BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig9647
         (1242 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY365248_1602881 Cucumis sativus 60S ribosomal protein L5 mRN...   419   e-116   
gb:AP003349_1828499 Oryza sativa (japonica cultivar-group) genom...   407   e-112   
sp|P49227|RL5_ARATH|RL5_ARATH 60S ribosomal protein L5.>gb:AB016876_151297...   406   e-112   Arabidopsis thaliana [mouse-ear cress]
gb:AP003349_1828500 Oryza sativa (japonica cultivar-group) genom...   405   e-112   
gb:AY054161_1562983 Arabidopsis thaliana AT5g39740/MKM21_30 mRNA...   404   e-111   
sp|P49625|RL5_ORYSA|RL5_ORYSA 60S ribosomal protein L5.                         404   e-111   Oryza sativa [red rice]
gb:AY087197_1572231 Arabidopsis thaliana clone 32753 mRNA, compl...   400   e-110   
gb:AP003316_1827940 Oryza sativa (japonica cultivar-group) genom...   395   e-109   
gb:AP003316_1827941 Oryza sativa (japonica cultivar-group) genom...   394   e-108   
gb:AB049724_1520913 Pisum sativum ssa-15 mRNA for putative senes...   362   1e-98   
pir|S39486|S39486 ribosomal protein L5 - rice                         347   1e-96   Oryza sativa Indica Group [Indian rice]
gb:BC042258_2548079 Xenopus laevis similar to ribosomal protein ...   279   1e-73   
gb:AF401557_2491984 Ictalurus punctatus ribosomal protein L5b mR...   277   4e-73   
gb:STJLRP_1398153 Styela clava ribosomal protein L5 gene, comple...   276   8e-73   
gb:AE016816_1746794 Ashbya gossypii (= Eremothecium gossypii) AT...   275   2e-72   
pir|A33823|A33823 ribosomal protein L5a - African clawed frog>gb...   275   2e-72   Xenopus laevis [clawed frog]
sp|P49405|RL5_CAEEL|RL5_CAEEL 60S ribosomal protein L5.>pir|T22631|T22631 ...   275   2e-72   Caenorhabditis elegans [roundworm]
gb:BC041227_2547863 Xenopus laevis similar to ribosomal protein ...   274   2e-72   
pir|B33823|B33823 ribosomal protein L5b - African clawed frog>gb...   274   2e-72   Xenopus laevis [clawed frog]
sp|Q26481|RL5_STYCL|RL5_STYCL 60S ribosomal protein L5.                         274   3e-72   Styela clava
gb:AF401556_2491983 Ictalurus punctatus ribosomal protein L5a mR...   273   5e-72   
sp|P15125|RL5A_XENLA|RL5A_XENLA 60S ribosomal protein L5A.                       273   7e-72   Xenopus laevis [clawed frog]
gb:BC071498_2556235 Danio rerio ribosomal protein L5, mRNA (cDNA...   272   9e-72   
sp|P15126|RL5B_XENLA|RL5B_XENLA 60S ribosomal protein L5B.                       272   9e-72   Xenopus laevis [clawed frog]
gb:AF113210_1149833 Homo sapiens MSTP030 mRNA, complete cds.>gb:...   272   1e-71   
sp|O65353|RL5_HELAN|RL5_HELAN 60S ribosomal protein L5.>pir|T12615|T12615 ...   272   1e-71   Helianthus annuus
sp|O76190|RL5_BOMMO|RL5_BOMMO 60S ribosomal protein L5.>gb:AF008229_123146...   272   1e-71   Bombyx mori [silk moth]
gb:AY769272_1350423 Bombyx mori ribosomal protein L5 (RpL5) mRNA...   271   2e-71   
gb:AY071305_1295389 Drosophila melanogaster RE33114 full length ...   271   2e-71   
pir|JC1308|JC1308 ribosomal protein L5 - chicken>gb:CHKRPL5G_256...   271   2e-71   Gallus gallus [bantam]
gb:BC059751_2552696 Xenopus tropicalis hypothetical protein MGC7...   270   4e-71   
gb:AY737527_1348921 Toxoptera citricida putative ribosomal prote...   270   4e-71   
pir|S55912|S55912 ribosomal protein L5, cytosolic - human>gb:HSU...   270   4e-71   Homo sapiens [man]
pir|S00111|R5RTL5 ribosomal protein L5, cytosolic [validated] - ...   270   4e-71   
sp|P22451|RL5_CHICK|RL5_CHICK 60S ribosomal protein L5.                         269   8e-71   Gallus gallus [bantam]
gb:CR382124_1656633 Kluyveromyces lactis strain NRRL Y-1140 chro...   268   1e-70   
gb:AK008489_1154607 Mus musculus adult male small intestine cDNA...   268   1e-70   
sp|P09895|RL5_RAT|RL5_RAT 60S ribosomal protein L5.                           268   2e-70   Rattus norvegicus [brown rat]
sp|P46777|RL5_HUMAN|RL5_HUMAN 60S ribosomal protein L5.                         268   2e-70   Homo sapiens [man]
sp|O22608|RL5_DUNSA|RL5_DUNSA 60S ribosomal protein L5.>pir|T08009|T08009 ...   268   2e-70   Dunaliella salina
gb:AY130399_1302451 Branchiostoma lanceolatum ribosomal protein ...   268   2e-70   
sp|O59953|RL5_NEUCR|RL5_NEUCR 60S ribosomal protein L5 (CPR4).>gb:NCB7H23_...   267   4e-70   
gb:CR380959_1653766 Candida glabrata strain CBS138 chromosome M ...   266   5e-70   
sp|P47962|RL5_MOUSE|RL5_MOUSE 60S ribosomal protein L5.                         266   5e-70   Mus musculus [mouse]
gb:RATRPL5_2133768 Rat ribosomal protein L5 mRNA, complete cds.       266   6e-70   
gb:AF526222_1279318 Argopecten irradians isolate iolsaicl209ct24...   264   2e-69   
gb:CGI563456_1372107 Crassostrea gigas partial mRNA for ribosoma...   262   9e-69   
gb:AY389937_2531430 Latimeria chalumnae ribosomal protein L5 mRN...   262   1e-68   
gb:BC049035_2550106 Danio rerio zgc:77176, mRNA (cDNA clone MGC:...   261   2e-68   
pir|S42144|S42144 ribosomal protein L5.e, cytosolic - yeast (Sac...   261   2e-68   Saccharomyces cerevisiae [brewer's yeast]
sp|P26321|RL5_YEAST|RL5_YEAST 60S ribosomal protein L5 (L1) (YL3) (Ribosom...   261   2e-68   Saccharomyces cerevisiae [brewer's yeast]
gb:AY223167_1176631 Schistosoma japonicum clone ZZD1555 mRNA seq...   260   4e-68   
gb:BX649606_1643407 Aspergillus fumigatus BAC pilot project supe...   260   5e-68   
gb:AY130401_2514067 Scyliorhinus canicula ribosomal protein L5 m...   258   2e-67   
gb:AY389938_2531431 Protopterus dolloi ribosomal protein L5 mRNA...   257   3e-67   
gb:AY292620_1316676 Oikopleura dioica 60S ribosomal protein L5 (...   254   3e-66   
gb:CR382131_1664377 Yarrowia lipolytica chromosome E of strain C...   253   4e-66   
gb:AF152472_2477323 Myxine glutinosa ribosomal protein L5 mRNA, ...   252   1e-65   
gb:AE017343_1755776 Cryptococcus neoformans var. neoformans JEC2...   250   4e-65   
sp|O74306|RL5B_SCHPO|RL5B_SCHPO 60S ribosomal protein L5-B.>pir|T39325|T393...   249   6e-65   Schizosaccharomyces pombe
sp|O44248|RL5_ANOGA|RL5_ANOGA 60S ribosomal protein L5.>gb:AF002238_123070...   249   1e-64   Anopheles gambiae
gb:CR382139_1673082 Debaryomyces hansenii chromosome G of strain...   248   2e-64   
sp|P52822|RL5A_SCHPO|RL5A_SCHPO 60S ribosomal protein L5-A.>pir|T38758|T387...   248   2e-64   Schizosaccharomyces pombe
gb:AY588943_1339467 Eimeria tenella large subunit ribosomal prot...   240   4e-62   
gb:SPU48270_1722209 Schizosaccharomyces pombe ribosomal protein ...   238   2e-61   
gb:AB089490_1198598 Giardia intestinalis gene for ribosomal prot...   221   2e-56   
gb:AY113682_1425082 Equus caballus ribosomal protein L5 (RPL5) m...   214   2e-54   
gb:AY231809_1177102 Drosophila yakuba clone yak-em_yip6 mRNA seq...   214   2e-54   
gb:AB016045_1512750 Schizosaccharomyces pombe mRNA for ribosomal...   210   4e-53   
pir|T43382|T43382 ribosomal protein L5 - fission yeast (Schizosa...   210   4e-53   Schizosaccharomyces pombe
gb:AE014187_938696 Plasmodium falciparum 3D7 chromosome 14 compl...   208   2e-52   
gb:AY232050_1177343 Drosophila yakuba clone yak-ad_yip6 mRNA seq...   200   6e-50   
gb:AB089486_1198594 Trichomonas vaginalis gene for ribosomal pro...   194   2e-48   
sp|P93779|RL5_SOLME|RL5_SOLME 60S ribosomal protein L5 (Fragment).>gb:AB00...   184   2e-45   Solanum melongena [aubergine]
gb:CNS07EGD_1373505 chromosome VI of strain GB-M1 of Encephalito...   181   3e-44   
gb:AF227803_1150602 Ictalurus punctatus ribosomal protein L5b mR...   179   1e-43   
gb:AY096006_1298407 Branchiostoma belcheri tsingtaunese ribosoma...   176   1e-42   
gb:AY130400_2514066 Petromyzon marinus ribosomal protein L5 mRNA...   167   3e-40   
gb:BT011515_1357983 Drosophila melanogaster SD13191 full insert ...   166   1e-39   
gb:AB002734_1192767 Entamoeba histolytica mRNA for ribosomal pro...   159   9e-38   
gb:AB002733_1192766 Entamoeba histolytica mRNA for ribosomal pro...   154   3e-36   
sp|Q95276|RL5_PIG|RL5_PIG 60S ribosomal protein L5 (Fragment).                137   3e-31   Sus scrofa [pigs]
gb:AF195190_1249790 Drosophila melanogaster yippee interacting p...   135   2e-30   
gb:BC001882_1967929 Homo sapiens ribosomal protein L5, mRNA (cDN...   125   2e-27   
gb:AL162740_1922621 Human DNA sequence from clone RP4-716F6 on c...   123   9e-27   
gb:AB010699_1511235 Arabidopsis thaliana genomic DNA, chromosome...   119   2e-25   
gb:HSU76609_2026040 Human ribosomal L5 protein mRNA, partial cds.     116   1e-24   
gb:BT012458_1358120 Drosophila melanogaster RE57391 full insert ...   114   4e-24   
gb:AF051242_1764231 Picea mariana probable 60S ribosomal protein...   111   3e-23   
gb:AY149443_1304060 Euprymna scolopes 60S ribosomal protein L5 m...   101   3e-20   
gb:AY713111_1348110 Ithomia salapia derasa voucher 8922 ribosoma...    99   2e-19   
gb:AY713101_1348100 Ithomia iphianassa n. ssp. RM-2005 voucher 8...    99   2e-19   
gb:AY713106_1348105 Ithomia patilla voucher 8031 ribosomal prote...    98   4e-19   
gb:AY713099_1348098 Ithomia heraldica heraldica voucher 8005 rib...    98   4e-19   
gb:AY713096_1348095 Ithomia eleonora voucher 9114 ribosomal prot...    98   4e-19   
gb:AY713093_1348092 Ithomia diasia hippocrenis voucher 2985 ribo...    98   4e-19   
gb:AY713092_1348091 Ithomia cleora voucher 8904 ribosomal protei...    98   4e-19   
gb:AY713098_1348097 Ithomia hyala n. ssp. RM-2004 voucher 8844 r...    95   3e-18   
gb:AY713094_1348093 Ithomia diasia hippocrenis voucher 8286 ribo...    95   3e-18   
gb:AY713113_1348112 Ithomia iphianassa n. ssp. RM-2005 voucher 8...    94   6e-18   
pir|D90116|D90116 60S ribosomal protein L5 [imported] - Guillard...    89   2e-16   Guillardia theta
gb:AE009857_256572 Pyrobaculum aerophilum strain IM2 section 112...    87   7e-16   
sp|P54044|RL18_METJA|RL18_METJA 50S ribosomal protein L18P.>pir|B64359|B643...    82   3e-14   Methanocaldococcus jannaschii
sp|O26130|RL18_METTH|RL18_METTH 50S ribosomal protein L18P.>pir|B69127|B691...    78   4e-13   Methanothermobacter thermautotrophicus
gb:AE010304_261662 Methanopyrus kandleri AV19 section 3 of 157 o...    75   3e-12   
sp|Q9YF94|RL18_AERPE|RL18_AERPE 50S ribosomal protein L18P.>pir|B72726|B727...    74   5e-12   Aeropyrum pernix
gb:AE017199_402908 Nanoarchaeum equitans Kin4-M, complete genome.      73   1e-11   
gb:BX957222_844671 Methanococcus maripaludis S2 complete genome;...    70   9e-11   
sp|Q9UX88|RL18_SULSO|RL18_SULSO 50S ribosomal protein L18P.>pir|A99218|A992...    70   1e-10   Saccharolobus solfataricus
sp|Q9V1V4|RL18_PYRAB|RL18_PYRAB 50S ribosomal protein L18P.>pir|E75145|E751...    69   2e-10   Pyrococcus abyssi
sp|P14033|RL18_METVA|RL18_METVA 50S ribosomal protein L18P.>pir|S05623|R5MX...    69   2e-10   Methanococcus vannielii
gb:AY684288_2543886 Sparus aurata ribosomal protein L5 mRNA, par...    69   3e-10   
gb:AP006878_576674 Thermococcus kodakaraensis strain KOD1 DNA, c...    68   4e-10   
pir|A71185|A71185 probable ribosomal protein L18 - Pyrococcus ho...    67   6e-10   Pyrococcus horikoshii
sp|O59438|RL18_PYRHO|RL18_PYRHO 50S ribosomal protein L18P.                       67   6e-10   Pyrococcus horikoshii
gb:AB040118_6468 Pyrococcus furiosus genes for ribosomal protein...    67   8e-10   
gb:GGU31753_2573592 Gallus gallus ribosomal protein L5 mRNA, par...    66   2e-09   
gb:BA000023_690984 Sulfolobus tokodaii str. 7 DNA, complete genome.    65   2e-09   
sp|O05640|RL18_SULAC|RL18_SULAC 50S ribosomal protein L18P.>gb:SSSPCOPER_19...    65   2e-09   Sulfolobus acidocaldarius
gb:MMRPL5_2117264 M.musculus mRNA for ribosomal protein L5, 3'end.     64   8e-09   
pir|S50100|S50100 ribosomal protein L5, cytosolic - mouse (fragm...    64   8e-09   Mus musculus [mouse]
sp|O28373|RL18_ARCFU|RL18_ARCFU 50S ribosomal protein L18P.>pir|A69488|A694...    63   1e-08   Archaeoglobus fulgidus
gb:BA000011_664790 Thermoplasma volcanium GSS1 DNA, complete gen...    62   2e-08   
pir|G84323|G84323 50S ribosomal protein L18P [imported] - Haloba...    61   4e-08   Halobacterium salinarum
sp|P50562|RL18_HALN1|RL18_HALN1 50S ribosomal protein L18P.                       61   4e-08   Halobacterium sp.
pir|S16541|R5HS18 ribosomal protein L18 [validated] - Haloarcula...    60   7e-08   
sp|P14123|RL18_HALMA|RL18_HALMA 50S ribosomal protein L18P (Hmal18) (Hl12).       60   7e-08   Haloarcula marismortui
gb:AE010775_266452 Methanosarcina acetivorans str. C2A, section ...    53   1e-05   
sp|P19949|RL5_RABIT|RL5_RABIT 60S ribosomal protein L5 (Fragments).              53   1e-05   Oryctolagus cuniculus [domestic rabbit]
gb:AY714857_1189972 Uncultured archaeon GZfos33E1 clone GZfos33E...    52   2e-05   
gb:AY714818_1188489 Uncultured archaeon GZfos12E2 clone GZfos12E...    52   2e-05   
pir|S00178|S00178 ribosomal protein L5 - rabbit (fragment)             52   2e-05   Oryctolagus cuniculus [domestic rabbit]
gb:AE013454_292473 Methanosarcina mazei strain Goe1, section 236...    51   4e-05   
gb:AY714862_1190152 Uncultured archaeon GZfos34H9 clone GZfos34H...    49   2e-04   
gb:TACID5_197006 Thermoplasma acidophilum complete genome; segme...    49   2e-04   
gb:AY714867_1190365 Uncultured archaeon GZfos37B2 clone GZfos37B...    46   0.001   
gb:AY534910_626217 Uncultured marine group II euryarchaeote Deep...    45   0.003   
gb:AF371263_1792416 Zea mays 50kD gamma zein mRNA, complete cds.       41   0.058   
gb:AB061848_1868824 Homo sapiens RPL5 gene for ribosomal protein...    39   0.29    
gb:AB042238_2045535 Cricetulus griseus ahr mRNA for Ah receptor,...    37   0.84    
gb:AF000668_1230608 Dirofilaria immitis cyclophilin Dicyp-3 mRNA...    37   0.84    
gb:AY052652_1562812 Chlamydomonas reinhardtii gamete-specific ho...    36   1.4     
gb:AF238888_491585 Bacillus cereus strain ATCC 43881 putative Vr...    36   1.9     
gb:AC117075_1207764 Dictyostelium discoideum chromosome 2 map 52...    35   2.4     
gb:AC116986_1207453 Dictyostelium discoideum chromosome 2 map 22...    35   2.4     
pir|T15109|T15109 hypothetical protein ZC132.5 - Caenorhabditis ...    35   2.4     Caenorhabditis elegans [roundworm]
gb:AE016820_1749892 Ashbya gossypii (= Eremothecium gossypii) AT...    35   4.1     
gb:AY071659_1295743 Drosophila melanogaster RE74364 full insert ...    34   5.4     
gb:AC116984_1207263 Dictyostelium discoideum chromosome 2 map 25...    34   5.4     
gb:AJ698831_529556 Lactobacillus animalis partial gene for gluca...    34   5.4     
gb:DMBR42I17_1378210 Drosophila melanogaster BAC clone BACR42I17.      34   7.1     
gb:AE014298_1123820 Drosophila melanogaster chromosome X, comple...    34   7.1     
gb:AE017261_419676 Picrophilus torridus DSM 9790, complete genome.     34   7.1     
sp|P48998|INVO_RAT|INVO_RAT Involucrin.>pir|I61106|I61106 involucrin - ra...    34   7.1     Rattus norvegicus [brown rat]
gb:AY094737_1297911 Drosophila melanogaster GH28553 full insert ...    33   9.2     
gb:AE014297_1141340 Drosophila melanogaster chromosome 3R, compl...    33   9.2     


>gb:AY365248_1602881 Cucumis sativus 60S ribosomal protein L5 mRNA,
            complete cds.
          Length = 302

 Score =  419 bits (1078), Expect = e-116
 Identities = 214/291 (73%), Positives = 236/291 (81%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            MAF K QKT+AY           REGKTDYRAR RLINQDKNKYNTPKYRFVVR +NKDI
Sbjct: 1    MAFAKAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRTSNKDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
             AQI+SASIAGD++LASAY+HELP+YGLEVG TNYAAAYCTG          LEM  EYE
Sbjct: 61   TAQIISASIAGDLVLASAYSHELPQYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYE 120

Query: 809  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFA 630
            GNVEATGEDYSVEP + RRPFRALLDVGL+RTTTGNRVF           DIPHS+KRFA
Sbjct: 121  GNVEATGEDYSVEPADTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA 180

Query: 629  GFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYK 450
            G++K+ +QLD EVHRKYI+GGHVAAYMR L+EDEPEKYQS FS YIKKGI+AD LE LYK
Sbjct: 181  GYAKNGQQLDVEVHRKYIFGGHVAAYMRTLMEDEPEKYQSHFSEYIKKGIEADELEGLYK 240

Query: 449  KVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAA 297
            KVHAAIRA+P AKKS+K  PK HKRYNLKKLTY+ERKA L+ RLNALN+AA
Sbjct: 241  KVHAAIRANPIAKKSDKPQPKAHKRYNLKKLTYDERKARLVERLNALNSAA 291



>gb:AP003349_1828499 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0674H09.
          Length = 304

 Score =  407 bits (1045), Expect = e-112
 Identities = 201/290 (69%), Positives = 230/290 (79%)
 Frame = -2

Query: 1163 FIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA 984
            F+K QKT AY           R+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI A
Sbjct: 4    FVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDITA 63

Query: 983  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGN 804
            QIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTG            + +EYEGN
Sbjct: 64   QIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLTLRGLDQEYEGN 123

Query: 803  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGF 624
            VEATGEDY VEP + RRPFRALLDVGL+RTTTGNRVF           DIPHS+KRFAGF
Sbjct: 124  VEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGF 183

Query: 623  SKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKV 444
             KD KQLD+++HRKYIYGGHVA YMR++ E+EPEK+Q+ FS Y+KKGIDAD +E LYKKV
Sbjct: 184  KKDEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGMESLYKKV 243

Query: 443  HAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG 294
            HAAIRADP+  KS K+ P  HKRYNLKKLTYE+RKASL+ RLNALN++AG
Sbjct: 244  HAAIRADPTMAKSTKKEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG 293



>sp|P49227|RL5_ARATH 60S ribosomal protein L5.>gb:AB016876_1512972
            Arabidopsis thaliana genomic DNA, chromosome 5, P1
            clone:MKM21.>gb:AY079020_1568134 Arabidopsis thaliana
            AT5g39740/MKM21_30 mRNA, complete
            cds.>gb:AY093123_1575077 Arabidopsis thaliana ribosomal
            protein L5 - like (At5g39740) mRNA, complete
            cds.>gb:BT008706_1639902 Arabidopsis thaliana At5g39740
            gene, complete cds.
          Length = 301

 Score =  406 bits (1043), Expect = e-112
 Identities = 204/292 (69%), Positives = 233/292 (79%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+K  K+ AY           R+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct: 1    MVFVKSSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTG          LEM +EYE
Sbjct: 61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE 120

Query: 809  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFA 630
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVF           DIPHS+KRFA
Sbjct: 121  GNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA 180

Query: 629  GFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYK 450
            GF K++KQLDAE+HR YIYGGHV+ YM+ L EDEPEK Q+ FSAYIKKG++A+++E++YK
Sbjct: 181  GFHKENKQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEEMYK 240

Query: 449  KVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG 294
            KVHAAIRA+P+ KK+EK  PKEHKRYNLKKLTYEERK  LI R+ ALN A G
Sbjct: 241  KVHAAIRAEPNHKKTEKSAPKEHKRYNLKKLTYEERKNKLIERVKALNGAGG 292



>gb:AP003349_1828500 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0674H09.
          Length = 304

 Score =  405 bits (1042), Expect = e-112
 Identities = 200/290 (68%), Positives = 230/290 (79%)
 Frame = -2

Query: 1163 FIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA 984
            F+K QKT AY           R+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI A
Sbjct: 4    FVKTQKTNAYHKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDITA 63

Query: 983  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGN 804
            QIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTG            + +EYEGN
Sbjct: 64   QIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEGN 123

Query: 803  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGF 624
            +EATGEDY VEP + RRPFRALLDVGL+RTTTGNRVF           DIPHS+KRFAGF
Sbjct: 124  IEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGF 183

Query: 623  SKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKV 444
             KD KQLD+++HRKYIYGGHVA YMR++ E+EPEK+Q+ FS Y+KKGIDAD +E LYKKV
Sbjct: 184  KKDEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGMEALYKKV 243

Query: 443  HAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG 294
            HAAIRADP+  KS K+ P  HKRYNLKKLTYE+RKASL+ RLNALN++AG
Sbjct: 244  HAAIRADPTMAKSTKKEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG 293



>gb:AY054161_1562983 Arabidopsis thaliana AT5g39740/MKM21_30 mRNA,
            complete cds.>gb:AY065103_1566257 Arabidopsis thaliana
            60S ribosomal protein L5 (At3g25550) mRNA, complete
            cds.>gb:AY081701_1568961 Arabidopsis thaliana 60S
            ribosomal protein L5 (At3g25550) mRNA, complete
            cds.>gb:AY136319_1581820 Arabidopsis thaliana putative
            ribosomal protein (At3g25520) mRNA, complete
            cds.>gb:AY186611_1588097 Arabidopsis thaliana ribosomal
            protein L5 mRNA, complete cds.>gb:BT000411_1634689
            Arabidopsis thaliana putative ribosomal protein
            (At3g25520) mRNA, complete cds.>gb:BT002427_1636030
            Arabidopsis thaliana ribosomal protein, putative
            (At3g25520) mRNA, complete cds.>gb:BT008705_1639901
            Arabidopsis thaliana At3g25520 gene, complete cds.
          Length = 301

 Score =  404 bits (1038), Expect = e-111
 Identities = 204/292 (69%), Positives = 232/292 (79%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+K  K+ AY           R+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct: 1    MVFVKSTKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTG          LEM +EYE
Sbjct: 61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE 120

Query: 809  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFA 630
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVF           DIPHS+KRFA
Sbjct: 121  GNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA 180

Query: 629  GFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYK 450
            GF K++KQLDAE+HR YIYGGHV+ YM+ L EDEPEK Q+ FSAYIKKG++A+++E+LYK
Sbjct: 181  GFHKENKQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEELYK 240

Query: 449  KVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG 294
            KVHAAIRADP+ KK+ K  PK+HKRYNLKKLTYEERK  LI R+ ALN A G
Sbjct: 241  KVHAAIRADPNPKKTVKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG 292



>sp|P49625|RL5_ORYSA 60S ribosomal protein L5.
          Length = 304

 Score =  404 bits (1038), Expect = e-111
 Identities = 200/290 (68%), Positives = 229/290 (78%)
 Frame = -2

Query: 1163 FIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA 984
            F+K QKT AY           R+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI A
Sbjct: 4    FVKTQKTNAYYKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDITA 63

Query: 983  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGN 804
            QIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTG            + +EYEGN
Sbjct: 64   QIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEGN 123

Query: 803  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGF 624
            +EATGEDY VEP + RRPFRALLDVGL+RTTTGNRVF           DIPHS+KRFAGF
Sbjct: 124  IEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGF 183

Query: 623  SKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKV 444
             KD KQLD+++HRKYIYGGHVA YMR++ E+EPEK+Q+ FS Y+KKGIDAD +E LYKKV
Sbjct: 184  KKDEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGMEALYKKV 243

Query: 443  HAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG 294
            HAAIRADP   KS K+ P  HKRYNLKKLTYE+RKASL+ RLNALN++AG
Sbjct: 244  HAAIRADPYHAKSTKKEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG 293



>gb:AY087197_1572231 Arabidopsis thaliana clone 32753 mRNA, complete
            sequence.
          Length = 301

 Score =  400 bits (1029), Expect = e-110
 Identities = 202/292 (69%), Positives = 231/292 (79%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+K  K+ AY           R+GKTDYRAR RLINQDKNKYNTPKYRFVVRFTNKDI
Sbjct: 1    MVFVKSTKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            +AQIVSASIAGD++ ASAYAHELP+YGL VG TNYAAAYCTG          LEM +EYE
Sbjct: 61   VAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYE 120

Query: 809  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFA 630
            GNVEATGED+SVEP + RRPFRALLDVGL+RTTTGNRVF           DIPHS+KRFA
Sbjct: 121  GNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFA 180

Query: 629  GFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYK 450
            GF K++KQLDAE+HR YIYGGHV+ YM+ L EDEPEK Q+ FSAYIKKG++A+++E+LYK
Sbjct: 181  GFHKENKQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEELYK 240

Query: 449  KVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG 294
            KVHAAIRA P+ +K+ K  PK+HKRYNLKKLTYEERK  LI R+ ALN A G
Sbjct: 241  KVHAAIRAXPNXRKTVKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG 292



>gb:AP003316_1827940 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0696G06.
          Length = 304

 Score =  395 bits (1016), Expect = e-109
 Identities = 198/290 (68%), Positives = 227/290 (78%)
 Frame = -2

Query: 1163 FIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA 984
            F+K QKT AY           R+GKTDYRAR RL NQDKNKYNTPKYRFV   TNKDI A
Sbjct: 7    FVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFV---TNKDITA 63

Query: 983  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGN 804
            QIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTG            + +EYEGN
Sbjct: 64   QIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLTLRGLDQEYEGN 123

Query: 803  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGF 624
            VEATGEDY VEP + RRPFRALLDVGL+RTTTGNRVF           DIPHS+KRFAGF
Sbjct: 124  VEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGF 183

Query: 623  SKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKV 444
             KD KQLD+++HRKYIYGGHVA YMR++ E+EPEK+Q+ FS Y+KKGIDAD +E LYKKV
Sbjct: 184  KKDEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGMESLYKKV 243

Query: 443  HAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG 294
            HAAIRADP+  KS K+ P  HKRYNLKKLTYE+RKASL+ RLNALN++AG
Sbjct: 244  HAAIRADPTMAKSTKKEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG 293



>gb:AP003316_1827941 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0696G06.
          Length = 301

 Score =  394 bits (1013), Expect = e-108
 Identities = 197/290 (67%), Positives = 227/290 (78%)
 Frame = -2

Query: 1163 FIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA 984
            F+K QKT AY           R+GKTDYRAR RL NQDKNKYNTPKYRFV   TNKDI A
Sbjct: 4    FVKTQKTNAYHKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFV---TNKDITA 60

Query: 983  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGN 804
            QIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTG            + +EYEGN
Sbjct: 61   QIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEGN 120

Query: 803  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGF 624
            +EATGEDY VEP + RRPFRALLDVGL+RTTTGNRVF           DIPHS+KRFAGF
Sbjct: 121  IEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGF 180

Query: 623  SKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKV 444
             KD KQLD+++HRKYIYGGHVA YMR++ E+EPEK+Q+ FS Y+KKGIDAD +E LYKKV
Sbjct: 181  KKDEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGMEALYKKV 240

Query: 443  HAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG 294
            HAAIRADP+  KS K+ P  HKRYNLKKLTYE+RKASL+ RLNALN++AG
Sbjct: 241  HAAIRADPTMAKSTKKEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG 290



>gb:AB049724_1520913 Pisum sativum ssa-15 mRNA for putative
            senescence-associated protein, complete cds.
          Length = 279

 Score =  362 bits (928), Expect = 1e-98
 Identities = 180/250 (72%), Positives = 205/250 (82%)
 Frame = -2

Query: 1049 KNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYC 870
            ++KYN P      RFTNKDI+AQIVSASIAGD++L +AYAHELP YGLEVG TNYAAAYC
Sbjct: 22   QDKYNFPSI-VCCRFTNKDIVAQIVSASIAGDIVLCAAYAHELPHYGLEVGLTNYAAAYC 80

Query: 869  TGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFX 690
            TG          LEM EEYEGNVEA+GEDYSVEP + RRPFRALLDVGL++TTTGNRVF 
Sbjct: 81   TGLLLARRVLKTLEMDEEYEGNVEASGEDYSVEPADSRRPFRALLDVGLVKTTTGNRVFG 140

Query: 689  XXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQS 510
                      DIPHS+KRFAGF K+ K+LDAEVHRKYI+GGHV AYM+ LIEDEPEKYQ+
Sbjct: 141  ALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHRKYIFGGHVTAYMKTLIEDEPEKYQT 200

Query: 509  VFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASL 330
             FS YIKKGI+AD +E+LYKKVHAAIRADP+ KK+EKQPPKEHKRYNLKKLTY+ER+  L
Sbjct: 201  HFSQYIKKGIEADGIEELYKKVHAAIRADPANKKAEKQPPKEHKRYNLKKLTYDERRTKL 260

Query: 329  ISRLNALNAA 300
            I+RL ALN+A
Sbjct: 261  IARLEALNSA 270



>pir|S39486|S39486 ribosomal protein L5 - rice
          Length = 294

 Score =  347 bits (891), Expect(2) = 1e-96
 Identities = 171/248 (68%), Positives = 195/248 (78%)
 Frame = -2

Query: 1163 FIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA 984
            F+K QKT AY           R+GKTDYRAR RL NQDKNKYNTPKYRFVVRFTNKDI A
Sbjct: 4    FVKTQKTNAYYKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDITA 63

Query: 983  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGN 804
            QIV A+IAGD+++A+AY+HELPRYGLEVG TNYAAAYCTG            + +EYEGN
Sbjct: 64   QIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEGN 123

Query: 803  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGF 624
            +EATGEDY VEP + RRPFRALLDVGL+RTTTGNRVF           DIPHS+KRFAGF
Sbjct: 124  IEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGF 183

Query: 623  SKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKV 444
             KD KQLD+++HRKYIYGGHVA YMR++ E+EPEK+Q+ FS Y+KKGIDAD +E LYKKV
Sbjct: 184  KKDEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGMEALYKKV 243

Query: 443  HAAIRADP 420
            HAAIRADP
Sbjct: 244  HAAIRADP 251



 Score = 30.0 bits (66), Expect(2) = 1e-96
 Identities = 14/29 (48%), Positives = 17/29 (58%)
 Frame = -1

Query: 381 QEVQP*EANL*REES*FDLETECPKCCCW 295
           QE+QP EANL  EE     + EC +  CW
Sbjct: 265 QEIQPQEANLRTEEGQSCRKIECSQLLCW 293



>gb:BC042258_2548079 Xenopus laevis similar to ribosomal protein L5,
            mRNA (cDNA clone MGC:53393 IMAGE:5571522), complete cds.
          Length = 296

 Score =  279 bits (713), Expect = 1e-73
 Identities = 144/278 (51%), Positives = 183/278 (65%), Gaps = 1/278 (0%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K +AY           REGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct: 1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            I QI  A I GDMI+ +AYAHELP+YG++VG TNYAAAYCTG            + + YE
Sbjct: 61   ICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNKFGLDKVYE 120

Query: 809  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G VE TG++Y+VE  +G    F   LD GL RTTTGN+VF            IPHS KRF
Sbjct: 121  GQVEVTGDEYNVESVDGEPGAFTCYLDAGLTRTTTGNKVFGALKGAVDGGLSIPHSTKRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  +SK+ +AEVHRK+I+G ++A YMR LIE++ + Y+  FS YIK G+ AD LE +Y
Sbjct: 181  PGYDSESKEFNAEVHRKHIFGLNIAEYMRLLIEEDEDAYKKQFSQYIKNGVAADQLEDIY 240

Query: 452  KKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERK 339
            KK HA IR +P  +K  K+  K+ KR+N  KL+ E++K
Sbjct: 241  KKAHAGIRENPVHEKKPKKEVKK-KRWNRAKLSLEQKK 277



>gb:AF401557_2491984 Ictalurus punctatus ribosomal protein L5b mRNA,
            complete cds.
          Length = 299

 Score =  277 bits (708), Expect = 4e-73
 Identities = 144/296 (48%), Positives = 189/296 (63%), Gaps = 5/296 (1%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K +AY           REGKTDY AR RL+ QDKNKYNTPKYR +VRF+N+DI
Sbjct: 1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYFARKRLVIQDKNKYNTPKYRMIVRFSNRDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            + QI  A I GD I+ +AY+HELPRYG+ VG TNYAAAYCTG            + + YE
Sbjct: 61   VCQIAYAKIEGDAIVCAAYSHELPRYGVSVGLTNYAAAYCTGLLLARRLLNKFNLDKVYE 120

Query: 809  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G VE TGE+++VE  +G+   F   LD GL RTTTGN+VF            IPHS KRF
Sbjct: 121  GQVEVTGEEFNVESVDGQPGAFTCYLDAGLTRTTTGNKVFGALKGAVDGGLSIPHSTKRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  +SK+   EVHRK+I G +V+ YM +LIE++ + Y+  FS +IK G+  D++E++Y
Sbjct: 181  PGYDSESKEFSGEVHRKHILGLNVSEYMSSLIEEDEDAYKKQFSRFIKNGVTPDSVEEMY 240

Query: 452  KKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISR----LNALNAAA 297
            KK HAAIR +P+ +K  K+  K+ KR+N  KLT  +RK  +  +    L A  AAA
Sbjct: 241  KKAHAAIRENPAHQKKPKKELKKKKRWNRAKLTLGQRKDRVAQKKASFLRAQEAAA 296



>gb:STJLRP_1398153 Styela clava ribosomal protein L5 gene, complete
            cds.
          Length = 295

 Score =  276 bits (705), Expect = 8e-73
 Identities = 142/278 (51%), Positives = 181/278 (65%), Gaps = 1/278 (0%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K +AY           R+GKTDY AR RL+ QDKNKYNTPKYR +VRFTNKDI
Sbjct: 1    MGFVKVVKNKAYFKRYQVKYKRRRQGKTDYFARKRLVVQDKNKYNTPKYRMIVRFTNKDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            + QI  A I GD+++ +AYAHELPRYG++VG TNYAAAYCTG            + E YE
Sbjct: 61   VCQIAYARIEGDVVICAAYAHELPRYGVKVGLTNYAAAYCTGLLLSRRLLNKFGLDEIYE 120

Query: 809  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G  E  G+++ VE  +G+   FRA LDVGL RTTTG +VF           DIPHS KRF
Sbjct: 121  GQTEIDGDEFYVEDVDGKPGAFRAFLDVGLARTTTGAKVFGAMKGAADGGLDIPHSTKRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  +S    AEVHR +I+GGHV+ YM+ L E++ E ++  FS YIK G+ AD +E++Y
Sbjct: 181  PGYDDESGDFSAEVHRSHIFGGHVSNYMKELEEEDEEAFKRQFSQYIKHGVTADTVEEMY 240

Query: 452  KKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERK 339
             K HAAIR DP+ KK      K  KR+N KK+T+ +R+
Sbjct: 241  TKAHAAIREDPTPKKKTDFAGKT-KRWNRKKMTFSQRR 277



>gb:AE016816_1746794 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome III, complete sequence.
          Length = 297

 Score =  275 bits (702), Expect = 2e-72
 Identities = 149/295 (50%), Positives = 189/295 (64%), Gaps = 6/295 (2%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            MAFIK  K  AY           REGKTDY AR RL+ Q K KYNTPKYR VVRFTNKDI
Sbjct: 1    MAFIKSIKNSAYHSRFQTPFRRRREGKTDYYARKRLVTQHKAKYNTPKYRLVVRFTNKDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            I Q+VS++I GD++LA+AY+HELPRYG+  G TN++AAY TG          L + E Y+
Sbjct: 61   ICQVVSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRTLQKLGLDETYK 120

Query: 809  GNVEATGEDYSVEPGE-GRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G  E  GE    E  E G RPF+  LD+GL RTTTG RVF            +PHSE RF
Sbjct: 121  GVEEPEGEYELTEAVEDGPRPFKVYLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  +S++LDA++ R YI+GGHV+AYM  L +D+ E+Y  +F  YI  GI+AD +E +Y
Sbjct: 181  PGWDFESEELDADLLRTYIFGGHVSAYMEELADDDEERYSELFKGYIADGIEADAIEDIY 240

Query: 452  KKVHAAIRADPSAKKSEKQPPKEH-----KRYNLKKLTYEERKASLISRLNALNA 303
             + HAAIRADPS K +EK+  KE      K++   KLT EERKA + +++ AL A
Sbjct: 241  TEAHAAIRADPSFKPTEKKFTKEQYAAESKKFRQVKLTKEERKARVAAKIAALAA 295



>pir|A33823|A33823 ribosomal protein L5a - African clawed
            frog>gb:XELRPL5A_2582216 X.laevis ribosomal protein L5a
            60 S subunit mRNA, complete cds.
          Length = 296

 Score =  275 bits (702), Expect = 2e-72
 Identities = 142/278 (51%), Positives = 181/278 (65%), Gaps = 1/278 (0%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K +AY           REGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct: 1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            I QI  A I GDMI+ +AYAHELP+YG++VG TNYAAAYCTG            + + YE
Sbjct: 61   ICQIAYARIEGDMIVCAAYAHELPKYGIKVGLTNYAAAYCTGLLLARRLLNKFGLDKVYE 120

Query: 809  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G VE TG++Y+VE  +G    F   LD GL RTTTGN+VF            IPHS KRF
Sbjct: 121  GQVEVTGDEYNVESIDGEPGAFTCYLDAGLTRTTTGNKVFGALKGAVDGGLSIPHSTKRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  +SK+ + EVHRK+I+  +VA YMR L+E++ + Y+  FS YIK G+ AD +E LY
Sbjct: 181  PGYDSESKEFNPEVHRKHIFAQNVAEYMRLLMEEDEDAYKKQFSQYIKNGVTADQVEDLY 240

Query: 452  KKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERK 339
            KK HA IR +P  +K  K+  K+ KR+N  KL+ E++K
Sbjct: 241  KKAHAGIRENPVHEKKPKKEVKK-KRWNRAKLSLEQKK 277



>sp|P49405|RL5_CAEEL 60S ribosomal protein L5.>pir|T22631|T22631
            hypothetical protein F54C9.5 - Caenorhabditis
            elegans>gb:CEF54C9_1364420 Caenorhabditis elegans cosmid
            F54C9, complete sequence.
          Length = 293

 Score =  275 bits (702), Expect = 2e-72
 Identities = 139/277 (50%), Positives = 184/277 (66%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M  +KV K +AY           REGKTDY AR RL  QDKNKYNTPKYR +VR TNKD+
Sbjct: 1    MGLVKVIKNKAYFKRYQVKLRRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRITNKDV 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            +AQ+  + I GD+++ASAY+HELPRYGL+VG TNYAAAY TG          + +   Y+
Sbjct: 61   VAQLAYSKIEGDVVVASAYSHELPRYGLKVGLTNYAAAYATGLLLARRHLKTIGLDSTYK 120

Query: 809  GNVEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFA 630
            G+ E TGEDY+VE    R PF+A+LD+GL RTTTG+++F           ++PHSE RF 
Sbjct: 121  GHEELTGEDYNVEEEGDRAPFKAVLDIGLARTTTGSKIFAVMKGVADGGINVPHSESRFF 180

Query: 629  GFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYK 450
            GF ++SK+ +AE HR  I G HVA YM  L E++ ++Y+  FS ++  G++ADNL   Y+
Sbjct: 181  GFDQESKEYNAEAHRDRILGKHVADYMTYLKEEDEDRYKRQFSKFLAAGLNADNLVATYQ 240

Query: 449  KVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERK 339
            KVH+AIRAD  A  + K+  K  KR+  K+LTY+ERK
Sbjct: 241  KVHSAIRAD--ASPAAKKAAKPSKRHTAKRLTYDERK 275



>gb:BC041227_2547863 Xenopus laevis similar to ribosomal protein L5,
            mRNA (cDNA clone MGC:52733 IMAGE:4683875), complete cds.
          Length = 296

 Score =  274 bits (701), Expect = 2e-72
 Identities = 141/278 (50%), Positives = 182/278 (65%), Gaps = 1/278 (0%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K +AY           REGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct: 1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            I QI  A I GDMI+ +AY+HELP+YG++VG TNYA+AYCTG            + + YE
Sbjct: 61   ICQIAYARIEGDMIVCAAYSHELPKYGIKVGLTNYASAYCTGLLLARRLLNKFGLDKVYE 120

Query: 809  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G VE TG++Y+VE  +G    F   LD GL RTTTGN+VF            IPHS KRF
Sbjct: 121  GQVEVTGDEYNVESIDGEPGAFTCYLDAGLTRTTTGNKVFGALKGAVDGGLSIPHSTKRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  +SK+ +AEVHRK+I+  +VA YMR L+E++ + Y+  FS YIK G+ AD +E LY
Sbjct: 181  PGYDSESKEFNAEVHRKHIFAQNVAEYMRLLMEEDEDAYKKQFSQYIKNGVTADQVEDLY 240

Query: 452  KKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERK 339
            KK HA IR +P  +K  K+  K+ KR+N  KL+ E++K
Sbjct: 241  KKAHAGIRENPVHEKKPKKEVKK-KRWNRAKLSLEQKK 277



>pir|B33823|B33823 ribosomal protein L5b - African clawed
            frog>gb:XELPRL5B_2582193 X.laevis ribosomal protein L5b
            60 S subunit mRNA, complete cds.
          Length = 296

 Score =  274 bits (701), Expect = 2e-72
 Identities = 141/278 (50%), Positives = 181/278 (65%), Gaps = 1/278 (0%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K +AY           REGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct: 1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            I QI  A I GDMI+ +AYAHELP+YG++VG TNYAAAYCTG            + + YE
Sbjct: 61   ICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNKFGLDKVYE 120

Query: 809  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G VE TG++Y+VE  +G    F   LD GL RTTTGN+VF            IPHS KRF
Sbjct: 121  GQVEVTGDEYNVESVDGEPGAFTCYLDAGLTRTTTGNKVFGALKGAVDGGLSIPHSTKRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  +SK+ + EVHRK+I+  ++A YMR L+E++ + Y+  FS YIK G+ AD LE +Y
Sbjct: 181  PGYDSESKEFNPEVHRKHIFAQNIAEYMRLLMEEDEDAYKKQFSQYIKNGVAADQLEDIY 240

Query: 452  KKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERK 339
            KK HA IR +P  +K  K+  K+ KR+N  KL+ E++K
Sbjct: 241  KKAHAGIRENPVHEKKPKKEVKK-KRWNRAKLSLEQKK 277



>sp|Q26481|RL5_STYCL 60S ribosomal protein L5.
          Length = 294

 Score =  274 bits (700), Expect = 3e-72
 Identities = 141/276 (51%), Positives = 180/276 (65%), Gaps = 1/276 (0%)
 Frame = -2

Query: 1163 FIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA 984
            F+KV K +AY           R+GKTDY AR RL+ QDKNKYNTPKYR +VRFTNKDI+ 
Sbjct: 2    FVKVVKNKAYFKRYQVKYKRRRQGKTDYFARKRLVVQDKNKYNTPKYRMIVRFTNKDIVC 61

Query: 983  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGN 804
            QI  A I GD+++ +AYAHELPRYG++VG TNYAAAYCTG            + E YEG 
Sbjct: 62   QIAYARIEGDVVICAAYAHELPRYGVKVGLTNYAAAYCTGLLLSRRLLNKFGLDEIYEGQ 121

Query: 803  VEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAG 627
             E  G+++ VE  +G+   FRA LDVGL RTTTG +VF           DIPHS KRF G
Sbjct: 122  TEIDGDEFYVEDVDGKPGAFRAFLDVGLARTTTGAKVFGAMKGAADGGLDIPHSTKRFPG 181

Query: 626  FSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKK 447
            +  +S    AEVHR +I+GGHV+ YM+ L E++ E ++  FS YIK G+ AD +E++Y K
Sbjct: 182  YDDESGDFSAEVHRSHIFGGHVSNYMKELEEEDEEAFKRQFSQYIKHGVTADTVEEMYTK 241

Query: 446  VHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERK 339
             HAAIR DP+ KK      K  KR+N KK+T+ +R+
Sbjct: 242  AHAAIREDPTPKKKTDFAGKT-KRWNRKKMTFSQRR 276



>gb:AF401556_2491983 Ictalurus punctatus ribosomal protein L5a mRNA,
            complete cds.
          Length = 296

 Score =  273 bits (698), Expect = 5e-72
 Identities = 141/278 (50%), Positives = 183/278 (65%), Gaps = 1/278 (0%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K +AY           REGKTDY AR RL+ QDKNKYNTPKYR +VRF+N+DI
Sbjct: 1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYFARKRLVIQDKNKYNTPKYRMIVRFSNRDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            + QI  A I GDMI+ +AY+HELP+YG+ VG TNYAAAYCTG            + + YE
Sbjct: 61   VCQIAYAKIEGDMIVCAAYSHELPKYGVTVGLTNYAAAYCTGLLLARQLLNKFGLDKVYE 120

Query: 809  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G VE TG++++VE  + +   F   LD GL RTTTGN+VF            IPHS KRF
Sbjct: 121  GQVEITGDEFNVESIDDKPSAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  +SK+ +AEVHRK+I G +VA YMR LIE++ E Y+  FS +IK G+  D++E++Y
Sbjct: 181  PGYDSESKEFNAEVHRKHILGLNVAEYMRLLIEEDEEAYKKQFSRFIKNGVTPDSIEEMY 240

Query: 452  KKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERK 339
            KK HAAIR +P  +K  K+  K+ KR+N  KLT  +RK
Sbjct: 241  KKAHAAIRENPVHEKKPKREVKK-KRWNRAKLTLAQRK 277



>sp|P15125|RL5A_XENLA 60S ribosomal protein L5A.
          Length = 295

 Score =  273 bits (697), Expect = 7e-72
 Identities = 141/276 (51%), Positives = 180/276 (65%), Gaps = 1/276 (0%)
 Frame = -2

Query: 1163 FIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA 984
            F+KV K +AY           REGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DII 
Sbjct: 2    FVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIIC 61

Query: 983  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGN 804
            QI  A I GDMI+ +AYAHELP+YG++VG TNYAAAYCTG            + + YEG 
Sbjct: 62   QIAYARIEGDMIVCAAYAHELPKYGIKVGLTNYAAAYCTGLLLARRLLNKFGLDKVYEGQ 121

Query: 803  VEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAG 627
            VE TG++Y+VE  +G    F   LD GL RTTTGN+VF            IPHS KRF G
Sbjct: 122  VEVTGDEYNVESIDGEPGAFTCYLDAGLTRTTTGNKVFGALKGAVDGGLSIPHSTKRFPG 181

Query: 626  FSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKK 447
            +  +SK+ + EVHRK+I+  +VA YMR L+E++ + Y+  FS YIK G+ AD +E LYKK
Sbjct: 182  YDSESKEFNPEVHRKHIFAQNVAEYMRLLMEEDEDAYKKQFSQYIKNGVTADQVEDLYKK 241

Query: 446  VHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERK 339
             HA IR +P  +K  K+  K+ KR+N  KL+ E++K
Sbjct: 242  AHAGIRENPVHEKKPKKEVKK-KRWNRAKLSLEQKK 276



>gb:BC071498_2556235 Danio rerio ribosomal protein L5, mRNA (cDNA
            clone MGC:86854 IMAGE:6902957), complete
            cds.>gb:BC076208_2559080 Danio rerio ribosomal protein
            L5, mRNA (cDNA clone MGC:92728 IMAGE:7075897), complete
            cds.
          Length = 296

 Score =  272 bits (696), Expect = 9e-72
 Identities = 139/278 (50%), Positives = 185/278 (66%), Gaps = 1/278 (0%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K ++Y           REGKTDY AR RL+ QDKNKYNTPKYR +VRF+N+DI
Sbjct: 1    MGFVKVVKNKSYFKRYQVKFRRRREGKTDYFARKRLVIQDKNKYNTPKYRMIVRFSNRDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            + QI  A I GDMI+ +AY+HELP+YG+ VG TNYAAAYCTG            + + Y+
Sbjct: 61   VCQIAYAKIEGDMIVCAAYSHELPKYGISVGLTNYAAAYCTGLLLARRLLNKFGLDKVYD 120

Query: 809  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G VE TG++++VE  +G+   F   LD GL RTTTGN+VF            IPHS KRF
Sbjct: 121  GQVEITGDEFNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  +SK+ +AEVHRK+I G ++A YMR L+E++ E Y+  FS +IK G+ AD++E++Y
Sbjct: 181  PGYDVESKEFNAEVHRKHILGLNIAEYMRLLMEEDEECYKKQFSRFIKNGVTADSMEEMY 240

Query: 452  KKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERK 339
            KK HAAIR +P  +K  K+  K+ KR+N  KLT  +RK
Sbjct: 241  KKAHAAIRENPVHEKKPKREVKK-KRWNRAKLTLAQRK 277



>sp|P15126|RL5B_XENLA 60S ribosomal protein L5B.
          Length = 295

 Score =  272 bits (696), Expect = 9e-72
 Identities = 140/276 (50%), Positives = 180/276 (65%), Gaps = 1/276 (0%)
 Frame = -2

Query: 1163 FIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA 984
            F+KV K +AY           REGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DII 
Sbjct: 2    FVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIIC 61

Query: 983  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGN 804
            QI  A I GDMI+ +AYAHELP+YG++VG TNYAAAYCTG            + + YEG 
Sbjct: 62   QIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNKFGLDKVYEGQ 121

Query: 803  VEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAG 627
            VE TG++Y+VE  +G    F   LD GL RTTTGN+VF            IPHS KRF G
Sbjct: 122  VEVTGDEYNVESVDGEPGAFTCYLDAGLTRTTTGNKVFGALKGAVDGGLSIPHSTKRFPG 181

Query: 626  FSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKK 447
            +  +SK+ + EVHRK+I+  ++A YMR L+E++ + Y+  FS YIK G+ AD LE +YKK
Sbjct: 182  YDSESKEFNPEVHRKHIFAQNIAEYMRLLMEEDEDAYKKQFSQYIKNGVAADQLEDIYKK 241

Query: 446  VHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERK 339
             HA IR +P  +K  K+  K+ KR+N  KL+ E++K
Sbjct: 242  AHAGIRENPVHEKKPKKEVKK-KRWNRAKLSLEQKK 276



>gb:AF113210_1149833 Homo sapiens MSTP030 mRNA, complete
            cds.>gb:AL162740_1922620 Human DNA sequence from clone
            RP4-716F6 on chromosome 1p21.2-22.3 Contains the RPL5
            gene for ribosomal protein L5 and the 3' end of a novel
            gene, possible ortholog of mouse RIKEN cDNA 2900024C23
            gene, complete sequence.
          Length = 297

 Score =  272 bits (695), Expect = 1e-71
 Identities = 141/278 (50%), Positives = 182/278 (65%), Gaps = 1/278 (0%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K +AY           REGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct: 1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            I QI  A I GDMI+ +AYAHELP+YG++VG TNYAAAYCTG            M + YE
Sbjct: 61   ICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYE 120

Query: 809  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G VE TG++Y+VE  +G+   F   LD GL RTTTGN+VF            IPHS KRF
Sbjct: 121  GQVEVTGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  +SK+ +AEVHRK+I G +VA YMR L+E++ + Y+  FS YIK  +  D +E++Y
Sbjct: 181  PGYDSESKEFNAEVHRKHIMGQNVADYMRYLMEEDEDAYKKQFSQYIKNSVTPDMMEEMY 240

Query: 452  KKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERK 339
            KK HAAIR +P  +K  K+  K+ KR+N  K++  ++K
Sbjct: 241  KKAHAAIRENPVYEKKPKKEVKK-KRWNRPKMSLAQKK 277



>sp|O65353|RL5_HELAN 60S ribosomal protein L5.>pir|T12615|T12615
            ribosomal protein L5 - common
            sunflower>gb:AF066077_1765529 Helianthus annuus
            RPL5A-related protein (RPL5A) mRNA, complete cds.
          Length = 297

 Score =  272 bits (695), Expect = 1e-71
 Identities = 147/282 (52%), Positives = 187/282 (66%), Gaps = 2/282 (0%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K + Y           REGKTDY AR RLI QDKNKYNTPKYR VVRF+N+DI
Sbjct: 1    MGFVKVVKNKQYFKRYQVKFKRRREGKTDYFARKRLIAQDKNKYNTPKYRLVVRFSNRDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
              Q+  + I GD IL +AYAHELP+YG++VG TNYAAAYCTG          L + + Y 
Sbjct: 61   TCQVAYSRIEGDKILCAAYAHELPQYGVKVGLTNYAAAYCTGLLLARKLLSQLGLDKLYI 120

Query: 809  GNVEATGEDYSVEPGE-GRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G+ E TGE+++V+P E G   FR  LDVGL+RTTTG RVF           +I HS KRF
Sbjct: 121  GSTEVTGEEFNVKPVEDGPGAFRCYLDVGLMRTTTGARVFGAMKGAVDGGLNILHSTKRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             GF  +SK+ +A+VHR++I+G HVA YMR L E++ E Y+  FS YIK G++AD +E LY
Sbjct: 181  PGFDSESKEFNADVHRQHIFGQHVAEYMRQLAEEDDEAYKRQFSQYIKLGLNADAIEGLY 240

Query: 452  KKVHAAIRADPSAKK-SEKQPPKEHKRYNLKKLTYEERKASL 330
            KK H AIRA+P+ K  ++K  PK  KR+  KKLT E+R+  +
Sbjct: 241  KKAHEAIRANPARKTVAKKAHPK--KRWTEKKLTREQRQGKV 280



>sp|O76190|RL5_BOMMO 60S ribosomal protein L5.>gb:AF008229_1231461
            Bombyx mori ribosomal protein L5 (L5) mRNA, complete cds.
          Length = 299

 Score =  272 bits (695), Expect = 1e-71
 Identities = 147/295 (49%), Positives = 187/295 (63%), Gaps = 9/295 (3%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K + Y           REGKTDY AR RL+ QDKNKYNTPKYR +VR +NKD+
Sbjct: 1    MGFVKVVKNKQYFKRYQVKFKRRREGKTDYYARKRLVVQDKNKYNTPKYRLIVRLSNKDV 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
              Q+  + I GD I+ +AY+HELPRYG++VG TNYAAAY TG          L +   Y 
Sbjct: 61   TCQVAYSRIEGDHIVCAAYSHELPRYGVKVGLTNYAAAYSTGLLLARRLLQRLGLDTLYT 120

Query: 809  GNVEATGEDYSVEPGE-GRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G  + TG++Y+VEP + G   FR  LDVGL RTTTG RVF           ++PHS KRF
Sbjct: 121  GTTDVTGDEYNVEPVDNGPGAFRCYLDVGLARTTTGRRVFGAMKGAVDGGLNVPHSIKRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  +SK+ +AEVHR +I+G HVA YMR+L +D+ + ++  FS YIK G+ AD +E +Y
Sbjct: 181  PGYDAESKKFNAEVHRAHIFGLHVAEYMRSLEQDDEDSFKRQFSKYIKLGVTADAIEAIY 240

Query: 452  KKVHAAIRADPSAKKSE-KQPPKEHKRYNLKKLTYEER-------KASLISRLNA 312
            KK H AIRADPS KK E K+   + KR+N +KLT  ER       KAS I RL A
Sbjct: 241  KKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQA 295



>gb:AY769272_1350423 Bombyx mori ribosomal protein L5 (RpL5) mRNA,
            complete cds.
          Length = 299

 Score =  271 bits (693), Expect = 2e-71
 Identities = 147/295 (49%), Positives = 187/295 (63%), Gaps = 9/295 (3%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K + Y           REGKTDY AR RL+ QDKNKYNTPKYR +VR +NKD+
Sbjct: 1    MGFVKVVKNKQYFKRYQVKFKRRREGKTDYYARKRLVVQDKNKYNTPKYRLIVRLSNKDV 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
              Q+  + I GD I+ +AY+HELPRYG++VG TNYAAAY TG          L +   Y 
Sbjct: 61   TCQVAYSRIEGDHIVCAAYSHELPRYGVKVGLTNYAAAYSTGLLLARRLLQRLGLDTLYT 120

Query: 809  GNVEATGEDYSVEPGE-GRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G  + TG++Y+VEP + G   FR  LDVGL RTTTG RVF           ++PHS KRF
Sbjct: 121  GTTDVTGDEYNVEPVDNGPGAFRCYLDVGLARTTTGARVFGAMKGAVDGGLNVPHSIKRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  +SK+ +AEVHR +I+G HVA YMR+L +D+ + ++  FS YIK G+ AD +E +Y
Sbjct: 181  PGYDAESKKFNAEVHRAHIFGLHVAEYMRSLEQDDEDSFKRQFSKYIKLGVTADAIEAIY 240

Query: 452  KKVHAAIRADPSAKKSE-KQPPKEHKRYNLKKLTYEER-------KASLISRLNA 312
            KK H AIRADPS KK E K+   + KR+N +KLT  ER       KAS I RL A
Sbjct: 241  KKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQA 295



>gb:AY071305_1295389 Drosophila melanogaster RE33114 full length cDNA.
          Length = 299

 Score =  271 bits (693), Expect = 2e-71
 Identities = 144/282 (51%), Positives = 181/282 (64%), Gaps = 2/282 (0%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K + Y           REGKTDY AR RL  QDKNKYNTPKYR +VR +NKDI
Sbjct: 1    MGFVKVVKNKQYFKRYQVKFRRRREGKTDYYARKRLTFQDKNKYNTPKYRLIVRLSNKDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
              QI  A I GD ++ +AY+HELP+YG++VG TNYAAAYCTG          L +   Y 
Sbjct: 61   TVQIAYARIEGDRVVCAAYSHELPKYGIQVGLTNYAAAYCTGLLVARRVLNKLGLDSLYA 120

Query: 809  GNVEATGEDYSVEP-GEGRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G  E TGE+++VEP  +G   FR  LDVGL RTTTG RVF           +IPHS KRF
Sbjct: 121  GCTEVTGEEFNVEPVDDGPGAFRCFLDVGLARTTTGARVFGAMKGAVDGGLNIPHSVKRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+S ++K  +A+VHR +I+G HVA YMR+L E++ E ++  FS YIK GI AD+LE +Y
Sbjct: 181  PGYSAETKSFNADVHRAHIFGQHVADYMRSLEEEDEESFKRQFSRYIKLGIRADDLEDIY 240

Query: 452  KKVHAAIRADPSAK-KSEKQPPKEHKRYNLKKLTYEERKASL 330
            KK H AIR DP+ K  ++K      KR+N KKLT E+RK  +
Sbjct: 241  KKAHQAIRNDPTHKVTAKKSSAVTKKRWNAKKLTNEQRKTKI 282



>pir|JC1308|JC1308 ribosomal protein L5 - chicken>gb:CHKRPL5G_2569523
            Chiken ribosomal protein L5 gene, complete
            cds.>gb:GDRPL5_2572596 Chicken mRNA for ribosomal protein
            L5.
          Length = 297

 Score =  271 bits (693), Expect = 2e-71
 Identities = 141/278 (50%), Positives = 181/278 (65%), Gaps = 1/278 (0%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K +AY           REGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct: 1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            I QI  A I GDMI+ +AYAHELP+YG++VG TNYAAAYCTG            + + YE
Sbjct: 61   ICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNKFGLDKIYE 120

Query: 809  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G VE TG++Y+VE  +G+   F   LD GL RTTTGN+VF            IPHS KRF
Sbjct: 121  GQVEVTGDEYNVESVDGKPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  +SK+ +AEVHRK+I G +VA YMR L+E++ + Y+  FS YIK  I  D +E++Y
Sbjct: 181  PGYDSESKEFNAEVHRKHIMGQNVADYMRYLMEEDEDAYKKQFSQYIKNNITPDGMEEMY 240

Query: 452  KKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERK 339
            KK HAAIR +P  +K  K+  K+ KR N  K++  ++K
Sbjct: 241  KKAHAAIRDNPVHEKKPKREVKK-KRVNSTKMSLAQKK 277



>gb:BC059751_2552696 Xenopus tropicalis hypothetical protein MGC75757,
            mRNA (cDNA clone MGC:75757 IMAGE:5381602), complete cds.
          Length = 296

 Score =  270 bits (690), Expect = 4e-71
 Identities = 139/278 (50%), Positives = 180/278 (64%), Gaps = 1/278 (0%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K +AY           REGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct: 1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            I QI  A I GDMI+ +AYAHEL +YG++VG TNYAAAYCTG            + + YE
Sbjct: 61   ICQIAYARIEGDMIVCAAYAHELTKYGVKVGLTNYAAAYCTGLLLARRLLNKFGLDKVYE 120

Query: 809  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G VE TG++Y+VE  +G    F   LD GL RTTTGN+VF            IPHS KRF
Sbjct: 121  GQVEVTGDEYNVESIDGEPGAFTCYLDAGLTRTTTGNKVFGALKGAVDGGLSIPHSTKRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  +SK+ +AEVHRK+I+G ++A YMR L E++ + ++  FS YIK G+ AD +E +Y
Sbjct: 181  PGYDSESKEFNAEVHRKHIFGQNIAEYMRLLTEEDEDAFKKQFSQYIKNGVTADQMEDIY 240

Query: 452  KKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERK 339
            KK HA IR +P  +K  K+  K+ KR+N  KL+  ++K
Sbjct: 241  KKAHAGIRENPVHEKKPKKEVKK-KRWNRAKLSLAQKK 277



>gb:AY737527_1348921 Toxoptera citricida putative ribosomal protein L5
            mRNA, complete cds.
          Length = 300

 Score =  270 bits (690), Expect = 4e-71
 Identities = 144/283 (50%), Positives = 181/283 (63%), Gaps = 2/283 (0%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K + Y           REGKTDY AR RLI QDKNKY+TPKYR +VRF+N+DI
Sbjct: 1    MGFVKVVKNKQYFKRYQVKFKRRREGKTDYYARKRLIVQDKNKYDTPKYRLIVRFSNRDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
              Q+  + I GD I+ +AY+HELP+YG++VG TNYAAAYCTG          L +   YE
Sbjct: 61   TCQVAHSRIEGDKIVCAAYSHELPKYGVKVGLTNYAAAYCTGLLVARRLLKKLGLDRLYE 120

Query: 809  GNVEATGEDYSVEPG-EGRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G  EA GE+Y VEP  EG   FR  LDVGL++T+TG RVF           +IPHS KRF
Sbjct: 121  GLKEANGEEYYVEPADEGPNAFRCNLDVGLMKTSTGARVFGAMKGAVDGGFNIPHSVKRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  ++K+  AE HRK+I G HVA YMR L E++ + +   FS YIK GI AD+LE +Y
Sbjct: 181  PGYDAEAKEYSAETHRKHILGLHVAEYMRKLEEEDEDAFNRQFSQYIKLGIVADDLENMY 240

Query: 452  KKVHAAIRADPSA-KKSEKQPPKEHKRYNLKKLTYEERKASLI 327
            KK H  IR+DP   +K +K   KE KR+N KKLT  ERK  ++
Sbjct: 241  KKAHENIRSDPKRDRKPKKDVSKEPKRWNAKKLTNAERKQRVV 283



>pir|S55912|S55912 ribosomal protein L5, cytosolic -
            human>gb:HSU14966_2022404 Human ribosomal protein L5
            mRNA, complete cds.
          Length = 297

 Score =  270 bits (690), Expect = 4e-71
 Identities = 140/278 (50%), Positives = 181/278 (65%), Gaps = 1/278 (0%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K +AY           REGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct: 1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            I QI  A I GDMI+ + YAHELP+YG++VG TNYAAAYCTG            M + YE
Sbjct: 61   ICQIAYARIEGDMIVCARYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYE 120

Query: 809  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G VE TG++Y+VE  +G+   F   LD GL RTTTGN+VF            IPHS KRF
Sbjct: 121  GQVEVTGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  +SK+ +AEVHRK+I G +VA YMR L+E++ + Y+  FS YIK  +  D +E++Y
Sbjct: 181  PGYDSESKEFNAEVHRKHIMGQNVADYMRYLMEEDEDAYKKQFSQYIKNSVTPDMMEEMY 240

Query: 452  KKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERK 339
            KK HAAIR +P  +K  K+  K+ KR+N  K++  ++K
Sbjct: 241  KKAHAAIRENPVYEKKPKKEVKK-KRWNRPKMSLAQKK 277



>pir|S00111|R5RTL5 ribosomal protein L5, cytosolic [validated] -
            rat>gb:BC060561_2104048 Rattus norvegicus ribosomal
            protein L5, mRNA (cDNA clone MGC:72798 IMAGE:6918805),
            complete cds.>gb:RNRPL5_2136378 Rat mRNA for ribosomal
            protein L5.
          Length = 297

 Score =  270 bits (690), Expect = 4e-71
 Identities = 140/278 (50%), Positives = 181/278 (65%), Gaps = 1/278 (0%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K +AY           REGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct: 1    MGFVKVVKNKAYFKRYQVRFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            I QI  A I GDMI+ +AYAHELP+YG++VG TNYAAAYCTG            M + YE
Sbjct: 61   ICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYE 120

Query: 809  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G VE  G++Y+VE  +G+   F   LD GL RTTTGN+VF            IPHS KRF
Sbjct: 121  GQVEVNGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  +SK+ +AEVHRK+I G +VA YMR L+E++ + Y+  FS YIK  +  D +E++Y
Sbjct: 181  PGYDSESKEFNAEVHRKHIMGQNVADYMRYLMEEDEDAYKKQFSQYIKNNVTPDMMEEMY 240

Query: 452  KKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERK 339
            KK HAAIR +P  +K  K+  K+ KR+N  K++  ++K
Sbjct: 241  KKAHAAIRENPVYEKKPKREVKK-KRWNRPKMSLAQKK 277



>sp|P22451|RL5_CHICK 60S ribosomal protein L5.
          Length = 296

 Score =  269 bits (688), Expect = 8e-71
 Identities = 140/276 (50%), Positives = 180/276 (65%), Gaps = 1/276 (0%)
 Frame = -2

Query: 1163 FIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA 984
            F+KV K +AY           REGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DII 
Sbjct: 2    FVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIIC 61

Query: 983  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGN 804
            QI  A I GDMI+ +AYAHELP+YG++VG TNYAAAYCTG            + + YEG 
Sbjct: 62   QIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNKFGLDKIYEGQ 121

Query: 803  VEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAG 627
            VE TG++Y+VE  +G+   F   LD GL RTTTGN+VF            IPHS KRF G
Sbjct: 122  VEVTGDEYNVESVDGKPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPG 181

Query: 626  FSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKK 447
            +  +SK+ +AEVHRK+I G +VA YMR L+E++ + Y+  FS YIK  I  D +E++YKK
Sbjct: 182  YDSESKEFNAEVHRKHIMGQNVADYMRYLMEEDEDAYKKQFSQYIKNNITPDGMEEMYKK 241

Query: 446  VHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERK 339
             HAAIR +P  +K  K+  K+ KR N  K++  ++K
Sbjct: 242  AHAAIRDNPVHEKKPKREVKK-KRVNSTKMSLAQKK 276



>gb:CR382124_1656633 Kluyveromyces lactis strain NRRL Y-1140
            chromosome D of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 297

 Score =  268 bits (686), Expect = 1e-70
 Identities = 146/293 (49%), Positives = 186/293 (63%), Gaps = 6/293 (2%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            MAFIK  KT AY           REGKTDY AR RL+ Q K KYNTPKYR VVRFTNKDI
Sbjct: 1    MAFIKDIKTSAYHSRYQTPFRRRREGKTDYYARKRLVAQHKAKYNTPKYRLVVRFTNKDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            I QIVS++I GD++LA+AY+HELPRYG+  G TN++AAY TG          L + E Y 
Sbjct: 61   ITQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATGLLLARRTLQKLGLDETYP 120

Query: 809  GNVEATGEDYSVEPGE-GRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G  E  GE    E  E G RPF+  LDVGL RTTTG R+F            +PHSE RF
Sbjct: 121  GVEEVEGEYELTEAVEDGPRPFKVYLDVGLQRTTTGARIFGALKGASDGGLYVPHSENRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  ++++LDA++ R YI+GGHV+ YM  L +D+ E+Y+ +F  Y+   IDAD +E +Y
Sbjct: 181  PGWDFEAEELDADLLRTYIFGGHVSQYMEELADDDEERYRELFKGYLADDIDADAVEDIY 240

Query: 452  KKVHAAIRADPSAKKSEKQPPKEH-----KRYNLKKLTYEERKASLISRLNAL 309
               HAAIR DP+ K +EK+  KE      K+Y   KLT EERKA + ++++AL
Sbjct: 241  ADAHAAIREDPAFKPTEKKFTKEQYAAESKKYRQVKLTREERKARVAAKISAL 293



>gb:AK008489_1154607 Mus musculus adult male small intestine cDNA,
            RIKEN full-length enriched library, clone:2010300E13
            product:ribosomal protein L5, full insert
            sequence.>gb:AK013107_1157328 Mus musculus 10, 11 days
            embryo whole body cDNA, RIKEN full-length enriched
            library, clone:2810417J10 product:ribosomal protein L5,
            full insert sequence.>gb:BC026934_2095639 Mus musculus
            ribosomal protein L5, mRNA (cDNA clone MGC:25420
            IMAGE:2651564), complete cds.>gb:BC083318_2108586 Mus
            musculus ribosomal protein L5, mRNA (cDNA clone
            MGC:101934 IMAGE:6818756), complete
            cds.>gb:BC082119_2562479 Xenopus laevis MGC97997 protein,
            mRNA (cDNA clone MGC:97997 IMAGE:7198548), complete cds.
          Length = 297

 Score =  268 bits (686), Expect = 1e-70
 Identities = 140/278 (50%), Positives = 180/278 (64%), Gaps = 1/278 (0%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K +AY           REGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct: 1    MGFVKVVKNKAYFKRYQVRFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            I QI  A I GDMI+ +AYAHELP+YG++VG TNYAAAYCTG            M + YE
Sbjct: 61   ICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYE 120

Query: 809  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G VE  G +Y+VE  +G+   F   LD GL RTTTGN+VF            IPHS KRF
Sbjct: 121  GQVEVNGGEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  +SK+ +AEVHRK+I G +VA YMR L+E++ + Y+  FS YIK  +  D +E++Y
Sbjct: 181  PGYDSESKEFNAEVHRKHIMGQNVADYMRYLMEEDEDAYKKQFSQYIKNNVTPDMMEEMY 240

Query: 452  KKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERK 339
            KK HAAIR +P  +K  K+  K+ KR+N  K++  ++K
Sbjct: 241  KKAHAAIRENPVYEKKPKREVKK-KRWNRPKMSLAQKK 277



>sp|P09895|RL5_RAT 60S ribosomal protein L5.
          Length = 296

 Score =  268 bits (685), Expect = 2e-70
 Identities = 139/276 (50%), Positives = 180/276 (65%), Gaps = 1/276 (0%)
 Frame = -2

Query: 1163 FIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA 984
            F+KV K +AY           REGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DII 
Sbjct: 2    FVKVVKNKAYFKRYQVRFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIIC 61

Query: 983  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGN 804
            QI  A I GDMI+ +AYAHELP+YG++VG TNYAAAYCTG            M + YEG 
Sbjct: 62   QIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYEGQ 121

Query: 803  VEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAG 627
            VE  G++Y+VE  +G+   F   LD GL RTTTGN+VF            IPHS KRF G
Sbjct: 122  VEVNGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPG 181

Query: 626  FSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKK 447
            +  +SK+ +AEVHRK+I G +VA YMR L+E++ + Y+  FS YIK  +  D +E++YKK
Sbjct: 182  YDSESKEFNAEVHRKHIMGQNVADYMRYLMEEDEDAYKKQFSQYIKNNVTPDMMEEMYKK 241

Query: 446  VHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERK 339
             HAAIR +P  +K  K+  K+ KR+N  K++  ++K
Sbjct: 242  AHAAIRENPVYEKKPKREVKK-KRWNRPKMSLAQKK 276



>sp|P46777|RL5_HUMAN 60S ribosomal protein L5.
          Length = 296

 Score =  268 bits (685), Expect = 2e-70
 Identities = 139/276 (50%), Positives = 180/276 (65%), Gaps = 1/276 (0%)
 Frame = -2

Query: 1163 FIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA 984
            F+KV K +AY           REGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DII 
Sbjct: 2    FVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIIC 61

Query: 983  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGN 804
            QI  A I GDMI+ + YAHELP+YG++VG TNYAAAYCTG            M + YEG 
Sbjct: 62   QIAYARIEGDMIVCARYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYEGQ 121

Query: 803  VEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAG 627
            VE TG++Y+VE  +G+   F   LD GL RTTTGN+VF            IPHS KRF G
Sbjct: 122  VEVTGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPG 181

Query: 626  FSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKK 447
            +  +SK+ +AEVHRK+I G +VA YMR L+E++ + Y+  FS YIK  +  D +E++YKK
Sbjct: 182  YDSESKEFNAEVHRKHIMGQNVADYMRYLMEEDEDAYKKQFSQYIKNSVTPDMMEEMYKK 241

Query: 446  VHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERK 339
             HAAIR +P  +K  K+  K+ KR+N  K++  ++K
Sbjct: 242  AHAAIRENPVYEKKPKKEVKK-KRWNRPKMSLAQKK 276



>sp|O22608|RL5_DUNSA 60S ribosomal protein L5.>pir|T08009|T08009
            probable ribosomal protein L5 - green alga (Dunaliella
            salina)>gb:AF028833_1762369 Dunaliella salina 60S
            ribosomal protein (DSRP1) mRNA, complete cds.
          Length = 271

 Score =  268 bits (685), Expect = 2e-70
 Identities = 136/268 (50%), Positives = 180/268 (67%), Gaps = 1/268 (0%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M ++KV KT  Y           R+GKTDYRAR RL+ QDKNKYNT KYR VVRF+NK++
Sbjct: 1    MGYVKVVKTSPYFSRYQVKYRRRRQGKTDYRARLRLVRQDKNKYNTHKYRLVVRFSNKNV 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
              QIV ++I GD+++A+AY+ ELP YGL+VG TNY+AAYC G          L +A+ Y+
Sbjct: 61   TCQIVYSTIQGDVVMAAAYSKELPNYGLKVGLTNYSAAYCVGLLVARRILTKLNLADTYK 120

Query: 809  GNVEATGEDYSVEPGE-GRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G  E  GEDY+VEP E G +PF  LLD GL RT+TG++VF           DIPH+EKRF
Sbjct: 121  GQEEPDGEDYNVEPVEDGPKPFYCLLDTGLKRTSTGSKVFAAMKGALDGGLDIPHNEKRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G++   K+LD EV +KYIYGGHVA Y   + E+EPEKYQ+ FS+Y++  I+ D +E +Y
Sbjct: 181  VGYA--DKKLDTEVLQKYIYGGHVAEYQETMQEEEPEKYQAHFSSYVENEIEPDGIEDMY 238

Query: 452  KKVHAAIRADPSAKKSEKQPPKEHKRYN 369
            K+VHA IR +P   K E+  P + KR++
Sbjct: 239  KEVHAKIRENPCPPKKERTKPADAKRWS 266



>gb:AY130399_1302451 Branchiostoma lanceolatum ribosomal protein L5
            mRNA, partial cds.
          Length = 271

 Score =  268 bits (684), Expect = 2e-70
 Identities = 138/254 (54%), Positives = 174/254 (68%), Gaps = 1/254 (0%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            EG TDY AR RL+ Q+KNKYNTPKYR +VRFTNKDII Q+  A I GD+I+++AYAHELP
Sbjct: 15   EGVTDYYARKRLVIQEKNKYNTPKYRLIVRFTNKDIICQVAYARIEGDIIVSAAYAHELP 74

Query: 917  RYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGR-RPFRA 741
            RYG++VG TNYAAAYCTG            +   YEG  E  G++Y+VE  +G+ RPFR 
Sbjct: 75   RYGIKVGLTNYAAAYCTGLLLARRILKKFSLDTIYEGCTEIDGDEYNVEEVDGQPRPFRC 134

Query: 740  LLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHV 561
             LDVGL+RT+TG RVF           DIPHS KRF G+  +SK  +AEVHR +I+G HV
Sbjct: 135  FLDVGLVRTSTGARVFGAMKGAVDGGLDIPHSTKRFPGYDAESKDFNAEVHRGHIFGQHV 194

Query: 560  AAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEH 381
            A YMR L E++ E Y+S F +YIK GI AD++E++Y K HAAIR DP  K  +K+     
Sbjct: 195  AEYMRKLEEEDEEAYKSQFGSYIKLGITADSVEEMYTKAHAAIREDPEHKPKDKKEVTV- 253

Query: 380  KRYNLKKLTYEERK 339
            KR+N  KL+  +RK
Sbjct: 254  KRWNRAKLSLAQRK 267



>sp|O59953|RL5_NEUCR 60S ribosomal protein L5
            (CPR4).>gb:NCB7H23_1690188 Neurospora crassa DNA linkage
            group V BAC contig B7H23.>gb:AF054907_1764563 Neurospora
            crassa putative 5S rRNA binding ribosomal protein (crp-4)
            gene, complete cds.
          Length = 301

 Score =  267 bits (682), Expect = 4e-70
 Identities = 150/301 (49%), Positives = 185/301 (61%), Gaps = 12/301 (3%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            MAF K+ K  AY           REGKTDY AR RLI Q KNKYN PKYR VVRFTN+DI
Sbjct: 1    MAFHKLVKNSAYYSRFQTKYKRRREGKTDYYARKRLITQAKNKYNAPKYRLVVRFTNRDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            I QIVS+ I GD + ASAY+HEL  YG+E G TN+AAAY TG          L + E ++
Sbjct: 61   ILQIVSSEITGDKVFASAYSHELKAYGIEHGLTNWAAAYATGLLLARRVLKKLGLDETFK 120

Query: 809  GNVEATGEDYSVEPGEG----RRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSE 642
            G  EA GE    E  E     RRPF+A LDVGL RT+TG RVF            IPHSE
Sbjct: 121  GVEEADGEYKLTEAAETDDGERRPFKAFLDVGLARTSTGARVFGAMKGASDGGIFIPHSE 180

Query: 641  KRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLE 462
             RF G+  +S++LDAE  +KYI+GGHVA YM  L +D+ E+Y+S F+ YI+  ++AD LE
Sbjct: 181  NRFPGYDMESEELDAETLKKYIFGGHVAEYMETLADDDEERYKSQFNRYIEDDLEADGLE 240

Query: 461  QLYKKVHAAIRADPSAKKSEKQPPKEHK--------RYNLKKLTYEERKASLISRLNALN 306
             LY + HAAIR DP  KK+E + PK+ K        +Y   KLT E+R A +  R+ AL 
Sbjct: 241  DLYAEAHAAIREDP-FKKAESEAPKKTKEEWKAESLKYKKSKLTREQRAAGVQERIAALR 299

Query: 305  A 303
            +
Sbjct: 300  S 300



>gb:CR380959_1653766 Candida glabrata strain CBS138 chromosome M
            complete sequence.
          Length = 297

 Score =  266 bits (681), Expect = 5e-70
 Identities = 144/293 (49%), Positives = 184/293 (62%), Gaps = 6/293 (2%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M FI+  KT AY           REGKTDY  R RL+ Q K KYN+PKYR VVRFTNKDI
Sbjct: 1    MVFIQNLKTSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            I QIVS++I GD++LA+AY+HELPRYG+  G TN+AAAY TG          L + E Y+
Sbjct: 61   ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRALQKLGLDETYK 120

Query: 809  GNVEATGEDYSVEPGE-GRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G  E  GE    E  E G RPF+  LD+GL RTTTG RVF            +PHSE RF
Sbjct: 121  GVEEVEGEYELTEAVEDGPRPFKVYLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  ++++LDAE+ R YI+GGHV+ YM  L +D+ E++  +F  Y+   IDAD++E +Y
Sbjct: 181  PGWDFEAEELDAELLRSYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSIEDIY 240

Query: 452  KKVHAAIRADPSAKKSEKQPPKEH-----KRYNLKKLTYEERKASLISRLNAL 309
               H AIRADPS K +EK+  KE      K+Y  KKLT EER A + +++ AL
Sbjct: 241  ASAHEAIRADPSFKPTEKKFTKEQYAAESKKYKAKKLTKEERDARVAAKIAAL 293



>sp|P47962|RL5_MOUSE 60S ribosomal protein L5.
          Length = 296

 Score =  266 bits (681), Expect = 5e-70
 Identities = 139/276 (50%), Positives = 179/276 (64%), Gaps = 1/276 (0%)
 Frame = -2

Query: 1163 FIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA 984
            F+KV K +AY           REGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DII 
Sbjct: 2    FVKVVKNKAYFKRYQVRFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIIC 61

Query: 983  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGN 804
            QI  A I GDMI+ +AYAHELP+YG++VG TNYAAAYCTG            M + YEG 
Sbjct: 62   QIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYEGQ 121

Query: 803  VEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAG 627
            VE  G +Y+VE  +G+   F   LD GL RTTTGN+VF            IPHS KRF G
Sbjct: 122  VEVNGGEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPG 181

Query: 626  FSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKK 447
            +  +SK+ +AEVHRK+I G +VA YMR L+E++ + Y+  FS YIK  +  D +E++YKK
Sbjct: 182  YDSESKEFNAEVHRKHIMGQNVADYMRYLMEEDEDAYKKQFSQYIKNNVTPDMMEEMYKK 241

Query: 446  VHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERK 339
             HAAIR +P  +K  K+  K+ KR+N  K++  ++K
Sbjct: 242  AHAAIRENPVYEKKPKREVKK-KRWNRPKMSLAQKK 276



>gb:RATRPL5_2133768 Rat ribosomal protein L5 mRNA, complete cds.
          Length = 296

 Score =  266 bits (680), Expect = 6e-70
 Identities = 140/278 (50%), Positives = 181/278 (65%), Gaps = 1/278 (0%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K +AY           REGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct: 1    MGFVKVVKNKAYFKRYQVRFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            I QI  A I GDMI+ +AYAHELP+YG++VG TNYAAAYCTG            M + YE
Sbjct: 61   ICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYE 120

Query: 809  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G VE  G++Y+VE  +G+   F   LD GL RTTTGN+VF            IPHS KRF
Sbjct: 121  GQVEVNGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  +SK+ +AEVHRK+I G +VA YMR L+E++ + Y+  FS YIK  +  D +E++Y
Sbjct: 181  PGYDSESKEFNAEVHRKHIMGQNVADYMRYLMEEDEDAYKKQFSQYIKNNVTPD-MEEMY 239

Query: 452  KKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERK 339
            KK HAAIR +P  +K  K+  K+ KR+N  K++  ++K
Sbjct: 240  KKAHAAIRENPVYEKKPKREVKK-KRWNRPKMSLAQKK 276



>gb:AF526222_1279318 Argopecten irradians isolate
            iolsaicl209ct241cn258 ribosomal protein L5 mRNA, partial
            cds.
          Length = 269

 Score =  264 bits (675), Expect = 2e-69
 Identities = 138/269 (51%), Positives = 177/269 (65%), Gaps = 2/269 (0%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K +AY           REGKTD+ AR RL+ Q+KNKYNTPKYR +VRFTNKDI
Sbjct: 1    MGFVKVVKNKAYFKRFQVKFRRRREGKTDFYARKRLVIQEKNKYNTPKYRLIVRFTNKDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            I QI  A I GD I+ SAYAHELPRYG++VG TNY+AAYCTG           ++   Y 
Sbjct: 61   ICQIAYARIEGDHIICSAYAHELPRYGVKVGLTNYSAAYCTGLLLARRLLKQFKLDSVYA 120

Query: 809  GNVEATGEDYSVEPGEGRR-PFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G  E  G++Y VE  +G    FR  LD GL+RT+TG RVF           DIPHS KRF
Sbjct: 121  GQEEVDGDEYYVEDVDGEAGAFRCYLDAGLVRTSTGARVFGALKGAVDGGLDIPHSTKRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  +S + +AEVHR +I+G HVA YM +L E++ E Y+  FS +IK G++++NLE++Y
Sbjct: 181  PGYDGESNEFNAEVHRNHIFGKHVAGYMAHLQEEDEEAYKRQFSRFIKNGLNSENLEEMY 240

Query: 452  KKVHAAIRADPS-AKKSEKQPPKEHKRYN 369
            KK HAAIRA+P  A K++K P  + KR+N
Sbjct: 241  KKGHAAIRANPERATKTKKAPAGKVKRWN 269



>gb:CGI563456_1372107 Crassostrea gigas partial mRNA for ribosomal
            protein L5 (rpl5 gene).
          Length = 267

 Score =  262 bits (670), Expect = 9e-69
 Identities = 138/267 (51%), Positives = 175/267 (65%), Gaps = 1/267 (0%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K +AY           REGKTD+ AR RL+ Q+KNKYNTPKYR +VRFTNKDI
Sbjct: 1    MGFVKVVKNKAYFKRFQVKFRRRREGKTDFFARKRLVIQEKNKYNTPKYRMIVRFTNKDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            I QI  A I GD+I+ +AY+HELPRYG++VG TNYAAAYCTG          L++ + YE
Sbjct: 61   ICQIAYARIEGDIIICAAYSHELPRYGVKVGLTNYAAAYCTGLLLARRLLQKLKLDDIYE 120

Query: 809  GNVEATGEDYSVEP-GEGRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G  E  GE ++VE   E    FR  LDVGL+RTTTG RVF           DIPHS KRF
Sbjct: 121  GQKEVDGEQFNVEDVDEKPGAFRCYLDVGLVRTTTGARVFGAMKGAADGGLDIPHSTKRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  ++ +  AEVHR +I+G HVA YMR+L +++ + ++  FS +IK  I ADNLE +Y
Sbjct: 181  PGYDSENGEFSAEVHRNHIFGQHVANYMRSLQDEDEDAFKKQFSQFIKNKITADNLEAMY 240

Query: 452  KKVHAAIRADPSAKKSEKQPPKEHKRY 372
            KK HAAIRADPS K  + +   + KR+
Sbjct: 241  KKCHAAIRADPSPKAKKDKKDVKVKRW 267



>gb:AY389937_2531430 Latimeria chalumnae ribosomal protein L5 mRNA,
            partial cds.
          Length = 271

 Score =  262 bits (669), Expect = 1e-68
 Identities = 137/256 (53%), Positives = 171/256 (66%), Gaps = 3/256 (1%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            EGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DII QI  A I GDMI+ +AY+HELP
Sbjct: 15   EGKTDYFARKRLVIQDKNKYNTPKYRMIVRITNRDIICQIAYARIEGDMIVCAAYSHELP 74

Query: 917  RYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGR-RPFRA 741
            +YG++VG TNYAAAYCTG            + + YEG VE TG++Y+VE  +G+   F  
Sbjct: 75   KYGVKVGLTNYAAAYCTGLLLARRLLNKFGLDKVYEGQVEVTGDEYNVESIDGQPSAFTC 134

Query: 740  LLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHV 561
             LD GL RTTTGN+VF            IPHS KRF G+  +SK+ +AEVHRK+I G +V
Sbjct: 135  YLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMGQNV 194

Query: 560  AAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKE- 384
            A YMR L+ED+ + Y+  FS YIK GI  D +E  YK+ HAAIR +P     EK+P KE 
Sbjct: 195  ADYMRYLMEDDEDAYKKQFSQYIKNGIAPDMMEDTYKRAHAAIRENP---VHEKKPEKEV 251

Query: 383  -HKRYNLKKLTYEERK 339
              KR+N  KL+  +RK
Sbjct: 252  KKKRWNRPKLSLAQRK 267



>gb:BC049035_2550106 Danio rerio zgc:77176, mRNA (cDNA clone MGC:56511
            IMAGE:5913721), complete cds.>gb:BC065687_2554132 Danio
            rerio zgc:77176, mRNA (cDNA clone MGC:77176
            IMAGE:6961703), complete cds.
          Length = 297

 Score =  261 bits (668), Expect = 2e-68
 Identities = 137/296 (46%), Positives = 188/296 (63%), Gaps = 5/296 (1%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K ++Y           REGKTDY AR RL+ QDKNKYNTPKYR ++RF+N+DI
Sbjct: 1    MGFVKVVKNKSYFRRYQVKFRRRREGKTDYFARKRLVIQDKNKYNTPKYRMIIRFSNRDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            + QI  A I GD I+ +AY+HELP+YG+  G TNYAAAYCTG            + + YE
Sbjct: 61   VCQIAYAKIEGDAIVCAAYSHELPKYGIACGLTNYAAAYCTGLLCARRLLNKFGLDKVYE 120

Query: 809  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G VE TG++++VE  +G+   F   LD GL RTTTGN+VF            IPHS KRF
Sbjct: 121  GQVEVTGDEFNVESIDGQPGAFSCYLDAGLTRTTTGNKVFGALKGAVDGGLSIPHSTKRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  +SK+ +AEVHRK+I G +V+ YM  L+E++ E Y+  FS +IK G+  +++E++Y
Sbjct: 181  PGYDSESKEFNAEVHRKHILGLNVSEYMSLLMEEDEELYKKQFSRFIKNGVTPESIEEMY 240

Query: 452  KKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISR----LNALNAAA 297
            KK HA+IR +P  ++  K+  K+ KR+N  KLT  +RK  +  +    L A  AAA
Sbjct: 241  KKAHASIRENPVHERKPKREVKK-KRWNRAKLTLAQRKDRVAQKKASFLRAQEAAA 295



>pir|S42144|S42144 ribosomal protein L5.e, cytosolic - yeast
            (Saccharomyces cerevisiae)>gb:SCU43703_1710383
            Saccharomyces cerevisiae chromosome XVI cosmid
            9545.>gb:YSCRIBPRO_1730464 Saccharomyces cerevisiae
            ribosomal protein L1 gene, complete cds.
          Length = 297

 Score =  261 bits (667), Expect = 2e-68
 Identities = 140/293 (47%), Positives = 182/293 (62%), Gaps = 6/293 (2%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            MAF K  K+ AY           REGKTDY  R RL+ Q K KYNTPKYR VVRFTNKDI
Sbjct: 1    MAFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFTNKDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            I QI+S++I GD++LA+AY+HELPRYG+  G TN+AAAY TG          L + E Y+
Sbjct: 61   ICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRTLQKLGLDETYK 120

Query: 809  GNVEATGEDYSVEPGE-GRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G  E  GE    E  E G RPF+  LD+GL RTTTG RVF            +PHSE RF
Sbjct: 121  GVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  +++++D E+ R YI+GGHV+ YM  L +D+ E++  +F  Y+   IDAD+LE +Y
Sbjct: 181  PGWDFETEEIDPELLRSYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY 240

Query: 452  KKVHAAIRADPSAKKSEKQPPKEH-----KRYNLKKLTYEERKASLISRLNAL 309
               H AIRADP+ K +EK+  KE      K+Y   KL+ EER A + +++ AL
Sbjct: 241  TSAHEAIRADPAFKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAAL 293



>sp|P26321|RL5_YEAST 60S ribosomal protein L5 (L1) (YL3) (Ribosomal 5S
            RNA-binding protein).>gb:YSCYL3_1730926 S.cerevisiae
            ribosomal 5S RNA-binding protein (YL3) gene, 5'
            cds.>gb:YSCYL3GN_1730928 Saccharomyces cerevisiae
            ribosomal 5S RNA-binding protein (YL3) gene, complete
            cds.
          Length = 297

 Score =  261 bits (667), Expect = 2e-68
 Identities = 140/293 (47%), Positives = 182/293 (62%), Gaps = 6/293 (2%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            MAF K  K+ AY           REGKTDY  R RL+ Q K KYNTPKYR VVRFTNKDI
Sbjct: 1    MAFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFTNKDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            I QI+S++I GD++LA+AY+HELPRYG+  G TN+AAAY TG          L + E Y+
Sbjct: 61   ICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRTLQRLGLDETYK 120

Query: 809  GNVEATGEDYSVEPGE-GRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G  E  GE    E  E G RPF+  LD+GL RTTTG RVF            +PHSE RF
Sbjct: 121  GVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  +++++D E+ R YI+GGHV+ YM  L +D+ E++  +F  Y+   IDAD+LE +Y
Sbjct: 181  PGWDFETEEIDPELLRSYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY 240

Query: 452  KKVHAAIRADPSAKKSEKQPPKEH-----KRYNLKKLTYEERKASLISRLNAL 309
               H AIRADP+ K +EK+  KE      K+Y   KL+ EER A + +++ AL
Sbjct: 241  TSAHEAIRADPAFKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAAL 293



>gb:AY223167_1176631 Schistosoma japonicum clone ZZD1555 mRNA
            sequence.
          Length = 299

 Score =  260 bits (665), Expect = 4e-68
 Identities = 144/281 (51%), Positives = 178/281 (63%), Gaps = 4/281 (1%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            MA +K+ K +AY           REGKTDY AR RLI QDKNKYNTPKYR VVRFTNKDI
Sbjct: 1    MAIVKLVKNKAYFKRFQVKFKRRREGKTDYYARKRLIWQDKNKYNTPKYRLVVRFTNKDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            I QI+ A I GD +L SAYAHELPRYG++VG TNYAAAYCTG          L +   Y 
Sbjct: 61   ICQIIYARIDGDRVLCSAYAHELPRYGVKVGLTNYAAAYCTGLLCARRVLKQLGLDGLYA 120

Query: 809  GNVEATGEDYSVEP-GEGRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G  +  G++Y VE  G  + PFR  LDVGL RT++G  +F           DIP+S  RF
Sbjct: 121  GAEKVDGQEYHVESVGGNKSPFRCHLDVGLARTSSGANIFGALKGAVDGGLDIPYSPSRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G++++SK+   EVHR  I G HVA YM+ L E+    YQ  FS YIK GI AD +E++Y
Sbjct: 181  PGYNQESKEYKPEVHRARILGHHVAEYMKQLQEENESDYQRQFSKYIKHGITADKIEEMY 240

Query: 452  KKVHAAIRADPS---AKKSEKQPPKEHKRYNLKKLTYEERK 339
               HAAIR+DPS    +K E QP    KR+N KK++Y+++K
Sbjct: 241  LSAHAAIRSDPSHIAHEKKEIQP----KRFNRKKMSYKQKK 277



>gb:BX649606_1643407 Aspergillus fumigatus BAC pilot project
            supercontig; segment 2/3.>gb:AFA5C11_1810859 Aspergillus
            fumigatus BAC AFA5C11.
          Length = 300

 Score =  260 bits (664), Expect = 5e-68
 Identities = 144/300 (48%), Positives = 184/300 (61%), Gaps = 11/300 (3%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F K+ K  AY           REGKTDY AR RLI Q KNKYN PKYR VVRFTN+DI
Sbjct: 1    MPFHKLVKNSAYYSRYQTKYRRRREGKTDYYARKRLITQAKNKYNAPKYRLVVRFTNRDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            I QIV + I GD + ASAY+HEL RYG+  G TN+AAAY TG          L + E++ 
Sbjct: 61   ITQIVYSEITGDKVFASAYSHELKRYGITQGLTNWAAAYATGLLLARRTLKKLGLDEQFT 120

Query: 809  GNVEATGE---DYSVEPGEG-RRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSE 642
            G  E  GE     +VE  +G RRPF+A LDVGL+RT+TG RVF            IPHSE
Sbjct: 121  GVEEPDGEYKLTEAVETDDGTRRPFKAFLDVGLVRTSTGARVFGAMKGASDGGIFIPHSE 180

Query: 641  KRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLE 462
             RF G+  +S++LDAE  R YI+GGHV+ YM  L +D+ E+Y+S F+ YI+  IDA +LE
Sbjct: 181  NRFPGYDIESEELDAETLRNYIFGGHVSEYMETLADDDEERYRSQFAKYIENEIDAGDLE 240

Query: 461  QLYKKVHAAIRADPSAKKSEKQPPK-------EHKRYNLKKLTYEERKASLISRLNALNA 303
            ++Y + H AIR DP  K  +++P K       E K+Y   KL+ EE+KA +  ++  L A
Sbjct: 241  EIYAEAHKAIREDPFKKDEDEKPKKSKEEWKAESKKYKKAKLSREEKKARVEQKIRELAA 300



>gb:AY130401_2514067 Scyliorhinus canicula ribosomal protein L5 mRNA,
            partial cds.
          Length = 271

 Score =  258 bits (659), Expect = 2e-67
 Identities = 127/254 (50%), Positives = 172/254 (67%), Gaps = 1/254 (0%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            EGKTDY AR RL+ QDKNKYNTPKYR +VRFTN+DII QI  A I GD+I+ +AY HELP
Sbjct: 15   EGKTDYFARKRLVVQDKNKYNTPKYRMIVRFTNRDIICQIAYAKIEGDIIVCAAYGHELP 74

Query: 917  RYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGR-RPFRA 741
            +YG++VG TNYAA+YCTG            +   YEG VE TG++Y+VE  +G+   F  
Sbjct: 75   KYGIKVGLTNYAASYCTGLLLARRLLRKFGLDTIYEGQVEVTGDEYNVESIDGKPSAFTC 134

Query: 740  LLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHV 561
             LD GL RTTTGN+VF            IPHS KRF G+  +SK+ + EVHRK+I+G ++
Sbjct: 135  YLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNPEVHRKHIFGVNI 194

Query: 560  AAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEH 381
            A YMR L+E++ + ++  FS Y+K G+ AD +E L+KK HA IR +P  +K  K+  K+ 
Sbjct: 195  AEYMRYLMEEDEDAFKKQFSQYVKHGVTADMIEDLFKKAHATIRENPIHEKKPKREVKK- 253

Query: 380  KRYNLKKLTYEERK 339
            KR+N  K++ ++R+
Sbjct: 254  KRWNRPKMSLQQRQ 267



>gb:AY389938_2531431 Protopterus dolloi ribosomal protein L5 mRNA,
            partial cds.
          Length = 271

 Score =  257 bits (657), Expect = 3e-67
 Identities = 132/254 (51%), Positives = 169/254 (66%), Gaps = 1/254 (0%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            EGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DII QI  A I GDMI+ +AY HELP
Sbjct: 15   EGKTDYYARKRLVIQDKNKYNTPKYRMIVRITNRDIIRQIAYAKIEGDMIVCAAYRHELP 74

Query: 917  RYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGR-RPFRA 741
            +YG++VG TNYAAAYCTG            + + YEG VE TG++++VE  +G+   F  
Sbjct: 75   KYGVKVGLTNYAAAYCTGLLLARRLLNKFGLDKIYEGQVEVTGDEFNVESIDGQPSAFTC 134

Query: 740  LLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHV 561
             LD GL RTTTGN+VF            IPHS KRF G+  +SK+ +AE HRK+I G ++
Sbjct: 135  YLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEGHRKHIMGINI 194

Query: 560  AAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEH 381
            A YMR L+E++ E Y+  FS YIK G+  D +E LYKK HAAIR +P  ++  K   K+ 
Sbjct: 195  ADYMRYLMEEDEEAYKKQFSQYIKNGVTPDMMEDLYKKAHAAIRQNPVHERKPKXEVKK- 253

Query: 380  KRYNLKKLTYEERK 339
            KR+N  KL+  +RK
Sbjct: 254  KRWNRAKLSLAQRK 267



>gb:AY292620_1316676 Oikopleura dioica 60S ribosomal protein L5 (RL5)
            gene, complete cds.
          Length = 303

 Score =  254 bits (649), Expect = 3e-66
 Identities = 142/278 (51%), Positives = 176/278 (63%), Gaps = 2/278 (0%)
 Frame = -2

Query: 1163 FIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA 984
            F+ V K +AY           REGKTDY AR RL  QDKNKYNTPKYR VVR TNKDIIA
Sbjct: 13   FVAVLKNKAYFKRYQPKFKRRREGKTDYFARKRLCVQDKNKYNTPKYRLVVRVTNKDIIA 72

Query: 983  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGN 804
            QI  A + GD+I+ SAYAHELPRYG+ VG TNY+AAY TG            +   YEG 
Sbjct: 73   QIAYARLQGDVIVTSAYAHELPRYGVSVGLTNYSAAYATGLLIGRRVLQKFGLDSMYEGQ 132

Query: 803  VEATGEDYSVEPGEGRR-PFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAG 627
            +E  G+++  E     +  FR  LD GL RT+TG R+F           DIPHS KRF G
Sbjct: 133  IEVDGDEFYEEADAAEKASFRCYLDTGLARTSTGARIFGVLKGCADAGIDIPHSPKRFPG 192

Query: 626  FSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKK 447
            F+ D K L+AE H+ +I+GGHV  YM  L E+  E Y+  FS +IK GI+++N+E++YKK
Sbjct: 193  FA-DGK-LNAEAHKDHIFGGHVGDYMEKLEEENEEAYKRQFSRFIKNGINSENIEEMYKK 250

Query: 446  VHAAIRADPSAK-KSEKQPPKEHKRYNLKKLTYEERKA 336
             HAAIRADPS K K EK   K  KR+N  K++Y +R+A
Sbjct: 251  AHAAIRADPSPKAKVEKTVDK--KRWNRAKISYAQRRA 286



>gb:CR382131_1664377 Yarrowia lipolytica chromosome E of strain CLIB99
            of Yarrowia lipolytica.
          Length = 296

 Score =  253 bits (647), Expect = 4e-66
 Identities = 134/294 (45%), Positives = 182/294 (61%), Gaps = 5/294 (1%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M+F K+ KT AY           REGKTDY AR RL+ Q K KYNTPKYR VVRFTNKDI
Sbjct: 1    MSFNKIVKTSAYHSRFQTPFRRRREGKTDYYARKRLVTQHKAKYNTPKYRLVVRFTNKDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            IAQIVS+ + GD++  +AYAHELPRYG++ G TN+AAAY  G          L + E Y+
Sbjct: 61   IAQIVSSQLKGDIVFTAAYAHELPRYGVKHGLTNWAAAYAVGLLVARRALKKLGLDETYK 120

Query: 809  GNVEATGEDYSVEPGE-GRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G  E  GE    E  E G RPF+  LDVG+ RTTTG + F            +PHS  RF
Sbjct: 121  GVEEVEGEFELTEAVEDGPRPFKVFLDVGMTRTTTGAKCFGVLKGASDGGLYVPHSASRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  +S++LD+E  RKYI+ GHV+ YM  L +D+ E+++ +F +Y+   +DAD++E++ 
Sbjct: 181  PGWDIESEELDSETLRKYIFAGHVSEYMEELADDDEERFRQIFQSYLDDEVDADSVEEIL 240

Query: 452  KKVHAAIRAD----PSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNA 303
            +  H  IRAD    P+AKK++ +   E K+Y  KKLT  ER A + +++  + A
Sbjct: 241  QAAHEQIRADPDHKPTAKKTKAEYAAESKKYKQKKLTKAERDARVQAKIQEIRA 294



>gb:AF152472_2477323 Myxine glutinosa ribosomal protein L5 mRNA,
            complete cds.
          Length = 296

 Score =  252 bits (643), Expect = 1e-65
 Identities = 130/277 (46%), Positives = 172/277 (62%), Gaps = 1/277 (0%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K RAY           REGKTDY AR RL+ QDKNKYNTPKYR +VR TNKDI
Sbjct: 1    MGFVKVVKNRAYFRRYQVKFKRRREGKTDYYARKRLVIQDKNKYNTPKYRLIVRITNKDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            I Q+  A I GD+I+ ++Y+HELP+YG+ VG TNYAAAYC+G            +   YE
Sbjct: 61   ICQLAYAKIEGDVIVCASYSHELPKYGIPVGLTNYAAAYCSGLLVARRVLRKFGIDRVYE 120

Query: 809  GNVEATGEDYSVEPGE-GRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G  E TG++++VE  E G   F   LD GL RTTTGN+VF            IPHS +RF
Sbjct: 121  GQPEVTGDEFNVESVERGPGAFTCYLDTGLARTTTGNKVFGVLKGAVDGGLSIPHSTRRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  +SK+ + ++HR++I+G +++ YM+ L+ED+ + Y+  FS YIK  I  D LE +Y
Sbjct: 181  PGYDSESKEFNPDIHRQHIFGTNISNYMKQLLEDDEDLYKKQFSRYIKHAITPDMLESMY 240

Query: 452  KKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEER 342
            +  HA IR +P  KK  K   K  KR+N  KL+  +R
Sbjct: 241  ENAHARIRKNPIRKKKPKWTGK-CKRWNRAKLSLAQR 276



>gb:AE017343_1755776 Cryptococcus neoformans var. neoformans JEC21
            chromosome 3, complete sequence.
          Length = 304

 Score =  250 bits (639), Expect = 4e-65
 Identities = 134/294 (45%), Positives = 184/294 (62%), Gaps = 5/294 (1%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KVQK  AY           R+GKTDY+AR  L++Q KNKY +PKYR VVR TNK +
Sbjct: 1    MPFVKVQKNDAYFSRYQVKPRRRRQGKTDYQARRGLVSQAKNKYASPKYRLVVRITNKQV 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            I QIV A + GD++ A A + ELPRYG++ G TN+ A Y TG          L +A++YE
Sbjct: 61   ICQIVYAKLQGDVVFAHATSKELPRYGIKHGLTNWTACYATGLLVARRALTKLGLADKYE 120

Query: 809  GNVEATGEDYSVEP--GEGRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKR 636
            G VE TGE   +EP   +  RPF+  LDVGL RT+TG RVF            IPHSEKR
Sbjct: 121  GVVEPTGELQLIEPLGDDEPRPFKCYLDVGLRRTSTGARVFGAMKGASDGGIFIPHSEKR 180

Query: 635  FAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQL 456
            F G+  +SK+LDAEV +KYI GGHVA YM +L E++ E+++  FS+Y+  G+ +D++E++
Sbjct: 181  FPGYDPESKELDAEVLQKYIVGGHVAEYMESLEEEDDERFKKQFSSYLADGVGSDDIEEM 240

Query: 455  YKKVHAAIRADPSAKKSEKQPPK---EHKRYNLKKLTYEERKASLISRLNALNA 303
            Y   + AIR DP+ K +EK   K   E  +Y   KLT E+++  + +++ A  A
Sbjct: 241  YTNAYEAIREDPTFKPTEKDVAKWKAESLKYKTFKLTKEQKQERVQAKIAAYKA 294



>sp|O74306|RL5B_SCHPO 60S ribosomal protein L5-B.>pir|T39325|T39325
            60s ribosomal protein l5 - fission yeast
            (Schizosaccharomyces pombe)>gb:SPBC11C11_1718837 S.pombe
            chromosome II cosmid c11C11.
          Length = 294

 Score =  249 bits (637), Expect = 6e-65
 Identities = 142/297 (47%), Positives = 176/297 (59%), Gaps = 4/297 (1%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M FIK  K+  Y           REGKTDY AR RLI Q KNKYN PKYR VVRF+N+ +
Sbjct: 1    MPFIKAVKSSPYFSRYQTKYRRRREGKTDYYARKRLIAQAKNKYNAPKYRLVVRFSNRFV 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
              QIVS+ + GD +LA A++ ELPRYG++ G  N+ AAY TG          + +A++YE
Sbjct: 61   TCQIVSSRVNGDYVLAHAHSSELPRYGIKWGLANWTAAYATGLLVARRALAKVGLADKYE 120

Query: 809  GNVEATGEDYSVEPGE-GRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G  E  GE    E  E G RPF+  LDVGL RT+TG+RVF            IPHS  RF
Sbjct: 121  GVTEPEGEFELTEAIEDGPRPFKVFLDVGLKRTSTGSRVFGAMKGASDGGLFIPHSPNRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             GF  ++++LD E  RKYIYGGHVA YM  LI+D+ E+YQ  FS  I  GI++D LE +Y
Sbjct: 181  PGFDIETEELDDETLRKYIYGGHVAEYMEMLIDDDEERYQKQFSGLIADGIESDQLEDIY 240

Query: 452  KKVHAAIRADPSAKKSEKQP---PKEHKRYNLKKLTYEERKASLISRLNALNAAAGR 291
             + +A IR DPS +KS K       E  +Y  +KLT EERK     R NA    AGR
Sbjct: 241  AEAYAKIREDPSFQKSGKDAAAFKAESLKYTQRKLTAEERK----ERFNAKVIEAGR 293



>sp|O44248|RL5_ANOGA 60S ribosomal protein L5.>gb:AF002238_1230703
            Anopheles gambiae ribosomal protein L5 mRNA, complete
            cds.
          Length = 327

 Score =  249 bits (635), Expect = 1e-64
 Identities = 132/268 (49%), Positives = 168/268 (62%), Gaps = 2/268 (0%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K + Y           REGKTDY AR RLI QDKNKYNTPK+R +VR +N+DI
Sbjct: 1    MGFVKVVKNKQYFKRYQVRFRRRREGKTDYYARKRLIFQDKNKYNTPKFRLIVRLSNRDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
              QI    I GD I+ +AY+HELPRYG++VG TNYAAAYCTG          L +   Y 
Sbjct: 61   TCQIAYRRIEGDRIVCAAYSHELPRYGVKVGLTNYAAAYCTGLLVARRILQKLRLDTLYA 120

Query: 809  GNVEATGEDYSVEP-GEGRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G  + TGE+Y VEP  EG   FR  LDVGL RTTTG+RVF           +IPHS KRF
Sbjct: 121  GCTDVTGEEYLVEPVDEGPAAFRCYLDVGLARTTTGSRVFGAMKGAVDGGLNIPHSVKRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+S ++K  +AE+HR +I+G HVA YMR L E++ E ++  FS YI  GI AD++E +Y
Sbjct: 181  PGYSAENKSFNAEMHRDHIFGLHVANYMRTLEEEDEEAFKRQFSKYISLGIKADDIENIY 240

Query: 452  KKVHAAIR-ADPSAKKSEKQPPKEHKRY 372
            K  HA+IR   PS +   ++ P+   R+
Sbjct: 241  KNAHASIRKIPPSRRNPRRRSPRSGGRW 268



>gb:CR382139_1673082 Debaryomyces hansenii chromosome G of strain
            CBS767 of Debaryomyces hansenii.
          Length = 297

 Score =  248 bits (632), Expect = 2e-64
 Identities = 133/296 (44%), Positives = 179/296 (60%), Gaps = 6/296 (2%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F +  K+ +Y           +EGKTDY  R RL+ Q K KYN+PKYR VVRFTNKDI
Sbjct: 1    MPFDQRPKSSSYHSRFQTPFRRRQEGKTDYYQRKRLVTQHKAKYNSPKYRLVVRFTNKDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            IAQIVS+ I GD++  +AYAHELPRYG+  G TN++AAY  G          L + E Y+
Sbjct: 61   IAQIVSSQITGDLVFTAAYAHELPRYGISHGLTNWSAAYAVGLLVARRALQKLGLDETYK 120

Query: 809  GNVEATGEDYSVEPGE-GRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G  E  GE    E  E G RPF+A LD+GL RTTTG R+F            +PHS  RF
Sbjct: 121  GVEEVEGEFELTEAVEDGPRPFKAFLDIGLQRTTTGARIFGVLKGASDGGLYVPHSPNRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             G+  + ++LDAE+ RKYI GGHVA YM  L++D+ EK++++F +Y+   I+A+++E+LY
Sbjct: 181  PGWDIEGEELDAELLRKYIMGGHVAEYMEELMDDDEEKFRTLFKSYLADEIEAEDVEELY 240

Query: 452  KKVHAAIRADPSAKKSEKQPPKEH-----KRYNLKKLTYEERKASLISRLNALNAA 300
               H  IR DPS K +EK+  KE      K+Y   KL+  ER   +  ++ A  A+
Sbjct: 241  MNAHEKIREDPSFKPTEKKFTKEQYAAESKKYRQTKLSKAERDQKIADKIVAFKAS 296



>sp|P52822|RL5A_SCHPO 60S ribosomal protein L5-A.>pir|T38758|T38758
            60s ribosomal protein L5 - fission yeast
            (Schizosaccharomyces pombe)>gb:SPAC3H5_1717877 S.pombe
            chromosome I cosmid c3H5.
          Length = 294

 Score =  248 bits (632), Expect = 2e-64
 Identities = 141/297 (47%), Positives = 176/297 (59%), Gaps = 4/297 (1%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M FIK  K+  Y           REGKTDY AR RLI Q KNKYN PKYR VVRF+N+ +
Sbjct: 1    MPFIKAVKSSPYFSRYQTKYRRRREGKTDYYARKRLIAQAKNKYNAPKYRLVVRFSNRFV 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
              QIVS+ + GD +LA A++ ELPRYG++ G  N+ AAY TG          + +A++YE
Sbjct: 61   TCQIVSSRVNGDYVLAHAHSSELPRYGIKWGLANWTAAYATGLLVARRALAKVGLADKYE 120

Query: 809  GNVEATGEDYSVEPGE-GRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G  E  GE    E  E G RPF+  LDVGL RT+TG+RVF            IPHS  RF
Sbjct: 121  GVTEPEGEFELTEAIEDGPRPFKVFLDVGLKRTSTGSRVFGAMKGASDGGLFIPHSPNRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             GF  ++++LD E  RKYIYGGHVA YM  LI+D+ E+YQ  FS  I  GI++D LE +Y
Sbjct: 181  PGFDIETEELDDETLRKYIYGGHVAEYMEMLIDDDEERYQKQFSGLIADGIESDQLEDIY 240

Query: 452  KKVHAAIRADPSAKKSEKQP---PKEHKRYNLKKLTYEERKASLISRLNALNAAAGR 291
             + +A IR DPS +KS K       E  ++  +KLT EERK     R NA    AGR
Sbjct: 241  AEAYAKIREDPSFQKSGKDAAAFKAESLKHTQRKLTAEERK----ERFNAKVIEAGR 293



>gb:AY588943_1339467 Eimeria tenella large subunit ribosomal protein
            L5 (RPL5) mRNA, complete cds.
          Length = 311

 Score =  240 bits (613), Expect = 4e-62
 Identities = 127/266 (47%), Positives = 167/266 (62%), Gaps = 5/266 (1%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            MAF+K  K +AY           REGKTDY AR RLI QDKNKYN PKYRFVVR TN  +
Sbjct: 1    MAFVKAIKNKAYFKRFQVKYRRRREGKTDYAARRRLILQDKNKYNAPKYRFVVRVTNSRV 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            + Q++ A++ GD ++ SA + EL RYG++VG TNY+AAY TG            +A+E++
Sbjct: 61   LCQVMYATLQGDRLVCSADSQELTRYGIKVGLTNYSAAYATGLLLARRLLKQKGLADEFK 120

Query: 809  GNVEATGEDYSVEP-GEGRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G  + +GE+Y +E   E RRPF+ +LDVG++ TT GNRVF            IPHS KRF
Sbjct: 121  GLEKPSGEEYHIEEVSEERRPFKCVLDVGIVATTVGNRVFGAMKGACDGGLHIPHSNKRF 180

Query: 632  AGFSKDSKQLD----AEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNL 465
             GF+K     D     EVHR  IYG HVA YMR L E++PE+YQ+ FSAYI+  ID D++
Sbjct: 181  PGFTKGEDGADDSYNPEVHRARIYGLHVAEYMRTLKEEDPERYQAQFSAYIRNKIDPDSI 240

Query: 464  EQLYKKVHAAIRADPSAKKSEKQPPK 387
            E++Y++    IRA+P   K E +  K
Sbjct: 241  EKMYEEAFQKIRANPDPVKKEAREVK 266



>gb:SPU48270_1722209 Schizosaccharomyces pombe ribosomal protein L5
            gene, complete cds.
          Length = 293

 Score =  238 bits (607), Expect = 2e-61
 Identities = 138/297 (46%), Positives = 173/297 (58%), Gaps = 4/297 (1%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M FIK  K+  Y            EGK DY AR RLI Q KNKYN PKYR VVRF+N+ +
Sbjct: 1    MPFIKAVKSSPYFSRYQTKYRRR-EGKIDYYARKRLIAQAKNKYNAPKYRLVVRFSNRFV 59

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
              QIVS+ + GD +LA A++ ELPRYG++ G  N+ AAY TG          + +A++YE
Sbjct: 60   TCQIVSSRVNGDYVLAHAHSSELPRYGIKWGLANWTAAYATGLLVARRALAKVGLADKYE 119

Query: 809  GNVEATGEDYSVEPGE-GRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G  E  GE    E  E G RPF+  LDVGL RT+TG+RVF            IPHS  RF
Sbjct: 120  GVTEPEGEFELTEAIEDGPRPFKVFLDVGLKRTSTGSRVFGAMKGASDGGLFIPHSPNRF 179

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLY 453
             GF  ++++LD E  RKYIYGGHVA YM  LI+D+ E+YQ   S  I  GI++D LE +Y
Sbjct: 180  PGFDIETEELDDETLRKYIYGGHVAEYMEMLIDDDEERYQKQSSGLIADGIESDQLEDIY 239

Query: 452  KKVHAAIRADPSAKKSEKQP---PKEHKRYNLKKLTYEERKASLISRLNALNAAAGR 291
             + +A IR DPS +KS K       E  ++  +KLT EERK     R NA    AGR
Sbjct: 240  AEAYAKIREDPSFQKSGKDAAAFKAESLKHTQRKLTAEERK----ERFNAKVIEAGR 292



>gb:AB089490_1198598 Giardia intestinalis gene for ribosomal protein
            L5, complete cds.
          Length = 297

 Score =  221 bits (563), Expect = 2e-56
 Identities = 131/297 (44%), Positives = 171/297 (57%), Gaps = 10/297 (3%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M ++KVQKTR+Y           REGKTDY+AR  LI QDKNKY TP+YRFVVR TNKDI
Sbjct: 1    MGWVKVQKTRSYFKRFQVQFRRRREGKTDYQARKALIIQDKNKYATPRYRFVVRRTNKDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTG-------XXXXXXXXXXL 831
            I Q+ +A +  D ++ +AY+HELPRYG+ VG TNYAAAY TG                  
Sbjct: 61   ICQVTAAELTKDRVVCAAYSHELPRYGIPVGLTNYAAAYATGLLCGRRLLEKLSVGIKEN 120

Query: 830  EMAEEYEGNVEATGEDYSVEPGEGR--RPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXD 657
             +A+ Y G  +ATGE+Y  +  E      F+A LD+GL R +TG RVF           +
Sbjct: 121  ALAQLYPGLDKATGEEYHPDENENEEVHAFKAFLDIGLARASTGARVFAAMKGAVDAGLN 180

Query: 656  IPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGID 477
            IPHS KRF G+SKD    D+   R  I G HV  YM  L  ++ E Y+  FS YI   ++
Sbjct: 181  IPHSMKRFPGYSKDG--FDSSALRDRIMGKHVGDYMAELKAEDEETYRKRFSKYIAAKVE 238

Query: 476  ADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASL-ISRLNAL 309
               LE +Y K HAAIRA+P A K++ +  K  ++    +LT +ERK  +   +L AL
Sbjct: 239  PLRLEAMYTKAHAAIRANPQAVKAKFEIKKPVRQ---ARLTLKERKERIDAKKLEAL 292



>gb:AY113682_1425082 Equus caballus ribosomal protein L5 (RPL5) mRNA,
            complete cds.
          Length = 247

 Score =  214 bits (546), Expect = 2e-54
 Identities = 110/227 (48%), Positives = 149/227 (65%), Gaps = 1/227 (0%)
 Frame = -2

Query: 1016 VVRFTNKDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXX 837
            +VR TN+DII QI  A I GDMI+ +AYAHELP+YG++VG TNYAAAYCTG         
Sbjct: 2    IVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLN 61

Query: 836  XLEMAEEYEGNVEATGEDYSVEPGEGRR-PFRALLDVGLLRTTTGNRVFXXXXXXXXXXX 660
               M + YEG VE TG++Y+VE  +G+   F   LD GL RTTTGN+VF           
Sbjct: 62   RFGMDKIYEGQVEVTGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGL 121

Query: 659  DIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGI 480
             IPHS KRF G+  +SK+ +AEVHRK+I G +VA YMR L+E++ + Y+  FS YIK  +
Sbjct: 122  SIPHSTKRFPGYDSESKEFNAEVHRKHIMGQNVADYMRYLMEEDEDAYKKQFSQYIKNNV 181

Query: 479  DADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERK 339
              D +E++YKK H+AIR +P  +K  K+  K+ KR+N  K++  ++K
Sbjct: 182  TPDMMEEMYKKAHSAIRENPVYEKKPKKEVKK-KRWNRPKMSLAQKK 227



>gb:AY231809_1177102 Drosophila yakuba clone yak-em_yip6 mRNA
            sequence.
          Length = 218

 Score =  214 bits (546), Expect = 2e-54
 Identities = 112/217 (51%), Positives = 139/217 (64%), Gaps = 1/217 (0%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K + Y           REGKTDY AR RL  QDKNKYNTPKYR +VR +NKDI
Sbjct: 1    MGFVKVVKNKQYFKRYQVKFRRRREGKTDYYARKRLTFQDKNKYNTPKYRLIVRLSNKDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
              QI  A I GD ++ +AY+HELP+YG++VG TNYAAAYCTG          L +   Y 
Sbjct: 61   TVQIAYARIEGDRVVCAAYSHELPKYGIQVGLTNYAAAYCTGLLVARRVLNKLGLDSLYA 120

Query: 809  GNVEATGEDYSVEP-GEGRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G  E TGE+++VEP  +G   FR  LDVGL RTTTG RVF           +IPHS KRF
Sbjct: 121  GCTEVTGEEFNVEPVDDGPGAFRCFLDVGLARTTTGARVFGAMKGAVDGGLNIPHSVKRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPE 522
             G+S ++K  +A+VHR +I+G HVA YMR+L E++ E
Sbjct: 181  PGYSAETKSFNADVHRAHIFGQHVADYMRSLEEEDEE 217



>gb:AB016045_1512750 Schizosaccharomyces pombe mRNA for ribosomal
            protein L5 homolog, partial cds.
          Length = 248

 Score =  210 bits (535), Expect = 4e-53
 Identities = 118/251 (47%), Positives = 151/251 (60%), Gaps = 4/251 (1%)
 Frame = -2

Query: 1031 PKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXX 852
            PKYR VVRF+N+ +  QIVS+ + GD +LA A++ ELPRYG++ G  N+ AAY TG    
Sbjct: 1    PKYRLVVRFSNRFVTCQIVSSRVNGDYVLAHAHSSELPRYGIKWGLANWTAAYATGLLVA 60

Query: 851  XXXXXXLEMAEEYEGNVEATGEDYSVEPGE-GRRPFRALLDVGLLRTTTGNRVFXXXXXX 675
                  + +A++YEG  E  GE    E  E G RPF+  LDVGL RT+TG+RVF      
Sbjct: 61   RRALAKVGLADKYEGVTEPEGEFELTEAIEDGPRPFKVFLDVGLKRTSTGSRVFGAMKGA 120

Query: 674  XXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAY 495
                  IPHS  RF GF  ++++LD E  RKYIYGGHVA YM  LI+D+ E+YQ  FS  
Sbjct: 121  SDGGLFIPHSPNRFPGFDIETEELDDETLRKYIYGGHVAEYMEMLIDDDEERYQKQFSGL 180

Query: 494  IKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQP---PKEHKRYNLKKLTYEERKASLIS 324
            I  GI++D LE +Y + +A IR DPS +KS K       E  +Y  +KLT EERK     
Sbjct: 181  IADGIESDQLEDIYAEAYAKIREDPSFQKSGKDAAAFKAESLKYTQRKLTAEERK----E 236

Query: 323  RLNALNAAAGR 291
            R NA    AGR
Sbjct: 237  RFNAKVIEAGR 247



>pir|T43382|T43382 ribosomal protein L5 - fission yeast
            (Schizosaccharomyces pombe) (fragment)
          Length = 248

 Score =  210 bits (535), Expect = 4e-53
 Identities = 118/251 (47%), Positives = 151/251 (60%), Gaps = 4/251 (1%)
 Frame = -2

Query: 1031 PKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXX 852
            PKYR VVRF+N+ +  QIVS+ + GD +LA A++ ELPRYG++ G  N+ AAY TG    
Sbjct: 1    PKYRLVVRFSNRFVTCQIVSSRVNGDYVLAHAHSSELPRYGIKWGLANWTAAYATGLLVA 60

Query: 851  XXXXXXLEMAEEYEGNVEATGEDYSVEPGE-GRRPFRALLDVGLLRTTTGNRVFXXXXXX 675
                  + +A++YEG  E  GE    E  E G RPF+  LDVGL RT+TG+RVF      
Sbjct: 61   RRALAKVGLADKYEGVTEPEGEFELTEAIEDGPRPFKVFLDVGLKRTSTGSRVFGAMKGA 120

Query: 674  XXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAY 495
                  IPHS  RF GF  ++++LD E  RKYIYGGHVA YM  LI+D+ E+YQ  FS  
Sbjct: 121  SDGGLFIPHSPNRFPGFDIETEELDDETLRKYIYGGHVAEYMEMLIDDDEERYQKQFSGL 180

Query: 494  IKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQP---PKEHKRYNLKKLTYEERKASLIS 324
            I  GI++D LE +Y + +A IR DPS +KS K       E  +Y  +KLT EERK     
Sbjct: 181  IADGIESDQLEDIYAEAYAKIREDPSFQKSGKDAAAFKAESLKYTQRKLTAEERK----E 236

Query: 323  RLNALNAAAGR 291
            R NA    AGR
Sbjct: 237  RFNAKVIEAGR 247



>gb:AE014187_938696 Plasmodium falciparum 3D7 chromosome 14 complete
            sequence.>gb:AE014819_1227772 Plasmodium falciparum 3D7
            chromosome 14 section 4 of 13 of the complete sequence.
          Length = 294

 Score =  208 bits (530), Expect = 2e-52
 Identities = 125/289 (43%), Positives = 161/289 (55%), Gaps = 5/289 (1%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            MA++KV K +AY           REGKTDYRAR  LI QDKNKYN  K RFVVR TN  +
Sbjct: 1    MAYVKVVKNKAYFKRYQVKYRRRREGKTDYRARKALILQDKNKYNAQKLRFVVRKTNSQV 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            I QI  A I GD ILA A + EL RYG+ VG  NYAAAY TG          L +  ++ 
Sbjct: 61   ICQIACAHIEGDKILAEAKSKELIRYGIPVGLKNYAAAYATGLLCARRFLKSLNLDTQFL 120

Query: 809  GNVEATGE---DYSVEPGEGRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEK 639
            G  + TGE   +   E  EGR+P +A LDVG+ RTTTGNRVF           +IPH   
Sbjct: 121  GVEKVTGEIENNEDKEDEEGRKPIKAFLDVGITRTTTGNRVFAALKGACDGGLNIPHGNN 180

Query: 638  RFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQ 459
            RF G      + + E  RK I G HVA YM+ L E++ +KY++ F+ Y+K  I AD++EQ
Sbjct: 181  RFPG---SKNEFNPEQLRKNILGIHVAEYMKTLQEEDNDKYKTHFNDYLKNNIGADDIEQ 237

Query: 458  LYKKVHAAIRADPSAKKSEKQPPKE--HKRYNLKKLTYEERKASLISRL 318
            +Y   H  IR +P  +  + +  K+   K    KKL  + RK  +  +L
Sbjct: 238  MYLNAHEKIRQNPEKESKDTKNVKKFVSKHEKPKKLNAKLRKKRVKEKL 286



>gb:AY232050_1177343 Drosophila yakuba clone yak-ad_yip6 mRNA
            sequence.
          Length = 203

 Score =  200 bits (508), Expect = 6e-50
 Identities = 104/203 (51%), Positives = 128/203 (63%), Gaps = 1/203 (0%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K + Y           REGKTDY AR RL  QDKNKYNTPKYR +VR +NKDI
Sbjct: 1    MGFVKVVKNKQYFKRYQVKFRRRREGKTDYYARKRLTFQDKNKYNTPKYRLIVRLSNKDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
              QI  A I GD ++ +AY+HELP+YG++VG TNYAAAYCTG          L +   Y 
Sbjct: 61   TVQIAYARIEGDRVVCAAYSHELPKYGIQVGLTNYAAAYCTGLLVARRVLNKLGLDSLYA 120

Query: 809  GNVEATGEDYSVEP-GEGRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G  E TGE+++VEP  +G   FR  LDVGL RTTTG RVF           +IPHS KRF
Sbjct: 121  GCTEVTGEEFNVEPVDDGPGAFRCFLDVGLARTTTGARVFGAMKGAVDGGLNIPHSVKRF 180

Query: 632  AGFSKDSKQLDAEVHRKYIYGGH 564
             G+S ++K  +A+VHR +I+G H
Sbjct: 181  PGYSAENKSFNADVHRAHIFGQH 203



>gb:AB089486_1198594 Trichomonas vaginalis gene for ribosomal protein
            L5, complete cds.
          Length = 308

 Score =  194 bits (494), Expect = 2e-48
 Identities = 122/308 (39%), Positives = 168/308 (54%), Gaps = 20/308 (6%)
 Frame = -2

Query: 1157 KVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQI 978
            K+ K   Y           RE KTDY  R +LI QDK KY   KYR V R TN  +IAQI
Sbjct: 4    KLVKNAGYFSRFQTKFRRRREAKTDYVQRTQLIQQDKTKYGAAKYRLVARITNTKVIAQI 63

Query: 977  VSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVE 798
            V A + GD  +  A + ELP+YG+++G +NY AAY TG          +++A+ ++  + 
Sbjct: 64   VVAELTGDKTVCQALSTELPKYGIKLGLSNYPAAYATGLLVARRFLTQMKLADVFKTEIT 123

Query: 797  ATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHS--------E 642
               E+Y +   E RRPF+ +LDVGL RTTTG +VF            IPH+        +
Sbjct: 124  ---EEY-LNDEENRRPFKVILDVGLARTTTGAKVFAVMKGAVDGGLFIPHNVCRLACKFD 179

Query: 641  KRFAGFSKDSKQLDAEV----HRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDA 474
            K+     KD K + AE     ++ YI GG VA YMR L ++  EKY   FS Y+K GI A
Sbjct: 180  KKDKDAGKDRKDVPAEKIVKGNQYYILGGAVADYMRKLKKESEEKYNKQFSRYVKAGITA 239

Query: 473  DNLEQLYKKVHAAIRADPSA------KKSEKQPPKEH--KRYNLKKLTYEERKASLISRL 318
            D+LE++YK  HAAIR +P+A      KK  ++  ++H  K+   KKL++EE++  L   L
Sbjct: 240  DSLEKIYKDAHAAIRKNPAATVIADKKKHAEEMKQKHAPKKPQTKKLSFEEKRKILNEHL 299

Query: 317  NALNAAAG 294
                AAAG
Sbjct: 300  ----AAAG 303



>sp|P93779|RL5_SOLME 60S ribosomal protein L5
           (Fragment).>gb:AB001583_1508481 Solanum melongena mRNA
           for ribosomal protein L5, partial cds.
          Length = 121

 Score =  184 bits (468), Expect = 2e-45
 Identities = 90/110 (81%), Positives = 97/110 (88%)
 Frame = -2

Query: 623 SKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKV 444
           SKDSKQLDAEVHRKYIYGGHVAAYM  L+EDEPEKYQS FS+YIK  +  DN+E++YKKV
Sbjct: 2   SKDSKQLDAEVHRKYIYGGHVAAYMNILMEDEPEKYQSHFSSYIKADLAPDNIEEMYKKV 61

Query: 443 HAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNALNAAAG 294
           HAAIR DPS KKS+KQPPK HKRYNLKKLTYEERKA LI RLNALNAA G
Sbjct: 62  HAAIRPDPSPKKSQKQPPKTHKRYNLKKLTYEERKAKLIERLNALNAAGG 111



>gb:CNS07EGD_1373505 chromosome VI of strain GB-M1 of Encephalitozoon
            cuniculi (Microspora).
          Length = 283

 Score =  181 bits (459), Expect = 3e-44
 Identities = 104/279 (37%), Positives = 150/279 (53%), Gaps = 1/279 (0%)
 Frame = -2

Query: 1145 TRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSAS 966
            TR Y           REGKTDY+ R  +I QD N   + K+R VVR T   +I QIV+A 
Sbjct: 3    TRNYHKNFQVKRRRRREGKTDYKHRTNMIRQDSNSCGSVKHRLVVRITGSRVICQIVAAY 62

Query: 965  IAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE-GNVEATG 789
            + GD ++  A + EL RYG+  G TNY+AAY TG          + + E Y    ++ T 
Sbjct: 63   MDGDRVMVYADSRELERYGINFGATNYSAAYATGFLIGRRALTAMSLDEVYRPKEIDGTY 122

Query: 788  EDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSK 609
                   GE + P R  LD+GL R+T G RVF           ++PHS  +F G   D  
Sbjct: 123  SVTKDIDGEKKAP-RVFLDIGLARSTRGARVFGALKGASDAGLNVPHSAAKFYGHKPDGS 181

Query: 608  QLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIR 429
                E+H + I+G +++ YM+ L + +PEKY++ FS+YIKKGID + + ++YK     I 
Sbjct: 182  FDAKELHDR-IFGYNISEYMKQLRDGDPEKYKTQFSSYIKKGIDPEEIPRIYKSAFDKIA 240

Query: 428  ADPSAKKSEKQPPKEHKRYNLKKLTYEERKASLISRLNA 312
             DP+ KK E +     K+Y   +LTYEER   + ++L+A
Sbjct: 241  EDPTRKKKETKDYSGFKKYKQARLTYEERAKRVQAKLSA 279



>gb:AF227803_1150602 Ictalurus punctatus ribosomal protein L5b mRNA,
            partial cds.
          Length = 226

 Score =  179 bits (453), Expect = 1e-43
 Identities = 101/229 (44%), Positives = 130/229 (56%), Gaps = 3/229 (1%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K +AY           REGKTDY AR RL+ QDKNKYNTPKYR +VRF+N+DI
Sbjct: 1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYFARKRLVIQDKNKYNTPKYRMIVRFSNRDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            + QI  A I GD I+ +AY+HELPRYG+ VG TNYAAAYCTG            + + YE
Sbjct: 61   VCQIAYAKIEGDAIVCAAYSHELPRYGVSVGLTNYAAAYCTGLLLARRLLNKFNLDKVYE 120

Query: 809  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRF 633
            G VE TGE+++VE  +G+   F   LD GL RTTTGN+VF               S    
Sbjct: 121  GQVEVTGEEFNVESVDGQPGAFTCYLDAGLTRTTTGNKVFGALKGAVDGGLS---SHTAL 177

Query: 632  AGFSKDSKQLDAEVHRK--YIYGGHVAAYMRNLIEDEPEKYQSVFSAYI 492
            +G    + +  +   R      G     YM +LIE++ + Y+  FS +I
Sbjct: 178  SGSRATTPRAKSSAVRSTGSTSGLERVEYMSSLIEEDEDAYKKQFSRFI 226



>gb:AY096006_1298407 Branchiostoma belcheri tsingtaunese ribosomal
            protein L5 mRNA, complete cds.
          Length = 207

 Score =  176 bits (445), Expect = 1e-42
 Identities = 90/160 (56%), Positives = 109/160 (68%), Gaps = 1/160 (0%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K +AY           REG TDY AR RL+ Q+KNKYNTPKYR +VRFTNKDI
Sbjct: 1    MGFVKVVKNKAYFKRFQVKFRRRREGVTDYYARKRLVIQEKNKYNTPKYRLIVRFTNKDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
            I Q+  A I GD+I+ +AYAHELPRYG++VG TNYAAAYCTG            +   YE
Sbjct: 61   ICQVAYARIEGDVIVCAAYAHELPRYGIKVGLTNYAAAYCTGLLLARRILKKFSLDTIYE 120

Query: 809  GNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVF 693
            G  E  G++Y+VE  +G+ RPFR  LDVGL+RT+TG RVF
Sbjct: 121  GCTEIDGDEYNVEEVDGQPRPFRCFLDVGLVRTSTGARVF 160



>gb:AY130400_2514066 Petromyzon marinus ribosomal protein L5 mRNA,
            partial cds.
          Length = 176

 Score =  167 bits (424), Expect = 3e-40
 Identities = 93/217 (42%), Positives = 119/217 (54%)
 Frame = -2

Query: 1163 FIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA 984
            FIK  K++AY           REGKTDY AR RLI QDKNKYNTPKYR  VR TN+D+I 
Sbjct: 2    FIKTVKSKAYFKRYQVKFKRRREGKTDYFARKRLIVQDKNKYNTPKYRLFVRLTNRDVIC 61

Query: 983  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGN 804
            Q+  A I GD+++ +AY+HEL +YG+ VG TNYAAA                        
Sbjct: 62   QVAYAKIEGDVMVCAAYSHELSKYGITVGLTNYAAA------------------------ 97

Query: 803  VEATGEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGF 624
                              F   LD GL RTTTGN+VF            IPHS KRF G+
Sbjct: 98   ------------------FTCYLDAGLTRTTTGNKVFGALKGAVDGGLSIPHSTKRFPGY 139

Query: 623  SKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQ 513
              +SK+ +A+VHRK+  G +VA YMR+L+E++ + Y+
Sbjct: 140  DSESKEFNADVHRKHXLGVNVADYMRSLMENDXDAYK 176



>gb:BT011515_1357983 Drosophila melanogaster SD13191 full insert cDNA.
          Length = 178

 Score =  166 bits (419), Expect = 1e-39
 Identities = 89/174 (51%), Positives = 106/174 (60%), Gaps = 1/174 (0%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K + Y           REGKTDY AR RL  QDKNKYNTPKYR +VR +NKDI
Sbjct: 1    MGFVKVVKNKQYFKRYQVKFRRRREGKTDYYARKRLTFQDKNKYNTPKYRLIVRLSNKDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYE 810
              QI  A I GD ++ +AY+HELP+YG++VG TNYAAAYCTG          L +   Y 
Sbjct: 61   TVQIAYARIEGDRVVCAAYSHELPKYGIQVGLTNYAAAYCTGLLVARRVLNKLGLDSLYA 120

Query: 809  GNVEATGEDYSVEP-GEGRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIP 651
            G  E TGE+++VEP  +G   FR  LDVGL RTTTG RVF           +IP
Sbjct: 121  GCTEVTGEEFNVEPVDDGPGAFRCFLDVGLARTTTGARVFGAMKGAVDGGLNIP 174



>gb:AB002734_1192767 Entamoeba histolytica mRNA for ribosomal protein
            L5, partial cds.
          Length = 167

 Score =  159 bits (403), Expect = 9e-38
 Identities = 85/158 (53%), Positives = 106/158 (67%), Gaps = 2/158 (1%)
 Frame = -2

Query: 1160 IKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQ 981
            +KV K RAY           REGKTDY AR ++I QDK+K+ TPKYR VVR TNK +IAQ
Sbjct: 1    LKVIKNRAYFKKYQTQFRRRREGKTDYYARRKMIFQDKDKFKTPKYRVVVRITNKTVIAQ 60

Query: 980  IVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNV 801
            I  + I GD IL +AY+HELPRYG+++G TNYAAAYCTG          L M +++ G  
Sbjct: 61   IAYSEIIGDKILCAAYSHELPRYGVKLGLTNYAAAYCTGLLLARRLLQKLGMDKQFVGVS 120

Query: 800  EAT--GEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVF 693
            +A   GEDY+ E  + RRPF  +LDVGL RTTTG++VF
Sbjct: 121  DAAKLGEDYTPEEVDERRPFTCILDVGLARTTTGSKVF 158



>gb:AB002733_1192766 Entamoeba histolytica mRNA for ribosomal protein
            L5, partial cds.
          Length = 167

 Score =  154 bits (390), Expect = 3e-36
 Identities = 84/158 (53%), Positives = 105/158 (66%), Gaps = 2/158 (1%)
 Frame = -2

Query: 1160 IKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQ 981
            +KV K RAY           REGKTDY AR ++I QDK+K+ TPKYR VVR TNK +IAQ
Sbjct: 1    LKVIKNRAYFKKYQTQFRRRREGKTDYYARRKMIFQDKDKFKTPKYRVVVRITNKTVIAQ 60

Query: 980  IVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNV 801
            I  + I GD IL +AY+HELPRYG+++G TNYAA YCTG          L M +++ G  
Sbjct: 61   IAYSEIIGDKILWAAYSHELPRYGVKLGLTNYAADYCTGLLLARRLLQKLGMDKQFGGVS 120

Query: 800  EAT--GEDYSVEPGEGRRPFRALLDVGLLRTTTGNRVF 693
            +A   GEDY+ E  + RRPF+ +LDVGL RTTTG+ VF
Sbjct: 121  DAAKLGEDYTPEEVDERRPFKCILDVGLGRTTTGSLVF 158



>sp|Q95276|RL5_PIG 60S ribosomal protein L5 (Fragment).
          Length = 124

 Score =  137 bits (346), Expect = 3e-31
 Identities = 70/122 (57%), Positives = 81/122 (66%)
 Frame = -2

Query: 1163 FIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIA 984
            F+KV K +AY           REGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DII 
Sbjct: 2    FVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIIC 61

Query: 983  QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGN 804
            QI  A I GDMI+ +AYAHELP+YG++VG TNYAAAYCTG            M + Y G 
Sbjct: 62   QIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMXKIYGGQ 121

Query: 803  VE 798
            VE
Sbjct: 122  VE 123



>gb:AF195190_1249790 Drosophila melanogaster yippee interacting
           protein 6 (yip6) mRNA, partial cds.
          Length = 177

 Score =  135 bits (339), Expect = 2e-30
 Identities = 70/140 (50%), Positives = 91/140 (65%), Gaps = 1/140 (0%)
 Frame = -2

Query: 815 YEGNVEATGEDYSVEP-GEGRRPFRALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEK 639
           Y G  E TGE+++VEP  +G   FR  LDVGL RTTTG RVF           +IPHS  
Sbjct: 4   YAGCTEVTGEEFNVEPVDDGPGAFRCFLDVGLARTTTGARVFGAMKGAVDGGLNIPHSVX 63

Query: 638 RFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQ 459
            F G+S ++K  +A+VHR +I+G HVA YMR+L E++ E ++  FS YIK GI AD+LE 
Sbjct: 64  LFPGYSAETKSFNADVHRAHIFGQHVADYMRSLEEEDEESFKRQFSRYIKLGIRADDLED 123

Query: 458 LYKKVHAAIRADPSAKKSEK 399
           +YKK H AIR DP+ K + K
Sbjct: 124 IYKKAHQAIRNDPTHKVTAK 143



>gb:BC001882_1967929 Homo sapiens ribosomal protein L5, mRNA (cDNA
            clone IMAGE:3544216), complete cds.
          Length = 101

 Score =  125 bits (313), Expect = 2e-27
 Identities = 62/98 (63%), Positives = 72/98 (73%)
 Frame = -2

Query: 1169 MAFIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDI 990
            M F+KV K +AY           REGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI
Sbjct: 1    MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI 60

Query: 989  IAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAA 876
            I QI  A I GDMI+ +AYAHELP+YG++VG TNYAAA
Sbjct: 61   ICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAA 98



>gb:AL162740_1922621 Human DNA sequence from clone RP4-716F6 on
            chromosome 1p21.2-22.3 Contains the RPL5 gene for
            ribosomal protein L5 and the 3' end of a novel gene,
            possible ortholog of mouse RIKEN cDNA 2900024C23 gene,
            complete sequence.
          Length = 126

 Score =  123 bits (308), Expect = 9e-27
 Identities = 64/124 (51%), Positives = 78/124 (62%), Gaps = 1/124 (0%)
 Frame = -2

Query: 1016 VVRFTNKDIIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXX 837
            +VR TN+DII QI  A I GDMI+ +AYAHELP+YG++VG TNYAAAYCTG         
Sbjct: 2    IVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLN 61

Query: 836  XLEMAEEYEGNVEATGEDYSVEPGEGR-RPFRALLDVGLLRTTTGNRVFXXXXXXXXXXX 660
               M + YEG VE TG++Y+VE  +G+   F   LD GL RTTTGN+VF           
Sbjct: 62   RFGMDKIYEGQVEVTGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGL 121

Query: 659  DIPH 648
             IPH
Sbjct: 122  SIPH 125



>gb:AB010699_1511235 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MSN9.
          Length = 88

 Score =  119 bits (297), Expect = 2e-25
 Identities = 57/86 (66%), Positives = 73/86 (84%)
 Frame = -2

Query: 551 MRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRY 372
           M+ L E EPEK Q++FSAYIKKG++A+++E++YKKVHAAIRA+P+ KK+EK   KEHKRY
Sbjct: 1   MKLLGEYEPEKLQTLFSAYIKKGVEAESIEEMYKKVHAAIRAEPNHKKTEKPATKEHKRY 60

Query: 371 NLKKLTYEERKASLISRLNALNAAAG 294
           +LKKLTYEERK  LI R+ ALN A+G
Sbjct: 61  DLKKLTYEERKNKLIERVKALNGASG 86



>gb:HSU76609_2026040 Human ribosomal L5 protein mRNA, partial cds.
          Length = 145

 Score =  116 bits (290), Expect = 1e-24
 Identities = 57/126 (45%), Positives = 82/126 (65%)
 Frame = -2

Query: 716 TTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLI 537
           TTTGN+VF            IPHS KRF G+  +SK+ +AEVHRK+I G +VA YMR L+
Sbjct: 1   TTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMGQNVADYMRYLM 60

Query: 536 EDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKL 357
           E++ + Y+  FS YIK  +  D +E++YKK HAAIR +P  +K  K+  K+ KR+N  K+
Sbjct: 61  EEDEDAYKKQFSQYIKNSVTPDMMEEMYKKAHAAIRENPVYEKKPKKEVKK-KRWNRPKM 119

Query: 356 TYEERK 339
           +  ++K
Sbjct: 120 SLAQKK 125



>gb:BT012458_1358120 Drosophila melanogaster RE57391 full insert
           cDNA.
          Length = 137

 Score =  114 bits (285), Expect = 4e-24
 Identities = 57/110 (51%), Positives = 77/110 (70%), Gaps = 1/110 (0%)
 Frame = -2

Query: 656 IPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGID 477
           IPHS KRF G+S ++K  +A+VHR +I+G HVA YMR+L E++ E ++  FS YIK GI 
Sbjct: 11  IPHSVKRFPGYSAETKSFNADVHRAHIFGQHVADYMRSLEEEDEESFKRQFSRYIKLGIR 70

Query: 476 ADNLEQLYKKVHAAIRADPSAK-KSEKQPPKEHKRYNLKKLTYEERKASL 330
           AD+LE +YKK H AIR DP+ K  ++K      KR+N KKLT E+RK  +
Sbjct: 71  ADDLEDIYKKAHQAIRNDPTHKVTAKKSSAVTKKRWNAKKLTNEQRKTKI 120



>gb:AF051242_1764231 Picea mariana probable 60S ribosomal protein L5
           (Sb58) mRNA, partial cds.
          Length = 89

 Score =  111 bits (277), Expect = 3e-23
 Identities = 56/82 (68%), Positives = 64/82 (78%)
 Frame = -2

Query: 542 LIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLK 363
           L EDEPEKYQ  FS Y KKGI+ +N+E+LYKKVHAAIRADP+ K +EK  PK  K Y  +
Sbjct: 2   LREDEPEKYQFQFSEYHKKGIEPENIEELYKKVHAAIRADPTIKYTEKHVPKVQKHYLTR 61

Query: 362 KLTYEERKASLISRLNALNAAA 297
           KLTYEERK  LI+RLNALNA A
Sbjct: 62  KLTYEERKNKLIARLNALNAGA 83



>gb:AY149443_1304060 Euprymna scolopes 60S ribosomal protein L5
           mRNA, partial cds.
          Length = 132

 Score =  101 bits (252), Expect = 3e-20
 Identities = 51/106 (48%), Positives = 73/106 (68%)
 Frame = -2

Query: 656 IPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVAAYMRNLIEDEPEKYQSVFSAYIKKGID 477
           +PH+ KRF G+  ++ + +AEVHR +I+G HV+ YM +L E+  E Y+  FS YIK GI 
Sbjct: 11  VPHNIKRFPGYDAENGEFNAEVHRDHIFGKHVSDYMVSLKEENEEAYRRQFSRYIKLGIC 70

Query: 476 ADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERK 339
           AD +E++YKK HAAIRADP  K   K+   + KR+N KK+  ++RK
Sbjct: 71  ADVIEKMYKKAHAAIRADPEHKPVPKKTVTK-KRHNAKKIGNKQRK 115



>gb:AY713111_1348110 Ithomia salapia derasa voucher 8922 ribosomal
           protein L5 (L5) gene, partial cds.
          Length = 110

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 52/101 (51%), Positives = 64/101 (63%), Gaps = 1/101 (0%)
 Frame = -2

Query: 992 IIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEY 813
           +  QI  + I GD I+ +AY+HELPRYG++VG TNYAAAYCTG          L +   Y
Sbjct: 1   VTCQIAYSRIEGDHIVCAAYSHELPRYGIKVGLTNYAAAYCTGLLVARRLLQRLGLDSLY 60

Query: 812 EGNVEATGEDYSVEP-GEGRRPFRALLDVGLLRTTTGNRVF 693
            G  E TG++++VEP   G   FR  LDVGL RTTTG RVF
Sbjct: 61  AGATEVTGDEFNVEPVDNGPGAFRCYLDVGLARTTTGARVF 101



>gb:AY713101_1348100 Ithomia iphianassa n. ssp. RM-2005 voucher 8107
           ribosomal protein L5 (L5) gene, partial
           cds.>gb:AY713102_1348101 Ithomia iphianassa panamensis
           voucher 8102 ribosomal protein L5 (L5) gene, partial
           cds.>gb:AY713104_1348103 Ithomia iphianassa panamensis
           voucher 8804 ribosomal protein L5 (L5) gene, partial
           cds.
          Length = 107

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 52/101 (51%), Positives = 64/101 (63%), Gaps = 1/101 (0%)
 Frame = -2

Query: 992 IIAQIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEY 813
           +  QI  + I GD I+ +AY+HELPRYG++VG TNYAAAYCTG          L +   Y
Sbjct: 1   VTCQIAYSRIEGDHIVCAAYSHELPRYGIKVGLTNYAAAYCTGLLVARRLLQRLGLDSLY 60

Query: 812 EGNVEATGEDYSVEP-GEGRRPFRALLDVGLLRTTTGNRVF 693
            G  E TG++++VEP   G   FR  LDVGL RTTTG RVF
Sbjct: 61  AGATEVTGDEFNVEPVDNGPGAFRCYLDVGLARTTTGARVF 101



>gb:AY713106_1348105 Ithomia patilla voucher 8031 ribosomal protein
           L5 (L5) gene, partial cds.
          Length = 106

 Score = 97.8 bits (242), Expect = 4e-19
 Identities = 52/98 (53%), Positives = 63/98 (64%), Gaps = 1/98 (1%)
 Frame = -2

Query: 983 QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGN 804
           QI  + I GD I+ +AY+HELPRYG++VG TNYAAAYCTG          L +   Y G 
Sbjct: 3   QIAYSRIEGDHIVCAAYSHELPRYGIKVGLTNYAAAYCTGLLVARRLLQRLGLDSLYAGA 62

Query: 803 VEATGEDYSVEP-GEGRRPFRALLDVGLLRTTTGNRVF 693
            E TG++++VEP   G   FR  LDVGL RTTTG RVF
Sbjct: 63  TEVTGDEFNVEPVDNGPGAFRCYLDVGLARTTTGARVF 100



>gb:AY713099_1348098 Ithomia heraldica heraldica voucher 8005
           ribosomal protein L5 (L5) gene, partial
           cds.>gb:AY713100_1348099 Ithomia heraldica heraldica
           voucher 8006 ribosomal protein L5 (L5) gene, partial
           cds.>gb:AY713110_1348109 Ithomia salapia derasa voucher
           8921 ribosomal protein L5 (L5) gene, partial cds.
          Length = 107

 Score = 97.8 bits (242), Expect = 4e-19
 Identities = 52/98 (53%), Positives = 63/98 (64%), Gaps = 1/98 (1%)
 Frame = -2

Query: 983 QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGN 804
           QI  + I GD I+ +AY+HELPRYG++VG TNYAAAYCTG          L +   Y G 
Sbjct: 2   QIAYSRIEGDHIVCAAYSHELPRYGIKVGLTNYAAAYCTGLLVARRLLQRLGLDSLYAGA 61

Query: 803 VEATGEDYSVEP-GEGRRPFRALLDVGLLRTTTGNRVF 693
            E TG++++VEP   G   FR  LDVGL RTTTG RVF
Sbjct: 62  TEVTGDEFNVEPVDNGPGAFRCYLDVGLARTTTGARVF 99



>gb:AY713096_1348095 Ithomia eleonora voucher 9114 ribosomal protein
           L5 (L5) gene, partial cds.>gb:AY713103_1348102 Ithomia
           iphianassa n. ssp. RM-2005 voucher 8912 ribosomal
           protein L5 (L5) gene, partial cds.>gb:AY713105_1348104
           Ithomia patilla voucher 8028 ribosomal protein L5 (L5)
           gene, partial cds.>gb:AY713107_1348106 Ithomia
           praeithomia voucher 9116 ribosomal protein L5 (L5) gene,
           partial cds.>gb:AY713108_1348107 Ithomia salapia aquinia
           voucher 8918 ribosomal protein L5 (L5) gene, partial
           cds.
          Length = 108

 Score = 97.8 bits (242), Expect = 4e-19
 Identities = 52/98 (53%), Positives = 63/98 (64%), Gaps = 1/98 (1%)
 Frame = -2

Query: 983 QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGN 804
           QI  + I GD I+ +AY+HELPRYG++VG TNYAAAYCTG          L +   Y G 
Sbjct: 2   QIAYSRIEGDHIVCAAYSHELPRYGIKVGLTNYAAAYCTGLLVARRLLQRLGLDSLYAGA 61

Query: 803 VEATGEDYSVEP-GEGRRPFRALLDVGLLRTTTGNRVF 693
            E TG++++VEP   G   FR  LDVGL RTTTG RVF
Sbjct: 62  TEVTGDEFNVEPVDNGPGAFRCYLDVGLARTTTGARVF 99



>gb:AY713093_1348092 Ithomia diasia hippocrenis voucher 2985
           ribosomal protein L5 (L5) gene, partial
           cds.>gb:AY713097_1348096 Ithomia hyala hyala voucher
           8910 ribosomal protein L5 (L5) gene, partial
           cds.>gb:AY713109_1348108 Ithomia salapia aquinia voucher
           8919 ribosomal protein L5 (L5) gene, partial
           cds.>gb:AY713112_1348111 Ithomia xenos xenos voucher
           8332 ribosomal protein L5 (L5) gene, partial
           cds.>gb:AY713114_1348113 Ithomia xenos xenos voucher
           8004 ribosomal protein L5 (L5) gene, partial cds.
          Length = 105

 Score = 97.8 bits (242), Expect = 4e-19
 Identities = 52/98 (53%), Positives = 63/98 (64%), Gaps = 1/98 (1%)
 Frame = -2

Query: 983 QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGN 804
           QI  + I GD I+ +AY+HELPRYG++VG TNYAAAYCTG          L +   Y G 
Sbjct: 2   QIAYSRIEGDHIVCAAYSHELPRYGIKVGLTNYAAAYCTGLLVARRLLQRLGLDSLYAGA 61

Query: 803 VEATGEDYSVEP-GEGRRPFRALLDVGLLRTTTGNRVF 693
            E TG++++VEP   G   FR  LDVGL RTTTG RVF
Sbjct: 62  TEVTGDEFNVEPVDNGPGAFRCYLDVGLARTTTGARVF 99



>gb:AY713092_1348091 Ithomia cleora voucher 8904 ribosomal protein
           L5 (L5) gene, partial cds.
          Length = 106

 Score = 97.8 bits (242), Expect = 4e-19
 Identities = 52/98 (53%), Positives = 63/98 (64%), Gaps = 1/98 (1%)
 Frame = -2

Query: 983 QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGN 804
           QI  + I GD I+ +AY+HELPRYG++VG TNYAAAYCTG          L +   Y G 
Sbjct: 1   QIAYSRIEGDHIVCAAYSHELPRYGIKVGLTNYAAAYCTGLLVARRLLQRLGLDSLYAGA 60

Query: 803 VEATGEDYSVEP-GEGRRPFRALLDVGLLRTTTGNRVF 693
            E TG++++VEP   G   FR  LDVGL RTTTG RVF
Sbjct: 61  TEVTGDEFNVEPVDNGPGAFRCYLDVGLARTTTGARVF 98



>gb:AY713098_1348097 Ithomia hyala n. ssp. RM-2004 voucher 8844
           ribosomal protein L5 (L5) gene, partial cds.
          Length = 99

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 50/92 (54%), Positives = 60/92 (65%), Gaps = 1/92 (1%)
 Frame = -2

Query: 965 IAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGE 786
           I GD I+ +AY+HELPRYG++VG TNYAAAYCTG          L +   Y G  E TG+
Sbjct: 2   IEGDHIVCAAYSHELPRYGIKVGLTNYAAAYCTGLLVARRLLQRLGLDSLYAGATEVTGD 61

Query: 785 DYSVEP-GEGRRPFRALLDVGLLRTTTGNRVF 693
           +++VEP   G   FR  LDVGL RTTTG RVF
Sbjct: 62  EFNVEPVDNGPGAFRCYLDVGLARTTTGARVF 93



>gb:AY713094_1348093 Ithomia diasia hippocrenis voucher 8286
           ribosomal protein L5 (L5) gene, partial
           cds.>gb:AY713095_1348094 Ithomia diasia hippocrenis
           voucher 8294 ribosomal protein L5 (L5) gene, partial
           cds.
          Length = 102

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 50/92 (54%), Positives = 60/92 (65%), Gaps = 1/92 (1%)
 Frame = -2

Query: 965 IAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGE 786
           I GD I+ +AY+HELPRYG++VG TNYAAAYCTG          L +   Y G  E TG+
Sbjct: 3   IEGDHIVCAAYSHELPRYGIKVGLTNYAAAYCTGLLVARRLLQRLGLDSLYAGATEVTGD 62

Query: 785 DYSVEP-GEGRRPFRALLDVGLLRTTTGNRVF 693
           +++VEP   G   FR  LDVGL RTTTG RVF
Sbjct: 63  EFNVEPVDNGPGAFRCYLDVGLARTTTGARVF 94



>gb:AY713113_1348112 Ithomia iphianassa n. ssp. RM-2005 voucher 8914
           ribosomal protein L5 (L5) gene, partial cds.
          Length = 97

 Score = 94.0 bits (232), Expect = 6e-18
 Identities = 50/96 (52%), Positives = 61/96 (63%), Gaps = 1/96 (1%)
 Frame = -2

Query: 983 QIVSASIAGDMILASAYAHELPRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGN 804
           QI  + I GD I+ +AY+HELPRYG++VG TNYAAAYCTG          L +   Y G 
Sbjct: 2   QIAYSRIEGDHIVCAAYSHELPRYGIKVGLTNYAAAYCTGLLVARRLLQRLGLDSLYAGA 61

Query: 803 VEATGEDYSVEP-GEGRRPFRALLDVGLLRTTTGNR 699
            E TG++++VEP   G   FR  LDVGL RTTTG R
Sbjct: 62  TEVTGDEFNVEPVDNGPGAFRCYLDVGLARTTTGAR 97



>pir|D90116|D90116 60S ribosomal protein L5 [imported] - Guillardia
            theta nucleomorph>gb:GTAJ10592_1681182 Guillardia theta
            DNA for complete sequence of nucleomorph chromosome 2.
          Length = 232

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 56/199 (28%), Positives = 98/199 (49%), Gaps = 1/199 (0%)
 Frame = -2

Query: 1094 GKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELPR 915
            GKTDY+ R +LI QDK K+   K R ++RF+ +++  Q+V++++ GD IL S+Y   L +
Sbjct: 26   GKTDYKKRMKLIRQDKKKFENKKKRIIIRFSKRNLSLQMVNSNVDGDFILLSSYLKNLSK 85

Query: 914  YGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRALL 735
               +    NY  +Y  G          ++ +E Y        ++YS +         A++
Sbjct: 86   LEYKNLTNNYPFSYLLGYYFGKDLIEKVKQSETY------NKKNYSSK-------ITAII 132

Query: 734  DVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDA-EVHRKYIYGGHVA 558
            D+GL R T GN+ F           +IPH+  +   F   + ++D+ E+  +   G H+ 
Sbjct: 133  DIGLKRATIGNKSFASMKGSVDSGINIPHNYNKI--FKVKNNEIDSKELFNERSKGIHII 190

Query: 557  AYMRNLIEDEPEKYQSVFS 501
             Y+  L  ++ EK +  FS
Sbjct: 191  KYIDLLKNEDEEKLKKQFS 209



>gb:AE009857_256572 Pyrobaculum aerophilum strain IM2 section 112 of
            201 of the complete genome.>gb:AE009441_899198
            Pyrobaculum aerophilum strain IM2 complete genome.
          Length = 205

 Score = 87.0 bits (214), Expect = 7e-16
 Identities = 68/222 (30%), Positives = 94/222 (42%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            EG T+YR R +L+   K        R VVR TNK IIAQIV A   GD+ +  A    L 
Sbjct: 16   EGLTNYRKRRKLLLSKKP-------RLVVRKTNKHIIAQIVVAKPQGDVTIVGADTRILA 68

Query: 917  RYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRAL 738
            ++G      N AAAY  G            +   Y+                 RR   A+
Sbjct: 69   KFGWRGDENNVAAAYLLG------------LVVGYKARA--------------RRVEEAI 102

Query: 737  LDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA 558
            LD+GL R   G RVF            IPH E+      +             I G HVA
Sbjct: 103  LDIGLHRPAPGARVFAVLKGALDAGLKIPHGEEVLPDEDR-------------IKGKHVA 149

Query: 557  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAI 432
             Y   L E+ PE Y++ FS Y+++G++ + L + +++V   I
Sbjct: 150  EYAEKLKEENPEAYKARFSRYLQRGLEPEKLPEHFEEVKKKI 191



>sp|P54044|RL18_METJA 50S ribosomal protein L18P.>pir|B64359|B64359
            ribosomal protein L18 - Methanococcus
            jannaschii>gb:U67497_206569 Methanocaldococcus jannaschii
            DSM 2661 section 39 of 150 of the complete
            genome.>gb:L77117_1099327 Methanocaldococcus jannaschii
            DSM 2661, complete genome.
          Length = 195

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 67/223 (30%), Positives = 98/223 (43%), Gaps = 1/223 (0%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            E KTDYR R +L+   K        R V R T    IAQIV     GD  + SA++ EL 
Sbjct: 16   EAKTDYRKRLKLLLSRKP-------RLVARRTLNHCIAQIVLYDEKGDKTVVSAHSRELI 68

Query: 917  RYGLEVGHT-NYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRA 741
            + G + GHT N  +AY TG                Y    +A  + Y+           A
Sbjct: 69   KLGYK-GHTGNLPSAYLTG----------------YLLGKKALAKGYT----------EA 101

Query: 740  LLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHV 561
            +LD+GL R T GN +F           +IPH E+      +             I G H+
Sbjct: 102  VLDIGLHRATKGNAIFAILKGALDAGMEIPHGEEILPSEER-------------IRGEHI 148

Query: 560  AAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAI 432
             AY   L E + E+Y+  FS Y++KG++ + L + ++++ A I
Sbjct: 149  KAYAEMLKEQDEERYKKQFSKYLEKGLEPEKLPEHFEEIKAKI 191



>sp|O26130|RL18_METTH 50S ribosomal protein L18P.>pir|B69127|B69127
            ribosomal protein L5 - Methanobacterium
            thermoautotrophicum  (strain Delta H)>gb:AE000796_27727
            Methanobacterium thermoautotrophicum from bases 10151 to
            26221 (section 2 of 148) of the complete
            genome.>gb:AE000666_924809 Methanobacterium
            thermoautotrophicum str. Delta H complete genome.
          Length = 192

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 64/222 (28%), Positives = 95/222 (42%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            EGKTDYRAR +++        T K R VVR T   +IAQI++  + GD  L SA++ +L 
Sbjct: 16   EGKTDYRARYKMVE-------TGKSRLVVRITTYHVIAQIINVGMNGDETLVSAHSKQLQ 68

Query: 917  RYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRAL 738
            + G   G +N AAAY TG                Y     A  E              A+
Sbjct: 69   KMGWLGGTSNTAAAYLTG----------------YLCGKRALKEGIE----------EAV 102

Query: 737  LDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA 558
            LD+GL     G++VF           ++PH E      S+             I G H+ 
Sbjct: 103  LDIGLRPAIRGSKVFAALKGAVDAGLNVPHGESVLPDESR-------------IRGEHIM 149

Query: 557  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAI 432
             Y  +L E+E  K    FS Y+++G+   +L + + ++   I
Sbjct: 150  EYAESLDEEELRKR---FSKYLERGLSPVDLPEHFDEIKKRI 188



>gb:AE010304_261662 Methanopyrus kandleri AV19 section 3 of 157 of the
            complete genome.>gb:AE009439_902443 Methanopyrus kandleri
            AV19, complete genome.
          Length = 202

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 66/226 (29%), Positives = 98/226 (43%), Gaps = 1/226 (0%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            EGKT+Y  R  LI  D         R V R T    IAQIV  +  GD+ LASA++ EL 
Sbjct: 19   EGKTNYYKRRELIKADAP-------RLVARKTLNHNIAQIVDFAPHGDVTLASAHSIELR 71

Query: 917  -RYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRA 741
             ++G +    N  AAY TG                 E  +E                 RA
Sbjct: 72   NKFGWKGHCGNTPAAYLTGYLCGLRAL---------ERGIE-----------------RA 105

Query: 740  LLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHV 561
            ++D+GL R   G+RVF           DIPH E+      +             I G H+
Sbjct: 106  VIDIGLHRPVRGSRVFAMLKGALDAGMDIPHGEEVLPPEDR-------------IRGEHI 152

Query: 560  AAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRAD 423
            A   R + E++PE+Y+  FS Y+++G+  + L + +++V + I  +
Sbjct: 153  ANLARQIKEEDPEEYERRFSKYLERGLKPEELPEHFEEVKSKIEEE 198



>sp|Q9YF94|RL18_AERPE 50S ribosomal protein L18P.>pir|B72726|B72726
            probable ribosomal protein L18 APE0347 - Aeropyrum pernix
             (strain K1)>gb:BA000002_651046 Aeropyrum pernix K1 DNA,
            complete genome.
          Length = 214

 Score = 74.3 bits (181), Expect = 5e-12
 Identities = 66/223 (29%), Positives = 98/223 (43%), Gaps = 1/223 (0%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHEL- 921
            EGKT+Y  R RL+   K        R  VR +N+ +  Q + A I GD ++A+A++ EL 
Sbjct: 16   EGKTNYYRRFRLVKSGKP-------RMAVRISNEYLWVQFLEARIEGDRVIAAAHSRELI 68

Query: 920  PRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRA 741
             ++G +    N  AAY TG                Y   + A      +E G       A
Sbjct: 69   KKFGWKGDGNNTCAAYLTG----------------YLAGLRA------LEKGVR----EA 102

Query: 740  LLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHV 561
            +LDVGL +   G+RVF           +IPHSE+   G        D  V  +     H+
Sbjct: 103  VLDVGLHKPVKGSRVFAALKGALDAGVEIPHSEEILPG--------DERVRCE-----HI 149

Query: 560  AAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAI 432
            A +   L E+  E YQ  FS Y+ +G++ + L    ++V  AI
Sbjct: 150  AQWAEALKEENAELYQRQFSRYLDRGLNPEELPGHVEEVKKAI 192



>gb:AE017199_402908 Nanoarchaeum equitans Kin4-M, complete genome.
          Length = 195

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 61/222 (27%), Positives = 94/222 (42%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            EGKT YR R +L+   K        R VVR  N +I+AQ+V     GD ++ + +++ L 
Sbjct: 16   EGKTVYRKRLKLLLSGKP-------RLVVRRFNSNILAQLVEYDPKGDRVIFTIHSNVLK 68

Query: 917  RYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRAL 738
            +YG +    N  +AY  G                     EA    Y            A+
Sbjct: 69   KYGWKGHRGNLPSAYLVGLIA----------------GYEALKRGYK----------EAV 102

Query: 737  LDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA 558
            LD+G  ++T GN ++           +IPHSE       +             I G H+A
Sbjct: 103  LDIGRYKSTKGNALYAVLKGALDAGLNIPHSETILPSEDR-------------IRGEHIA 149

Query: 557  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAI 432
             Y + L E+E E Y+  FS Y+K+G+D + L   +++V   I
Sbjct: 150  NYAKMLKENE-ELYKKQFSRYLKEGLDPEQLPNHFEEVKQKI 190



>gb:BX957222_844671 Methanococcus maripaludis S2 complete genome;
            segment 4/5.
          Length = 193

 Score = 70.1 bits (170), Expect = 9e-11
 Identities = 65/222 (29%), Positives = 98/222 (44%), Gaps = 4/222 (1%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            EGKTD+R R  L+   K        R V R +  ++ AQ+++    GD++L SA++ EL 
Sbjct: 16   EGKTDFRQRLGLLLSGKP-------RLVARKSLNNVTAQLMAYDEKGDVVLVSAHSKELV 68

Query: 917  RYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRAL 738
            + G +    N  AAY TG                     +A  ED             A+
Sbjct: 69   KMGYKGHCGNLPAAYLTGLLL----------------GAKAVKEDVK----------EAV 102

Query: 737  LDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA 558
            LD GL R T G  +F           DIPH +K  A    D ++L+         G HV 
Sbjct: 103  LDKGLHRATKGAAIFAVLKGALDAGMDIPHGDKIIA----DEERLN---------GTHVK 149

Query: 557  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNL----EQLYKKV 444
             Y  +L ED  + Y+  FS Y++KG++ ++L    E+L +K+
Sbjct: 150  NYAESLKED-ADAYKKQFSKYLEKGLNPEDLPEHVEELKEKI 190



>sp|Q9UX88|RL18_SULSO 50S ribosomal protein L18P.>pir|A99218|A99218
            lSU ribosomal protein L18AB (rpl18AB) [imported] -
            Sulfolobus solfataricus>gb:SSU18930_191231 Sulfolobus
            solfataricus 281 kb genomic DNA fragment, strain
            P2.>gb:AE006696_221598 Sulfolobus solfataricus P2 section
            55 of 272 of the complete genome.>gb:AE006641_1107446
            Sulfolobus solfataricus P2, complete genome.
          Length = 199

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 58/225 (25%), Positives = 92/225 (40%), Gaps = 1/225 (0%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHEL- 921
            EGKT+Y  R   +   +        RF+VR TNK +I QI      GD+++ASA++ EL 
Sbjct: 19   EGKTNYYKRYVYVISKQT-------RFIVRITNKYVIVQIAKIDPKGDIMIASAHSAELA 71

Query: 920  PRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRA 741
             ++G +    N  AAY TG                Y   + A            R     
Sbjct: 72   KKFGWKGDENNTPAAYLTG----------------YLAGLRAI----------KRGVTEC 105

Query: 740  LLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHV 561
            + D+GL   + GNRVF            IP                D  +    I G H+
Sbjct: 106  VADIGLHVPSKGNRVFYVIKGAIDAGLKIPIG--------------DISIENDRIKGEHI 151

Query: 560  AAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRA 426
            A Y   L  +  + Y  +FS Y+++G++ +NL   ++++   I++
Sbjct: 152  AKYAEKLKSENSDLYSKLFSRYLQRGLNPENLPSHFEEILNKIKS 196



>sp|Q9V1V4|RL18_PYRAB 50S ribosomal protein L18P.>pir|E75145|E75145
            lsu ribosomal protein l18p (rpl18p) PAB2135 - Pyrococcus
            abyssi (strain Orsay)>gb:CNSPAX02_849083 Pyrococcus
            abyssi complete genome; segment 2/6.
          Length = 203

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 66/223 (29%), Positives = 92/223 (41%), Gaps = 1/223 (0%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            EGKT+YR R +L+   K        R VVR +    IAQI+     GD  L SA+  EL 
Sbjct: 16   EGKTNYRKRLKLLKSGKP-------RLVVRKSLNHHIAQIIVYDPKGDRTLVSAHTRELI 68

Query: 917  RYGLEVGHT-NYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRA 741
            R     GH  N  +AY  G                Y+       E              A
Sbjct: 69   RDFGWKGHCGNTPSAYLLGLLIG------------YKAKKAGIEE--------------A 102

Query: 740  LLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHV 561
            +LD+GL     G+ VF           ++PHS + F            E +R  I G H+
Sbjct: 103  ILDIGLHPPVRGSSVFAVLKGAVDAGLNVPHSPEIFP-----------EDYR--IRGEHI 149

Query: 560  AAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAI 432
            A Y R L E + EK++  F  Y++KG+D + L + + +V A I
Sbjct: 150  AEYARMLKEQDEEKFRRQFGGYLEKGLDPEKLPEHFDEVKARI 192



>sp|P14033|RL18_METVA 50S ribosomal protein L18P.>pir|S05623|R5MX18
            ribosomal protein L18 - Methanococcus
            vannielii>gb:MVRPOP_151785 Methanococcus vanelli DNA for
            transcriptional unit for ribosomal proteins.
          Length = 195

 Score = 69.3 bits (168), Expect = 2e-10
 Identities = 65/222 (29%), Positives = 98/222 (44%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            EGKTD+R R  L+   K        R V R +  +IIAQ+++    GD++L SA++ EL 
Sbjct: 18   EGKTDFRQRLGLLLSGKP-------RLVARKSLNNIIAQLMAYDEKGDIVLVSAHSRELV 70

Query: 917  RYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRAL 738
            + G +    N  AAY TG                            +VE G       A+
Sbjct: 71   KMGYKGHCGNLPAAYLTGLLLGKK----------------------AVEEGLE----EAI 104

Query: 737  LDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA 558
            LD GL R T G  +F           DIP  E+  A    D ++L+         G H+ 
Sbjct: 105  LDKGLHRATKGAAIFAVLKGALDAGMDIPCGEEIIA----DEERLN---------GTHIK 151

Query: 557  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAI 432
             Y   L EDE E Y+  FS Y++KG++ ++L + ++++   I
Sbjct: 152  QYAELLKEDE-EAYKKQFSKYLEKGLNPEDLPEHFEELKGKI 192



>gb:AY684288_2543886 Sparus aurata ribosomal protein L5 mRNA,
           partial cds.
          Length = 98

 Score = 68.6 bits (166), Expect = 3e-10
 Identities = 35/80 (43%), Positives = 53/80 (66%), Gaps = 2/80 (2%)
 Frame = -2

Query: 572 GGHVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQP 393
           G +V+ YM  L+E++ + Y+  FS +IK G+  D++E++YKK HA IR +P     EK+P
Sbjct: 2   GVNVSEYMSLLMEEDEDAYKKQFSRFIKNGVTPDSIEEMYKKAHATIRENP---VHEKKP 58

Query: 392 PKE--HKRYNLKKLTYEERK 339
           PKE   KR+N  KL+  +RK
Sbjct: 59  PKEVKKKRWNRAKLSLAQRK 78



>gb:AP006878_576674 Thermococcus kodakaraensis strain KOD1 DNA,
            complete genome.
          Length = 201

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 63/223 (28%), Positives = 94/223 (42%), Gaps = 1/223 (0%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            EGKT+Y  R +L+   K        R VVR T    IAQIV     GD  L SA+  EL 
Sbjct: 16   EGKTNYHKRLKLLKSKKP-------RLVVRKTLNHHIAQIVVYDPKGDKTLVSAHTMELM 68

Query: 917  R-YGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRA 741
            R +G +    N  +AY  G                 +  +E                  A
Sbjct: 69   RDFGWKGHGGNTPSAYLLGLLIGYKAK---------QAGIE-----------------EA 102

Query: 740  LLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHV 561
            +LD+GL   T G+ +F           ++PHSE+ +            E +R  I G H+
Sbjct: 103  ILDIGLHPPTRGSSIFAVLKGAVDAGLNVPHSEEIYP-----------EDYR--INGEHI 149

Query: 560  AAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAI 432
            A Y + L E++   Y+  FS Y+ KG++ + L + +++V A I
Sbjct: 150  ANYAKALKEEDEALYRKQFSGYLVKGLEPEKLPEHFEEVKAKI 192



>pir|A71185|A71185 probable ribosomal protein L18 - Pyrococcus
            horikoshii>gb:BA000001_650434 Pyrococcus horikoshii OT3
            DNA, complete genome.
          Length = 206

 Score = 67.4 bits (163), Expect = 6e-10
 Identities = 63/223 (28%), Positives = 93/223 (41%), Gaps = 1/223 (0%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            EGKT+YR R +L+   K        R VVR +    IAQI+     GD  L SA+  EL 
Sbjct: 19   EGKTNYRKRLKLLKSGKP-------RLVVRKSLNHHIAQIIVYDPKGDRTLVSAHTRELI 71

Query: 917  RYGLEVGHT-NYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRA 741
            R     GH  N  +AY  G                Y+       E              A
Sbjct: 72   RDFGWKGHCGNTPSAYLLGLLIG------------YKAKKAGIEE--------------A 105

Query: 740  LLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHV 561
            +LD+GL     G+ +F           ++PHS + F            E +R  I G H+
Sbjct: 106  ILDIGLHPPVRGSSIFAVLKGAIDAGLNVPHSPEIFP-----------EDYR--IRGEHI 152

Query: 560  AAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAI 432
            A Y R L E + ++++  F  Y++KG+D + L + +++V A I
Sbjct: 153  AEYARMLKEQDEDRFRRQFGGYLEKGLDPEKLPEHFEEVKARI 195



>sp|O59438|RL18_PYRHO 50S ribosomal protein L18P.
          Length = 203

 Score = 67.4 bits (163), Expect = 6e-10
 Identities = 63/223 (28%), Positives = 93/223 (41%), Gaps = 1/223 (0%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            EGKT+YR R +L+   K        R VVR +    IAQI+     GD  L SA+  EL 
Sbjct: 16   EGKTNYRKRLKLLKSGKP-------RLVVRKSLNHHIAQIIVYDPKGDRTLVSAHTRELI 68

Query: 917  RYGLEVGHT-NYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRA 741
            R     GH  N  +AY  G                Y+       E              A
Sbjct: 69   RDFGWKGHCGNTPSAYLLGLLIG------------YKAKKAGIEE--------------A 102

Query: 740  LLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHV 561
            +LD+GL     G+ +F           ++PHS + F            E +R  I G H+
Sbjct: 103  ILDIGLHPPVRGSSIFAVLKGAIDAGLNVPHSPEIFP-----------EDYR--IRGEHI 149

Query: 560  AAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAI 432
            A Y R L E + ++++  F  Y++KG+D + L + +++V A I
Sbjct: 150  AEYARMLKEQDEDRFRRQFGGYLEKGLDPEKLPEHFEEVKARI 192



>gb:AB040118_6468 Pyrococcus furiosus genes for ribosomal protein,
            complete cds.>gb:AE010278_261372 Pyrococcus furiosus DSM
            3638, section 153 of 173 of the complete
            genome.>gb:AE009950_902153 Pyrococcus furiosus DSM 3638,
            complete genome.
          Length = 203

 Score = 67.0 bits (162), Expect = 8e-10
 Identities = 62/223 (27%), Positives = 90/223 (40%), Gaps = 1/223 (0%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            EGKT+YR R +L+   K        R VVR +    IAQI+     GD  L SA+  EL 
Sbjct: 16   EGKTNYRKRLKLLKSGKP-------RLVVRKSLNHHIAQIIVYDPKGDRTLVSAHTRELI 68

Query: 917  RYGLEVGHT-NYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRA 741
            R     GH  N  +AY  G                 +  +E                  A
Sbjct: 69   RDFGWKGHCGNTPSAYLLGLLIGYKAK---------QAGIE-----------------EA 102

Query: 740  LLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHV 561
            +LD+GL     G+ VF           ++PHS + F    +             I G H+
Sbjct: 103  ILDIGLHPPVRGSSVFAVLKGAVDAGLNVPHSPEIFPDEYR-------------IRGEHI 149

Query: 560  AAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAI 432
            A Y + L E + EK++  F  Y+ KG+D + L + +++V A I
Sbjct: 150  AEYAKMLKEQDEEKFRRQFGGYLVKGLDPEKLPEHFEEVKARI 192



>gb:GGU31753_2573592 Gallus gallus ribosomal protein L5 mRNA,
           partial cds.
          Length = 96

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 33/76 (43%), Positives = 50/76 (65%)
 Frame = -2

Query: 566 HVAAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPK 387
           +VA YMR L+E++ + Y+  FS YIK  I  D +E++YKK HAAIR +P  +K  K+  K
Sbjct: 2   NVADYMRYLMEEDEDAYKKQFSQYIKNNITPDGMEEMYKKAHAAIRDNPVHEKKPKREVK 61

Query: 386 EHKRYNLKKLTYEERK 339
           + KR N  K++  ++K
Sbjct: 62  K-KRVNSTKMSLAQKK 76



>gb:BA000023_690984 Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 196

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 58/225 (25%), Positives = 93/225 (41%), Gaps = 1/225 (0%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHEL- 921
            EGKT+Y  R   +  +         R VVR TNK IIAQI   +  GD+I+ +A++ EL 
Sbjct: 16   EGKTNYYKRYTYVINNTT-------RLVVRLTNKYIIAQIAKFNPKGDVIVVAAHSMELA 68

Query: 920  PRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRA 741
             ++G +    N  AAY TG                Y   V A                 A
Sbjct: 69   KKFGWKGDLNNTPAAYLTG----------------YLLGVRALKAGIK----------EA 102

Query: 740  LLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHV 561
            + D+GL     G+R+F            IP                D  +    I G H+
Sbjct: 103  VADIGLFVPVKGSRIFTAIKGAIDAGLSIPVG--------------DLGIKEDRIKGVHI 148

Query: 560  AAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRA 426
            A+Y + L  + PE ++ +FS Y+++G+   +L   ++++   I++
Sbjct: 149  ASYAQKLEAENPELFKRLFSKYLERGLHPKDLPSHFEEILNKIKS 193



>sp|O05640|RL18_SULAC 50S ribosomal protein L18P.>gb:SSSPCOPER_191035
            S.acidocaldarius DNA for spc operon.
          Length = 197

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 58/219 (26%), Positives = 88/219 (40%), Gaps = 1/219 (0%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHEL- 921
            EGKTDY  R   +  +         RFV R TNK +I  +      GD+++A A++ EL 
Sbjct: 16   EGKTDYYTRYTYVINNA-------IRFVPRLTNKYVIVSVSKFDQKGDIMIAYAHSIELV 68

Query: 920  PRYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRA 741
             +YG +    N  AAY TG                Y   + A                 A
Sbjct: 69   KKYGWKGDTNNTPAAYLTG----------------YLAGLRAVKSGVKA----------A 102

Query: 740  LLDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHV 561
            + D+GL     G R+F            +P  +    G  KD            + G H+
Sbjct: 103  VSDIGLFVPVKGGRIFAVIKGAIDAGLKVPVGD---LGKLKDR-----------VNGSHI 148

Query: 560  AAYMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKV 444
            +AY + L  +  E Y  +FS+YI++G+D   L Q +++V
Sbjct: 149  SAYAQKLKNENQELYNKLFSSYIQRGLDPVLLPQHFEEV 187



>gb:MMRPL5_2117264 M.musculus mRNA for ribosomal protein L5, 3'end.
          Length = 92

 Score = 63.5 bits (153), Expect = 8e-09
 Identities = 30/72 (41%), Positives = 48/72 (66%)
 Frame = -2

Query: 554 YMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKR 375
           YMR L+E++ + Y+  FS YIK  +  D +E++YKK HAAIR +P  +K  K+  K+ KR
Sbjct: 2   YMRYLMEEDEDAYKKQFSQYIKNNVTPDMMEEMYKKAHAAIRENPVYEKKPKREVKK-KR 60

Query: 374 YNLKKLTYEERK 339
           +N  K++  ++K
Sbjct: 61  WNRPKMSLAQKK 72



>pir|S50100|S50100 ribosomal protein L5, cytosolic - mouse
           (fragments)
          Length = 110

 Score = 63.5 bits (153), Expect = 8e-09
 Identities = 30/72 (41%), Positives = 48/72 (66%)
 Frame = -2

Query: 554 YMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKR 375
           YMR L+E++ + Y+  FS YIK  +  D +E++YKK HAAIR +P  +K  K+  K+ KR
Sbjct: 20  YMRYLMEEDEDAYKKQFSQYIKNNVTPDMMEEMYKKAHAAIRENPVYEKKPKREVKK-KR 78

Query: 374 YNLKKLTYEERK 339
           +N  K++  ++K
Sbjct: 79  WNRPKMSLAQKK 90



>sp|O28373|RL18_ARCFU 50S ribosomal protein L18P.>pir|A69488|A69488
            LSU ribosomal protein L18P (rpl18P) homolog -
            Archaeoglobus fulgidus>gb:AE000971_29998 Archaeoglobus
            fulgidus DSM 4304 section 136 of 172 of the complete
            genome.>gb:AE000782_975782 Archaeoglobus fulgidus DSM
            4304 complete genome.
          Length = 189

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 60/211 (28%), Positives = 87/211 (41%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            EGKT+YR R +L+   K        R VVR TN+ +IAQIV  +  GD ++    +  L 
Sbjct: 18   EGKTNYRKRLKLLLSRKP-------RLVVRITNRRVIAQIVEYAPEGDRVVVGVDSAMLR 70

Query: 917  RYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRAL 738
             +G +    N  AAY TG                            +++ G G     A+
Sbjct: 71   EFGWKGDLNNTPAAYLTGILIAKK----------------------ALQKGIG----EAV 104

Query: 737  LDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA 558
            LD+GL   T G+RVF           ++PHS++     S+             I G H+A
Sbjct: 105  LDIGLHTPTRGSRVFAVLRGAVEGGLEVPHSDEVLPDDSR-------------IRGEHIA 151

Query: 557  AYMRNLIEDEPEKYQSVFSAYIKKGIDADNL 465
            AY     E  PE+    F  Y K+G+   +L
Sbjct: 152  AY----YEMNPER----FGEYEKRGLKPSDL 174



>gb:BA000011_664790 Thermoplasma volcanium GSS1 DNA, complete genome.
          Length = 160

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 54/165 (32%), Positives = 68/165 (41%)
 Frame = -2

Query: 1094 GKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELPR 915
            GKTDY  R RL+            RF+VR TNK IIAQI   S+ GD ILA+     L +
Sbjct: 9    GKTDYGRRLRLLKSKDR-------RFIVRITNKGIIAQIAEYSVNGDRILATITDKALSK 61

Query: 914  YGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRALL 735
            YG+E+   N    Y  G                Y   VEA  +   VE         A+L
Sbjct: 62   YGIELRGNNLQICYLVG----------------YAAGVEA--QKAGVE--------TAVL 95

Query: 734  DVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLD 600
            D+G  +   G R+            DIPH E  F     D K+L+
Sbjct: 96   DIGRKKFRKGGRIAACLKGITDSGVDIPHGEDVF----PDKKRLN 136



>pir|G84323|G84323 50S ribosomal protein L18P [imported] -
            Halobacterium sp. NRC-1>gb:AE005077_63115 Halobacterium
            sp. NRC-1 section 108 of 170 of the complete
            genome.>gb:AE004437_888034 Halobacterium sp. NRC-1
            complete genome.
          Length = 183

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 55/191 (28%), Positives = 76/191 (39%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            E +TDY  R RL+   K        R V R +NK + AQ+V+    GD  +ASA++ +L 
Sbjct: 16   EVRTDYHQRLRLLKSGKP-------RLVARKSNKHVTAQLVTTGPDGDETVASAHSSDLD 68

Query: 917  RYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRAL 738
             YG      N  AAY TG                          D  VE         A+
Sbjct: 69   AYGWAAPTGNLPAAYLTGLLAGQRAV------------------DAGVE--------EAV 102

Query: 737  LDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA 558
            LD+GL   T G++VF           D+PH++   A +S+               G H+A
Sbjct: 103  LDIGLNTATPGSKVFAIQEGAIDAGLDVPHNDSVLADWSRTR-------------GEHIA 149

Query: 557  AYMRNLIEDEP 525
             Y  +L  DEP
Sbjct: 150  EYAESL--DEP 158



>sp|P50562|RL18_HALN1 50S ribosomal protein L18P.
          Length = 182

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 55/191 (28%), Positives = 76/191 (39%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            E +TDY  R RL+   K        R V R +NK + AQ+V+    GD  +ASA++ +L 
Sbjct: 15   EVRTDYHQRLRLLKSGKP-------RLVARKSNKHVTAQLVTTGPDGDETVASAHSSDLD 67

Query: 917  RYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRAL 738
             YG      N  AAY TG                          D  VE         A+
Sbjct: 68   AYGWAAPTGNLPAAYLTGLLAGQRAV------------------DAGVE--------EAV 101

Query: 737  LDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA 558
            LD+GL   T G++VF           D+PH++   A +S+               G H+A
Sbjct: 102  LDIGLNTATPGSKVFAIQEGAIDAGLDVPHNDSVLADWSRTR-------------GEHIA 148

Query: 557  AYMRNLIEDEP 525
             Y  +L  DEP
Sbjct: 149  EYAESL--DEP 157



>pir|S16541|R5HS18 ribosomal protein L18 [validated] - Haloarcula
            marismortui>gb:HMRIBOS_137324 H.marismortui genes HmaL5,
            HmaS14, HmaS8, HmaL6, HL5, HL24, HmaL18, HmaS5, HmaL30,
            and HmaL15 for ribosomal proteins.>gb:AY596297_632975
            Haloarcula marismortui ATCC 43049 chromosome I, complete
            sequence.
          Length = 187

 Score = 60.5 bits (145), Expect = 7e-08
 Identities = 54/188 (28%), Positives = 73/188 (38%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            E +TDY  R RL+   K        R V R +NK + AQ+V+    GD  LASA++ +L 
Sbjct: 16   EARTDYHQRLRLLKSGKP-------RLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLA 68

Query: 917  RYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRAL 738
             YG E    N  +AY TG                 E  VE                  A+
Sbjct: 69   EYGWEAPTGNMPSAYLTGLLAG---------LRAQEAGVE-----------------EAV 102

Query: 737  LDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA 558
            LD+GL   T G++VF           DIPH++   A + +               G H+A
Sbjct: 103  LDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTR-------------GAHIA 149

Query: 557  AYMRNLIE 534
             Y   L E
Sbjct: 150  EYDEQLEE 157



>sp|P14123|RL18_HALMA 50S ribosomal protein L18P (Hmal18) (Hl12).
          Length = 186

 Score = 60.5 bits (145), Expect = 7e-08
 Identities = 54/188 (28%), Positives = 73/188 (38%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            E +TDY  R RL+   K        R V R +NK + AQ+V+    GD  LASA++ +L 
Sbjct: 15   EARTDYHQRLRLLKSGKP-------RLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLA 67

Query: 917  RYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRAL 738
             YG E    N  +AY TG                 E  VE                  A+
Sbjct: 68   EYGWEAPTGNMPSAYLTGLLAG---------LRAQEAGVE-----------------EAV 101

Query: 737  LDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA 558
            LD+GL   T G++VF           DIPH++   A + +               G H+A
Sbjct: 102  LDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTR-------------GAHIA 148

Query: 557  AYMRNLIE 534
             Y   L E
Sbjct: 149  EYDEQLEE 156



>gb:AE010775_266452 Methanosarcina acetivorans str. C2A, section 120
            of 534 of the complete genome.>gb:AE010299_907011
            Methanosarcina acetivorans str. C2A, complete genome.
          Length = 174

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 48/196 (24%), Positives = 84/196 (42%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            EG+T+Y  R +L+   ++       R VVR +++++  Q+++ +  GD+  +SA ++EL 
Sbjct: 16   EGRTNYHLRLKLLLSRQD-------RVVVRKSSRNVQIQLIAPTPDGDITYSSAVSNELA 68

Query: 917  RYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRAL 738
            +YG      N  AAY TG            + + YEG +                     
Sbjct: 69   KYGYTGATGNTTAAYLTG-----LLFGLKSLQKGYEGGI--------------------- 102

Query: 737  LDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA 558
            LD+GL  ++ G+RV+           +IP S + F    +             I G H+A
Sbjct: 103  LDIGLQASSAGSRVYAALKGVVDSGFEIPCSPEVFPPDER-------------IRGEHIA 149

Query: 557  AYMRNLIEDEPEKYQS 510
             Y R    D PE++++
Sbjct: 150  GY-REESSDLPEQFEA 164



>sp|P19949|RL5_RABIT 60S ribosomal protein L5 (Fragments).
          Length = 101

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 26/47 (55%), Positives = 30/47 (63%)
 Frame = -2

Query: 1163 FIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTPKY 1023
            F+KV K +AY           REGKTDY AR RL+ QDKNKYNTP +
Sbjct: 2    FVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPAH 48



>gb:AY714857_1189972 Uncultured archaeon GZfos33E1 clone GZfos33E1,
            *** SEQUENCING IN PROGRESS ***.
          Length = 176

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 34/78 (43%), Positives = 41/78 (52%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            EGKTDYR R +L+   K        R VVR +NK I  Q+V     GD    S+ + EL 
Sbjct: 16   EGKTDYRRRLKLLFSRKP-------RVVVRKSNKHIRMQLVLFDQVGDKTFVSSTSSELK 68

Query: 917  RYGLEVGHTNYAAAYCTG 864
            R+G E G  N  AAY TG
Sbjct: 69   RFGYEGGTGNIPAAYLTG 86



>gb:AY714818_1188489 Uncultured archaeon GZfos12E2 clone GZfos12E2,
            *** SEQUENCING IN PROGRESS ***.
          Length = 176

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 34/78 (43%), Positives = 41/78 (52%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            EGKTDYR R +L+   K        R VVR +NK I  Q+V     GD    S+ + EL 
Sbjct: 16   EGKTDYRRRLKLLFSRKP-------RVVVRKSNKHIRMQLVLFDQVGDKTFVSSTSSELK 68

Query: 917  RYGLEVGHTNYAAAYCTG 864
            R+G E G  N  AAY TG
Sbjct: 69   RFGYEGGTGNIPAAYLTG 86



>pir|S00178|S00178 ribosomal protein L5 - rabbit (fragment)
          Length = 46

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 26/45 (57%), Positives = 29/45 (64%)
 Frame = -2

Query: 1163 FIKVQKTRAYXXXXXXXXXXXREGKTDYRARNRLINQDKNKYNTP 1029
            F+KV K +AY           REGKTDY AR RL+ QDKNKYNTP
Sbjct: 2    FVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTP 46



>gb:AE013454_292473 Methanosarcina mazei strain Goe1, section 236 of
            379 of the complete genome.>gb:AE008384_966582
            Methanosarcina mazei strain Goe1, complete genome.
          Length = 189

 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 48/196 (24%), Positives = 81/196 (41%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            EG+T+Y  R +L+   ++       R VVR + +++  Q+++ +  GD+  +SA + EL 
Sbjct: 31   EGRTNYHLRLKLLLSGQD-------RVVVRKSARNVQIQLLAPTPEGDITYSSAVSSELA 83

Query: 917  RYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRAL 738
            +YG      N  AAY TG            + + YEG +                     
Sbjct: 84   KYGYTGATGNTTAAYLTG-----LLFGLKSLQKGYEGGI--------------------- 117

Query: 737  LDVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAEVHRKYIYGGHVA 558
            LD+GL  ++ G+RV+           +IP S   F    +             I G H+A
Sbjct: 118  LDIGLQASSAGSRVYAALKGIVDSGFEIPCSSDVFPSDER-------------IRGEHIA 164

Query: 557  AYMRNLIEDEPEKYQS 510
             Y R    D PE++++
Sbjct: 165  EY-REESSDLPEQFEA 179



>gb:AY714862_1190152 Uncultured archaeon GZfos34H9 clone GZfos34H9,
            *** SEQUENCING IN PROGRESS ***.
          Length = 176

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 32/78 (41%), Positives = 40/78 (51%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            E KTDYR R +L+   K        R VVR +NK I  Q+V     GD    S+ + EL 
Sbjct: 16   EAKTDYRRRLKLLLSRKP-------RVVVRKSNKHIRMQLVLFDYVGDKTFVSSTSSELK 68

Query: 917  RYGLEVGHTNYAAAYCTG 864
             +G E G +N  AAY TG
Sbjct: 69   GFGYEGGTSNIPAAYLTG 86



>gb:TACID5_197006 Thermoplasma acidophilum complete genome; segment
            5/5.
          Length = 163

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 44/167 (26%), Positives = 65/167 (38%)
 Frame = -2

Query: 1094 GKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELPR 915
            G TDY  R +L+   +        RF+VR T K +IAQ+   S  GD IL +     L +
Sbjct: 12   GITDYSKRLKLLKSREK-------RFIVRITGKGVIAQVAEYSDIGDRILFTVTDKTLAK 64

Query: 914  YGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRALL 735
            YG+++   N    Y  G                Y   +E+  E   VE         A+L
Sbjct: 65   YGVDLRGNNIQVCYLVG----------------YIAGIES--EKNGVE--------SAVL 98

Query: 734  DVGLLRTTTGNRVFXXXXXXXXXXXDIPHSEKRFAGFSKDSKQLDAE 594
            D G  +   G R+            ++PH E  F     D K++D +
Sbjct: 99   DTGRRKFRKGGRIAACLKGFTDAGIEVPHGEDVF----PDKKRIDGK 141



>gb:AY714867_1190365 Uncultured archaeon GZfos37B2 clone GZfos37B2,
            *** SEQUENCING IN PROGRESS ***.
          Length = 174

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 43/150 (28%), Positives = 60/150 (40%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            EG+T+Y  R +L+   K        R VVR + + I  Q+      GDMIL+SA + EL 
Sbjct: 16   EGRTNYHKRLKLLLSKKP-------RMVVRKSARHIRLQLTIPEREGDMILSSATSIELG 68

Query: 917  RYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRAL 738
            +YG      N  AAY  G                 +G  E                   +
Sbjct: 69   KYGYSGSTGNSTAAYLAGLLFGYRTIS--------KGFTE------------------GV 102

Query: 737  LDVGLLRTTTGNRVFXXXXXXXXXXXDIPH 648
            LD+GL  +T+G+RV+           DIPH
Sbjct: 103  LDMGLHASTSGSRVYAALRGAVDAGMDIPH 132



>gb:AY534910_626217 Uncultured marine group II euryarchaeote
            DeepAnt-JyKC7 clone cosmid DeepAnt-JyKC7, complete
            sequence.
          Length = 171

 Score = 45.1 bits (105), Expect = 0.003
 Identities = 42/152 (27%), Positives = 57/152 (37%), Gaps = 3/152 (1%)
 Frame = -2

Query: 1094 GKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHEL-P 918
            G+TDYR R R++            R VVR +N     Q+++    GD ++ S     L  
Sbjct: 17   GETDYRRRMRMLRGGAT-------RAVVRVSNTQTTCQLINYDSTGDEVIISVTGKTLVD 69

Query: 917  RYG--LEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFR 744
            R+G  L+    +  A+Y TG                      A G               
Sbjct: 70   RFGWPLDASRKSVPASYLTGFALAKAAI--------------AAGHS------------E 103

Query: 743  ALLDVGLLRTTTGNRVFXXXXXXXXXXXDIPH 648
            A+LDVGL   T+GNRVF           DIPH
Sbjct: 104  AVLDVGLAAATSGNRVFAALRGMVDAGLDIPH 135



>gb:AF371263_1792416 Zea mays 50kD gamma zein mRNA, complete cds.
          Length = 295

 Score = 40.8 bits (94), Expect = 0.058
 Identities = 42/147 (28%), Positives = 62/147 (42%), Gaps = 2/147 (1%)
 Frame = +2

Query: 533 LQSDSSCMQQHGLHRCTCGEPQ-HQVVWNPC*I-PQTFFHCEECQVHHLVHP*EHQKHDS 706
           L S  SC Q  G   C+CG+ Q H+   +P    PQ   H    Q H      + Q+H  
Sbjct: 13  LVSSVSCTQTGG---CSCGQQQSHEQQHHPQQHHPQKQQHQPPPQHH------QQQQHQQ 63

Query: 707 QW*FVIDQHPKEHGKASCLHQVQQNNPLQWPQHFLHTLQPFQAFGEVAEPREVQCSKLQH 886
           Q    +   P++H +   +H  QQ    Q PQH               + ++ Q  + QH
Sbjct: 64  QQ---VHMQPQKHQQQQEVHVQQQQ---QQPQH--------------QQQQQQQQHQQQH 103

Query: 887 NLCGQPQGHNEAVHGHKQKQESCHQQY 967
              GQ Q H ++  GH Q+ E  H+Q+
Sbjct: 104 QCEGQQQHHQQS-QGHVQQHEQSHEQH 129



>gb:AB061848_1868824 Homo sapiens RPL5 gene for ribosomal protein
           L5, exons 7 and 8 and partial cds.
          Length = 62

 Score = 38.5 bits (88), Expect = 0.29
 Identities = 18/43 (41%), Positives = 30/43 (69%)
 Frame = -2

Query: 467 LEQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKKLTYEERK 339
           +E++YKK HAAIR +P  +K  K+  K+ KR+N  K++  ++K
Sbjct: 1   MEEMYKKAHAAIRENPVYEKKPKKEVKK-KRWNRPKMSLAQKK 42



>gb:AB042238_2045535 Cricetulus griseus ahr mRNA for Ah receptor,
           complete cds.
          Length = 941

 Score = 37.0 bits (84), Expect = 0.84
 Identities = 26/109 (23%), Positives = 46/109 (42%), Gaps = 7/109 (6%)
 Frame = +2

Query: 656 CQVHHLVHP*EHQKHDSQW*FVIDQHPKE-----HGKASCLHQVQQNNPLQWPQHFLHTL 820
           C +   +H  E Q+   Q    + QH  +     H       Q Q ++ ++  Q   H +
Sbjct: 607 CMLQERLHL-EQQQQQQQQQQQLQQHQTQAAEPQHELEQMESQQQLHHQMEPQQQLHHQM 665

Query: 821 QPFQAFGEVAEPREVQCSKL--QHNLCGQPQGHNEAVHGHKQKQESCHQ 961
           +P Q      EP++  C ++  Q  LC Q +   +  H  + +Q+ CHQ
Sbjct: 666 EPQQQLHHQMEPQQQLCHQMEPQQQLCHQMELQQQLCHQMEPQQQLCHQ 714



>gb:AF000668_1230608 Dirofilaria immitis cyclophilin Dicyp-3 mRNA,
           complete cds.
          Length = 527

 Score = 37.0 bits (84), Expect = 0.84
 Identities = 28/120 (23%), Positives = 53/120 (44%), Gaps = 15/120 (12%)
 Frame = -2

Query: 554 YMRNLIEDEPEKYQSVFSAYIKKGIDADNLEQLYK-KVHAAIRADPSAKKSEKQPPKEHK 378
           ++R+L+ DEP + + + +      ++  N+EQ +  K+    +A+  A+K   + PK H 
Sbjct: 144 HLRDLLTDEPFQRKDIITLQDPNHLEKFNIEQFHHVKLDLKTKAEIEAEKKAMEDPKFHI 203

Query: 377 RYN-------LKKLT-------YEERKASLISRLNALNAAAGRXXXXXXXXXXX*MTHSE 240
           R+        L+KL         EE +  +   LNA + + GR            +TH +
Sbjct: 204 RWMNNETKEILEKLAKEYVPTKIEEIEEEITDELNAAHYSQGRVAAGLTSTTMDPVTHQK 263



>gb:AY052652_1562812 Chlamydomonas reinhardtii gamete-specific
           homeodomain protein (gsp1) gene, complete
           cds.>gb:AF108140_1768621 Chlamydomonas reinhardtii
           gamete-specific homeodomain protein GSP1 mRNA, complete
           cds.
          Length = 1033

 Score = 36.2 bits (82), Expect = 1.4
 Identities = 32/110 (29%), Positives = 44/110 (40%)
 Frame = +2

Query: 668 HLVHP*EHQKHDSQW*FVIDQHPKEHGKASCLHQVQQNNPLQWPQHFLHTLQPFQAFGEV 847
           H+ H  +HQ+   Q  +   QH + H      HQ Q    LQ PQH     Q +Q +   
Sbjct: 223 HMQHRQQHQQEQQQMLYAYHQHNQYH------HQQQH---LQ-PQH-----QQYQQYPPQ 267

Query: 848 AEPREVQCSKLQHNLCGQPQGHNEAVHGHKQKQESCHQQY*QIQFVQLYP 997
              ++VQ  + QH   G P   +   H H Q     HQ + Q    Q  P
Sbjct: 268 LPHQQVQ-HQHQHTALGSPPVQHHQHHQHHQHHHQHHQHHHQHHHQQHVP 316



>gb:AF238888_491585 Bacillus cereus strain ATCC 43881 putative VrrB
            (vrrB) gene, partial cds.
          Length = 294

 Score = 35.8 bits (81), Expect = 1.9
 Identities = 33/115 (28%), Positives = 38/115 (33%)
 Frame = +2

Query: 659  QVHHLVHP*EHQKHDSQW*FVIDQHPKEHGKASCLHQVQQNNPLQWPQHFLHTLQPFQAF 838
            QVHH  H   H  H      +   H  +HG     HQ Q +       H  H        
Sbjct: 172  QVHHHGH---HHIHPQA--VLYQTHQGQHGHHGHHHQGQHHGHQGHHHHQGH-------- 218

Query: 839  GEVAEPREVQCSKLQHNLCGQPQGHNEAVHGHKQKQESCHQQY*QIQFVQLYPCW 1003
                     Q     H   GQ  GH    HGH+ +Q   HQQY Q Q  Q    W
Sbjct: 219  ---------QGQHGHHGHQGQHHGHQGQHHGHQGQQHQQHQQYQQYQQQQQSSPW 264



>gb:AC117075_1207764 Dictyostelium discoideum chromosome 2 map
            5201047-5455781 strain AX4, complete sequence.
          Length = 1461

 Score = 35.4 bits (80), Expect = 2.4
 Identities = 27/103 (26%), Positives = 42/103 (40%)
 Frame = +2

Query: 659  QVHHLVHP*EHQKHDSQW*FVIDQHPKEHGKASCLHQVQQNNPLQWPQHFLHTLQPFQAF 838
            Q HH  +  +HQ+H         QH ++        Q QQ    Q  QH  H  Q  Q  
Sbjct: 969  QQHHQNNHQQHQQHQQH------QHHQQQQLQQQQQQQQQQQHHQHQQHHHHQQQQQQQQ 1022

Query: 839  GEVAEPREVQCSKLQHNLCGQPQGHNEAVHGHKQKQESCHQQY 967
             +  + ++ Q  + Q     Q Q   +  H H+Q+ +  HQQ+
Sbjct: 1023 QQQQQQQQQQQQQQQQQQHQQQQQQQQQQHQHQQQHQ--HQQH 1063



>gb:AC116986_1207453 Dictyostelium discoideum chromosome 2 map
            2234041-2567370 strain AX4, complete sequence.
          Length = 3417

 Score = 35.4 bits (80), Expect = 2.4
 Identities = 29/110 (26%), Positives = 47/110 (42%)
 Frame = +2

Query: 650  EECQVHHLVHP*EHQKHDSQW*FVIDQHPKEHGKASCLHQVQQNNPLQWPQHFLHTLQPF 829
            ++ Q  H     + Q+H  Q      Q  ++H +    HQ QQ    Q  QH  H  Q +
Sbjct: 1800 QQQQQQHQQQQQQQQQHQQQ-----QQQQQQHQQQQ--HQQQQQQQHQQHQHQQH--QQY 1850

Query: 830  QAFGEVAEPREVQCSKLQHNLCGQPQGHNEAVHGHKQKQESCHQQY*QIQ 979
            Q   +  + ++ Q  + Q     Q Q  ++  H H+ +Q   HQQ+ Q Q
Sbjct: 1851 QQQQQQQQHQQYQQQQHQQYQQQQQQQQHQQQHQHQHQQHQQHQQHQQHQ 1900



>pir|T15109|T15109 hypothetical protein ZC132.5 - Caenorhabditis
            elegans>gb:AF014939_1231921 Caenorhabditis elegans cosmid
            ZC132, complete sequence.
          Length = 1277

 Score = 35.4 bits (80), Expect = 2.4
 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 3/66 (4%)
 Frame = -2

Query: 530  EPEKYQSVFSAYIKKGIDADNLEQLYKKVHAAIRADPSAKKSEKQPPKEHKRYNLKK--- 360
            E E+ Q    A   + +  DN+E + +K+   +    S   +E   P +++RYNL+K   
Sbjct: 1139 EIEEIQHETDAQDAENVMEDNMENIPEKIQEVVANGQSEINTEIDQPNQNRRYNLRKKKT 1198

Query: 359  LTYEER 342
            + YEE+
Sbjct: 1199 INYEEK 1204



>gb:AE016820_1749892 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VII, complete sequence.
          Length = 1110

 Score = 34.7 bits (78), Expect = 4.1
 Identities = 26/94 (27%), Positives = 43/94 (45%), Gaps = 1/94 (1%)
 Frame = +2

Query: 686 EHQKHDSQW*FVIDQHPKEHGKASCL-HQVQQNNPLQWPQHFLHTLQPFQAFGEVAEPRE 862
           ++Q+H       + Q P++  +      Q QQ  P   PQ      QP Q   +  + ++
Sbjct: 346 QNQQHQQLQQQQLQQQPQQQPQQPQQPQQPQQPQPQPQPQPQPQPQQPQQPQQQSQQHQQ 405

Query: 863 VQCSKLQHNLCGQPQGHNEAVHGHKQKQESCHQQ 964
            Q  +LQ  L  QPQ H+   H H+Q+++   QQ
Sbjct: 406 QQQQQLQQQLQPQPQPHHH--HHHQQQKQQLQQQ 437



>gb:AY071659_1295743 Drosophila melanogaster RE74364 full insert
           cDNA.
          Length = 436

 Score = 34.3 bits (77), Expect = 5.4
 Identities = 28/110 (25%), Positives = 45/110 (40%), Gaps = 4/110 (3%)
 Frame = +2

Query: 464 QGYRHQYPF*CMH*IQTGTF-QAHLQSDSSCMQQHGLHRCTCGEPQH--QVVWNPC*IPQ 634
           QG+ HQ  +      Q  ++ Q H Q   + +Q H        + QH  +  + P     
Sbjct: 134 QGFNHQQHYGLSQQQQHESYGQEHYQQSPNQLQHH--------QSQHANEYAYEPA---- 181

Query: 635 TFFHCEECQVHHLVHP*-EHQKHDSQW*FVIDQHPKEHGKASCLHQVQQN 781
              H ++ Q HH +    +HQ+    W FV +Q P+ H      H  QQ+
Sbjct: 182 ---HFQQQQQHHEIQSHKQHQQRKEHWNFVQEQQPQNHEPWQSSHGFQQH 228



>gb:AC116984_1207263 Dictyostelium discoideum chromosome 2 map
           2567470-3108875 strain AX4, complete sequence.
          Length = 680

 Score = 34.3 bits (77), Expect = 5.4
 Identities = 24/108 (22%), Positives = 45/108 (41%)
 Frame = +2

Query: 641 FHCEECQVHHLVHP*EHQKHDSQW*FVIDQHPKEHGKASCLHQVQQNNPLQWPQHFLHTL 820
           ++ ++ Q HH     +HQ+H  Q      Q  ++  +     Q QQ    Q+ QH     
Sbjct: 489 YNSQQHQQHHQQQHQQHQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQYHQHQQQYH 548

Query: 821 QPFQAFGEVAEPREVQCSKLQHNLCGQPQGHNEAVHGHKQKQESCHQQ 964
           Q  Q + + ++ ++ Q  + Q     Q Q   +     +Q+Q+   QQ
Sbjct: 549 QYQQQYHQPSQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 596



>gb:AJ698831_529556 Lactobacillus animalis partial gene for
            glucansucrase.
          Length = 374

 Score = 34.3 bits (77), Expect = 5.4
 Identities = 16/48 (33%), Positives = 25/48 (52%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGD 954
            +G  DY A  +L N+  N+YN P   + +  TNKD I ++    +  D
Sbjct: 132  QGLKDYMADQKLTNKKYNRYNIPS-SYAILLTNKDTIPRVYYGDLYSD 178



>gb:DMBR42I17_1378210 Drosophila melanogaster BAC clone BACR42I17.
          Length = 692

 Score = 33.9 bits (76), Expect = 7.1
 Identities = 28/110 (25%), Positives = 45/110 (40%), Gaps = 4/110 (3%)
 Frame = +2

Query: 464 QGYRHQYPF*CMH*IQTGTF-QAHLQSDSSCMQQHGLHRCTCGEPQH--QVVWNPC*IPQ 634
           QG+ HQ  +      Q  ++ Q H Q   + +Q H        + QH  +  + P     
Sbjct: 134 QGFNHQQHYGLSQQQQHESYGQEHYQQSPNQLQHH--------QSQHANEYAYEPA---- 181

Query: 635 TFFHCEECQVHHLVHP*-EHQKHDSQW*FVIDQHPKEHGKASCLHQVQQN 781
              H ++ Q HH +    +HQ+    W FV +Q P+ H      H  QQ+
Sbjct: 182 ---HFQQQQQHHEIQGHKQHQQRKEHWNFVQEQQPQNHEPWQSSHGFQQH 228



>gb:AE014298_1123820 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003420_1209002 Drosophila melanogaster
           chromosome X, section 4 of 74 of the complete sequence.
          Length = 436

 Score = 33.9 bits (76), Expect = 7.1
 Identities = 28/110 (25%), Positives = 45/110 (40%), Gaps = 4/110 (3%)
 Frame = +2

Query: 464 QGYRHQYPF*CMH*IQTGTF-QAHLQSDSSCMQQHGLHRCTCGEPQH--QVVWNPC*IPQ 634
           QG+ HQ  +      Q  ++ Q H Q   + +Q H        + QH  +  + P     
Sbjct: 134 QGFNHQQHYGLSQQQQHESYGQEHYQQSPNQLQHH--------QSQHANEYAYEPA---- 181

Query: 635 TFFHCEECQVHHLVHP*-EHQKHDSQW*FVIDQHPKEHGKASCLHQVQQN 781
              H ++ Q HH +    +HQ+    W FV +Q P+ H      H  QQ+
Sbjct: 182 ---HFQQQQQHHEIQGHKQHQQRKEHWNFVQEQQPQNHEPWQSSHGFQQH 228



>gb:AE017261_419676 Picrophilus torridus DSM 9790, complete genome.
          Length = 158

 Score = 33.9 bits (76), Expect = 7.1
 Identities = 34/125 (27%), Positives = 48/125 (38%)
 Frame = -2

Query: 1097 EGKTDYRARNRLINQDKNKYNTPKYRFVVRFTNKDIIAQIVSASIAGDMILASAYAHELP 918
            EG TDYR R RL+   +        R V+R T K +I Q+V     GD +L +     L 
Sbjct: 12   EGVTDYRKRYRLVISRET-------RAVIRQTRKGLIIQLVDYVPEGDHVLVTVTNKTLK 64

Query: 917  RYGLEVGHTNYAAAYCTGXXXXXXXXXXLEMAEEYEGNVEATGEDYSVEPGEGRRPFRAL 738
            +  L +   N    Y  G            ++    G V  TG     + G      + L
Sbjct: 65   K-ALNIDGNNIQMYYLAGYMAAKKG-----ISLGISGAVVDTGRAIFRKGGRIAAAIKGL 118

Query: 737  LDVGL 723
            +D GL
Sbjct: 119  IDGGL 123



>sp|P48998|INVO_RAT Involucrin.>pir|I61106|I61106 involucrin -
           rat>gb:RATINVO_2132693 Rattus norvegicus involucrin
           gene, complete cds.
          Length = 568

 Score = 33.9 bits (76), Expect = 7.1
 Identities = 29/105 (27%), Positives = 43/105 (40%)
 Frame = +2

Query: 650 EECQVHHLVHP*EHQKHDSQW*FVIDQHPKEHGKASCLHQVQQNNPLQWPQHFLHTLQPF 829
           +E ++HH     + Q  + +   V  Q  K+H    CL + QQ    +   H     Q  
Sbjct: 207 QEQELHHGQKQKQQQPQEQELQLVQHQKQKQHEPELCLRKQQQQESHERELHLGKQQQQ- 265

Query: 830 QAFGEVAEPREVQCSKLQHNLCGQPQGHNEAVHGHKQKQESCHQQ 964
               E  EP E+   K QH    +P+ H     G +Q QESC  +
Sbjct: 266 ----ESHEP-ELHLGKQQHQESHEPELH----LGKQQHQESCEPE 301



>gb:AY094737_1297911 Drosophila melanogaster GH28553 full insert
           cDNA.
          Length = 828

 Score = 33.5 bits (75), Expect = 9.2
 Identities = 27/94 (28%), Positives = 36/94 (38%), Gaps = 1/94 (1%)
 Frame = +2

Query: 626 IPQTFFHCEECQVHHLVHP*EHQKHDSQW*FVIDQHPKEHGKASCLHQVQQNNPLQWPQH 805
           IPQ   H    Q H   HP   Q+H         QH +       LHQ QQ        +
Sbjct: 146 IPQHQAHQPHQQPHQHQHPQHQQQHQQH-----QQHQQHQQHQQHLHQQQQQQ-----AN 195

Query: 806 FLHTLQPFQAFGEVAEPREV-QCSKLQHNLCGQP 904
           FLH  Q  Q   +++ P  + Q  +LQ  +   P
Sbjct: 196 FLHIQQSLQHNHQLSHPEPIHQLPQLQGTVADPP 229



>gb:AE014297_1141340 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003750_1223333 Drosophila melanogaster
           chromosome 3R, section 88 of 118 of the complete
           sequence.
          Length = 828

 Score = 33.5 bits (75), Expect = 9.2
 Identities = 27/94 (28%), Positives = 36/94 (38%), Gaps = 1/94 (1%)
 Frame = +2

Query: 626 IPQTFFHCEECQVHHLVHP*EHQKHDSQW*FVIDQHPKEHGKASCLHQVQQNNPLQWPQH 805
           IPQ   H    Q H   HP   Q+H         QH +       LHQ QQ        +
Sbjct: 146 IPQHQAHQPHQQPHQHQHPQHQQQHQQH-----QQHQQHQQHQQHLHQQQQQQ-----AN 195

Query: 806 FLHTLQPFQAFGEVAEPREV-QCSKLQHNLCGQP 904
           FLH  Q  Q   +++ P  + Q  +LQ  +   P
Sbjct: 196 FLHIQQSLQHNHQLSHPEPIHQLPQLQGTVADPP 229


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,107,579,215
Number of Sequences: 1806583
Number of extensions: 21653716
Number of successful extensions: 60904
Number of sequences better than 10.0: 156
Number of HSP's better than 10.0 without gapping: 57742
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 60663
length of database: 581,917,975
effective HSP length: 127
effective length of database: 352,481,934
effective search space used: 100809833124
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)