: 335 PEYAMTGKLTKMSDIYSFGVVLLEIITGRRAIDTTKPTREQILVHWAAPLFRDKKKFVKM 394

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
            DP L+  F +KG  +A  +++ CL  +  +RP++S+VV AL
Sbjct: 395 ADPLLDMKFPLKGLYQALAISSMCLQEEASSRPLISDVVTAL 436



>gb:AC098693_1736831 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1004C08, complete sequence.
          Length = 381

 Score =  107 bits (268), Expect = 2e-22
 Identities = 50/102 (49%), Positives = 70/102 (68%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           P+YV++G LT KSD+YSFGV+LLE+ITGRR  D +RP  E++L+ W+RP L +KR+FYRL
Sbjct: 235 PDYVVSGKLTMKSDIYSFGVLLLELITGRRIYDASRPKPEQSLLTWSRPFLHDKRKFYRL 294

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
            DP L G +      +   ++  CL   P  RP++S+VV  L
Sbjct: 295 ADPALHGCYPTSALNQLVVISIMCLQDQPHVRPIISDVVIGL 336



>pir|T02132|T02132 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) F8K4.7 - Arabidopsis
           thaliana>gb:AE005173_893857 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:F8K4_1678593 Arabidopsis thaliana
           chromosome 1 BAC F8K4 sequence, complete sequence.
          Length = 420

 Score =  107 bits (267), Expect = 2e-22
 Identities = 55/134 (41%), Positives = 79/134 (58%), Gaps = 31/134 (23%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEW-------------- 582
           PEY MTG LT+KSDVYSFGVVLLE+I+GRR++D +RP  E+NL+ W              
Sbjct: 258 PEYAMTGQLTAKSDVYSFGVVLLEIISGRRAIDGDRPTEEQNLISWVFHQARVLLTYLCC 317

Query: 581 -----------------ARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDP 453
                            A P L ++R F +++DP L+G++ +KG  +A  +AA CL  + 
Sbjct: 318 CLRRKKPMKVFFFLVWQAEPLLKDRRMFAQIVDPNLDGNYPVKGLHQALAIAAMCLQEEA 377

Query: 452 KARPMMSEVVEALK 411
           + RP+M +VV AL+
Sbjct: 378 ETRPLMGDVVTALE 391



>pir|D84848|D84848 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:BT010881_1640827 Arabidopsis thaliana
           At2g41970 gene, complete cds.>gb:U90439_1726506
           Arabidopsis thaliana chromosome 2 BAC T6D20 genomic
           sequence, complete sequence.>gb:AK175234_1817222
           Arabidopsis thaliana mRNA for putative protein kinase,
           complete cds, clone: RAFL21-66-E15.>gb:AK175270_1817258
           Arabidopsis thaliana mRNA for putative protein kinase,
           complete cds, clone: RAFL21-70-K24.>gb:AK176504_1818492
           Arabidopsis thaliana mRNA for putative protein kinase,
           complete cds, clone: RAFL25-02-K06.>gb:AK176586_1818574
           Arabidopsis thaliana mRNA for putative protein kinase,
           complete cds, clone: RAFL25-11-J01.>gb:AK176796_1818784
           Arabidopsis thaliana mRNA for putative protein kinase,
           complete cds, clone: RAFL25-34-H15.
          Length = 365

 Score =  107 bits (267), Expect = 2e-22
 Identities = 56/115 (48%), Positives = 73/115 (63%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG +T KSDVYSFGVVLLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 250 PEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWATPRLSED-KVKQC 308

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSS 375
           IDP+L   F  K   K A +AA C+  +   RP M+ VV+AL+PL N K     S
Sbjct: 309 IDPKLNNDFPPKAVAKLAAVAALCVQYEADFRPNMTIVVKALQPLLNSKPAGPES 363



>gb:ATF8D20_1551119 Arabidopsis thaliana DNA chromosome 4, BAC clone
           F8D20 (ESSAII project).
          Length = 356

 Score =  107 bits (266), Expect = 3e-22
 Identities = 55/131 (41%), Positives = 83/131 (63%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ TGHL  KSDV++FGVVLLE++TG  + +  RP G+ +LV+W RP L  K R  ++
Sbjct: 201 PEYMATGHLYVKSDVFAFGVVLLEIMTGLTAHNTKRPRGQESLVDWLRPELSNKHRVKQI 260

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           +D  ++G ++ K A + A++   C+  DPK RP M EVVE L+ +  L  + + S   Q 
Sbjct: 261 MDKGIKGQYTTKVATEMARITLSCIEPDPKNRPHMKEVVEVLEHIQGLNVVPNRSSTKQA 320

Query: 359 MQADRIASSPN 327
           + A+   SSP+
Sbjct: 321 V-ANSSRSSPH 330



>gb:AB005242_1509517 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MQK4.
          Length = 608

 Score =  107 bits (266), Expect = 3e-22
 Identities = 51/102 (50%), Positives = 71/102 (69%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY     LT KSDVYSFGVVLLE+ITGRR++D  +PN E+NLV WA+P   + +R+  +
Sbjct: 244 PEYTRGDDLTVKSDVYSFGVVLLELITGRRAIDTTKPNDEQNLVAWAQPIFKDPKRYPDM 303

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
            DP L  +FS +G  +A  + + CL  +P ARP++S+V+ AL
Sbjct: 304 ADPLLRKNFSERGLNQAVAITSMCLQEEPTARPLISDVMVAL 345



>pir|T04665|T04665 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) F8D20.110 - Arabidopsis thaliana (fragment)
          Length = 356

 Score =  107 bits (266), Expect = 3e-22
 Identities = 55/131 (41%), Positives = 83/131 (63%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ TGHL  KSDV++FGVVLLE++TG  + +  RP G+ +LV+W RP L  K R  ++
Sbjct: 201 PEYMATGHLYVKSDVFAFGVVLLEIMTGLTAHNTKRPRGQESLVDWLRPELSNKHRVKQI 260

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           +D  ++G ++ K A + A++   C+  DPK RP M EVVE L+ +  L  + + S   Q 
Sbjct: 261 MDKGIKGQYTTKVATEMARITLSCIEPDPKNRPHMKEVVEVLEHIQGLNVVPNRSSTKQA 320

Query: 359 MQADRIASSPN 327
           + A+   SSP+
Sbjct: 321 V-ANSSRSSPH 330



>pir|C85420|C85420 protein kinase-like protein [imported] -
           Arabidopsis thaliana>gb:ATCHRIV83_1547520 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No. 83.
          Length = 415

 Score =  107 bits (266), Expect = 3e-22
 Identities = 55/131 (41%), Positives = 83/131 (63%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ TGHL  KSDV++FGVVLLE++TG  + +  RP G+ +LV+W RP L  K R  ++
Sbjct: 260 PEYMATGHLYVKSDVFAFGVVLLEIMTGLTAHNTKRPRGQESLVDWLRPELSNKHRVKQI 319

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           +D  ++G ++ K A + A++   C+  DPK RP M EVVE L+ +  L  + + S   Q 
Sbjct: 320 MDKGIKGQYTTKVATEMARITLSCIEPDPKNRPHMKEVVEVLEHIQGLNVVPNRSSTKQA 379

Query: 359 MQADRIASSPN 327
           + A+   SSP+
Sbjct: 380 V-ANSSRSSPH 389



>sp|P27450|CX32_ARATH Probable serine/threonine-protein kinase Cx32
           (EC 2.7.1.37).>gb:AY065403_1566514 Arabidopsis thaliana
           putative protein kinase (At4g35600) mRNA, complete
           cds.>gb:AY096501_1576043 Arabidopsis thaliana putative
           protein kinase (At4g35600) mRNA, complete cds.
          Length = 419

 Score =  107 bits (266), Expect = 3e-22
 Identities = 55/131 (41%), Positives = 83/131 (63%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ TGHL  KSDV++FGVVLLE++TG  + +  RP G+ +LV+W RP L  K R  ++
Sbjct: 264 PEYMATGHLYVKSDVFAFGVVLLEIMTGLTAHNTKRPRGQESLVDWLRPELSNKHRVKQI 323

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           +D  ++G ++ K A + A++   C+  DPK RP M EVVE L+ +  L  + + S   Q 
Sbjct: 324 MDKGIKGQYTTKVATEMARITLSCIEPDPKNRPHMKEVVEVLEHIQGLNVVPNRSSTKQA 383

Query: 359 MQADRIASSPN 327
           + A+   SSP+
Sbjct: 384 V-ANSSRSSPH 393



>gb:AP002537_1822501 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0001B06.>gb:AP003417_1829189 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0498B01.
          Length = 333

 Score =  106 bits (265), Expect = 4e-22
 Identities = 52/103 (50%), Positives = 68/103 (66%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTGHL  KSDVYS+GVVLLE++TGR+ +D +RP G+ NLV WARP L       + 
Sbjct: 126 PEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDMSRPGGQENLVSWARPLLTNVVSLRQA 185

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALK 411
           +DP L  +  +    KAA +A+ C+  +   RP M EVV+ALK
Sbjct: 186 VDPLLGPNVPLDNVAKAAAIASMCVQPEVAHRPSMGEVVQALK 228



>gb:AJ608156_1811970 Nicotiana tabacum mRNA for protein kinase 1
           (pk1 gene).
          Length = 365

 Score =  106 bits (265), Expect = 4e-22
 Identities = 54/115 (46%), Positives = 73/115 (63%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG +T KSDVYSFGVVLLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 250 PEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWATPRLSED-KVKQC 308

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSS 375
           +DP+L   +  K   K A +AA C+  +   RP M+ VV+AL+PL N K     S
Sbjct: 309 VDPKLNNDYPAKAIAKMAAVAALCVQYEADFRPNMTIVVKALQPLLNAKPAGPES 363



>gb:AC132492_1741212 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0605G01, complete sequence.
          Length = 491

 Score =  106 bits (265), Expect = 4e-22
 Identities = 51/115 (44%), Positives = 74/115 (64%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY  TG LT+KSDVYS+GVVLLE++TGR  +D  RP G+  LV WA P L  + +  ++
Sbjct: 340 PEYASTGKLTTKSDVYSYGVVLLELLTGRVPVDTKRPPGQHVLVSWALPRLTNREKLVQM 399

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSS 375
           +DP L G FS+K   + A + A C+      RP+M++VV++L P+     M+ +S
Sbjct: 400 VDPALIGQFSLKDLVQVAAITAMCIQTKADYRPLMTDVVQSLIPIVKSPLMSCTS 454



>gb:AY494981_1608865 Triticum turgidum A genome HMW glutenin A gene
           locus, sequence.
          Length = 568

 Score =  106 bits (265), Expect = 4e-22
 Identities = 47/102 (46%), Positives = 72/102 (70%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY M+G LT  SD+Y FGVVLLE+ITGRR++D  +P  E+ LV WA P   +K++F ++
Sbjct: 419 PEYAMSGKLTKMSDIYCFGVVLLELITGRRAIDTTKPTREQILVHWAAPLFKDKKKFTKM 478

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
            DP+L+  + +KG  +A  +++ CL  +  +RP++S+VV AL
Sbjct: 479 ADPKLDSKYPLKGLYQALAISSMCLQEEASSRPLISDVVTAL 520



>gb:AY150374_1584939 Arabidopsis thaliana putative kinase interactor
           (At1g06700) mRNA, complete cds.
          Length = 361

 Score =  106 bits (265), Expect = 4e-22
 Identities = 54/105 (51%), Positives = 72/105 (68%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LT KSDVYSFGVVLLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 246 PEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSED-KVKQC 304

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           IDP+L+  +  K   K A +AA C+  + + RP MS VV+AL+PL
Sbjct: 305 IDPKLKADYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQPL 349



>gb:AC007592_1535979 Genomic sequence for Arabidopsis thaliana BAC
           F12K11 from chromosome I, complete sequence.
          Length = 246

 Score =  106 bits (265), Expect = 4e-22
 Identities = 54/105 (51%), Positives = 72/105 (68%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LT KSDVYSFGVVLLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 131 PEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSED-KVKQC 189

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           IDP+L+  +  K   K A +AA C+  + + RP MS VV+AL+PL
Sbjct: 190 IDPKLKADYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQPL 234



>pir|F86201|F86201 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AE005172_889678 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC011001_1537190 Arabidopsis thaliana
           chromosome I BAC F4H5 genomic sequence, complete
           sequence.
          Length = 377

 Score =  106 bits (265), Expect = 4e-22
 Identities = 54/105 (51%), Positives = 72/105 (68%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LT KSDVYSFGVVLLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 262 PEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSED-KVKQC 320

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           IDP+L+  +  K   K A +AA C+  + + RP MS VV+AL+PL
Sbjct: 321 IDPKLKADYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQPL 365



>pir|C96791|C96791 hypothetical protein F15M4.13 [imported] -
           Arabidopsis thaliana>gb:AE005173_895168 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC012394_1537627 Arabidopsis thaliana
           chromosome 1 BAC F15M4 genomic sequence, complete
           sequence.
          Length = 381

 Score =  106 bits (265), Expect = 4e-22
 Identities = 55/131 (41%), Positives = 83/131 (63%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY M+G LT KSD+YSFGVVLLE+I+GR+++D ++PNGE+ LV WARP+L + ++F  L
Sbjct: 247 PEYAMSGRLTIKSDIYSFGVVLLELISGRKAIDLSKPNGEQYLVAWARPYLKDPKKFGLL 306

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
           +DP L G FS +    A  +   CL+ +   RP + +VV A + +      AS S  ++ 
Sbjct: 307 VDPLLRGKFSKRCLNYAISITEMCLNDEANHRPKIGDVVVAFEYI------ASQSKSYED 360

Query: 359 MQADRIASSPN 327
            +  R ++  N
Sbjct: 361 RRTARKSTDSN 371



>gb:AC134931_1741948 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0079L11, complete sequence.
          Length = 443

 Score =  105 bits (263), Expect = 6e-22
 Identities = 52/102 (50%), Positives = 72/102 (70%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYV TG L++K+DVYSFGV LLE+ITGRR++D  RP  E+ L  WA+P L ++RR++ L
Sbjct: 262 PEYVRTGMLSTKTDVYSFGVFLLELITGRRAVDTCRPVCEQILAYWAKPMLHDRRRYHEL 321

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
           +DP L G +  K   +AA +AA C+  +   RP MS++V AL
Sbjct: 322 VDPLLRGDYPDKDFNQAAAVAAICIEDEASVRPYMSDIVVAL 363



>gb:AJ608157_1811971 Nicotiana tabacum mRNA for protein kinase 2
           (pk2 gene).
          Length = 369

 Score =  105 bits (262), Expect = 8e-22
 Identities = 54/115 (46%), Positives = 73/115 (63%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG +T KSDVYSFGVVLLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 254 PEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWATPRLSED-KVKQC 312

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSS 375
           +DP+L   +  K   K A +AA C+  +   RP M+ VV+AL+PL N K     S
Sbjct: 313 VDPKLNNDYPPKAIAKLAAVAALCVQYEADFRPNMTIVVKALQPLLNSKPAGPES 367



>gb:AC087552_1734100 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0519E07, complete
           sequence.>gb:AC093490_1736000 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OJ1127_B08, complete
           sequence.
          Length = 361

 Score =  105 bits (262), Expect = 8e-22
 Identities = 55/109 (50%), Positives = 73/109 (66%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG L+SKSDVYSFGVVLLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 244 PEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSED-KVRQC 302

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLK 393
           +D RL G +  K   K A +AA C+  +   RP MS VV+AL+PL N +
Sbjct: 303 VDSRLGGDYPPKAVAKFAAVAALCVQYEADFRPNMSIVVKALQPLLNAR 351



>gb:AY224476_1590678 Oryza sativa (japonica cultivar-group) isolate
           29082 putative protein kinase mRNA, partial cds.
          Length = 242

 Score =  105 bits (262), Expect = 8e-22
 Identities = 55/109 (50%), Positives = 73/109 (66%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG L+SKSDVYSFGVVLLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 125 PEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSED-KVRQC 183

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLK 393
           +D RL G +  K   K A +AA C+  +   RP MS VV+AL+PL N +
Sbjct: 184 VDSRLGGDYPPKAVAKFAAVAALCVQYEADFRPNMSIVVKALQPLLNAR 232



>gb:AX093394_1461117 Sequence 13 from Patent WO0118061.
          Length = 362

 Score =  105 bits (262), Expect = 8e-22
 Identities = 56/114 (49%), Positives = 75/114 (65%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG L+SKSDVYSFGVVLLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 243 PEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSED-KVRQC 301

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASS 378
           +D RL G +  K   K A +AA C+  +   RP MS VV+AL+PL N    A++
Sbjct: 302 VDSRLGGDYPPKAVAKFAAVAALCVQYEADFRPNMSIVVKALQPLLNAHARATN 355



>pir|A84712|A84712 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AC002340_1530531 Arabidopsis thaliana
           chromosome 2 BAC T11J7 genomic sequence, complete
           sequence.
          Length = 338

 Score =  105 bits (262), Expect = 8e-22
 Identities = 53/105 (50%), Positives = 69/105 (65%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LT KSDVY FGVVLLE++TGR+ +D   P G+++LV WA P L E       
Sbjct: 225 PEYAMTGELTHKSDVYGFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPKLSED-TVEEC 283

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +DP+L+G +S K   K A +AA C+  +   RP MS VV+AL+ L
Sbjct: 284 VDPKLKGEYSPKSVAKLAAVAALCVQYESNCRPKMSTVVKALQQL 328



>gb:AF370260_1792145 Arabidopsis thaliana putative protein kinase
           interactor (At1g06700) mRNA, complete cds.
          Length = 361

 Score =  105 bits (261), Expect = 1e-21
 Identities = 53/105 (50%), Positives = 71/105 (67%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LT KSDVYSFGVVLLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 246 PEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSED-KVKQC 304

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           IDP+L+  +  K   K A +AA C+  + + RP MS V +AL+PL
Sbjct: 305 IDPKLKADYPPKAVAKLAAVAALCVQYEAEFRPNMSIVAKALQPL 349



>pir|T02181|T02181 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AC004411_1531673 Arabidopsis thaliana
           chromosome 2 clone F14M4 map CIC06C03, complete
           sequence.>gb:AY080876_1568560 Arabidopsis thaliana
           putative protein kinase (At2g47060) mRNA, complete
           cds.>gb:AY114044_1578455 Arabidopsis thaliana putative
           protein kinase (At2g47060) mRNA, complete
           cds.>gb:AF325090_1786544 Arabidopsis thaliana putative
           protein kinase (At2g47060) mRNA, complete cds.
          Length = 365

 Score =  105 bits (261), Expect = 1e-21
 Identities = 55/112 (49%), Positives = 74/112 (66%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG L +KSDVYSFGVVLLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 249 PEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHRLPRGQQSLVTWATPKLSED-KVKQC 307

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMA 384
           +D RL G +  K   K A +AA C+  +   RP MS VV+AL+PL N + +A
Sbjct: 308 VDARLGGDYPPKAVAKLAAVAALCVQYEADFRPNMSIVVKALQPLLNARAVA 359



>gb:AF023164_1762043 Zea mays leucine-rich repeat transmembrane
           protein kinase 1 (ltk1) mRNA, partial cds.
          Length = 684

 Score =  104 bits (260), Expect = 1e-21
 Identities = 53/111 (47%), Positives = 71/111 (63%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PE  MTG  T KSDVYSFGVV+LE++TGRR  D +RP  E++LV WA P L +     R+
Sbjct: 553 PEVDMTGQYTFKSDVYSFGVVMLELLTGRRPFDSSRPRSEQSLVRWATPQLHDIDALDRM 612

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDM 387
           +DP L+G +  K   + A + A C+  +P+ RP MSEVV+AL  L    +M
Sbjct: 613 VDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPMSEVVQALVRLVQRANM 663



>gb:AY094451_1575749 Arabidopsis thaliana At5g56885 mRNA, complete
            cds.>gb:BT002287_1635890 Arabidopsis thaliana At5g56885
            mRNA, complete cds.
          Length = 1113

 Score =  104 bits (260), Expect = 1e-21
 Identities = 53/112 (47%), Positives = 68/112 (60%)
 Frame = -1

Query: 719  PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
            PEY MTGHL  KSDVYS+GVVLLE++TGR+ +D ++P G+ NLV W RP L        +
Sbjct: 896  PEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDMSQPPGQENLVSWTRPFLTSAEGLAAI 955

Query: 539  IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMA 384
            ID  L    S     K A +A+ C+  +   RP M EVV+ALK + N  D A
Sbjct: 956  IDQSLGPEISFDSIAKVAAIASMCVQPEVSHRPFMGEVVQALKLVSNECDEA 1007



>gb:AC069144_1540630 Arabidopsis thaliana chromosome 1 BAC F14C21
           genomic sequence, complete sequence.
          Length = 423

 Score =  104 bits (260), Expect = 1e-21
 Identities = 49/118 (41%), Positives = 75/118 (63%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY  TG LT+KSDVYS+G+VLL+++TGR  +D  RP G+  LV WA P L  + +   +
Sbjct: 292 PEYASTGKLTTKSDVYSYGIVLLQLLTGRTPIDSRRPRGQDVLVSWALPRLTNREKISEM 351

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYF 366
           +DP ++G +S K   + A +AA C+  +   RP+M++VV +L PL    + ++ S  F
Sbjct: 352 VDPTMKGQYSQKDLIQVAAIAAVCVQPEASYRPLMTDVVHSLIPLVKAFNKSTDSSRF 409



>pir|B96590|B96590 hypothetical protein T22H22.21 [imported] -
           Arabidopsis thaliana>gb:AE005173_893374 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:T22H22_1723786 Sequence of BAC T22H22 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 507

 Score =  104 bits (260), Expect = 1e-21
 Identities = 49/118 (41%), Positives = 75/118 (63%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY  TG LT+KSDVYS+G+VLL+++TGR  +D  RP G+  LV WA P L  + +   +
Sbjct: 376 PEYASTGKLTTKSDVYSYGIVLLQLLTGRTPIDSRRPRGQDVLVSWALPRLTNREKISEM 435

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYF 366
           +DP ++G +S K   + A +AA C+  +   RP+M++VV +L PL    + ++ S  F
Sbjct: 436 VDPTMKGQYSQKDLIQVAAIAAVCVQPEASYRPLMTDVVHSLIPLVKAFNKSTDSSRF 493



>pir|T01267|T01267 leucine-rich repeat transmembrane protein kinase
           1 - maize  (fragment)
          Length = 684

 Score =  104 bits (260), Expect = 1e-21
 Identities = 53/111 (47%), Positives = 71/111 (63%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PE  MTG  T KSDVYSFGVV+LE++TGRR  D +RP  E++LV WA P L +     R+
Sbjct: 553 PEVDMTGQYTFKSDVYSFGVVMLELLTGRRPFDSSRPRSEQSLVRWATPQLHDIDALDRM 612

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDM 387
           +DP L+G +  K   + A + A C+  +P+ RP MSEVV+AL  L    +M
Sbjct: 613 VDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPMSEVVQALVRLVQRANM 663



>pir|T01268|T01268 leucine-rich repeat transmembrane protein kinase
           2 - maize>gb:AF023165_1762044 Zea mays leucine-rich
           repeat transmembrane protein kinase 2 (ltk2) mRNA,
           complete cds.
          Length = 725

 Score =  104 bits (260), Expect = 1e-21
 Identities = 53/111 (47%), Positives = 71/111 (63%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PE  MTG  T KSDVYSFGVV+LE++TGRR  D +RP  E++LV WA P L +     R+
Sbjct: 593 PEVDMTGQYTLKSDVYSFGVVMLELLTGRRPFDSSRPRSEQSLVRWAAPQLHDIDALDRM 652

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDM 387
           +DP L+G +  K   + A + A C+  +P+ RP MSEVV+AL  L    +M
Sbjct: 653 VDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPMSEVVQALVRLVQRANM 703



>gb:AP005839_1858834 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OSJNBa0044K01.
          Length = 174

 Score =  104 bits (259), Expect = 2e-21
 Identities = 60/132 (45%), Positives = 83/132 (62%), Gaps = 3/132 (2%)
 Frame = -1

Query: 701 GHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRLIDPRLE 522
           G     +D   FG+VLLEM+TG R++D  RP  + +LVEWA+P+L ++R+   L+DPRLE
Sbjct: 42  GRNNKVADGGGFGMVLLEMLTGMRALDTGRPALQHSLVEWAKPYLADRRKLAWLVDPRLE 101

Query: 521 GHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKP-LPNLKDM--ASSSYYFQTMQA 351
           G +  + AQ+AAQL  RCLS DP++RP M+EVV    P LP    +   SSS   + +Q 
Sbjct: 102 GQYPSRAAQQAAQLTLRCLSGDPRSRPSMAEVVAQRPPVLPRRHPLQPTSSSLSRRPLQP 161

Query: 350 DRIASSPNTKNG 315
              ASSP  + G
Sbjct: 162 ---ASSPLRRPG 170



>gb:AC079633_1732639 Genomic Sequence for Oryza sativa, Nipponbare
           strain, clone OSJNBa0032G08, from Chromosome 3, complete
           sequence.
          Length = 718

 Score =  104 bits (259), Expect = 2e-21
 Identities = 53/111 (47%), Positives = 70/111 (63%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PE  MTG  T KSDVYSFGVV+LE++TGRR  D  RP  E++LV WA P L +     R+
Sbjct: 586 PEVDMTGQYTLKSDVYSFGVVMLELLTGRRPFDSTRPRSEQSLVRWATPQLHDIDALDRM 645

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDM 387
           +DP L+G +  K   + A + A C+  +P+ RP MSEVV+AL  L    +M
Sbjct: 646 VDPALKGLYPAKSLSRFADVLALCVQPEPEFRPPMSEVVQALVRLVQRANM 696



>gb:AY368673_1602937 Triticum turgidum HMW-glutenin locus, complete
           sequence.
          Length = 617

 Score =  104 bits (259), Expect = 2e-21
 Identities = 46/102 (45%), Positives = 70/102 (68%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY M+G LT  SD+Y FGVV LE+ITGRR++D  +P  E+ LV WA P   +K++F ++
Sbjct: 468 PEYAMSGKLTKMSDIYCFGVVFLELITGRRAIDTTKPTREQILVHWAAPLFKDKKKFTKM 527

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
            DP+L+  + +KG   A  +++ CL  +  +RP++S+VV AL
Sbjct: 528 ADPKLDSKYPLKGLYHALAISSMCLQEEASSRPLISDVVTAL 569



>gb:AY054678_1563332 Arabidopsis thaliana similar to Pto kinase
           interactor 1 gb|AAC61805.1 (At1g48210; F21D18.6) mRNA,
           complete cds.>gb:AY081552_1568812 Arabidopsis thaliana
           similar to Pto kinase interactor 1 (At1g48210) mRNA,
           complete cds.
          Length = 363

 Score =  104 bits (259), Expect = 2e-21
 Identities = 55/107 (51%), Positives = 72/107 (67%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG L+SKSDVYSFGVVLLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 244 PEYAMTGTLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSED-KVKQC 302

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPN 399
           +D RL G +  K   K A +AA C+  +   RP MS VV+AL+PL N
Sbjct: 303 VDARLLGEYPPKAVGKLAAVAALCVQYEANFRPNMSIVVKALQPLLN 349



>pir|T48014|T48014 serine/threonine protein kinase-like protein -
           Arabidopsis thaliana>gb:ATT17J13_1554733 Arabidopsis
           thaliana DNA chromosome 3, BAC clone
           T17J13.>gb:BT010538_1640484 Arabidopsis thaliana
           At3g62220 gene, complete cds.
          Length = 361

 Score =  104 bits (259), Expect = 2e-21
 Identities = 54/109 (49%), Positives = 73/109 (66%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG L++KSDVYSFGVVLLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 245 PEYAMTGQLSAKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSED-KVKQC 303

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLK 393
           +D RL G +  K   K A +AA C+  +   RP MS VV+AL+PL N +
Sbjct: 304 VDSRLGGDYPPKAVAKLAAVAALCVQYEADFRPNMSIVVKALQPLLNAR 352



>gb:AC147426_1744672 Oryza sativa chromosome 3 B1377B10 genomic
           sequence, complete sequence.
          Length = 355

 Score =  103 bits (258), Expect = 2e-21
 Identities = 52/105 (49%), Positives = 70/105 (66%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG LT KSDVYSFGVVLLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 244 PEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWATPRLSED-KVKQC 302

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +DP+L   +  K   K A +AA C+  +   RP M+ VV+AL+PL
Sbjct: 303 VDPKLNDEYPPKAVAKLAAVAALCVQYEADFRPNMTIVVKALQPL 347



>gb:AY268139_1593945 Hordeum vulgare BAC 184G9, complete sequece.
          Length = 499

 Score =  103 bits (258), Expect = 2e-21
 Identities = 47/102 (46%), Positives = 71/102 (69%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY M+G LT  SD+Y FGVVLLE+ITGRR++D  +P  E+ LV WA P   +K++F ++
Sbjct: 350 PEYAMSGKLTKMSDIYCFGVVLLELITGRRAIDTTKPTREQILVHWAAPLFKDKKKFTKM 409

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
            DP L+  + +KG  +A  +++ CL  +  +RP++S+VV AL
Sbjct: 410 ADPLLDSKYPLKGLYQALAISSMCLQEEAISRPLISDVVTAL 451



>gb:AK176466_1818454 Arabidopsis thaliana mRNA, complete cds, clone:
           RAFL24-25-H16.
          Length = 381

 Score =  103 bits (257), Expect = 3e-21
 Identities = 48/105 (45%), Positives = 72/105 (68%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY M+G LT KSD+Y FGVVLLE+ITGR+++D  +  GE+NLV W+RP+L ++++F  L
Sbjct: 250 PEYAMSGKLTVKSDIYCFGVVLLELITGRKAIDLGQKQGEQNLVTWSRPYLKDQKKFGHL 309

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +DP L G +  +    A  + A CL+ +   RP + ++V AL+ L
Sbjct: 310 VDPSLRGKYPRRCLNYAIAIIAMCLNEEAHYRPFIGDIVVALEYL 354



>gb:AE005172_891020 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC027665_1539894 Genomic sequence
           for Arabidopsis thaliana BAC F5M15 from chromosome I,
           complete sequence.>gb:AC069251_1540724 Genomic sequence
           for Arabidopsis thaliana BAC F2D10 from chromosome I,
           complete sequence.>gb:AK176526_1818514 Arabidopsis
           thaliana mRNA, complete cds, clone: RAFL25-03-O06.
          Length = 381

 Score =  103 bits (257), Expect = 3e-21
 Identities = 48/105 (45%), Positives = 72/105 (68%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY M+G LT KSD+Y FGVVLLE+ITGR+++D  +  GE+NLV W+RP+L ++++F  L
Sbjct: 250 PEYAMSGKLTVKSDIYCFGVVLLELITGRKAIDLGQKQGEQNLVTWSRPYLKDQKKFGHL 309

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +DP L G +  +    A  + A CL+ +   RP + ++V AL+ L
Sbjct: 310 VDPSLRGKYPRRCLNYAIAIIAMCLNEEAHYRPFIGDIVVALEYL 354



>gb:OSJN00068_1694248 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0065L13, complete
           sequence.>gb:OSJN00169_1696118 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0043L24, complete
           sequence.
          Length = 756

 Score =  103 bits (256), Expect = 4e-21
 Identities = 51/108 (47%), Positives = 71/108 (65%), Gaps = 1/108 (0%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTGHL  KSDVYS+GVVLLE+++GR+ +D  +P G  NLV WARP L ++    +L
Sbjct: 511 PEYAMTGHLLVKSDVYSYGVVLLELLSGRKPVDMTQPPGSENLVTWARPLLTDRDGLQQL 570

Query: 539 IDPRL-EGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPN 399
           +DP +    +  +   KAA +A+ C+  +   RP M EVV+ALK + N
Sbjct: 571 VDPSMPAASYGFEKLAKAAAIASMCVHVEASHRPFMGEVVQALKLIYN 618



>gb:AB022216_1515058 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MGD8.>gb:AY070413_1566811 Arabidopsis thaliana
           putative protein kinase (At3g17410) mRNA, complete
           cds.>gb:AY096595_1576135 Arabidopsis thaliana putative
           protein kinase (At3g17410) mRNA, complete cds.
          Length = 364

 Score =  103 bits (256), Expect = 4e-21
 Identities = 53/107 (49%), Positives = 72/107 (67%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG L++KSDVYSFGVVLLE++TGR+ +D   P G++++V WA P L E  +  + 
Sbjct: 245 PEYAMTGTLSTKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSVVTWATPKLSED-KVKQC 303

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPN 399
           +D RL G +  K   K A +AA C+  +   RP MS VV+AL+PL N
Sbjct: 304 VDARLNGEYPPKAVAKLAAVAALCVQYEADFRPNMSIVVKALQPLLN 350



>pir|G86239|G86239 protein F20B24.6 [imported] - Arabidopsis
            thaliana>gb:AE005172_890075 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC009398_1536752 Genomic sequence for
            Arabidopsis thaliana BAC F20B24 from chromosome I,
            complete sequence.
          Length = 715

 Score =  103 bits (256), Expect = 4e-21
 Identities = 61/161 (37%), Positives = 85/161 (52%), Gaps = 3/161 (1%)
 Frame = -1

Query: 719  PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHL---CEKRRF 549
            PEY  +G LT +SDV+SFGVVLLE+ITGR+ +D ++P GE +LVEWARP L    EK   
Sbjct: 536  PEYASSGKLTDRSDVFSFGVVLLELITGRKPVDTSQPLGEESLVEWARPRLIEAIEKGDI 595

Query: 548  YRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYY 369
              ++DPRLE  +      K  + AA C+      RP M +VV AL    +L D+ +    
Sbjct: 596  SEVVDPRLENDYVESEVYKMIETAASCVRHSALKRPRMVQVVRALDTRDDLSDLTNGVKV 655

Query: 368  FQTMQADRIASSPNTKNGIVFSKNGQQNPRSLSIPNGSHAS 246
             Q+    R+  S    N I   +   ++   L    G + S
Sbjct: 656  GQS----RVYDSGQYSNEIRIFRRASEDSSDLGTNTGYYPS 692



>gb:AP004865_1846234 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0020C11.
          Length = 363

 Score =  102 bits (255), Expect = 5e-21
 Identities = 50/109 (45%), Positives = 71/109 (65%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG +  KSDVYSFGV+LLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 246 PEYAMTGQINQKSDVYSFGVILLELLTGRKPVDHTMPKGQQSLVTWATPRLSED-KVKQC 304

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLK 393
           +DP+L   +  K   K A +AA C+  +   RP M+ VV+A++PL N K
Sbjct: 305 VDPKLNNDYPPKAVAKLAAVAALCVQYEADFRPNMTIVVKAIQPLLNTK 353



>gb:AP002901_1823734 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0456F08.
          Length = 429

 Score =  101 bits (252), Expect = 1e-20
 Identities = 51/103 (49%), Positives = 64/103 (62%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTGHL  KSDVYS+GVVLLE++TGR+ +D  RP G+ NLV WA P L  +     +
Sbjct: 226 PEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDILRPPGQENLVAWACPFLTSRDGLETI 285

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALK 411
           IDP L          K A +A+ C+  +   RP M EVV+ALK
Sbjct: 286 IDPSLGNSILFDSIAKVAAIASMCVQPEVDQRPFMGEVVQALK 328



>gb:AP002901_1823733 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0456F08.
          Length = 736

 Score =  101 bits (252), Expect = 1e-20
 Identities = 51/103 (49%), Positives = 64/103 (62%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTGHL  KSDVYS+GVVLLE++TGR+ +D  RP G+ NLV WA P L  +     +
Sbjct: 533 PEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDILRPPGQENLVAWACPFLTSRDGLETI 592

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALK 411
           IDP L          K A +A+ C+  +   RP M EVV+ALK
Sbjct: 593 IDPSLGNSILFDSIAKVAAIASMCVQPEVDQRPFMGEVVQALK 635



>gb:AC108500_1738477 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1280_A04, complete sequence.
          Length = 417

 Score =  101 bits (252), Expect = 1e-20
 Identities = 45/108 (41%), Positives = 73/108 (67%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY  +G  T KSDVYSFGVVL+++I+GRR++D ++P  E+N+V WA P   +++R++ L
Sbjct: 252 PEYDRSGQATMKSDVYSFGVVLVQLISGRRAIDPDKPTEEQNVVAWAMPMFKDQKRYHEL 311

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNL 396
           +DP ++  ++ K   +   +AA CL  +   RP+M++VV  L  L +L
Sbjct: 312 VDPLIKSEYAAKALNQVVAMAAMCLQEEDSVRPLMADVVMTLGFLTSL 359



>gb:LEU28007_1684726 Lycopersicon esculentum Pto kinase interactor 1
           (Pti1) mRNA, complete cds.
          Length = 354

 Score =  101 bits (252), Expect = 1e-20
 Identities = 53/105 (50%), Positives = 70/105 (66%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG L+SKSDVYSFGVVLLE++TGR+ +D   P G+++LV WA P L E  +  + 
Sbjct: 244 PEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSED-KVKQC 302

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +D RL   +  K   K A +AA C+  +   RP MS VV+AL+PL
Sbjct: 303 VDARLNTDYPPKAIAKMAAVAALCVQYEADFRPNMSIVVKALQPL 347



>gb:AY026759_1559033 Arabidopsis thaliana protein kinase AtSIK mRNA,
           complete cds.
          Length = 557

 Score =  101 bits (251), Expect = 2e-20
 Identities = 48/108 (44%), Positives = 73/108 (67%)
 Frame = -1

Query: 716 EYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRLI 537
           E +  G LT KS+V+S+G+VLLEM+TGR++MD + P  ERNLV+W+R  L +  R   ++
Sbjct: 352 ETLERGLLTPKSNVWSYGIVLLEMLTGRKNMDGSYPKEERNLVKWSRAFLADDCRLSLIM 411

Query: 536 DPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLK 393
           DP+L+G F  K A+  A +A +CL  +P  RP M  +V+ LK + ++K
Sbjct: 412 DPQLKGRFPAKAARSIADIAQKCLQVEPSERPTMRNIVDQLKIIQDMK 459



>gb:AC012562_1537733 Arabidopsis thaliana chromosome 3 BAC F17O14
           genomic sequence, complete sequence.
          Length = 557

 Score =  101 bits (251), Expect = 2e-20
 Identities = 48/108 (44%), Positives = 73/108 (67%)
 Frame = -1

Query: 716 EYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRLI 537
           E +  G LT KS+V+S+G+VLLEM+TGR++MD + P  ERNLV+W+R  L +  R   ++
Sbjct: 352 ETLERGLLTPKSNVWSYGIVLLEMLTGRKNMDGSYPKEERNLVKWSRAFLADDCRLSLIM 411

Query: 536 DPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLK 393
           DP+L+G F  K A+  A +A +CL  +P  RP M  +V+ LK + ++K
Sbjct: 412 DPQLKGRFPAKAARSIADIAQKCLQVEPSERPTMRNIVDQLKIIQDMK 459



>gb:AB013392_1512117 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MIK19.
          Length = 710

 Score =  101 bits (251), Expect = 2e-20
 Identities = 51/103 (49%), Positives = 68/103 (66%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY  +G +T K+DVYSFGVVL+E+ITGR++MD  RP G++ L EWARP L +K+    L
Sbjct: 549 PEYAQSGQITEKADVYSFGVVLVELITGRKAMDIKRPKGQQCLTEWARP-LLQKQAINEL 607

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALK 411
           +DPRL   +  +     A  A  C+ RDP +RP MS+V   LK
Sbjct: 608 LDPRLMNCYCEQEVYCMALCAYLCIRRDPNSRPRMSQVCSHLK 650



>gb:AC129720_1740666 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0683F12, complete
           sequence.>gb:AC134931_1741949 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBb0079L11,
           complete sequence.
          Length = 440

 Score =  100 bits (250), Expect = 2e-20
 Identities = 49/102 (48%), Positives = 67/102 (65%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY+ T  LT+K+DVYSFGV LLE+ITGRR++D +RP  ++ LV+WA+P L    R + L
Sbjct: 258 PEYIKTRQLTTKTDVYSFGVFLLELITGRRAVDSSRPECDQILVKWAKPMLKNPSRHHEL 317

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
           +DP L G +      +A  +AA CL  +   RP MS+ V AL
Sbjct: 318 VDPLLRGDYPRGDLNQAVAVAAMCLQEEASVRPYMSDTVVAL 359



>gb:BT000971_1635226 Arabidopsis thaliana clone C104780 unknown
           protein (At5g56790) mRNA, complete cds.
          Length = 669

 Score =  100 bits (250), Expect = 2e-20
 Identities = 50/103 (48%), Positives = 69/103 (66%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY  +G +T K+DVYSFGVVL+E+ITGR++MD  RP G++ L EWARP L +K+    L
Sbjct: 560 PEYAQSGQITEKADVYSFGVVLVELITGRKAMDIKRPKGQQCLTEWARP-LLQKQAINEL 618

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALK 411
           +DPRL   +  +     A  A  C+ RDP +RP MS+V+  L+
Sbjct: 619 LDPRLMNCYCEQEVYCMALCAYLCIRRDPNSRPRMSQVLRMLE 661



>gb:AY056259_1563577 Arabidopsis thaliana unknown protein
           (At5g56790) mRNA, complete cds.
          Length = 669

 Score =  100 bits (250), Expect = 2e-20
 Identities = 50/103 (48%), Positives = 69/103 (66%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY  +G +T K+DVYSFGVVL+E+ITGR++MD  RP G++ L EWARP L +K+    L
Sbjct: 560 PEYAQSGQITEKADVYSFGVVLVELITGRKAMDIKRPKGQQCLTEWARP-LLQKQAINEL 618

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALK 411
           +DPRL   +  +     A  A  C+ RDP +RP MS+V+  L+
Sbjct: 619 LDPRLMNCYCEQEVYCMALCAYLCIRRDPNSRPRMSQVLRMLE 661



>gb:AP002972_1824065 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0638D12.>gb:AP003218_1825440 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OSJNBb0021A09.
          Length = 671

 Score =  100 bits (249), Expect = 3e-20
 Identities = 54/108 (50%), Positives = 67/108 (62%), Gaps = 3/108 (2%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHL---CEKRRF 549
           PEY ++G LT+KSDVYSFGVVLLE+ITGR+ +D ++P G+ +LVEWARP L    E R F
Sbjct: 511 PEYALSGKLTAKSDVYSFGVVLLELITGRKPVDASQPLGDESLVEWARPLLLKAIEHREF 570

Query: 548 YRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
             L DPR+E  F           AA C+      RP M +VV AL  L
Sbjct: 571 GDLPDPRMENRFDENEMYHMIGAAAACIRHSAAMRPRMGQVVRALDSL 618



>gb:OSJN00051_1693921 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0084K20, complete
           sequence.>gb:OSJN00261_1697569 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0076N16, complete
           sequence.
          Length = 363

 Score = 99.8 bits (247), Expect = 4e-20
 Identities = 49/102 (48%), Positives = 63/102 (61%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG +  KSDVYSFG+VLLE++TGR+ +D+  P G+R+LV WA P L E  R    
Sbjct: 251 PEYAMTGQMNDKSDVYSFGIVLLELLTGRKPLDRTLPQGQRSLVNWATPILTED-RVQDC 309

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
           IDP L   +   GA K  ++A +CL  DP  RP M  V   +
Sbjct: 310 IDPNLGDKYPPTGALKLGRIAVQCLQYDPTFRPSMGTVARVI 351



>pir|E71446|E71446 probable protein kinase - Arabidopsis
           thaliana>gb:ATCHRIV46_1545568 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 46.>gb:ATFCA8_1551816
           Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
           fragment No. 8.
          Length = 371

 Score = 99.8 bits (247), Expect = 4e-20
 Identities = 50/117 (42%), Positives = 77/117 (65%), Gaps = 3/117 (2%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYV+TGHL +  DVYSFGVVL E+ITGRR++++ +P  E+ L+EW + +    +RF  +
Sbjct: 250 PEYVITGHLKTHCDVYSFGVVLYEIITGRRTLERMKPLAEQKLLEWVKKYPINSKRFKMI 309

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL---PNLKDMASS 378
           +D +L   + I   ++ A+LA  C+++  K RP M+ VVE+L  +    N +DM SS
Sbjct: 310 VDSKLCNKYPIAMVRRVAKLADHCVNKIDKERPTMAFVVESLTNIIEESNSEDMGSS 366



>gb:AP003302_1827705 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0703B11.>gb:AP003348_1828479 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0485B12.
          Length = 541

 Score = 99.0 bits (245), Expect = 8e-20
 Identities = 48/108 (44%), Positives = 71/108 (65%)
 Frame = -1

Query: 716 EYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRLI 537
           E +  G LT KS+V+ FGVVLLE+ITGR+++D      ERN+V+W+RP L +  R   ++
Sbjct: 344 ETLEKGVLTPKSNVWCFGVVLLELITGRKNLDVRSSKEERNIVKWSRPFLTDDSRLSLIM 403

Query: 536 DPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLK 393
           D R++G F  K A+  A +  RCL++DP  RP M  VVE+L  + ++K
Sbjct: 404 DSRIKGRFPTKAARIVADIILRCLNKDPSERPTMRAVVESLASVQDIK 451



>gb:AP005849_1859071 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBb0031B09.
          Length = 718

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 46/102 (45%), Positives = 67/102 (65%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PE+ M+G  T KSDVYSFGVV+LE++TGR+ +D +R   E++LV WA P L +     ++
Sbjct: 581 PEFAMSGIYTVKSDVYSFGVVMLELLTGRKPLDSSRERSEQSLVRWATPQLHDIDALAKM 640

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
           +DP L G +  K   + A + A C+  +P+ RP MSEVV+ L
Sbjct: 641 VDPALNGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQQL 682



>gb:AC091787_1735101 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBa0087G11 map MAP_LOC, complete
           sequence.
          Length = 753

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 48/113 (42%), Positives = 72/113 (63%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PE  M+G  + KSDVYSFGVV+LE++TGR++ D+++P  +++LV WA P L +     ++
Sbjct: 621 PEVTMSGQYSQKSDVYSFGVVMLELLTGRKAFDRSQPWPQQSLVRWASPQLHDIDALDQM 680

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMAS 381
           +DP LEG +  K   + A   A C+  +P+ RP MSEVV++L  L     M S
Sbjct: 681 VDPALEGLYPAKSLSRFADAIALCVQPEPEFRPPMSEVVQSLVRLVQRSSMGS 733



>pir|G96593|G96593 probable protein kinase, 86372-89112 [imported] -
           Arabidopsis thaliana>gb:AE005173_893403 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC027034_1539783 Arabidopsis thaliana
           chromosome 1 BAC F7A10 genomic sequence, complete
           sequence.>gb:AY063963_1565908 Arabidopsis thaliana
           putative protein kinase (At1g55200) mRNA, complete
           cds.>gb:AY096404_1575948 Arabidopsis thaliana putative
           protein kinase (At1g55200) mRNA, complete cds.
          Length = 676

 Score = 98.2 bits (243), Expect = 1e-19
 Identities = 50/103 (48%), Positives = 67/103 (65%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY  +G +T K+DVYSFGVVL+E+ITGR++MD  RP G++ L EWAR  L E+     L
Sbjct: 549 PEYAQSGQITEKADVYSFGVVLIELITGRKAMDIYRPKGQQCLTEWAR-SLLEEYAVEEL 607

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALK 411
           +DPRLE  +S          A+ C+ RDP  RP MS+V+  L+
Sbjct: 608 VDPRLEKRYSETQVICMIHTASLCIRRDPHLRPRMSQVLRLLE 650



>pir|F96577|F96577 hypothetical protein F22G10.3 [imported] -
           Arabidopsis thaliana>gb:AE005173_893272 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC024260_1539285 Arabidopsis thaliana
           chromosome 1 BAC F22G10 genomic sequence, complete
           sequence.>gb:AY518291_1610793 Arabidopsis thaliana
           strubbelig receptor family 6 (SRF6) mRNA, complete
           cds.>gb:BT010600_1640546 Arabidopsis thaliana At1g53730
           gene, complete cds.
          Length = 719

 Score = 98.2 bits (243), Expect = 1e-19
 Identities = 47/112 (41%), Positives = 71/112 (63%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PE  M+G  + KSD+YSFGVV+LE++TGR+  D  R   E++LV WA P L +     ++
Sbjct: 586 PEVSMSGQYSLKSDIYSFGVVMLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALAKM 645

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMA 384
           +DP L+G + +K   + A + A C+  +P+ RP MSEVV+AL  L    +M+
Sbjct: 646 VDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVQALVVLVQRANMS 697



>gb:AP004308_1839999 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC
           clone:P0552F09.>gb:AP004309_1840005 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0560B08.>gb:AP004988_1846760 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:B1056G08.
          Length = 720

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 48/111 (43%), Positives = 70/111 (63%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PE  M+G  + KSDVYSFGVV+LE++TGR+  D++RP  E++LV WA P L +     ++
Sbjct: 587 PEVTMSGQYSVKSDVYSFGVVMLELLTGRKPFDRSRPRSEQSLVGWATPQLHDIDALDQM 646

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDM 387
           +DP L+G +  K   + A   A C+  +P+ RP MSEVV+ L  L    +M
Sbjct: 647 VDPALQGLYPSKSLSRFADAIALCVQSEPEFRPPMSEVVQLLVRLVQRANM 697



>gb:AY224517_1590714 Oryza sativa (japonica cultivar-group) isolate
           20144 putative leucine-rich repeat transmembrane protein
           kinase mRNA, complete cds.
          Length = 719

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 51/111 (45%), Positives = 69/111 (62%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PE  MTG  T KSDVYSFGVV+LE++TGR+  D  R   E++LV WA P L +     R+
Sbjct: 587 PEVDMTGQYTLKSDVYSFGVVMLELLTGRKPFDSARLRTEQSLVRWATPQLHDIDALDRM 646

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDM 387
           +DP L+G +  K   + A + A C+  +P+ RP MSEVV+AL  L    +M
Sbjct: 647 VDPALKGLYPAKSLSRFADVIALCVQPEPEFRPPMSEVVQALVRLVQRANM 697



>gb:AB022220_1515144 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MLN21.>gb:AY518292_1610794 Arabidopsis
           thaliana strubbelig receptor family 7 (SRF7) mRNA,
           complete cds.
          Length = 717

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 48/112 (42%), Positives = 71/112 (63%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PE  M+G  + KSDVYSFGVV+LE++TGR+  D  R   E++LV WA P L +     ++
Sbjct: 589 PETSMSGQYSLKSDVYSFGVVMLELLTGRKPFDSTRSRSEQSLVRWATPQLHDIDALGKM 648

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMA 384
           +DP L+G + +K   + A + A C+  +P+ RP MSEVV+AL  L    +M+
Sbjct: 649 VDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVQALVVLVQRANMS 700



>gb:AB005231_1509264 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MBB18.>gb:AY075681_1567820 Arabidopsis thaliana
           AT5g38560/MBB18_10 mRNA, complete
           cds.>gb:AY113039_1578199 Arabidopsis thaliana
           AT5g38560/MBB18_10 mRNA, complete
           cds.>gb:AF424623_1798961 Arabidopsis thaliana
           AT5g38560/MBB18_10 mRNA, complete cds.
          Length = 681

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 51/116 (43%), Positives = 71/116 (61%), Gaps = 3/116 (2%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHL---CEKRRF 549
           PEY  +G L+ K+DVYS+GV+LLE+ITGR+ +D ++P G+ +LVEWARP L    E   F
Sbjct: 510 PEYATSGKLSEKADVYSYGVILLELITGRKPVDTSQPLGDESLVEWARPLLGQAIENEEF 569

Query: 548 YRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMAS 381
             L+DPRL  +F      +  + AA C+      RP MS+VV AL  L    D+ +
Sbjct: 570 DELVDPRLGKNFIPGEMFRMVEAAAACVRHSAAKRPKMSQVVRALDTLEEATDITN 625



>gb:AE016959_1022362 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC079936_1733087
           Genomic Sequence For Oryza sativa, Nipponbare Strain,
           Chromosome X, Clone OSJNBb0061I18, complete
           sequence.>gb:AE017089_1752181 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 43 of 77 of the
           complete sequence.
          Length = 736

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 51/111 (45%), Positives = 69/111 (62%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PE  MTG  T KSDVYSFGVV+LE++TGR+  D  R   E++LV WA P L +     R+
Sbjct: 604 PEVDMTGQYTLKSDVYSFGVVMLELLTGRKPFDSARLRTEQSLVRWATPQLHDIDALDRM 663

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDM 387
           +DP L+G +  K   + A + A C+  +P+ RP MSEVV+AL  L    +M
Sbjct: 664 VDPALKGLYPAKSLSRFADVIALCVQPEPEFRPPMSEVVQALVRLVQRANM 714



>gb:AP001307_1821106 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone:MMM17.
          Length = 753

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 49/103 (47%), Positives = 66/103 (64%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY  +G +T K+DVYSFGVVL+E++TGR+++D  RP G++ L EWARP L E+     L
Sbjct: 581 PEYAQSGQITEKADVYSFGVVLVELVTGRKAIDITRPKGQQCLTEWARP-LLEEYAIDEL 639

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALK 411
           IDPRL   F           A+ C+ RDP  RP MS+V+  L+
Sbjct: 640 IDPRLGNRFVESEVICMLHAASLCIRRDPHLRPRMSQVLRILE 682



>gb:AC107226_1738418 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBa0081P02, complete sequence.
          Length = 364

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 49/105 (46%), Positives = 68/105 (64%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY MTG L  KSDVYSFGV+LLE++TGR+ +D   P  +++LV WA P L E  +  + 
Sbjct: 251 PEYAMTGQLNQKSDVYSFGVILLELLTGRKPVDHTMPKRQQSLVTWATPRLSED-KVRQC 309

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +DP+L   +  K   K A +AA C+  +   RP M+ VV+AL+PL
Sbjct: 310 VDPKLGDDYPPKAVAKMAAVAALCVQYESDFRPNMTIVVKALQPL 354



>gb:AY664415_1620622 Zea mays cultivar B73 locus 9009, complete
           sequence.>gb:AY664419_1620660 Zea mays cultivar Mo17
           locus 9009, complete sequence.
          Length = 693

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 47/111 (42%), Positives = 70/111 (63%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PE ++ G  + KSDVYSFGVV+LE++TGR+  D+ RP  E++LV WA P L +     ++
Sbjct: 563 PEVILAGQYSLKSDVYSFGVVMLELLTGRKPFDRTRPRPEQSLVRWATPQLHDIDALDQM 622

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDM 387
           +DP L+G +  K   + A   A C+  +P+ RP MSEVV++L  L    +M
Sbjct: 623 VDPALQGLYPSKSLSRFADAIALCVQPEPEFRPPMSEVVQSLVRLVQRANM 673



>gb:AY139778_1582395 Arabidopsis thaliana AT3g13690/MMM17_12 mRNA,
           complete cds.>gb:BT003038_1636620 Arabidopsis thaliana
           AT3g13690/MMM17_12 gene, complete cds.
          Length = 753

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 49/103 (47%), Positives = 66/103 (64%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY  +G +T K+DVYSFGVVL+E++TGR+++D  RP G++ L EWARP L E+     L
Sbjct: 581 PEYAQSGQITEKADVYSFGVVLVELVTGRKAIDITRPKGQQCLTEWARP-LLEEYAIDEL 639

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALK 411
           IDPRL   F           A+ C+ RDP  RP MS+V+  L+
Sbjct: 640 IDPRLGNRFVESEVICMLHAASLCIRRDPHLRPRMSQVLRILE 682



>pir|D96728|D96728 hypothetical protein F24J13.3 [imported] -
           Arabidopsis thaliana>gb:AE005173_894630 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010796_1537105 Arabidopsis thaliana
           chromosome 1 BAC F24J13 genomic sequence, complete
           sequence.
          Length = 710

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 54/127 (42%), Positives = 76/127 (59%), Gaps = 3/127 (2%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHL---CEKRRF 549
           PEY  +G LT +SDV+SFGVVLLE+ITGR+ +D+ +P GE +LVEWARP L    E   F
Sbjct: 522 PEYAQSGKLTDRSDVFSFGVVLLELITGRKPVDQYQPLGEESLVEWARPLLHKAIETGDF 581

Query: 548 YRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYY 369
             L+D RLE H+      +  + AA C+      RP M +VV AL    ++ D+++ +  
Sbjct: 582 SELVDRRLEKHYVENEVFRMIETAAACVRHSGPKRPRMVQVVRALDSEGDMGDISNGNKV 641

Query: 368 FQTMQAD 348
            Q+   D
Sbjct: 642 GQSSAYD 648



>gb:AY518293_1610795 Arabidopsis thaliana strubbelig receptor family
           8 (SRF8) mRNA, complete cds.
          Length = 703

 Score = 96.7 bits (239), Expect = 4e-19
 Identities = 44/102 (43%), Positives = 67/102 (65%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PE+ ++G  T KSDVY+FGVV+LE++TGR+ +D +R   E++LV WA P L +     ++
Sbjct: 568 PEFALSGIYTVKSDVYTFGVVMLELLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKM 627

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
           +DP L G +  K   + A + A C+  +P+ RP MSEVV+ L
Sbjct: 628 VDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPPMSEVVQQL 669



>pir|T49120|T49120 serine/threonine protein kinase like protein -
           Arabidopsis thaliana>gb:ATCHRIV56_1546050 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           56.>gb:ATF1N20_1549414 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F1N20 (ESSA project).
          Length = 338

 Score = 96.7 bits (239), Expect = 4e-19
 Identities = 44/102 (43%), Positives = 67/102 (65%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PE+ ++G  T KSDVY+FGVV+LE++TGR+ +D +R   E++LV WA P L +     ++
Sbjct: 203 PEFALSGIYTVKSDVYTFGVVMLELLTGRKPLDSSRTRAEQSLVRWATPQLHDIDALSKM 262

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
           +DP L G +  K   + A + A C+  +P+ RP MSEVV+ L
Sbjct: 263 VDPSLNGMYPAKSLSRFADIIALCIQPEPEFRPPMSEVVQQL 304



>gb:OSJN00054_1693976 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0072K14, complete sequence.
          Length = 662

 Score = 96.3 bits (238), Expect = 5e-19
 Identities = 54/147 (36%), Positives = 78/147 (53%), Gaps = 38/147 (25%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEW-------------- 582
           PEY MTG LT KSDVYSFGVVLLE+ITGR+++D  RP+ E NLV W              
Sbjct: 256 PEYAMTGQLTVKSDVYSFGVVLLELITGRKAIDSTRPHVEPNLVSWHLIILTSGIYTVLT 315

Query: 581 ------------------------ARPHLCEKRRFYRLIDPRLEGHFSIKGAQKAAQLAA 474
                                   ARP   ++R+  ++ DP LEG + ++G  +A  +A+
Sbjct: 316 SAITFFKRFIGKVDVLIIVRTKCRARPLFNDRRKLPKMADPGLEGRYPMRGLYQALAVAS 375

Query: 473 RCLSRDPKARPMMSEVVEALKPLPNLK 393
            C+  +  +RP++++VV AL  L + K
Sbjct: 376 MCIQSEAASRPLIADVVTALSYLASQK 402



>gb:ATF2I11_1550489 Arabidopsis thaliana DNA chromosome 5, BAC clone
           F2I11 (ESSA project).
          Length = 336

 Score = 96.3 bits (238), Expect = 5e-19
 Identities = 42/110 (38%), Positives = 69/110 (62%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEYV++GHL +KSDVY+FGV+LLE++TG ++ D  +    ++L  W +P L ++ +   +
Sbjct: 227 PEYVISGHLGTKSDVYTFGVILLEILTGLKASDGKKNENMQSLHVWTKPFLSDQSKIREI 286

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKD 390
           IDPRL   + +  A +  +L  RC+  D + RP M +V + L  +  +KD
Sbjct: 287 IDPRLGNDYPVNAATQMGKLIKRCIKLDTRKRPSMQQVFDGLNDIAEIKD 336



>gb:AP005386_1850809 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0019I19.
          Length = 558

 Score = 95.9 bits (237), Expect = 6e-19
 Identities = 44/102 (43%), Positives = 67/102 (65%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PE+ M+G  T KSDVYSFGVV+LE++T R+ +D +R   E++LV WA P L +     ++
Sbjct: 422 PEFAMSGIYTVKSDVYSFGVVMLELLTARKPLDSSRERSEQSLVTWATPQLHDIDALAKM 481

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
           +DP ++G +  K   + A + A C+  +P+ RP MSEVV+ L
Sbjct: 482 VDPAMDGMYPAKSLSRFADIIALCVQPEPEFRPPMSEVVQQL 523



>pir|C96728|C96728 hypothetical protein F24J13.2 [imported] -
           Arabidopsis thaliana>gb:AE005173_894629 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010796_1537104 Arabidopsis thaliana
           chromosome 1 BAC F24J13 genomic sequence, complete
           sequence.
          Length = 394

 Score = 95.9 bits (237), Expect = 6e-19
 Identities = 53/127 (41%), Positives = 74/127 (58%), Gaps = 3/127 (2%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHL---CEKRRF 549
           PEY  +G LT +SDV+SFGVVLLE+ITGR+ +D+N+P GE +LV WARP L    E   F
Sbjct: 219 PEYAQSGQLTDRSDVFSFGVVLLELITGRKPVDRNQPLGEESLVGWARPLLKKAIETGDF 278

Query: 548 YRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYY 369
             L+D RLE H+      +  + AA C+      RP M +V+ AL    ++ D+ +    
Sbjct: 279 SELVDRRLEKHYVKNEVFRMIETAAACVRYSGPKRPRMVQVLRALDSEGDMGDICNGIKV 338

Query: 368 FQTMQAD 348
            Q+   D
Sbjct: 339 GQSSTCD 345



>gb:AP003518_1830289 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0008F02.>gb:AP004012_1836360 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OJ1568_D07.
          Length = 748

 Score = 95.1 bits (235), Expect = 1e-18
 Identities = 49/105 (46%), Positives = 65/105 (61%), Gaps = 3/105 (2%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLC---EKRRF 549
           PEY  +G LT +SDV+SFGVVLLE+ITGR+ +D+ +P GE +LVEWARP L    E    
Sbjct: 579 PEYASSGKLTDRSDVFSFGVVLLELITGRKPVDQTQPLGEESLVEWARPVLADAVETGDL 638

Query: 548 YRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
             L+DPRLEG ++        + AA C+      RP M +V+  L
Sbjct: 639 SELVDPRLEGAYNRNEMMTMVEAAAACVRHSAPKRPRMVQVMRVL 683



>gb:AC084405_1733619 Oryza sativa chromosome 3 BAC OSJNBa0044H10
           genomic sequence, complete sequence.
          Length = 387

 Score = 94.7 bits (234), Expect = 1e-18
 Identities = 51/133 (38%), Positives = 82/133 (61%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           P+Y+ +G LT +SD+YSFGVV+LE+ITG++ +D +R   ERN+VEWA P +  K+ F +L
Sbjct: 243 PDYLESGKLTVQSDIYSFGVVMLEVITGQKVIDDSRAKPERNIVEWAIPKI-NKKDFPKL 301

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYYFQT 360
            DP L G + ++   +A  +AA C+ R    RP ++ VV+A   L  + +  SS   + +
Sbjct: 302 ADPVLNGQYHMRSLFRALTVAALCVDRTANRRPDITAVVDA---LTQISESQSSRKRWSS 358

Query: 359 MQADRIASSPNTK 321
                + SS +T+
Sbjct: 359 RLQSSVGSSASTE 371



>gb:AB110953_1527050 Nicotiana tabacum NtPERK1 mRNA for PERK1-like
           protein kinase, partial cds.
          Length = 276

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 49/114 (42%), Positives = 71/114 (62%), Gaps = 3/114 (2%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHL---CEKRRF 549
           PEY  +G LT KSDV+S+G++LLE+ITGRR +D ++   + +LV+WARP L    E  +F
Sbjct: 69  PEYASSGKLTEKSDVFSYGIMLLELITGRRPVDSSQTYMDDSLVDWARPQLTRALEDEKF 128

Query: 548 YRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDM 387
             LIDPRL   ++     +    AA C+    + RP MS+VV AL+   +L D+
Sbjct: 129 DSLIDPRLGNDYNHNEVARMVACAAACVRHSARRRPRMSQVVRALEGDVSLSDL 182



>gb:AC006234_1533809 Arabidopsis thaliana chromosome 2 clone F5H14
           map mi148, complete sequence.>gb:AY056176_1563501
           Arabidopsis thaliana putative LRR receptor protein
           kinase (At2g20850) mRNA, complete
           cds.>gb:AY518286_1610788 Arabidopsis thaliana strubbelig
           receptor family 1 (SRF1) mRNA, complete
           cds.>gb:BT001939_1635542 Arabidopsis thaliana clone
           C105466 putative LRR receptor protein kinase (At2g20850)
           mRNA, complete cds.
          Length = 772

 Score = 94.0 bits (232), Expect = 2e-18
 Identities = 45/99 (45%), Positives = 64/99 (64%)
 Frame = -1

Query: 701 GHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRLIDPRLE 522
           G  T K DVYSFGVV+LE++TGR+S DK R  GE+ LV WA P L +     +++DP L+
Sbjct: 654 GIYTMKCDVYSFGVVMLELLTGRKSYDKKRDRGEQFLVRWAIPQLHDIDALAKMVDPSLK 713

Query: 521 GHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           G +  K     A + +RC+  +P+ RP+MSEVV+ L  +
Sbjct: 714 GDYPAKSLSHFADVISRCVQSEPEYRPLMSEVVQDLSDM 752



>pir|D96711|D96711 hypothetical protein F24J5.8 [imported] -
           Arabidopsis thaliana>gb:AE005173_894489 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AY035076_1559848 Arabidopsis thaliana
           putative protein kinase (At1g68690) mRNA, complete
           cds.>gb:AY113877_1578288 Arabidopsis thaliana putative
           protein kinase (At1g68690) mRNA, complete
           cds.>gb:F24J5_1677998 Arabidopsis thaliana chromosome 1
           BAC F24J5 sequence, complete sequence.
          Length = 708

 Score = 94.0 bits (232), Expect = 2e-18
 Identities = 48/108 (44%), Positives = 66/108 (61%), Gaps = 3/108 (2%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARP---HLCEKRRF 549
           PEY  +G LT KSDV+SFGVVLLE+ITGR+ +D ++P G+ +LVEWARP   H  E   F
Sbjct: 545 PEYASSGKLTEKSDVFSFGVVLLELITGRKPVDTSQPLGDESLVEWARPLISHAIETEEF 604

Query: 548 YRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
             L DP+L G++      +  + A  C+      RP M ++V A + L
Sbjct: 605 DSLADPKLGGNYVESEMFRMIEAAGACVRHLATKRPRMGQIVRAFESL 652



>pir|B84594|B84594 probable LRR receptor protein kinase [imported] -
           Arabidopsis thaliana
          Length = 767

 Score = 94.0 bits (232), Expect = 2e-18
 Identities = 45/99 (45%), Positives = 64/99 (64%)
 Frame = -1

Query: 701 GHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRLIDPRLE 522
           G  T K DVYSFGVV+LE++TGR+S DK R  GE+ LV WA P L +     +++DP L+
Sbjct: 649 GIYTMKCDVYSFGVVMLELLTGRKSYDKKRDRGEQFLVRWAIPQLHDIDALAKMVDPSLK 708

Query: 521 GHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           G +  K     A + +RC+  +P+ RP+MSEVV+ L  +
Sbjct: 709 GDYPAKSLSHFADVISRCVQSEPEYRPLMSEVVQDLSDM 747



>gb:AP002882_1823607 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0439B06.
          Length = 698

 Score = 93.6 bits (231), Expect = 3e-18
 Identities = 50/111 (45%), Positives = 69/111 (62%), Gaps = 3/111 (2%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHL---CEKRRF 549
           PEY  +G LT +SDV+SFGVVLLE+ITGR+ +D ++P G+ +LVEWARP L    E    
Sbjct: 529 PEYASSGKLTERSDVFSFGVVLLELITGRKPVDASKPLGDESLVEWARPLLTEAIETGNV 588

Query: 548 YRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNL 396
             LID RL+ +F+     +  + AA C+      RP MS+VV  L  L ++
Sbjct: 589 GELIDSRLDKNFNEAEMFRMIEAAAACIRHSASRRPRMSQVVRVLDSLADV 639



>gb:AC084319_1733485 Oryza sativa chromosome 3 BAC OSJNBa0004B24
           genomic sequence, complete sequence.
          Length = 501

 Score = 93.6 bits (231), Expect = 3e-18
 Identities = 53/127 (41%), Positives = 73/127 (57%), Gaps = 3/127 (2%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHL---CEKRRF 549
           PEY  +G LT +SDV+SFGVVLLE+ITGR+ +D ++P GE +LVEWARP L    E   F
Sbjct: 337 PEYASSGKLTDRSDVFSFGVVLLELITGRKPVDSSQPLGEESLVEWARPLLVDALETDDF 396

Query: 548 YRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSSYY 369
             L DP LE  +S    ++  + AA C+      RP M +V  +L    +  D+ +    
Sbjct: 397 RELADPALERRYSKSEMRRMVEAAAACIRYSVTKRPRMVQVWRSLDVEGSSPDLTNGVKL 456

Query: 368 FQTMQAD 348
            Q+M  D
Sbjct: 457 GQSMAYD 463



>gb:AY065457_1566562 Arabidopsis thaliana putative protein kinase
           (At2g28250) mRNA, complete cds.>gb:BT004417_1637489
           Arabidopsis thaliana clone U18012 putative protein
           kinase (At2g28250) mRNA, complete cds.
          Length = 565

 Score = 93.6 bits (231), Expect = 3e-18
 Identities = 62/150 (41%), Positives = 87/150 (58%), Gaps = 6/150 (4%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPN-GERNLVEWARPHLCE-KRRFY 546
           PEY + G  +  SDV+SFGVVLLE+ITGR+ + K   N GE +LV WA P L + KR   
Sbjct: 389 PEYAIAGCASQMSDVFSFGVVLLELITGRKPIQKPSNNKGEESLVIWAVPRLQDSKRVIE 448

Query: 545 RLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL-PNLKDMASS--- 378
            L DPRL G F+ +  Q  A LA  CL  DP++RP M EVV+ L  + P+      +   
Sbjct: 449 ELPDPRLNGKFAEEEMQIMAYLAKECLLLDPESRPTMREVVQILSTITPDTSSRRRNFPI 508

Query: 377 SYYFQTMQADRIASSPNTKNGIVFSKNGQQ 288
           +Y FQ+ +  + +    ++ G   SK+GQ+
Sbjct: 509 NYLFQSNEKKKESKVGWSRGG---SKSGQE 535



>gb:AC137001_1743353 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0012L23, complete sequence.
          Length = 471

 Score = 93.2 bits (230), Expect = 4e-18
 Identities = 61/175 (34%), Positives = 88/175 (50%), Gaps = 8/175 (4%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHL---CEKRRF 549
           PEY  +G LT KSDV+S+GV+LLE+ITGRR +D ++   + +LV+WARP L    E   +
Sbjct: 266 PEYASSGKLTEKSDVFSYGVMLLELITGRRPVDTSQTYMDDSLVDWARPLLMQALENGNY 325

Query: 548 YRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDM-----A 384
             L+DPRL   F+     +    AA C+    + RP MS+VV AL+   +L+D+      
Sbjct: 326 EELVDPRLGKDFNPNEMARMIACAAACVRHSARRRPRMSQVVRALEGDVSLEDLNEGVRP 385

Query: 383 SSSYYFQTMQADRIASSPNTKNGIVFSKNGQQNPRSLSIPNGSHASPYRQFSQNS 219
             S YF +  +    S    ++   F K    N    S    +  S Y Q    S
Sbjct: 386 GHSRYFGSYSSSDYDSGQYNEDMKKFRKMAFTNNNDTSSQYSAPTSEYGQIPSAS 440



>gb:AY224526_1590723 Oryza sativa (japonica cultivar-group) isolate
           20960 putative receptor protein kinase mRNA, partial
           cds.
          Length = 394

 Score = 93.2 bits (230), Expect = 4e-18
 Identities = 61/175 (34%), Positives = 88/175 (50%), Gaps = 8/175 (4%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHL---CEKRRF 549
           PEY  +G LT KSDV+S+GV+LLE+ITGRR +D ++   + +LV+WARP L    E   +
Sbjct: 189 PEYASSGKLTEKSDVFSYGVMLLELITGRRPVDTSQTYMDDSLVDWARPLLMQALENGNY 248

Query: 548 YRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDM-----A 384
             L+DPRL   F+     +    AA C+    + RP MS+VV AL+   +L+D+      
Sbjct: 249 EELVDPRLGKDFNPNEMARMIACAAACVRHSARRRPRMSQVVRALEGDVSLEDLNEGVRP 308

Query: 383 SSSYYFQTMQADRIASSPNTKNGIVFSKNGQQNPRSLSIPNGSHASPYRQFSQNS 219
             S YF +  +    S    ++   F K    N    S    +  S Y Q    S
Sbjct: 309 GHSRYFGSYSSSDYDSGQYNEDMKKFRKMAFTNNNDTSSQYSAPTSEYGQIPSAS 363



>gb:AY518290_1610792 Arabidopsis thaliana strubbelig receptor family
           5 (SRF5) mRNA, complete cds.
          Length = 699

 Score = 92.4 bits (228), Expect = 7e-18
 Identities = 52/112 (46%), Positives = 66/112 (58%), Gaps = 5/112 (4%)
 Frame = -1

Query: 692 TSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRLIDPRLEGHF 513
           T KSDVYSFGVV+LE++TGR   D  +P  ER+LV WA P L +      + DP L G +
Sbjct: 580 TPKSDVYSFGVVMLELLTGRVPFDGEKPRPERSLVRWATPQLHDIDALSNIADPALHGLY 639

Query: 512 SIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL-----KPLPNLKDMASSSY 372
             K   + A + A C+  +P+ RP MSEVVEAL     +    LKD  SSSY
Sbjct: 640 PPKSLSRFADIIALCVQVEPEFRPPMSEVVEALVRMVQRSSMKLKDDLSSSY 691



>gb:AP004324_1840160 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OJ1215_E11.
          Length = 402

 Score = 92.0 bits (227), Expect = 9e-18
 Identities = 50/112 (44%), Positives = 68/112 (60%), Gaps = 9/112 (8%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGER-NLVEWARPHLCEKRRFYR 543
           PEYV TGHLT+ SDVY FGVVLLEM+ GRR+++       + NLV+WARP L   ++  R
Sbjct: 256 PEYVATGHLTAMSDVYGFGVVLLEMLVGRRALEPPAAGCSKCNLVDWARPILIRPKKLER 315

Query: 542 LIDPRLE--------GHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALK 411
           ++D R+         G       ++ A+LA  CLS++PK RP M  VV  L+
Sbjct: 316 IVDRRMALPAPAADYGGGVDAAVERVARLAYDCLSQNPKVRPTMGRVVHVLE 367



>pir|F86387|F86387 probable Pto kinase interactor [imported] -
           Arabidopsis thaliana>gb:AE005172_891490 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC079829_1732818 Arabidopsis thaliana
           chromosome 1 BAC F28B23 genomic sequence, complete
           sequence.
          Length = 760

 Score = 92.0 bits (227), Expect = 9e-18
 Identities = 49/108 (45%), Positives = 66/108 (61%), Gaps = 3/108 (2%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHL---CEKRRF 549
           PEY  +G LT KSDV+SFGVVLLE+ITGR+ +D ++P G+ +LVEWARP L    E   F
Sbjct: 597 PEYASSGKLTEKSDVFSFGVVLLELITGRKPVDASQPLGDESLVEWARPLLSNATETEEF 656

Query: 548 YRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
             L DP+L  ++      +  + AA C+      RP MS++V A   L
Sbjct: 657 TALADPKLGRNYVGVEMFRMIEAAAACIRHSATKRPRMSQIVRAFDSL 704



>gb:AY518288_1610790 Arabidopsis thaliana strubbelig receptor family
           3 (SRF3) mRNA, complete cds.
          Length = 776

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 44/97 (45%), Positives = 64/97 (65%)
 Frame = -1

Query: 704 TGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRLIDPRL 525
           +G  T +SDVYSFGVV+LE++TGR S D++R  GE+ LV WA P L +     +++DP L
Sbjct: 663 SGIYTWQSDVYSFGVVMLELLTGRMSYDRDRSRGEQFLVRWAIPQLHDIDALGKMVDPSL 722

Query: 524 EGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
            G +  K     A + +RC+  +P+ RP+MSEVV+ L
Sbjct: 723 NGQYPAKSLSHFADIISRCVQSEPEFRPLMSEVVQDL 759



>pir|A85043|A85043 probable LRR receptor-like protein kinase
           [imported] - Arabidopsis thaliana>gb:AC005275_1532370
           Arabidopsis thaliana BAC F4C21 from chromosome IV, top
           arm, near 17 cM, complete sequence.>gb:ATCHRIV8_1547320
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 8.
          Length = 754

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 44/97 (45%), Positives = 64/97 (65%)
 Frame = -1

Query: 704 TGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRLIDPRL 525
           +G  T +SDVYSFGVV+LE++TGR S D++R  GE+ LV WA P L +     +++DP L
Sbjct: 641 SGIYTWQSDVYSFGVVMLELLTGRMSYDRDRSRGEQFLVRWAIPQLHDIDALGKMVDPSL 700

Query: 524 EGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
            G +  K     A + +RC+  +P+ RP+MSEVV+ L
Sbjct: 701 NGQYPAKSLSHFADIISRCVQSEPEFRPLMSEVVQDL 737



>pir|F84682|F84682 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AC006202_1533609 Arabidopsis thaliana
           chromosome 2 clone T3B23 map mi54, complete sequence.
          Length = 486

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 53/107 (49%), Positives = 67/107 (62%), Gaps = 2/107 (1%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPN-GERNLVEWARPHLCE-KRRFY 546
           PEY + G  +  SDV+SFGVVLLE+ITGR+ + K   N GE +LV WA P L + KR   
Sbjct: 358 PEYAIAGCASQMSDVFSFGVVLLELITGRKPIQKPSNNKGEESLVIWAVPRLQDSKRVIE 417

Query: 545 RLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
            L DPRL G F+ +  Q  A LA  CL  DP++RP M EVV+ L  +
Sbjct: 418 ELPDPRLNGKFAEEEMQIMAYLAKECLLLDPESRPTMREVVQILSTI 464



>gb:ATT30N20_1555820 Arabidopsis thaliana DNA chromosome 5, BAC
           clone T30N20 (ESSA project).
          Length = 356

 Score = 90.9 bits (224), Expect = 2e-17
 Identities = 39/105 (37%), Positives = 70/105 (66%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY++ G LT KSDVY+FGVVLLE++ G++ ++K  P   ++++ WA P+L ++ +   +
Sbjct: 232 PEYLLNGQLTEKSDVYAFGVVLLELLLGKKPVEKLAPGECQSIITWAMPYLTDRTKLPSV 291

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           IDP ++    +K   + A +A  C+  +P  RP++++V+ +L PL
Sbjct: 292 IDPAIKDTMDLKHLYQVAAVAILCVQPEPSYRPLITDVLHSLIPL 336



>pir|T50811|T50811 ser/thr specific protein kinase-like protein -
           Arabidopsis thaliana (fragment)
          Length = 356

 Score = 90.9 bits (224), Expect = 2e-17
 Identities = 39/105 (37%), Positives = 70/105 (66%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY++ G LT KSDVY+FGVVLLE++ G++ ++K  P   ++++ WA P+L ++ +   +
Sbjct: 232 PEYLLNGQLTEKSDVYAFGVVLLELLLGKKPVEKLAPGECQSIITWAMPYLTDRTKLPSV 291

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           IDP ++    +K   + A +A  C+  +P  RP++++V+ +L PL
Sbjct: 292 IDPAIKDTMDLKHLYQVAAVAILCVQPEPSYRPLITDVLHSLIPL 336



>pir|T51791|T51791 ser/thr specific protein kinase-like protein -
           Arabidopsis thaliana>gb:ATT5K6_1556194 Arabidopsis
           thaliana DNA chromosome 5, BAC clone T5K6 (ESSA
           project).
          Length = 402

 Score = 90.9 bits (224), Expect = 2e-17
 Identities = 39/105 (37%), Positives = 70/105 (66%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY++ G LT KSDVY+FGVVLLE++ G++ ++K  P   ++++ WA P+L ++ +   +
Sbjct: 278 PEYLLNGQLTEKSDVYAFGVVLLELLLGKKPVEKLAPGECQSIITWAMPYLTDRTKLPSV 337

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           IDP ++    +K   + A +A  C+  +P  RP++++V+ +L PL
Sbjct: 338 IDPAIKDTMDLKHLYQVAAVAILCVQPEPSYRPLITDVLHSLIPL 382



>pir|T01477|T01477 protein kinase homolog F17O7.1 - Arabidopsis
           thaliana>gb:F17O7_1677653 Arabidopsis thaliana
           chromosome 1 BAC F17O7 complete sequence.
          Length = 321

 Score = 90.9 bits (224), Expect = 2e-17
 Identities = 48/101 (47%), Positives = 63/101 (62%), Gaps = 3/101 (2%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHL---CEKRRF 549
           PEY  +G LT +SDV+SFGVVLLE+ITGR+ +D+N+P GE +LV WARP L    E   F
Sbjct: 219 PEYAQSGQLTDRSDVFSFGVVLLELITGRKPVDRNQPLGEESLVGWARPLLKKAIETGDF 278

Query: 548 YRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEV 426
             L+D RLE H+      +  + AA C+      RP M +V
Sbjct: 279 SELVDRRLEKHYVKNEVFRMIETAAACVRYSGPKRPRMVQV 319



>gb:AP003705_1832164 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1112_E08.>gb:AP003932_1835435 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OJ1773_H01.
          Length = 750

 Score = 90.5 bits (223), Expect = 3e-17
 Identities = 42/102 (41%), Positives = 64/102 (62%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PE   +G L+ +SDVYSFGVV+LE++TGR+  D +RP  E++LV WA   L +     ++
Sbjct: 569 PEVHESGLLSDRSDVYSFGVVMLELLTGRKPYDSSRPRAEQHLVRWATSQLYDIDAISKM 628

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
           +DP + G  S K   +   + + C+  +P+ RP MSEVV+ L
Sbjct: 629 VDPSIRGQCSEKALSRFVDIISSCIQHEPEFRPSMSEVVQDL 670



>gb:AY518289_1610791 Arabidopsis thaliana strubbelig receptor family
           4 (SRF4) mRNA, complete cds.
          Length = 687

 Score = 90.5 bits (223), Expect = 3e-17
 Identities = 45/105 (42%), Positives = 63/105 (60%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PE       T KSDVYSFGVV+LE++TGR+  D  RP  E++LV WA+P L +      +
Sbjct: 582 PECTDPSAYTQKSDVYSFGVVMLELLTGRKPYDSGRPKAEQSLVRWAKPQLKDMDTLDEM 641

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +DP L G ++ +     A + + C+  +P  RP +S VVEALK L
Sbjct: 642 VDPALCGLYAPESVSSFADIVSICVMTEPGLRPPVSNVVEALKRL 686



>gb:AP004082_1837433 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1149_C12.>gb:AP005290_1849952 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ1282_E10.
          Length = 368

 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 48/110 (43%), Positives = 68/110 (61%), Gaps = 8/110 (7%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERN-------LVEWARPHLC- 564
           P+Y M+G L  KSDVYSFGVVLLE+ITGRR+ D    + E         L +WARP+L  
Sbjct: 232 PDYAMSGKLNVKSDVYSFGVVLLELITGRRAFDAASSDSESEDHQRFLLLRDWARPYLAG 291

Query: 563 EKRRFYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
           +++R + L DP L+G +  +   + A +A+ CL  +P  RP M++V  AL
Sbjct: 292 DRKRCFALADPALQGRYPRRAFYQLAVVASLCLRDNPNLRPSMTDVTRAL 341



>gb:AP003992_1836055 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1077_E05.
          Length = 795

 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 42/102 (41%), Positives = 64/102 (62%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PE    G  T +SDVYSFGVV+LE++TGR+  D +RP  E++LV WA     +     ++
Sbjct: 682 PEIHEAGTFTYRSDVYSFGVVMLELLTGRKPYDSSRPRAEQHLVRWADSQFHDIESISKM 741

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
           +DP ++G  S K   + A + +RC+  +P+ RP MSE+V+ L
Sbjct: 742 VDPSIQGECSEKVLSRFADIISRCIRPEPEFRPSMSEIVQDL 783



>gb:AC134344_1741747 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0059K16, complete
           sequence.>gb:AC136224_1743126 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBb0006B22,
           complete sequence.
          Length = 478

 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 40/105 (38%), Positives = 69/105 (65%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY++ G LT KSDVY+FGVVLLE++ GR+ ++K  P+  +++V WA P L ++ +   +
Sbjct: 350 PEYLLDGKLTEKSDVYAFGVVLLELLMGRKPVEKMSPSQCQSIVTWAMPQLTDRSKLPSI 409

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPL 405
           +DP ++     K   + A +A  C+  +P  RP++++V+ +L PL
Sbjct: 410 VDPVIKDTMDPKHLYQVAAVAVLCVQAEPSYRPLITDVLHSLVPL 454



>gb:AC007945_1536371 Genomic sequence for Arabidopsis thaliana BAC
           F28C11 from chromosome I, complete sequence.
          Length = 752

 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 49/105 (46%), Positives = 64/105 (60%), Gaps = 3/105 (2%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHL---CEKRRF 549
           PEY  +G LT +SDV+SFGVVLLE++TGR+ +D+ +P GE +LVEWARP L    E    
Sbjct: 572 PEYASSGKLTDRSDVFSFGVVLLELVTGRKPVDQTQPLGEESLVEWARPLLLKAIETGDL 631

Query: 548 YRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
             LID RLE  +      +  + AA C+      RP M +VV AL
Sbjct: 632 SELIDTRLEKRYVEHEVFRMIETAAACVRHSGPKRPRMVQVVRAL 676



>pir|B86369|B86369 hypothetical protein F5O8.10 - Arabidopsis
           thaliana>gb:AE005172_891306 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AX088879_1461048 Sequence 4 from Patent
           WO0114563.>gb:AX825709_1475975 Sequence 7 from Patent
           WO03072763.>gb:F5O8_1678420 Arabidopsis thaliana
           chromosome 1 BAC F5O8 sequence, complete sequence.
          Length = 731

 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 49/105 (46%), Positives = 64/105 (60%), Gaps = 3/105 (2%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHL---CEKRRF 549
           PEY  +G LT +SDV+SFGVVLLE++TGR+ +D+ +P GE +LVEWARP L    E    
Sbjct: 551 PEYASSGKLTDRSDVFSFGVVLLELVTGRKPVDQTQPLGEESLVEWARPLLLKAIETGDL 610

Query: 548 YRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL 414
             LID RLE  +      +  + AA C+      RP M +VV AL
Sbjct: 611 SELIDTRLEKRYVEHEVFRMIETAAACVRHSGPKRPRMVQVVRAL 655



>gb:AP002953_1823972 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0426D06.
          Length = 516

 Score = 89.7 bits (221), Expect = 5e-17
 Identities = 49/109 (44%), Positives = 65/109 (59%), Gaps = 3/109 (2%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY  TG L  KSD+YSFGVVLLE ITGR  +D  RP  E NLV+W +  +   RR   +
Sbjct: 364 PEYANTGLLNEKSDIYSFGVVLLEAITGRDPVDYGRPANEVNLVDWLK-MMVASRRSEEV 422

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALK---PLP 402
           +DP +E   S +  ++A   A RC+  D + RP M +VV  L+   P+P
Sbjct: 423 VDPTIETRPSTRALKRALLTALRCVDPDSEKRPKMGQVVRMLESDDPIP 471



>pir|T01711|T01711 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) A_IG002N01.22 - Arabidopsis
           thaliana>gb:ATCHRIV3_1544819 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 3.>gb:IG002N01_1683033
           Arabidopsis thaliana BAC IG002N01.
          Length = 450

 Score = 89.7 bits (221), Expect = 5e-17
 Identities = 42/103 (40%), Positives = 64/103 (62%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY  TG LT KSD+YSFG++++E+ITGR  +D +RP GE NLVEW +  +   RR   +
Sbjct: 331 PEYACTGMLTEKSDIYSFGILIMEIITGRNPVDYSRPQGEVNLVEWLKT-MVGNRRSEEV 389

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALK 411
           +DP++    + K  ++   +A RC+  D   RP M  ++  L+
Sbjct: 390 VDPKIPEPPTSKALKRVLLVALRCVDPDANKRPKMGHIIHMLE 432



>gb:AY518287_1610789 Arabidopsis thaliana strubbelig receptor family
           2 (SRF2) mRNA, complete cds.>gb:AP002032_1821494
           Arabidopsis thaliana genomic DNA, chromosome 5, P1
           clone:MPH15.
          Length = 735

 Score = 89.4 bits (220), Expect = 6e-17
 Identities = 45/115 (39%), Positives = 72/115 (62%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PE+   G   +KSD Y+ GV+LLE++TGR++ D +RP GE+ LV+WA   L ++R   ++
Sbjct: 590 PEHGQPGSSGTKSDTYALGVLLLELLTGRKAFDSSRPRGEQLLVKWASTRLHDRRSLEQM 649

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSS 375
           ID  + G FS + A + A + + C   + + RP +SE+VEAL  L   ++  +SS
Sbjct: 650 IDGGIAGTFSSRVASQYADIISLCTQAEKEFRPPVSEIVEALTALIQKQNKEASS 704



>gb:AC091532_1734806 Oryza sativa chromosome 3 BAC OSJNBa0078A17
            genomic sequence, complete sequence.
          Length = 962

 Score = 89.0 bits (219), Expect = 8e-17
 Identities = 42/109 (38%), Positives = 66/109 (60%), Gaps = 1/109 (0%)
 Frame = -1

Query: 719  PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
            PEY +TG +T+K+DV+SFGV+L+E+ITGR+++D+ +P    +LV W R     K  F + 
Sbjct: 783  PEYAVTGRVTTKADVFSFGVILMELITGRKALDETQPEDSMHLVTWFRRMQLSKDTFQKA 842

Query: 539  IDPRLE-GHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNL 396
            IDP ++    ++      A+LA  C +R+P  RP M   V  L  L ++
Sbjct: 843  IDPTIDLTEETLASVSTVAELAGHCCAREPHQRPDMGHAVNVLSTLSDV 891



>pir|A96574|A96574 protein F12M16.30 [imported] - Arabidopsis
            thaliana>gb:AE005173_893243 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:AC008007_1536424 Genomic sequence for
            Arabidopsis thaliana BAC F12M16 from chromosome I,
            complete sequence.
          Length = 854

 Score = 89.0 bits (219), Expect = 8e-17
 Identities = 48/128 (37%), Positives = 73/128 (57%), Gaps = 2/128 (1%)
 Frame = -1

Query: 719  PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
            PEY M GHLT K+DVYSFG+V LE++ GR +  +   N    L++W    L EK     L
Sbjct: 696  PEYAMRGHLTDKADVYSFGIVALEIVHGRSNKIERSKNNTFYLIDWVEV-LREKNNLLEL 754

Query: 539  IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEAL--KPLPNLKDMASSSYYF 366
            +DPRL   ++ + A    Q+A  C S +P  RP MSEVV+ L  K +  ++ +  +S + 
Sbjct: 755  VDPRLGSEYNREEAMTMIQIAIMCTSSEPCERPSMSEVVKMLEGKKMVEVEKLEEASVHR 814

Query: 365  QTMQADRI 342
            +T + + +
Sbjct: 815  ETKRLENM 822



>pir|A96563|A96563 probable protein kinase 60711-62822 [imported] -
           Arabidopsis thaliana>gb:AE005173_893141 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC037424_1540009 Arabidopsis thaliana
           chromosome 1 BAC F19K6 genomic sequence, complete
           sequence.>gb:BT011757_1641279 Arabidopsis thaliana
           At1g52290 gene, complete cds.
          Length = 509

 Score = 89.0 bits (219), Expect = 8e-17
 Identities = 48/119 (40%), Positives = 71/119 (59%), Gaps = 4/119 (3%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRP-NGERNLVEWARPHLCE---KRR 552
           PEY  +G LT KSDV+S GVVLLE+ITGRR +DK++P   + ++V+WA+P + +      
Sbjct: 312 PEYASSGKLTEKSDVFSIGVVLLELITGRRPVDKSQPFADDDSIVDWAKPLMIQALNDGN 371

Query: 551 FYRLIDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNLKDMASSS 375
           F  L+DPRLE  F I    +    AA  +    K RP MS++V A +   ++ D+   +
Sbjct: 372 FDGLVDPRLENDFDINEMTRMVACAAASVRHSAKRRPKMSQIVRAFEGNISIDDLTEGA 430



>pir|T04124|T04124 receptor-like protein kinase (EC 2.7.1.-) -
            rice>gb:OSTMK_1698389 O.sativa mRNA for leucine rich
            repeat receptor-like kinase.
          Length = 962

 Score = 89.0 bits (219), Expect = 8e-17
 Identities = 42/109 (38%), Positives = 66/109 (60%), Gaps = 1/109 (0%)
 Frame = -1

Query: 719  PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
            PEY +TG +T+K+DV+SFGV+L+E+ITGR+++D+ +P    +LV W R     K  F + 
Sbjct: 783  PEYAVTGRVTTKADVFSFGVILMELITGRKALDETQPEDSMHLVTWFRRMQLSKDTFQKA 842

Query: 539  IDPRLE-GHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALKPLPNL 396
            IDP ++    ++      A+LA  C +R+P  RP M   V  L  L ++
Sbjct: 843  IDPTIDLTEETLASVSTVAELAGHCCAREPHQRPDMGHAVNVLSTLSDV 891



>gb:AY093964_1575470 Arabidopsis thaliana At1g01540/F22L4_6 mRNA,
           complete cds.>gb:AF367265_1791718 Arabidopsis thaliana
           At1g01540/F22L4_6 mRNA, complete cds.
          Length = 479

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 41/103 (39%), Positives = 63/103 (61%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY  TG L  KSD+YSFG++++E+ITGR  +D +RP GE NLV+W +  +   RR   +
Sbjct: 325 PEYACTGMLNEKSDIYSFGILIMEIITGRNPVDYSRPQGETNLVDWLK-SMVGNRRSEEV 383

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALK 411
           +DP++    S K  ++   +A RC+  D   RP M  ++  L+
Sbjct: 384 VDPKIPEPPSSKALKRVLLVALRCVDPDANKRPKMGHIIHMLE 426



>gb:ATY12776_1557476 Arabidopsis thaliana DNA, 40 kb surrounding
           ACS1 locus.>gb:AF332429_1787241 Arabidopsis thaliana
           clone C00102 (h) putative protein serine/threonine
           kinase (At1g01540) mRNA, complete cds.
          Length = 472

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 41/103 (39%), Positives = 63/103 (61%)
 Frame = -1

Query: 719 PEYVMTGHLTSKSDVYSFGVVLLEMITGRRSMDKNRPNGERNLVEWARPHLCEKRRFYRL 540
           PEY  TG L  KSD+YSFG++++E+ITGR  +D +RP GE NLV+W +  +   RR   +
Sbjct: 325 PEYACTGMLNEKSDIYSFGILIMEIITGRNPVDYSRPQGETNLVDWLK-SMVGNRRSEEV 383

Query: 539 IDPRLEGHFSIKGAQKAAQLAARCLSRDPKARPMMSEVVEALK 411
           +DP++    S K  ++   +A RC+  D   RP M  ++  L+
Sbjct: 384 VDPKIPEPPSSKALKRVLLVALRCVDPDANKRPKMGHIIHMLE 426


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 787,085,960
Number of Sequences: 1806583
Number of extensions: 16989270
Number of successful extensions: 48630
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 46042
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 47538
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 42871928976
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)