BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig9621
         (761 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY062465_1565121 Arabidopsis thaliana Unknown protein (At3g10...   162   5e-39   
gb:AY735670_1625712 Arabidopsis thaliana hypothetical protein AT...   159   5e-38   
gb:AY907344_1632110 Poncirus trifoliata Cys-rich domain protein ...   127   2e-28   
gb:AC135924_1742869 Oryza sativa (japonica cultivar-group) chrom...   125   1e-27   
gb:AP003315_1827903 Oryza sativa (japonica cultivar-group) genom...    94   4e-18   
gb:AB010692_1511107 Arabidopsis thaliana genomic DNA, chromosome...    69   7e-11   
gb:AC135417_1742209 Oryza sativa (japonica cultivar-group) chrom...    66   6e-10   
gb:ATAC009991_1543123 Arabidopsis thaliana chromosome III BAC F9...    50   3e-05   
gb:AP004001_1836189 Oryza sativa (japonica cultivar-group) genom...    42   0.012   
pir|T28872|T28872 hypothetical protein R04E5.8 - Caenorhabditis ...    39   0.13    Caenorhabditis elegans [roundworm]
sp|Q05860|FMN1_MOUSE|FMN1_MOUSE Formin 1 isoforms I/II/III (Limb deformity ...    39   0.13    Mus musculus [mouse]
sp|Q05859|FM14_MOUSE|FM14_MOUSE Formin 1 isoform IV (Limb deformity protein...    39   0.13    Mus musculus [mouse]
gb:AF192748_2479338 Lampetra fluviatilis synapsin Ib (SYN I) mRN...    38   0.23    
gb:AF192747_2479337 Lampetra fluviatilis synapsin Ia (SYN I) mRN...    38   0.23    
gb:HAELIP_1681413 H.annuus mRNA for homologous early light induc...    38   0.23    
sp|P78621|SEPA_EMENI|SEPA_EMENI Cytokinesis protein sepA (FH1/2 protein) (F...    38   0.23    
gb:BX640446_815757 Bordetella bronchiseptica strain RB50, comple...    37   0.39    
gb:AF327876_1786901 Chlamydomonas reinhardtii PF6 protein gene, ...    36   0.67    
pir|T18397|T18397 protein CTRP - malaria parasite (Plasmodium fa...    36   0.87    Plasmodium falciparum
gb:BC071180_2556021 Danio rerio zgc:63914, mRNA (cDNA clone MGC:...    35   1.1     
gb:MMU271054_2119971 Mus musculus partial mRNA for iroquois home...    35   1.1     
gb:S72602_2041258 bcl2 [human, 697 pre-B cell acute lymphocytic ...    35   1.1     
gb:AY462111_1607522 Pleurotus djamor ketopantoate reductase-like...    35   1.1     
gb:AB019228_1514090 Arabidopsis thaliana genomic DNA, chromosome...    35   1.1     
gb:A76121_1450667 Sequence 1 from Patent WO9320200.>gb:AX277471_...    35   1.1     
gb:U40419_1403344 Caenorhabditis elegans cosmid C27F2, complete ...    35   1.1     
pir|T15666|T15666 hypothetical protein C27F2.8 - Caenorhabditis ...    35   1.1     Caenorhabditis elegans [roundworm]
pir|B29409|TVHUB1 transforming protein bcl-2, splice form beta -...    35   1.1     
sp|P10415|BCL2_HUMAN|BCL2_HUMAN Apoptosis regulator Bcl-2.>pir|C37332|TVHUA...    35   1.1     Homo sapiens [man]
gb:AP003622_1831616 Oryza sativa (japonica cultivar-group) genom...    35   1.5     
gb:AP005647_1855410 Oryza sativa (japonica cultivar-group) genom...    35   1.9     
gb:NCB11N2_1689085 Neurospora crassa DNA linkage group V BAC con...    35   1.9     
gb:PFMAL3P5_1394524 Plasmodium falciparum MAL3P5, complete seque...    35   1.9     
gb:AY122256_1301618 Drosophila melanogaster SD07343 full insert ...    35   1.9     
gb:AF475087_1274210 Drosophila melanogaster transcriptional core...    35   1.9     
gb:AF217844_1252053 Drosophila melanogaster GRUNGE (Gug) mRNA, c...    35   1.9     
gb:AE014296_1135345 Drosophila melanogaster chromosome 3L, compl...    35   1.9     
gb:AE014296_1135344 Drosophila melanogaster chromosome 3L, compl...    35   1.9     
gb:AE014296_1135343 Drosophila melanogaster chromosome 3L, compl...    35   1.9     
gb:AE014296_1135342 Drosophila melanogaster chromosome 3L, compl...    35   1.9     
gb:BA000039_728006 Thermosynechococcus elongatus BP-1 DNA, compl...    35   1.9     
sp|Q9CXC3|CT72_MOUSE|CT72_MOUSE Protein C20orf72 homolog.>gb:AK018387_11595...    35   1.9     Mus musculus [mouse]
gb:BC054483_2101730 Mus musculus ataxin 2-like, mRNA (cDNA clone...    34   2.5     
gb:AK122196_2068861 Mus musculus mRNA for mKIAA0059 protein.           34   2.5     
gb:AF404775_2065156 Mus musculus actin-binding LIM protein 1 med...    34   2.5     
gb:AP006548_1862368 Oryza sativa (japonica cultivar-group) genom...    34   2.5     
gb:CR382132_1665573 Yarrowia lipolytica chromosome F of strain C...    34   2.5     
gb:AY280868_1594658 Brassica napus putative beta-glucan elicitor...    34   2.5     
gb:AF047651_1236416 Caenorhabditis elegans cosmid C05D2, complet...    34   2.5     
gb:BA000035_717587 Corynebacterium efficiens YS-314 DNA, complet...    34   2.5     
pir|T32987|T32987 hypothetical protein C05D2.5 - Caenorhabditis ...    34   2.5     Caenorhabditis elegans [roundworm]
pir|T51947|T51947 probable transcription factor HUA2 [imported] ...    34   2.5     Arabidopsis thaliana [mouse-ear cress]
gb:BC085671_2564547 Danio rerio zgc:92560, mRNA (cDNA clone MGC:...    34   3.3     
gb:OBU87832_2444738 Oat blue dwarf virus complete genome.              34   3.3     
gb:HSBCL2IG_2011003 H.sapiens mRNA for bcl2-Ig fusion gene.            34   3.3     
gb:BA000025_1966146 Homo sapiens genomic DNA, chromosome 6p21.3,...    34   3.3     
gb:AL805934_1932917 Human DNA sequence from clone DAQB-195H10 on...    34   3.3     
gb:AL805934_1932915 Human DNA sequence from clone DAQB-195H10 on...    34   3.3     
gb:AL805934_1932912 Human DNA sequence from clone DAQB-195H10 on...    34   3.3     
gb:AL662801_1931519 Human DNA sequence from clone XXbac-296P20 o...    34   3.3     
gb:AL662801_1931518 Human DNA sequence from clone XXbac-296P20 o...    34   3.3     
gb:AB128049_1873915 Macaca mulatta genes, MHC class I region, pa...    34   3.3     
gb:AP002524_1822400 Oryza sativa (japonica cultivar-group) genom...    34   3.3     
gb:AC145271_1744284 Oryza sativa (japonica cultivar-group) chrom...    34   3.3     
gb:AC137609_1743489 Oryza sativa (japonica cultivar-group) chrom...    34   3.3     
gb:AY495663_1608976 Cochliobolus heterostrophus polyketide synth...    34   3.3     
gb:AY450929_1606692 Chlamydomonas reinhardtii minus agglutinin (...    34   3.3     
gb:CCA438575_1359426 Ceratitis capitata partial mRNA for ecdyson...    34   3.3     
gb:AF305060_1260699 Dictyostelium discoideum Wiscott-Aldrich syn...    34   3.3     
gb:HSM807388_1187847 Homo sapiens mRNA; cDNA DKFZp686L0653 (from...    34   3.3     
gb:BX640427_809870 Bordetella parapertussis strain 12822, comple...    34   3.3     
gb:AY034092_585768 Micrococcus sp. 28 plasmid pSD10, complete se...    34   3.3     
gb:AE006188_216406 Pasteurella multocida subsp. multocida str. P...    34   3.3     
sp|P46379|BAT3_HUMAN|BAT3_HUMAN Large proline-rich protein BAT3 (HLA-B-asso...    34   3.3     Homo sapiens [man]
gb:BC081280_2562170 Xenopus laevis hypothetical protein LOC44695...    33   4.3     
gb:AF165985_2057551 Mus musculus iroquois-class homeobox protein...    33   4.3     
gb:HUMORFA05_2035301 Homo sapiens KIAA0054 mRNA, partial cds.          33   4.3     
gb:BC070062_1988407 Homo sapiens Ras and Rab interactor 3, mRNA ...    33   4.3     
gb:AP005631_1855111 Oryza sativa (japonica cultivar-group) genom...    33   4.3     
gb:AF020261_1761619 Santalum album proline rich protein mRNA, co...    33   4.3     
gb:VURNAEXT3_1727444 V.unguiculata mRNA for extensine-like prote...    33   4.3     
gb:VCA242540_1726990 Volvox carteri mRNA for hydroxyproline-rich...    33   4.3     
gb:CAR6770_1645444 Cicer arietinum mRNA for extensin, partial.         33   4.3     
gb:AB008227_1510367 Adiantum capillus-veneris AcExt1 mRNA for Ex...    33   4.3     
gb:AJ630366_1422764 Canis familiaris MHC class II region on chro...    33   4.3     
gb:AF016886_1232857 Strongylocentrotus purpuratus paired box pro...    33   4.3     
gb:AE016959_1022024 Oryza sativa (japonica cultivar-group) chrom...    33   4.3     
gb:AE017319_441312 Desulfovibrio vulgaris subsp. vulgaris str. H...    33   4.3     
pir|S49915|S49915 extensin-like protein - maize>gb:ZMEXTENS_1731...    33   4.3     Zea mays [maize]
pir|T09024|T09024 proline-rich protein T27E11.90 - Arabidopsis t...    33   4.3     Arabidopsis thaliana [mouse-ear cress]
pir|S54156|S54156 extensin-like protein - cowpea (fragment)            33   4.3     Vigna unguiculata
pir|H83619|H83619 hypothetical protein PA0197 [imported] - Pseud...    33   4.3     Pseudomonas aeruginosa
sp|Q9JKQ4|IRX5_MOUSE|IRX5_MOUSE Iroquois-class homeodomain protein IRX-5 (I...    33   4.3     Mus musculus [mouse]
sp|P42694|HELZ_HUMAN|HELZ_HUMAN Potential helicase with zinc-finger domain.       33   4.3     Homo sapiens [man]
gb:HUMORFKG1L_2035335 Homo sapiens KIAA0059 mRNA, partial cds.         33   5.7     
gb:AL133384_1918452 Human DNA sequence from clone RP11-317F20 on...    33   5.7     
gb:AL133384_1918451 Human DNA sequence from clone RP11-317F20 on...    33   5.7     
gb:AL133384_1918450 Human DNA sequence from clone RP11-317F20 on...    33   5.7     
gb:AP004275_1839616 Oryza sativa (japonica cultivar-group) genom...    33   5.7     
gb:AE016814_1745898 Ashbya gossypii (= Eremothecium gossypii) AT...    33   5.7     
gb:SOYHRGPB_1716023 Soybean hydroxyproline-rich glycoprotein (sb...    33   5.7     
gb:CR382131_1664251 Yarrowia lipolytica chromosome E of strain C...    33   5.7     
gb:CFHEPABC_1646282 Cylindrotheca fusiformis hepA, hepB, hepC ge...    33   5.7     
gb:AY536857_1612411 Arabidopsis thaliana putative protein kinase...    33   5.7     
gb:AY450930_1606694 Chlamydomonas reinhardtii plus agglutinin (S...    33   5.7     
gb:AC007945_1536371 Genomic sequence for Arabidopsis thaliana BA...    33   5.7     
pir|T04455|T04455 hypothetical protein F4D11.90 - Arabidopsis th...    33   5.7     Arabidopsis thaliana [mouse-ear cress]
pir|B86369|B86369 hypothetical protein F5O8.10 - Arabidopsis tha...    33   5.7     Arabidopsis thaliana [mouse-ear cress]
pir|S54986|S54986 regulatory protein - Emericella nidulans>gb:EM...    33   5.7     Aspergillus nidulans
pir|S71560|S71560 early light-induced protein homolog SDi-1, dro...    33   5.7     Helianthus annuus
pir|T07623|T07623 extensin homolog HRGP2 - soybean (fragment)          33   5.7     Glycine max [soybeans]
pir|B38274|B38274 Y box-binding protein 2 - African clawed frog>...    33   5.7     Xenopus laevis [clawed frog]
sp|P21574|YB56_XENLA|YB56_XENLA Cytoplasmic RNA-binding protein P56 (Y box ...    33   5.7     Xenopus laevis [clawed frog]
sp|Q9FPQ6|GP1_CHLRE|GP1_CHLRE Vegetative cell wall protein gp1 precursor (...    33   5.7     Chlamydomonas reinhardtii
sp|P55196|AF6_HUMAN|AF6_HUMAN AF-6 protein.>gb:AB011399_1864355 Homo sapie...    33   5.7     Homo sapiens [man]
gb:CHE441113_2396849 Crane hepatitis B virus preS/S gene for pre...    33   7.4     
gb:AY261359_2319383 Bovine herpesvirus 5 strain SV507/99, comple...    33   7.4     
gb:AY150312_2301429 PRRSV HB-1(sh)/2002, complete genome.              33   7.4     
gb:AY032626_2290133 Porcine reproductive and respiratory syndrom...    33   7.4     
gb:AB083478_2047738 Mus musculus Pclo mRNA for Piccolo, complete...    33   7.4     
gb:AB083477_2047737 Mus musculus Pclo mRNA for Piccolo, complete...    33   7.4     
gb:AF005654_1875970 Homo sapiens actin-binding double-zinc-finge...    33   7.4     
gb:AP006161_1861110 Oryza sativa (japonica cultivar-group) genom...    33   7.4     
gb:AP004762_1844615 Oryza sativa (japonica cultivar-group) genom...    33   7.4     
gb:AP000735_1820573 Arabidopsis thaliana genomic DNA, chromosome...    33   7.4     
gb:AF327424_1786793 Arabidopsis thaliana unknown protein (At2g45...    33   7.4     
gb:PCC17D7_1699148 P. carinii cosmid 17D7.                             33   7.4     
gb:PCC11H121B_1699140 P. carinii cosmids PC11H11 and 1B2.>gb:PCW...    33   7.4     
gb:PCC11A11_1699130 P. carinii cosmid 11A11.                           33   7.4     
gb:AY097182_1576324 Lycopersicon cheesmanii LA483 fw2.2 gene, co...    33   7.4     
gb:AB013390_1512068 Arabidopsis thaliana genomic DNA, chromosome...    33   7.4     
gb:AF004917_1231183 Drosophila melanogaster cup mRNA, complete cds.    33   7.4     
pir|E84885|E84885 hypothetical protein At2g45010 [imported] - Ar...    33   7.4     Arabidopsis thaliana [mouse-ear cress]
pir|E96710|E96710 hypothetical protein F24J5.15 [imported] - Ara...    33   7.4     Arabidopsis thaliana [mouse-ear cress]
sp|Q865B7|PPG1_BOVIN|PPG1_BOVIN Peroxisome proliferator activated receptor ...    33   7.4     Bos taurus [bovine]
sp|Q9VMA3|CUP_DROME|CUP_DROME Cup protein (Oskar ribonucleoprotein complex...    33   7.4     Drosophila melanogaster
gb:BC074257_2557772 Xenopus laevis MGC84010 protein, mRNA (cDNA ...    32   9.7     
gb:AY277968_2524180 Takifugu rubripes transcription factor Sox17...    32   9.7     
gb:AY149116_2515201 Xenopus laevis transcription factor Sox10 mR...    32   9.7     
gb:BC083185_2108578 Mus musculus cDNA sequence BC059845, mRNA (c...    32   9.7     
gb:AF528099_1906061 Homo sapiens transforming acidic coiled coil...    32   9.7     
gb:AP004797_1845217 Oryza sativa (japonica cultivar-group) genom...    32   9.7     
gb:VURNEXT26_1727446 V.unguiculata mRNA for extensine-like prote...    32   9.7     
gb:PCC22C8_1699168 P. carinii cosmid 22C8.                             32   9.7     
gb:PCC11H121B_1699137 P. carinii cosmids PC11H11 and 1B2.>gb:PCW...    32   9.7     
gb:OSJN00185_1696383 Oryza sativa genomic DNA, chromosome 4, BAC...    32   9.7     
gb:AY676932_1621978 Oryza sativa (indica cultivar-group) transcr...    32   9.7     
gb:AY091043_1574272 Arabidopsis thaliana unknown protein (At3g19...    32   9.7     
gb:AC073166_1540981 Oryza sativa chromosome 10 BAC OSJNBb0064P21...    32   9.7     
gb:AY035848_1424241 Sus scrofa clone D2A basic proline-rich prot...    32   9.7     
gb:AY035847_1424240 Sus scrofa clone TP23 basic proline-rich pro...    32   9.7     
gb:PFATRAPC_1394099 Plasmodium falciparum thrombospondin related...    32   9.7     
gb:AY060680_1292485 Drosophila melanogaster GH11848 full length ...    32   9.7     
gb:CR858106_1182293 Pongo pygmaeus mRNA; cDNA DKFZp468F1911 (fro...    32   9.7     
gb:AE016959_1023665 Oryza sativa (japonica cultivar-group) chrom...    32   9.7     
gb:AE016959_1020786 Oryza sativa (japonica cultivar-group) chrom...    32   9.7     
gb:AE014186_938047 Plasmodium falciparum 3D7 chromosome 11 compl...    32   9.7     
gb:BA000035_714994 Corynebacterium efficiens YS-314 DNA, complet...    32   9.7     
gb:AF071081_476065 Mycobacterium tuberculosis proline-rich mucin...    32   9.7     
gb:CR555308_109988 Azoarcus sp. EbN1 plasmid 2.                        32   9.7     
pir|D96711|D96711 hypothetical protein F24J5.8 [imported] - Arab...    32   9.7     Arabidopsis thaliana [mouse-ear cress]
pir|T11622|T11622 extensin class 1 precursor - cowpea>gb:VUEXT26...    32   9.7     Vigna unguiculata
pir|S25299|S25299 extensin precursor - tomato>gb:TOMEXTENB_17256...    32   9.7     Solanum lycopersicum
pir|S37781|S37781 retinoid X receptor beta - human                     32   9.7     Homo sapiens [man]
sp|O95487|S24B_HUMAN|S24B_HUMAN Protein transport protein Sec24B (SEC24-rel...    32   9.7     Homo sapiens [man]
sp|P39653|DEXT_STRDO|DEXT_STRDO Dextranase precursor (EC 3.2.1.11) (Alpha-1...    32   9.7     Streptococcus downei


>gb:AY062465_1565121 Arabidopsis thaliana Unknown protein
           (At3g10980; F9F8.20) mRNA, complete
           cds.>gb:BT000119_1634397 Arabidopsis thaliana Unknown
           protein (At3g10980) mRNA, complete cds.
          Length = 563

 Score =  162 bits (411), Expect = 5e-39
 Identities = 87/146 (59%), Positives = 97/146 (66%), Gaps = 10/146 (6%)
 Frame = -2

Query: 757 FGLLYGGFWRIQMRKRYNLPSYNSCCGKSSVADCALWLFCCWCSLAQEVRTGNSYDIVED 578
           FGLLYGGFWRIQMRKR+ LPSYN C G++++ADCALWL CCWCSLAQEVRT NSY+IVED
Sbjct: 417 FGLLYGGFWRIQMRKRFKLPSYNFCFGRAAIADCALWLCCCWCSLAQEVRTANSYEIVED 476

Query: 577 KF-YRKRHDNGEQPPPVSPLPREDGVF------RSSPDQKPKSTTPSPSRFAMEHCSPGN 419
           KF  RK   N   P  VSPLPREDGVF       SSP     +++PSPSRF  E  SP  
Sbjct: 477 KFCQRKEEKNMVSPNLVSPLPREDGVFDPRFGLGSSPKNISGASSPSPSRFWKEAHSPNV 536

Query: 418 NEPNSG---GSHDPMAPPSPPIIQRE 350
             P       S   + PPSP  I RE
Sbjct: 537 QTPREKEEVKSDVALTPPSPLSIHRE 562



>gb:AY735670_1625712 Arabidopsis thaliana hypothetical protein
           AT5G05350 mRNA, complete cds.
          Length = 526

 Score =  159 bits (402), Expect = 5e-38
 Identities = 82/146 (56%), Positives = 96/146 (65%), Gaps = 10/146 (6%)
 Frame = -2

Query: 757 FGLLYGGFWRIQMRKRYNLPSYNSCCGKSSVADCALWLFCCWCSLAQEVRTGNSYDIVED 578
           FGLLYGGFWRIQMRKR+ LP YN CCG+ ++ADC LWLFCCWCSLAQEVRT NSY+IVED
Sbjct: 388 FGLLYGGFWRIQMRKRFKLPGYNICCGRPAIADCTLWLFCCWCSLAQEVRTANSYEIVED 447

Query: 577 KFYRKRHDNG--EQPPPVSPLPREDGVFRSSPDQKPK--------STTPSPSRFAMEHCS 428
           KF ++R +N   +    VS LPREDGVF   P   PK        S+T SPSR   E C 
Sbjct: 448 KFCKRREENSKIDDEVVVSALPREDGVF--DPSCLPKKMTTTMIASSTLSPSRQKDETCL 505

Query: 427 PGNNEPNSGGSHDPMAPPSPPIIQRE 350
               +       + ++PPSPP I RE
Sbjct: 506 GEKGD-------EALSPPSPPFIHRE 524



>gb:AY907344_1632110 Poncirus trifoliata Cys-rich domain protein
           (CPPR) mRNA, partial cds.
          Length = 212

 Score =  127 bits (320), Expect = 2e-28
 Identities = 66/128 (51%), Positives = 78/128 (60%), Gaps = 12/128 (9%)
 Frame = -2

Query: 757 FGLLYGGFWRIQMRKRYNLPSYNSCCGKSSVADCALWLFCCWCSLAQEVRTGNSYDIVED 578
           FGLLYGGFWRIQMRKR++LP+ NSCCGK ++AD A WL CCWCSLAQEVRT + YD+VE 
Sbjct: 86  FGLLYGGFWRIQMRKRFSLPANNSCCGKPAIADFAQWLSCCWCSLAQEVRTADYYDVVEG 145

Query: 577 KFYRKRHDNGEQPPPVSPLPREDGVFRSSPDQKPKS------------TTPSPSRFAMEH 434
           K   K+ D   Q   +SPLPREDG  +    Q   S                PSRF+ + 
Sbjct: 146 KLCMKQIDENSQ-LTLSPLPREDGSAQFRSGQTSLSGNNPGFSRIEIGNLSGPSRFSKDK 204

Query: 433 CSPGNNEP 410
            SP    P
Sbjct: 205 YSPNRQGP 212



>gb:AC135924_1742869 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0486C01, complete sequence.
          Length = 554

 Score =  125 bits (313), Expect = 1e-27
 Identities = 70/145 (48%), Positives = 87/145 (60%), Gaps = 9/145 (6%)
 Frame = -2

Query: 757 FGLLYGGFWRIQMRKRYNLPSYNSCCGKSSVADCALWLFCCWCSLAQEVRTGNSYDIVED 578
           FGLLYGGFWRIQMRKR+NLP+ N CC  +   DC  WL C  CSLAQEVRT + YDI ED
Sbjct: 406 FGLLYGGFWRIQMRKRFNLPANNFCCRSAEATDCFQWLCCSSCSLAQEVRTADYYDIAED 465

Query: 577 KFYRKRHDNGEQPPPVSPLPREDG--VFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNS 404
           + Y ++     Q   ++PL REDG  +FRS+P    +S+T SPS F ME  S     P  
Sbjct: 466 RSYTEQITARSQ-HVMTPLSREDGLPLFRSNPGSPYRSSTASPSIFIMESPSAPRRSPGP 524

Query: 403 ---GGS----HDPMAPPSPPIIQRE 350
              GGS       M  P+P ++ R+
Sbjct: 525 SPLGGSPTMGDRTMKAPTPSVLHRD 549



>gb:AP003315_1827903 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0439E11.
          Length = 525

 Score = 93.6 bits (231), Expect = 4e-18
 Identities = 43/72 (59%), Positives = 51/72 (70%), Gaps = 2/72 (2%)
 Frame = -2

Query: 754 GLLYGGFWRIQMRKRYNLPSYNSCCGKSSVADCALWLFCCWCSLAQEVRTGNSYDIVE-- 581
           GLLYGGFWR+QMRKR+ LP    CCG +S+ D A WLFC  C+LAQEVRTGN YD+ +  
Sbjct: 385 GLLYGGFWRVQMRKRFALPGSRWCCGSASLTDYARWLFCWPCALAQEVRTGNLYDVEDGG 444

Query: 580 DKFYRKRHDNGE 545
             FY K  D G+
Sbjct: 445 GVFYEKAMDGGD 456



>gb:AB010692_1511107 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K18I23.
          Length = 410

 Score = 69.3 bits (168), Expect = 7e-11
 Identities = 46/101 (45%), Positives = 56/101 (55%), Gaps = 10/101 (9%)
 Frame = -2

Query: 622 AQEVRTGNSYDIVEDKFYRKRHDNG--EQPPPVSPLPREDGVFRSSPDQKPK-------- 473
           AQEVRT NSY+IVEDKF ++R +N   +    VS LPREDGVF   P   PK        
Sbjct: 317 AQEVRTANSYEIVEDKFCKRREENSKIDDEVVVSALPREDGVF--DPSCLPKKMTTTMIA 374

Query: 472 STTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSPPIIQRE 350
           S+T SPSR   E C     +       + ++PPSPP I RE
Sbjct: 375 SSTLSPSRQKDETCLGEKGD-------EALSPPSPPFIHRE 408



>gb:AC135417_1742209 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1314_A05, complete sequence.
          Length = 521

 Score = 66.2 bits (160), Expect = 6e-10
 Identities = 40/99 (40%), Positives = 53/99 (53%), Gaps = 13/99 (13%)
 Frame = -2

Query: 760 AFGLLYGGFWRIQMRKRYNL-----PSYNSCCGK-SSVADCALWLFCCWCSLAQEVRTGN 599
           A GLLYGG+WR +MR+R+ L         +CCG  SS+AD   W+FC  C+LAQEVRT N
Sbjct: 353 ALGLLYGGYWRARMRRRFGLLPGRHGGGGACCGSPSSLADYLRWMFCWSCALAQEVRTAN 412

Query: 598 SYDIVEDKFYRKRHDNGE-------QPPPVSPLPREDGV 503
              +  D+       +             + PLPRE+GV
Sbjct: 413 VLLLDADEAGGAGGGSSSSGGGGRGDATLLQPLPRENGV 451



>gb:ATAC009991_1543123 Arabidopsis thaliana chromosome III BAC F9F8
           genomic sequence, complete sequence.
          Length = 531

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 34/76 (44%), Positives = 40/76 (52%), Gaps = 2/76 (2%)
 Frame = -2

Query: 730 RIQMRKRYNLPSYNSCCGKSSV-ADCALWLFCCWCSLAQEVRTGNSYDIVEDKF-YRKRH 557
           R  + +RY+  S ++  G   V      W        AQEVRT NSY+IVEDKF  RK  
Sbjct: 297 RFTLERRYSFASASTGVGDGMVPVSDPQWS-------AQEVRTANSYEIVEDKFCQRKEE 349

Query: 556 DNGEQPPPVSPLPRED 509
            N   P  VSPLPRED
Sbjct: 350 KNMVSPNLVSPLPRED 365



>gb:AP004001_1836189 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1115_D03.>gb:AP004168_1838490 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ1756_H07.
          Length = 152

 Score = 42.0 bits (97), Expect = 0.012
 Identities = 20/46 (43%), Positives = 28/46 (60%)
 Frame = -2

Query: 745 YGGFWRIQMRKRYNLPSYNSCCGKSSVADCALWLFCCWCSLAQEVR 608
           Y G++R ++R +Y LP       +S + DC   LFC WC+LAQE R
Sbjct: 84  YAGWYRGKLRAQYGLP-------ESPLPDCLTHLFCHWCALAQEHR 122



>pir|T28872|T28872 hypothetical protein R04E5.8 - Caenorhabditis
           elegans>gb:U41538_1404040 Caenorhabditis elegans cosmid
           R04E5, complete sequence.
          Length = 997

 Score = 38.5 bits (88), Expect = 0.13
 Identities = 25/69 (36%), Positives = 30/69 (43%), Gaps = 2/69 (2%)
 Frame = -2

Query: 568 RKRHDNGEQPPPVSP--LPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGS 395
           RK    G  PPP  P  +PR     RS P ++P  T PSP R       P    P+    
Sbjct: 129 RKSRAGGSSPPPPPPPRVPRTPPP-RSPPPRRPPMTPPSPQR------RPPRTPPSPEPR 181

Query: 394 HDPMAPPSP 368
           + P  PPSP
Sbjct: 182 NPPRTPPSP 190



 Score = 35.8 bits (81), Expect = 0.87
 Identities = 23/74 (31%), Positives = 30/74 (40%), Gaps = 8/74 (10%)
 Frame = -2

Query: 562 RHDNGEQPPPVSPLPREDGVFRSSP--------DQKPKSTTPSPSRFAMEHCSPGNNEPN 407
           +H + E  PP  P PR+     SSP         + P   +P P R  M   SP    P 
Sbjct: 114 QHGDHEASPPPPPPPRKSRAGGSSPPPPPPPRVPRTPPPRSPPPRRPPMTPPSPQRRPPR 173

Query: 406 SGGSHDPMAPPSPP 365
           +  S +P  PP  P
Sbjct: 174 TPPSPEPRNPPRTP 187



 Score = 35.4 bits (80), Expect = 1.1
 Identities = 22/65 (33%), Positives = 28/65 (43%)
 Frame = -2

Query: 541 PPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSPPI 362
           PPP SP PR   +   SP ++P  T PSP     E  +P    P+         PP PP 
Sbjct: 150 PPPRSPPPRRPPMTPPSPQRRPPRTPPSP-----EPRNPPRTPPSP-------IPPPPPR 197

Query: 361 IQRED 347
           +   D
Sbjct: 198 LNSHD 202



>sp|Q05860|FMN1_MOUSE Formin 1 isoforms I/II/III (Limb deformity
            protein).>pir|S11515|S11515 formin -
            mouse>gb:MMLDF_2116263 M.musculus limb deformity mRNA for
            formin.
          Length = 1468

 Score = 38.5 bits (88), Expect = 0.13
 Identities = 22/59 (37%), Positives = 26/59 (44%)
 Frame = -2

Query: 541  PPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSPP 365
            PPP +P+P  DG     P   P    P P+  A+         PNSGG   P  PP PP
Sbjct: 917  PPPPTPVPPSDG-----PPPPPPPPPPLPNVLAL---------PNSGGPPPPPPPPPPP 961



>sp|Q05859|FM14_MOUSE Formin 1 isoform IV (Limb deformity
           protein).>pir|S24407|S24407 formin isoform IV -
           mouse>gb:MMIFOR_2115469 M.musculus mRNA for formin
           (isoform IV).
          Length = 1206

 Score = 38.5 bits (88), Expect = 0.13
 Identities = 22/59 (37%), Positives = 26/59 (44%)
 Frame = -2

Query: 541 PPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSPP 365
           PPP +P+P  DG     P   P    P P+  A+         PNSGG   P  PP PP
Sbjct: 691 PPPPTPVPPSDG-----PPPPPPPPPPLPNVLAL---------PNSGGPPPPPPPPPPP 735



>gb:AF192748_2479338 Lampetra fluviatilis synapsin Ib (SYN I) mRNA,
           complete cds.
          Length = 642

 Score = 37.7 bits (86), Expect = 0.23
 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 4/67 (5%)
 Frame = -2

Query: 538 PPVSPLPREDGVFRSSPDQKPKSTTPSP----SRFAMEHCSPGNNEPNSGGSHDPMAPPS 371
           P  SP P +    + SP Q+  S TPSP    +  A     P    P  G    P  P +
Sbjct: 471 PAPSPQPGQQRGGQPSPGQQRSSPTPSPQPGQAAGAQARPPPQGGGPQQGAGAQPQRPGA 530

Query: 370 PPIIQRE 350
           PP++Q++
Sbjct: 531 PPLVQQQ 537



>gb:AF192747_2479337 Lampetra fluviatilis synapsin Ia (SYN I) mRNA,
           complete cds.
          Length = 687

 Score = 37.7 bits (86), Expect = 0.23
 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 4/67 (5%)
 Frame = -2

Query: 538 PPVSPLPREDGVFRSSPDQKPKSTTPSP----SRFAMEHCSPGNNEPNSGGSHDPMAPPS 371
           P  SP P +    + SP Q+  S TPSP    +  A     P    P  G    P  P +
Sbjct: 471 PAPSPQPGQQRGGQPSPGQQRSSPTPSPQPGQAAGAQARPPPQGGGPQQGAGAQPQRPGA 530

Query: 370 PPIIQRE 350
           PP++Q++
Sbjct: 531 PPLVQQQ 537



>gb:HAELIP_1681413 H.annuus mRNA for homologous early light induced
           protein.
          Length = 174

 Score = 37.7 bits (86), Expect = 0.23
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 4/66 (6%)
 Frame = -2

Query: 505 VFRSSPDQKPKSTTPSPSR----FAMEHCSPGNNEPNSGGSHDPMAPPSPPIIQREDV*H 338
           VF ++P  +  +TTPS SR    FA+  C   + +P++  S  P APP PP   +     
Sbjct: 7   VFMATPVAR-LTTTPSSSRRNINFAVVRCMSQDQQPSTDASKTPSAPPPPPPAPKVSTKF 65

Query: 337 NEILRF 320
           +++L F
Sbjct: 66  SDVLAF 71



>sp|P78621|SEPA_EMENI Cytokinesis protein sepA (FH1/2 protein) (Forced
            expression inhibition of growth A).>gb:ENU83658_1676822
            Emericella nidulans FH1/FH2 protein homolog (sepA) gene,
            complete cds.
          Length = 1790

 Score = 37.7 bits (86), Expect = 0.23
 Identities = 20/59 (33%), Positives = 23/59 (38%)
 Frame = -2

Query: 541  PPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSPP 365
            PPP  P P   G+  ++P   P    P P   A     P    P  GG   P  PP PP
Sbjct: 1017 PPPPPPPPAHPGLSGAAPPPPPPPPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPPPPP 1075



>gb:BX640446_815757 Bordetella bronchiseptica strain RB50, complete
           genome; segment 10/16.
          Length = 528

 Score = 37.0 bits (84), Expect = 0.39
 Identities = 23/73 (31%), Positives = 33/73 (45%), Gaps = 9/73 (12%)
 Frame = -2

Query: 556 DNGEQPPPVSPLPRED--------GVFRSSPDQKPKSTTPSP-SRFAMEHCSPGNNEPNS 404
           D  E+P P  PLP+ED        G   + P+  P   +P P +    E  SP   +   
Sbjct: 85  DEDEEPGPRPPLPKEDLEALEDLFGSGDTPPEPPPAPPSPGPMAPNVPEDASPHLPDHAG 144

Query: 403 GGSHDPMAPPSPP 365
           G +  P +PP+PP
Sbjct: 145 GDAMPPASPPAPP 157



>gb:AF327876_1786901 Chlamydomonas reinhardtii PF6 protein gene,
            promoter and complete cds.
          Length = 2301

 Score = 36.2 bits (82), Expect = 0.67
 Identities = 19/65 (29%), Positives = 28/65 (43%), Gaps = 1/65 (1%)
 Frame = -2

Query: 556  DNGEQP-PPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMA 380
            D G +P PP +P P  + V    P+ K K         + +    G  +   GG  +P  
Sbjct: 1198 DEGSKPKPPPTPPPEPESVAEPEPEVKGKGAKAGAKPASKDTLKKGKGK-GKGGDDEPTP 1256

Query: 379  PPSPP 365
            PP+PP
Sbjct: 1257 PPTPP 1261



>pir|T18397|T18397 protein CTRP - malaria parasite (Plasmodium
           falciparum)>gb:PFU34363_1395068 Plasmodium falciparum
           CTRP gene, complete cds.
          Length = 2098

 Score = 35.8 bits (81), Expect = 0.87
 Identities = 26/74 (35%), Positives = 32/74 (43%), Gaps = 1/74 (1%)
 Frame = -2

Query: 586 VEDKFYRKRHDNGEQPPPVSPLPREDGVFRSSPDQKPKSTTP-SPSRFAMEHCSPGNNEP 410
           V + F +K  DNG   PP SP     G    S    P  +TP SPS       +PGN   
Sbjct: 747 VSEVFVKKICDNGVVLPPGSPSESTPGSPSESTPGNPSESTPGSPS-----ESTPGNPSE 801

Query: 409 NSGGSHDPMAPPSP 368
           ++ GS     P SP
Sbjct: 802 STPGSPSESTPGSP 815



>gb:BC071180_2556021 Danio rerio zgc:63914, mRNA (cDNA clone
           MGC:63914 IMAGE:6790615), complete cds.
          Length = 441

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 21/62 (33%), Positives = 28/62 (45%), Gaps = 1/62 (1%)
 Frame = -2

Query: 535 PVSPLPREDGVFRSSPDQKPKSTTPS-PSRFAMEHCSPGNNEPNSGGSHDPMAPPSPPII 359
           P  P  +ED    S     P+S+ P  PS   +     G N P++G  H   APP PP +
Sbjct: 122 PRPPGSQEDPDSPSQQVSPPESSRPQRPSLPDLSRSPAGGNSPSTGMKHSSSAPPPPPPM 181

Query: 358 QR 353
            R
Sbjct: 182 SR 183



>gb:MMU271054_2119971 Mus musculus partial mRNA for iroquois
           homeobox protein 5 (Irx5 gene).
          Length = 410

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 25/71 (35%), Positives = 30/71 (42%), Gaps = 5/71 (7%)
 Frame = -2

Query: 562 RHDNGEQPPPVSPLPREDGVFRSSPDQKPK--STTPSPSRFAMEHCSPGNNEPNSGGS-- 395
           RHD   +PP      R     R + D  P   ++ P+P      H S G   P SGGS  
Sbjct: 186 RHDELPRPPRAGESSRVGPHARLAEDAGPHYPASVPAPG----PHPSAGELPPGSGGSSV 241

Query: 394 -HDPMAPPSPP 365
            H P  PP PP
Sbjct: 242 IHSPPPPPPPP 252



>gb:S72602_2041258 bcl2 [human, 697 pre-B cell acute lymphocytic
           leukemia cell line, Genomic, 454 nt].
          Length = 131

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 21/66 (31%), Positives = 28/66 (42%)
 Frame = -2

Query: 556 DNGEQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAP 377
           D G  PP  +P P   G+F S P   P    P+ SR  +   SP       G +  P   
Sbjct: 34  DVGAAPPGAAPAP---GIFSSQPGHTPH---PAASRDPVARTSPLQTPAAPGAAAGPALS 87

Query: 376 PSPPII 359
           P PP++
Sbjct: 88  PVPPVV 93



>gb:AY462111_1607522 Pleurotus djamor ketopantoate reductase-like
           protein (KPAR), GDP-fucose transporter-like protein
           (GDPF), glycine dehydrogenase-like protein (GLYDH),
           hypothetical protein PDUPA1 (PDUPA1) genes, complete
           cds; HD2 homeodomain mating-type protein (a2) gene,
           a2-A7 allele, complete cds; HD1 homeodomain mating-type
           protein (a1) gene, a1-A7 allele, complete cds;
           mitochondrial intermediate peptidase (MIP) gene,
           complete cds, nuclear gene for mitochondrial protein;
           hypothetical protein PDUPA2 (UPA2), hypothetical protein
           PDUPA3 (UPA3), putative glycogenin protein (GLGEN),
           putative NADH:flavin oxidoreductase 1 (FMNOR1), putative
           NADH:flavin oxidoreductase 2 (FMNOR2), and hypothetical
           protein PDUPA4 (UPA4) genes, complete cds.
          Length = 1190

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 24/88 (27%), Positives = 37/88 (42%), Gaps = 5/88 (5%)
 Frame = -2

Query: 616 EVRTGNSYDIVEDKFYRKRHDNGEQPPPVSPLPR---EDGVFRSSPDQKPKSTTPSPSRF 446
           +V++   + I ED F+R        PPP S +P    E G +R    +    + P P   
Sbjct: 671 KVQSPGDHPINEDGFFR--------PPPASDIPNSLLEQGHYRQVTGESETGSAPQPDAT 722

Query: 445 AMEHCSPGNNEPN--SGGSHDPMAPPSP 368
            ++H  P  N+P    G +      PSP
Sbjct: 723 KVKHIFPWENKPRYMPGRAFPEGEKPSP 750



>gb:AB019228_1514090 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MCK7.
          Length = 1307

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 22/65 (33%), Positives = 28/65 (43%), Gaps = 6/65 (9%)
 Frame = -2

Query: 541 PPPVSPLPREDGV--FRSSPDQKPKSTTPSPSRFAMEHCSP----GNNEPNSGGSHDPMA 380
           PPP  P P+ +G+   +SSP        P+P R      SP        P  G +  P A
Sbjct: 735 PPPAPPTPQSNGISAMKSSPP-----APPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSA 789

Query: 379 PPSPP 365
           PP PP
Sbjct: 790 PPPPP 794



>gb:A76121_1450667 Sequence 1 from Patent
           WO9320200.>gb:AX277471_1465097 Sequence 11 from Patent
           WO0160998.>gb:HUMBCL2A_2029540 Human B-cell
           leukemia/lymphoma 2 (bcl-2) proto-oncogene mRNA encoding
           bcl-2-alpha protein, complete cds.
          Length = 239

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 21/66 (31%), Positives = 28/66 (42%)
 Frame = -2

Query: 556 DNGEQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAP 377
           D G  PP  +P P   G+F S P   P    P+ SR  +   SP       G +  P   
Sbjct: 34  DVGAAPPGAAPAP---GIFSSQPGHTPH---PAASRDPVARTSPLQTPAAPGAAAGPALS 87

Query: 376 PSPPII 359
           P PP++
Sbjct: 88  PVPPVV 93



>gb:U40419_1403344 Caenorhabditis elegans cosmid C27F2, complete
            sequence.
          Length = 1715

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 21/63 (33%), Positives = 28/63 (44%), Gaps = 4/63 (6%)
 Frame = -2

Query: 541  PPPVSP----LPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPP 374
            PPP  P     P E     + P ++PK  TPS +R   +  S  N   +   S  P+AP 
Sbjct: 1335 PPPTEPEKPIKPSEQKKPNAIPVERPKQPTPSKARTPSKTPSQSNRAQHPASSPAPIAPT 1394

Query: 373  SPP 365
            S P
Sbjct: 1395 SAP 1397



>pir|T15666|T15666 hypothetical protein C27F2.8 - Caenorhabditis
            elegans
          Length = 1659

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 21/63 (33%), Positives = 28/63 (44%), Gaps = 4/63 (6%)
 Frame = -2

Query: 541  PPPVSP----LPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPP 374
            PPP  P     P E     + P ++PK  TPS +R   +  S  N   +   S  P+AP 
Sbjct: 1335 PPPTEPEKPIKPSEQKKPNAIPVERPKQPTPSKARTPSKTPSQSNRAQHPASSPAPIAPT 1394

Query: 373  SPP 365
            S P
Sbjct: 1395 SAP 1397



>pir|B29409|TVHUB1 transforming protein bcl-2, splice form beta -
           human>gb:AX277473_1465098 Sequence 13 from Patent
           WO0160998.>gb:HUMBCL2B_2029541 Human B-cell
           leukemia/lymphoma 2 (bcl-2) proto-oncogene mRNA encoding
           bcl-2-beta protein, complete cds.
          Length = 205

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 21/66 (31%), Positives = 28/66 (42%)
 Frame = -2

Query: 556 DNGEQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAP 377
           D G  PP  +P P   G+F S P   P    P+ SR  +   SP       G +  P   
Sbjct: 34  DVGAAPPGAAPAP---GIFSSQPGHTPH---PAASRDPVARTSPLQTPAAPGAAAGPALS 87

Query: 376 PSPPII 359
           P PP++
Sbjct: 88  PVPPVV 93



>sp|P10415|BCL2_HUMAN Apoptosis regulator Bcl-2.>pir|C37332|TVHUA1
           transforming protein bcl-2, splice form alpha -
           human>gb:AY220759_1939538 Homo sapiens B-cell
           CLL/lymphoma 2 (BCL2) gene, complete
           cds.>gb:BC027258_1978876 Homo sapiens B-cell
           CLL/lymphoma 2, transcript variant alpha, mRNA (cDNA
           clone MGC:21366 IMAGE:4511027), complete cds.
          Length = 239

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 21/66 (31%), Positives = 28/66 (42%)
 Frame = -2

Query: 556 DNGEQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAP 377
           D G  PP  +P P   G+F S P   P    P+ SR  +   SP       G +  P   
Sbjct: 34  DVGAAPPGAAPAP---GIFSSQPGHTPH---PAASRDPVARTSPLQTPAAPGAAAGPALS 87

Query: 376 PSPPII 359
           P PP++
Sbjct: 88  PVPPVV 93



>gb:AP003622_1831616 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0633E08.
          Length = 643

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 28/69 (40%), Positives = 30/69 (43%), Gaps = 5/69 (7%)
 Frame = -2

Query: 544 QPPPVSPLPREDGV---FRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPP 374
           QPPPV PLP  D      RS P   P    P P+  A    S       SG S  P+A  
Sbjct: 108 QPPPVRPLPTVDPAPLHRRSPPPPPPHRRLPDPAAAA----STAPQTVGSGVSPPPVASS 163

Query: 373 S--PPIIQR 353
           S  PP IQR
Sbjct: 164 SATPPRIQR 172



>gb:AP005647_1855410 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0026E05.
          Length = 694

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 25/63 (39%), Positives = 35/63 (55%), Gaps = 1/63 (1%)
 Frame = -2

Query: 550 GEQPP-PVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPP 374
           G+ PP PVS  PR     R  P  +P S++P+PS     + SP ++ P   GS+ P + P
Sbjct: 397 GQGPPAPVSSPPR-----RRGPYPQPPSSSPTPS-----YPSPSSSYPAPPGSNTP-SYP 445

Query: 373 SPP 365
           SPP
Sbjct: 446 SPP 448



>gb:NCB11N2_1689085 Neurospora crassa DNA linkage group V BAC contig
           B11N2.
          Length = 1006

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 21/61 (34%), Positives = 27/61 (44%)
 Frame = -2

Query: 547 EQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSP 368
           E PPP      ED +F SS   K + TT  PSR A +  +P    P    +     P +P
Sbjct: 634 EAPPPSQQFEDEDLLFGSSGPSKSQITTALPSRPAAKSTAPPPPAPRRSPAPIQPKPAAP 693

Query: 367 P 365
           P
Sbjct: 694 P 694



>gb:PFMAL3P5_1394524 Plasmodium falciparum MAL3P5, complete
           sequence.
          Length = 2114

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 25/74 (33%), Positives = 32/74 (43%), Gaps = 1/74 (1%)
 Frame = -2

Query: 586 VEDKFYRKRHDNGEQPPPVSPLPREDGVFRSSPDQKPKSTTP-SPSRFAMEHCSPGNNEP 410
           V + F +K  DNG   PP SP     G    S    P  +TP SPS       +PGN   
Sbjct: 747 VSEVFVKKICDNGVVLPPGSPSESTPGSPSESTPGSPSESTPGSPS-----ESTPGNPSE 801

Query: 409 NSGGSHDPMAPPSP 368
           ++ GS     P +P
Sbjct: 802 STPGSPSESTPGNP 815



>gb:AY122256_1301618 Drosophila melanogaster SD07343 full insert
           cDNA.
          Length = 1153

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 23/64 (35%), Positives = 27/64 (42%), Gaps = 9/64 (14%)
 Frame = -2

Query: 541 PPPVSPLPREDGVFRSSPDQ---------KPKSTTPSPSRFAMEHCSPGNNEPNSGGSHD 389
           PPP SP+   D   RS+P Q         +P S  P P +F   H SP    P  GG   
Sbjct: 104 PPPESPI---DASARSTPGQDSQGSNSNSQPPSMPPQPQQFQSPHPSPHMPSPAGGGLPP 160

Query: 388 PMAP 377
            M P
Sbjct: 161 GMHP 164



>gb:AF475087_1274210 Drosophila melanogaster transcriptional
            corepressor Atro (Atro) mRNA, complete cds.
          Length = 1985

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 23/64 (35%), Positives = 27/64 (42%), Gaps = 9/64 (14%)
 Frame = -2

Query: 541  PPPVSPLPREDGVFRSSPDQ---------KPKSTTPSPSRFAMEHCSPGNNEPNSGGSHD 389
            PPP SP+   D   RS+P Q         +P S  P P +F   H SP    P  GG   
Sbjct: 936  PPPESPI---DASARSTPGQDSQGSNSNSQPPSMPPQPQQFQSPHPSPHMPSPAGGGLPP 992

Query: 388  PMAP 377
             M P
Sbjct: 993  GMHP 996



>gb:AF217844_1252053 Drosophila melanogaster GRUNGE (Gug) mRNA,
            complete cds.
          Length = 1966

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 23/64 (35%), Positives = 27/64 (42%), Gaps = 9/64 (14%)
 Frame = -2

Query: 541  PPPVSPLPREDGVFRSSPDQ---------KPKSTTPSPSRFAMEHCSPGNNEPNSGGSHD 389
            PPP SP+   D   RS+P Q         +P S  P P +F   H SP    P  GG   
Sbjct: 936  PPPESPI---DASARSTPGQDSQGSNSNSQPPSMPPQPQQFQSPHPSPHMPSPAGGGLPP 992

Query: 388  PMAP 377
             M P
Sbjct: 993  GMHP 996



>gb:AE014296_1135345 Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE003555_1215356 Drosophila melanogaster
            chromosome 3L, section 30 of 83 of the complete sequence.
          Length = 1966

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 23/64 (35%), Positives = 27/64 (42%), Gaps = 9/64 (14%)
 Frame = -2

Query: 541  PPPVSPLPREDGVFRSSPDQ---------KPKSTTPSPSRFAMEHCSPGNNEPNSGGSHD 389
            PPP SP+   D   RS+P Q         +P S  P P +F   H SP    P  GG   
Sbjct: 936  PPPESPI---DASARSTPGQDSQGSNSNSQPPSMPPQPQQFQSPHPSPHMPSPAGGGLPP 992

Query: 388  PMAP 377
             M P
Sbjct: 993  GMHP 996



>gb:AE014296_1135344 Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE003555_1215355 Drosophila melanogaster
            chromosome 3L, section 30 of 83 of the complete sequence.
          Length = 1985

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 23/64 (35%), Positives = 27/64 (42%), Gaps = 9/64 (14%)
 Frame = -2

Query: 541  PPPVSPLPREDGVFRSSPDQ---------KPKSTTPSPSRFAMEHCSPGNNEPNSGGSHD 389
            PPP SP+   D   RS+P Q         +P S  P P +F   H SP    P  GG   
Sbjct: 936  PPPESPI---DASARSTPGQDSQGSNSNSQPPSMPPQPQQFQSPHPSPHMPSPAGGGLPP 992

Query: 388  PMAP 377
             M P
Sbjct: 993  GMHP 996



>gb:AE014296_1135343 Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE003555_1215354 Drosophila melanogaster
            chromosome 3L, section 30 of 83 of the complete sequence.
          Length = 1985

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 23/64 (35%), Positives = 27/64 (42%), Gaps = 9/64 (14%)
 Frame = -2

Query: 541  PPPVSPLPREDGVFRSSPDQ---------KPKSTTPSPSRFAMEHCSPGNNEPNSGGSHD 389
            PPP SP+   D   RS+P Q         +P S  P P +F   H SP    P  GG   
Sbjct: 936  PPPESPI---DASARSTPGQDSQGSNSNSQPPSMPPQPQQFQSPHPSPHMPSPAGGGLPP 992

Query: 388  PMAP 377
             M P
Sbjct: 993  GMHP 996



>gb:AE014296_1135342 Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE003555_1215353 Drosophila melanogaster
            chromosome 3L, section 30 of 83 of the complete sequence.
          Length = 1988

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 23/64 (35%), Positives = 27/64 (42%), Gaps = 9/64 (14%)
 Frame = -2

Query: 541  PPPVSPLPREDGVFRSSPDQ---------KPKSTTPSPSRFAMEHCSPGNNEPNSGGSHD 389
            PPP SP+   D   RS+P Q         +P S  P P +F   H SP    P  GG   
Sbjct: 936  PPPESPI---DASARSTPGQDSQGSNSNSQPPSMPPQPQQFQSPHPSPHMPSPAGGGLPP 992

Query: 388  PMAP 377
             M P
Sbjct: 993  GMHP 996



>gb:BA000039_728006 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 488

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 25/68 (36%), Positives = 29/68 (42%), Gaps = 9/68 (13%)
 Frame = -2

Query: 541 PPPVSPLPR------EDGVFRSSPDQKPKST---TPSPSRFAMEHCSPGNNEPNSGGSHD 389
           PPP S  P       E GV +SSP   P  +   TP PS  A     P N++P S     
Sbjct: 413 PPPSSSEPSNATPSPEPGVSQSSPPPAPVESPVPTPPPSPAAETPPPPTNSQPTSEPPTP 472

Query: 388 PMAPPSPP 365
           P  P  PP
Sbjct: 473 PPQPTPPP 480



>sp|Q9CXC3|CT72_MOUSE Protein C20orf72 homolog.>gb:AK018387_1159550
           Mus musculus 16 days embryo lung cDNA, RIKEN full-length
           enriched library, clone:8430406I07 product:hypothetical
           protein, full insert sequence.>gb:AK031535_1162482 Mus
           musculus 13 days embryo male testis cDNA, RIKEN
           full-length enriched library, clone:6030448G16
           product:hypothetical protein, full insert
           sequence.>gb:AK043140_1166520 Mus musculus 7 days
           neonate cerebellum cDNA, RIKEN full-length enriched
           library, clone:A730059E21 product:hypothetical protein,
           full insert sequence.>gb:AK049565_1168861 Mus musculus 7
           days embryo whole body cDNA, RIKEN full-length enriched
           library, clone:C430041G10 product:hypothetical protein,
           full insert sequence.>gb:BC063088_2105155 Mus musculus
           RIKEN cDNA 8430406I07 gene, mRNA (cDNA clone MGC:69979
           IMAGE:6329248), complete cds.
          Length = 338

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 26/91 (28%), Positives = 37/91 (40%), Gaps = 5/91 (5%)
 Frame = -2

Query: 601 NSYDIVEDKFY----RKRHDNGEQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEH 434
           NSY+ V+   Y    R     G    P S    +D ++   P  K K+  P P     +H
Sbjct: 40  NSYEAVDQAKYSRLVRSVLSRGPAQTPESLFKEDDVLY--GPVSKHKAAEPEPQARVPQH 97

Query: 433 CSPGNNEPNSGGSH-DPMAPPSPPIIQREDV 344
           C P  NE  +G  H D  + P    +QR  +
Sbjct: 98  CFPIFNEERTGKPHTDASSSPLKIPLQRNSI 128



>gb:BC054483_2101730 Mus musculus ataxin 2-like, mRNA (cDNA clone
           MGC:62777 IMAGE:6391591), complete cds.
          Length = 1049

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 4/46 (8%)
 Frame = -2

Query: 490 PDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPM----APPSPP 365
           P Q  +   P P++ A+   SPG   P +GG   P+    APP PP
Sbjct: 7   PQQTSQPQQPPPTQQAVARRSPGGTSPPNGGLPGPLTATAAPPGPP 52



>gb:AK122196_2068861 Mus musculus mRNA for mKIAA0059 protein.
          Length = 670

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 32/90 (35%), Positives = 40/90 (44%), Gaps = 16/90 (17%)
 Frame = -2

Query: 583 EDKFYRKRHDNGEQPPPVSPLPREDG--------VFRS-------SPDQKPKSTTPSPSR 449
           EDK  ++R   GE P  +SP P  +G        + RS       SP     S TP+ SR
Sbjct: 355 EDK--QERQSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSR 412

Query: 448 FAMEHCSPGNNEPNSG-GSHDPMAPPSPPI 362
                  PG NEP+SG  S  P  P S P+
Sbjct: 413 SPQHFHRPG-NEPSSGRNSPLPYRPDSRPL 441



>gb:AF404775_2065156 Mus musculus actin-binding LIM protein 1 medium
           isoform (Ablim1) mRNA, complete cds; alternatively
           spliced.
          Length = 701

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 32/90 (35%), Positives = 40/90 (44%), Gaps = 16/90 (17%)
 Frame = -2

Query: 583 EDKFYRKRHDNGEQPPPVSPLPREDG--------VFRS-------SPDQKPKSTTPSPSR 449
           EDK  ++R   GE P  +SP P  +G        + RS       SP     S TP+ SR
Sbjct: 339 EDK--QERQSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSR 396

Query: 448 FAMEHCSPGNNEPNSG-GSHDPMAPPSPPI 362
                  PG NEP+SG  S  P  P S P+
Sbjct: 397 SPQHFHRPG-NEPSSGRNSPLPYRPDSRPL 425



>gb:AP006548_1862368 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone: P0705E11.
          Length = 4322

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 22/68 (32%), Positives = 26/68 (38%), Gaps = 9/68 (13%)
 Frame = -2

Query: 550 GEQPPPVSPLPREDGVFRS---------SPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGG 398
           GEQPPP   L  +  VF S         SP +K  S+TPS   F      P     +   
Sbjct: 276 GEQPPPADSLSEKASVFSSQSTTHKSIASPSKKNTSSTPSLGNFPSTADKPPRIHADMSS 335

Query: 397 SHDPMAPP 374
             D   PP
Sbjct: 336 IRDVSVPP 343



>gb:CR382132_1665573 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 408

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 19/61 (31%), Positives = 25/61 (40%)
 Frame = -2

Query: 547 EQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSP 368
           + PPP  P    D  +   P   P  T   P+         G ++P+ GG H P  PP P
Sbjct: 114 QHPPPPPPPSLHDYHYTHGPPISPNMTQAPPAVQTPTQTPLGLHQPH-GGIHGPPPPPPP 172

Query: 367 P 365
           P
Sbjct: 173 P 173



>gb:AY280868_1594658 Brassica napus putative beta-glucan elicitor
           receptor (Bger1), constans-like protein (CoL), and
           constans (Coa1) genes, complete cds.
          Length = 752

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 30/109 (27%), Positives = 46/109 (42%), Gaps = 1/109 (0%)
 Frame = -2

Query: 562 RHDNGEQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHC-SPGNNEPNSGGSHDP 386
           R  + E PPP SPLP      +S P Q+  S+    + F      S    +P+   SHD 
Sbjct: 27  RPPSPEPPPPTSPLP------QSPPPQEMSSSRQKNAPFLFPRSESSVLPDPSRFFSHDL 80

Query: 385 MAPPSPPIIQREDV*HNEILRFRLKFGLQLTSYERFLCRPHLLSIGILY 239
           ++ P P         ++    F LK G Q   +  ++ +P   S+ I Y
Sbjct: 81  LSTPLPT--------NSFFQNFTLKNGDQAEYFHPYIIKPSPSSLSISY 121



>gb:AF047651_1236416 Caenorhabditis elegans cosmid C05D2, complete
           sequence.
          Length = 702

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 23/86 (26%), Positives = 36/86 (41%)
 Frame = -2

Query: 601 NSYDIVEDKFYRKRHDNGEQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPG 422
           NSYD  E++F R R+     PPP+  L R+ G  R S  +      PS  +   E  + G
Sbjct: 223 NSYDSDEEEFLRSRYQRAVTPPPI--LERQSGSTRESVSE------PSEGKILEEDATLG 274

Query: 421 NNEPNSGGSHDPMAPPSPPIIQREDV 344
           +      G    +   +P  + R  +
Sbjct: 275 SEHTERVGKRIELEEINPSQLLRTKI 300



>gb:BA000035_717587 Corynebacterium efficiens YS-314 DNA, complete
           genome.
          Length = 422

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 24/79 (30%), Positives = 34/79 (43%), Gaps = 10/79 (12%)
 Frame = -2

Query: 553 NGEQPP--PVSPLPREDGVFRSSPDQKPKSTTPSPSRFA-------MEHCSPGNNEPN-S 404
           NGE PP  P SP P ED       +    +  P+P+  A       +    PG   P+ S
Sbjct: 212 NGEMPPAPPTSPDPAEDSSQAEQTEPAEPTGKPTPATIASTPKPGPVPGPVPGAPRPSPS 271

Query: 403 GGSHDPMAPPSPPIIQRED 347
             + DP+ P  PP+   +D
Sbjct: 272 TSTPDPVVPAEPPLPPADD 290



>pir|T32987|T32987 hypothetical protein C05D2.5 - Caenorhabditis
           elegans
          Length = 774

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 23/86 (26%), Positives = 36/86 (41%)
 Frame = -2

Query: 601 NSYDIVEDKFYRKRHDNGEQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPG 422
           NSYD  E++F R R+     PPP+  L R+ G  R S  +      PS  +   E  + G
Sbjct: 295 NSYDSDEEEFLRSRYQRAVTPPPI--LERQSGSTRESVSE------PSEGKILEEDATLG 346

Query: 421 NNEPNSGGSHDPMAPPSPPIIQREDV 344
           +      G    +   +P  + R  +
Sbjct: 347 SEHTERVGKRIELEEINPSQLLRTKI 372



>pir|T51947|T51947 probable transcription factor HUA2 [imported] -
            Arabidopsis thaliana>gb:AF116556_1769406 Arabidopsis
            thaliana putative transcription factor (HUA2) mRNA,
            complete cds.
          Length = 1392

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 20/61 (32%), Positives = 24/61 (39%)
 Frame = -2

Query: 547  EQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSP 368
            E PPP+ PLP        SP   P S  P P         P  ++P       P +PP P
Sbjct: 1067 ESPPPLPPLPPSPPP--PSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPP 1124

Query: 367  P 365
            P
Sbjct: 1125 P 1125



>gb:BC085671_2564547 Danio rerio zgc:92560, mRNA (cDNA clone
           MGC:92560 IMAGE:2351710), complete cds.
          Length = 913

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 19/59 (32%), Positives = 22/59 (37%)
 Frame = -2

Query: 541 PPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSPP 365
           PPP    P   G     P +   ST   PSR  +    P  N P+      P AP  PP
Sbjct: 532 PPPPPDRPHPAGADNRLPRRPLPSTPGDPSRDKLPPAPPNRNMPDWNSRPVPKAPSQPP 590



>gb:OBU87832_2444738 Oat blue dwarf virus complete genome.
          Length = 2066

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 23/64 (35%), Positives = 30/64 (46%)
 Frame = -2

Query: 541 PPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSPPI 362
           P P SP P  D   R+ P Q P S  PS    A     P + EP +  +H P   P  P+
Sbjct: 556 PHPPSPTPAPDS--RAEPLQPP-SAPPSTHEPA-----PADLEPQAPPAHAPQTEPPSPV 607

Query: 361 IQRE 350
           I++E
Sbjct: 608 IEQE 611



>gb:HSBCL2IG_2011003 H.sapiens mRNA for bcl2-Ig fusion gene.
          Length = 239

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 21/66 (31%), Positives = 27/66 (40%)
 Frame = -2

Query: 556 DNGEQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAP 377
           D G  PP  +P P   G F S P   P    P+ SR  +   SP       G +  P   
Sbjct: 34  DVGAAPPGAAPAP---GFFSSQPGHTPH---PAASRDPVARTSPLQTPAAPGAAAGPALS 87

Query: 376 PSPPII 359
           P PP++
Sbjct: 88  PVPPVV 93



>gb:BA000025_1966146 Homo sapiens genomic DNA, chromosome 6p21.3, HLA
            Class I region.
          Length = 1126

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = -2

Query: 550  GEQPPPVSPLPRE-DGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHD 389
            G+ P P+   P E  G  R+SP+ + ++ +P+P   A E  S G      GGS D
Sbjct: 938  GDPPQPLPEEPMEVQGAERASPEPQRENASPAPGTTAEEAMSRGPPPAPEGGSRD 992



>gb:AL805934_1932917 Human DNA sequence from clone DAQB-195H10 on
            chromosome 6 Contains the AIF1 gene for allograft
            inflammatory factor 1, the BAT2 genes for HLA-B
            associated transcript 2, the BAT3 gene for HLA-B
            associated transcript 3, the APOM gene for apolipoprotein
            M, the C6orf47 gene for chromosome 6 open reading frame
            47, the BAT4 gene for HLA-B associated transcript 4, the
            CSNK2B gene for casein kinase 2, beta polypeptide, the
            LY6G5B gene for lymphocyte antigen 6 complex, locus G5B,
            the bQB195H10.12 gene for a novel protein, the LY6G5C
            gene for lymphocyte antigen 6 complex, locus G5C, the
            BAT5 gene for HLA-B associated transcript 5, the 5' end
            for LY6G6D gene for lymphocyte antigen 6 complex, locus
            G6D and 7 CpG islands, complete sequence.
          Length = 1162

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = -2

Query: 550  GEQPPPVSPLPRE-DGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHD 389
            G+ P P+   P E  G  R+SP+ + ++ +P+P   A E  S G      GGS D
Sbjct: 974  GDPPQPLPEEPMEVQGAERASPEPQRENASPAPGTTAEEAMSRGPPPAPEGGSRD 1028



>gb:AL805934_1932915 Human DNA sequence from clone DAQB-195H10 on
            chromosome 6 Contains the AIF1 gene for allograft
            inflammatory factor 1, the BAT2 genes for HLA-B
            associated transcript 2, the BAT3 gene for HLA-B
            associated transcript 3, the APOM gene for apolipoprotein
            M, the C6orf47 gene for chromosome 6 open reading frame
            47, the BAT4 gene for HLA-B associated transcript 4, the
            CSNK2B gene for casein kinase 2, beta polypeptide, the
            LY6G5B gene for lymphocyte antigen 6 complex, locus G5B,
            the bQB195H10.12 gene for a novel protein, the LY6G5C
            gene for lymphocyte antigen 6 complex, locus G5C, the
            BAT5 gene for HLA-B associated transcript 5, the 5' end
            for LY6G6D gene for lymphocyte antigen 6 complex, locus
            G6D and 7 CpG islands, complete sequence.
          Length = 1077

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = -2

Query: 550  GEQPPPVSPLPRE-DGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHD 389
            G+ P P+   P E  G  R+SP+ + ++ +P+P   A E  S G      GGS D
Sbjct: 938  GDPPQPLPEEPMEVQGAERASPEPQRENASPAPGTTAEEAMSRGPPPAPEGGSRD 992



>gb:AL805934_1932912 Human DNA sequence from clone DAQB-195H10 on
            chromosome 6 Contains the AIF1 gene for allograft
            inflammatory factor 1, the BAT2 genes for HLA-B
            associated transcript 2, the BAT3 gene for HLA-B
            associated transcript 3, the APOM gene for apolipoprotein
            M, the C6orf47 gene for chromosome 6 open reading frame
            47, the BAT4 gene for HLA-B associated transcript 4, the
            CSNK2B gene for casein kinase 2, beta polypeptide, the
            LY6G5B gene for lymphocyte antigen 6 complex, locus G5B,
            the bQB195H10.12 gene for a novel protein, the LY6G5C
            gene for lymphocyte antigen 6 complex, locus G5C, the
            BAT5 gene for HLA-B associated transcript 5, the 5' end
            for LY6G6D gene for lymphocyte antigen 6 complex, locus
            G6D and 7 CpG islands, complete
            sequence.>gb:DJ201G24_1995555 Homo sapiens MSH55 gene,
            partial cds; and CLIC1, DDAH, G6b, G6c, G5b, G6d, G6e,
            G6f, BAT5, G5b, CSK2B, BAT4, G4, Apo M, BAT3, BAT2,
            AIF-1, 1C7, LST-1, LTB, TNF, and LTA genes, complete cds.
          Length = 1229

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = -2

Query: 550  GEQPPPVSPLPRE-DGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHD 389
            G+ P P+   P E  G  R+SP+ + ++ +P+P   A E  S G      GGS D
Sbjct: 1041 GDPPQPLPEEPMEVQGAERASPEPQRENASPAPGTTAEEAMSRGPPPAPEGGSRD 1095



>gb:AL662801_1931519 Human DNA sequence from clone XXbac-296P20 on
            chromosome 6 contains a ribosomal protein L15 (RPL15)
            pseudogene, the BAT1 gene for HLA-B associated transcript
            1, the ATP6V1G gene for ATPase, H+ transporting,
            lysosomal 13kDa, V1 subunit G, the NFKBIL1 gene for
            nuclear factor of kappa light polypeptide gene enhancer
            in B-cells inhibitor-like 1, the LTA gene for lymphotoxin
            alpha, the TNF gene for tumour necrosis factor, the LTB
            gene for lymphotoxin beta, the LST1 gene for leukocyte
            specific transcript 1, the LY117 gene for lymphocyte
            antigen 117, the AIF1 gene for alograft imflammatory
            factor 1, the BAT2 gene for HLA-B associated transcript
            2, the BAT3 gene for HLA-B associated transcript 3, the
            APOM gene for apolipoprotein M, the 3' end of the gene
            for chromosome 6, open reading frame 47 and four CpG
            islands, complete sequence.>gb:AL662847_1931764 Human DNA
            sequence from clone XXbac-270M2 on chromosome 6 contains
            the gene for a novel protein similar to similar to
            peptidyl-prolyl cis-trans isomerase A (PPIase), a
            ribosomal protein L15 (RPL15) pseudogene, the BAT1 gene
            for HLA-B associated transcript 1, the ATP6V1G gene for
            ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G,
            the NFKBIL1 gene for nuclear factor of kappa light
            polypeptide gene enhancer in B-cells inhibitor-like 1,
            the LTA gene for lymphotoxin alpha, the TNF gene for
            tumour necrosis factor, the LTB gene for lymphotoxin
            beta, the LST1 gene for leukocyte specific transcript 1,
            the LY117 gene for lymphocyte antigen 117, the AIF1 gene
            for alograft imflammatory factor 1, the BAT2 gene for
            HLA-B associated transcript 2, the 3' end of the BAT3
            gene for HLA-B associated transcript 3 and two CpG
            islands, complete sequence.>gb:AL670886_1932118 Human DNA
            sequence from clone XXbac-88C14 on chromosome 6 contains
            the 5' end of the BAT3 gene for HLA-B associated
            transcript 3, the APOM gene for apolipoprotein M, the
            gene for chromosome 6, open reading frame 47, the BAT4
            gene for HLA-B associated transcript 4, the CSNK2B gene
            for casein kinase 2, beta polypeptide, the LY6G5B gene
            for lymphocyte antigen 6 complex, locus 5B , the gene for
            G5c protein, the BAT5 gene for HLA-B associated
            transcript 5, the LY6G6F gene for lymphocyte antigen 6
            complex, locus G6f, the LY6G6E gene for lymphocyte
            antigen 6 complex, locus G6E, the LY6G6C gene for
            lymphocyte antigen 6 complex, locus G6C, the gene for
            chromosome 6 open reading frame 25, the DDAH gene for
            dimethylarginine dimethylaminohydrolase 2, the CLIC1 gene
            for chloride intracellular channel 1 and seven CpG
            islands, complete sequence.>gb:AL805934_1932918 Human DNA
            sequence from clone DAQB-195H10 on chromosome 6 Contains
            the AIF1 gene for allograft inflammatory factor 1, the
            BAT2 genes for HLA-B associated transcript 2, the BAT3
            gene for HLA-B associated transcript 3, the APOM gene for
            apolipoprotein M, the C6orf47 gene for chromosome 6 open
            reading frame 47, the BAT4 gene for HLA-B associated
            transcript 4, the CSNK2B gene for casein kinase 2, beta
            polypeptide, the LY6G5B gene for lymphocyte antigen 6
            complex, locus G5B, the bQB195H10.12 gene for a novel
            protein, the LY6G5C gene for lymphocyte antigen 6
            complex, locus G5C, the BAT5 gene for HLA-B associated
            transcript 5, the 5' end for LY6G6D gene for lymphocyte
            antigen 6 complex, locus G6D and 7 CpG islands, complete
            sequence.
          Length = 1132

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = -2

Query: 550  GEQPPPVSPLPRE-DGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHD 389
            G+ P P+   P E  G  R+SP+ + ++ +P+P   A E  S G      GGS D
Sbjct: 944  GDPPQPLPEEPMEVQGAERASPEPQRENASPAPGTTAEEAMSRGPPPAPEGGSRD 998



>gb:AL662801_1931518 Human DNA sequence from clone XXbac-296P20 on
            chromosome 6 contains a ribosomal protein L15 (RPL15)
            pseudogene, the BAT1 gene for HLA-B associated transcript
            1, the ATP6V1G gene for ATPase, H+ transporting,
            lysosomal 13kDa, V1 subunit G, the NFKBIL1 gene for
            nuclear factor of kappa light polypeptide gene enhancer
            in B-cells inhibitor-like 1, the LTA gene for lymphotoxin
            alpha, the TNF gene for tumour necrosis factor, the LTB
            gene for lymphotoxin beta, the LST1 gene for leukocyte
            specific transcript 1, the LY117 gene for lymphocyte
            antigen 117, the AIF1 gene for alograft imflammatory
            factor 1, the BAT2 gene for HLA-B associated transcript
            2, the BAT3 gene for HLA-B associated transcript 3, the
            APOM gene for apolipoprotein M, the 3' end of the gene
            for chromosome 6, open reading frame 47 and four CpG
            islands, complete sequence.>gb:AL662847_1931763 Human DNA
            sequence from clone XXbac-270M2 on chromosome 6 contains
            the gene for a novel protein similar to similar to
            peptidyl-prolyl cis-trans isomerase A (PPIase), a
            ribosomal protein L15 (RPL15) pseudogene, the BAT1 gene
            for HLA-B associated transcript 1, the ATP6V1G gene for
            ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G,
            the NFKBIL1 gene for nuclear factor of kappa light
            polypeptide gene enhancer in B-cells inhibitor-like 1,
            the LTA gene for lymphotoxin alpha, the TNF gene for
            tumour necrosis factor, the LTB gene for lymphotoxin
            beta, the LST1 gene for leukocyte specific transcript 1,
            the LY117 gene for lymphocyte antigen 117, the AIF1 gene
            for alograft imflammatory factor 1, the BAT2 gene for
            HLA-B associated transcript 2, the 3' end of the BAT3
            gene for HLA-B associated transcript 3 and two CpG
            islands, complete sequence.>gb:AL670886_1932119 Human DNA
            sequence from clone XXbac-88C14 on chromosome 6 contains
            the 5' end of the BAT3 gene for HLA-B associated
            transcript 3, the APOM gene for apolipoprotein M, the
            gene for chromosome 6, open reading frame 47, the BAT4
            gene for HLA-B associated transcript 4, the CSNK2B gene
            for casein kinase 2, beta polypeptide, the LY6G5B gene
            for lymphocyte antigen 6 complex, locus 5B , the gene for
            G5c protein, the BAT5 gene for HLA-B associated
            transcript 5, the LY6G6F gene for lymphocyte antigen 6
            complex, locus G6f, the LY6G6E gene for lymphocyte
            antigen 6 complex, locus G6E, the LY6G6C gene for
            lymphocyte antigen 6 complex, locus G6C, the gene for
            chromosome 6 open reading frame 25, the DDAH gene for
            dimethylarginine dimethylaminohydrolase 2, the CLIC1 gene
            for chloride intracellular channel 1 and seven CpG
            islands, complete sequence.>gb:AL805934_1932916 Human DNA
            sequence from clone DAQB-195H10 on chromosome 6 Contains
            the AIF1 gene for allograft inflammatory factor 1, the
            BAT2 genes for HLA-B associated transcript 2, the BAT3
            gene for HLA-B associated transcript 3, the APOM gene for
            apolipoprotein M, the C6orf47 gene for chromosome 6 open
            reading frame 47, the BAT4 gene for HLA-B associated
            transcript 4, the CSNK2B gene for casein kinase 2, beta
            polypeptide, the LY6G5B gene for lymphocyte antigen 6
            complex, locus G5B, the bQB195H10.12 gene for a novel
            protein, the LY6G5C gene for lymphocyte antigen 6
            complex, locus G5C, the BAT5 gene for HLA-B associated
            transcript 5, the 5' end for LY6G6D gene for lymphocyte
            antigen 6 complex, locus G6D and 7 CpG islands, complete
            sequence.>gb:BC003133_1968714 Homo sapiens HLA-B
            associated transcript 3, transcript variant 2, mRNA (cDNA
            clone MGC:3619 IMAGE:2957896), complete cds.
          Length = 1126

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = -2

Query: 550  GEQPPPVSPLPRE-DGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHD 389
            G+ P P+   P E  G  R+SP+ + ++ +P+P   A E  S G      GGS D
Sbjct: 938  GDPPQPLPEEPMEVQGAERASPEPQRENASPAPGTTAEEAMSRGPPPAPEGGSRD 992



>gb:AB128049_1873915 Macaca mulatta genes, MHC class I region,
           partial and complete cds.
          Length = 481

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = -2

Query: 550 GEQPPPVSPLPRE-DGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHD 389
           G+ P P+   P E  G  R+SP+ + ++ +P+P   A E  S G      GGS D
Sbjct: 293 GDPPQPLPEEPMEVQGAERASPEPQRENASPAPGTTAEEAMSRGPPPAPEGGSRD 347



>gb:AP002524_1822400 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0406H10.>gb:AP003118_1824789 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OJ1174_D05.
          Length = 520

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 19/59 (32%), Positives = 22/59 (37%)
 Frame = -2

Query: 541 PPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSPP 365
           PPP  P P         P   P ST+P P         P +  P +   H P  PP PP
Sbjct: 380 PPPSPPPPSPPPPSPPPPSPPPPSTSPPPPSPPPPSPPPPSPPPPAPIFHPPQPPPPPP 438



 Score = 33.5 bits (75), Expect = 4.3
 Identities = 19/59 (32%), Positives = 22/59 (37%)
 Frame = -2

Query: 541 PPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSPP 365
           PPP SP P         P   P    P P     E   P    P  GG+   ++PP PP
Sbjct: 416 PPPPSPPPPAPIFHPPQPPPPPPPPAPQPHPPCPELPPPPPPPPPCGGATPALSPPPPP 474



>gb:AC145271_1744284 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone B1140B01, complete sequence.
          Length = 1004

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 23/61 (37%), Positives = 29/61 (47%)
 Frame = -2

Query: 547 EQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSP 368
           E  PP SP PR  G  R+S  ++P+   P+P     E           GG  DP+APP P
Sbjct: 355 EGTPPPSP-PRGGGAVRAS-SKRPEGAVPTPQP---EGERKKKWPRKMGGIRDPVAPPLP 409

Query: 367 P 365
           P
Sbjct: 410 P 410



>gb:AC137609_1743489 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0010H19, complete sequence.
          Length = 1721

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 18/60 (30%), Positives = 25/60 (41%)
 Frame = -2

Query: 544 QPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSPP 365
           +P PV P   E     S+ D    +  P PS++   +   GN    S  +H    PP PP
Sbjct: 289 EPAPVVPQEGEASGVGSTEDALLLTFRPGPSQWRSANAGDGNQPEGSNRNHHGSPPPPPP 348



>gb:AY495663_1608976 Cochliobolus heterostrophus polyketide synthase
            (PKS22) gene, complete cds.
          Length = 2528

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 18/55 (32%), Positives = 26/55 (47%)
 Frame = -2

Query: 529  SPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSPP 365
            +P PR+D   R+       +TT  PSR A+    P +  P  G S    + P+PP
Sbjct: 1737 APAPRKDPAPRTDSAPPKHATTAVPSRHAVPDLLPADASPAHGYSESEGSVPTPP 1791



>gb:AY450929_1606692 Chlamydomonas reinhardtii minus agglutinin (SAD1)
            gene, complete cds.
          Length = 3889

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 23/61 (37%), Positives = 25/61 (40%), Gaps = 2/61 (3%)
 Frame = -2

Query: 541  PPPVSPLPREDGVFRSSPDQKPKS-TTPSPSRFAMEHCSPGNNEPNSGGSHDPM-APPSP 368
            PPP SP P         P  +P S   PSP   + E  SP    P       P  APPSP
Sbjct: 980  PPPPSPEPPSPAPLPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSPPPPSPEPPSPAPPSP 1039

Query: 367  P 365
            P
Sbjct: 1040 P 1040



>gb:CCA438575_1359426 Ceratitis capitata partial mRNA for ecdysone
           receptor A isoform (ecR gene).
          Length = 207

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 22/60 (36%), Positives = 27/60 (45%), Gaps = 6/60 (10%)
 Frame = -2

Query: 526 PLPREDGVFRSSPDQKPKSTTP-SPSRFAMEHC-----SPGNNEPNSGGSHDPMAPPSPP 365
           P   E+ +  SSP   P S  P SPS  +  H      S G   P S GS+DP +P   P
Sbjct: 133 PPSNEEWISTSSPGSVPSSAPPLSPSPGSQNHSYSANMSNGYPSPMSAGSYDPYSPNGKP 192



>gb:AF305060_1260699 Dictyostelium discoideum Wiscott-Aldrich
           syndrome protein (wasA) gene, complete cds.
          Length = 399

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 20/62 (32%), Positives = 26/62 (41%)
 Frame = -2

Query: 550 GEQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPS 371
           G   PP  P   + G  RS+P   P     +P      H +P    P+ GG+  P  PP 
Sbjct: 245 GRSAPPAPPSSNQPG--RSAPPPPPSVGKSAPPPPPPSHKTPAA-PPSGGGAPPPPPPPP 301

Query: 370 PP 365
           PP
Sbjct: 302 PP 303



>gb:HSM807388_1187847 Homo sapiens mRNA; cDNA DKFZp686L0653 (from
            clone DKFZp686L0653).
          Length = 1126

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = -2

Query: 550  GEQPPPVSPLPRE-DGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHD 389
            G+ P P+   P E  G  R+SP+ + ++ +P+P   A E  S G      GGS D
Sbjct: 938  GDPPQPLPEEPMEVQGAERASPEPQRENASPAPGTTAEEAMSRGPPPAPEGGSRD 992



>gb:BX640427_809870 Bordetella parapertussis strain 12822, complete
           genome; segment 5/14.
          Length = 491

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 26/105 (24%), Positives = 42/105 (40%), Gaps = 9/105 (8%)
 Frame = -2

Query: 652 LWLFCCWCSLAQEVRTGNSYDIVEDKFYRKRHDNGEQPPPVSPLPRED--------GVFR 497
           LWL                +++  D  + +  + G +P P  PLP+ED        G   
Sbjct: 26  LWLPAAQAQYWSPGAQAGPHNVGTDGVFDEDEEPGPRPRP--PLPKEDLEALEDLFGSGD 83

Query: 496 SSPDQKPKSTTPSP-SRFAMEHCSPGNNEPNSGGSHDPMAPPSPP 365
           + P+  P   +P P +    E  SP   +   G +  P +PP+PP
Sbjct: 84  TPPEPPPAPPSPGPMAPNVPEDASPHLPDHAGGDAMPPASPPAPP 128



>gb:AY034092_585768 Micrococcus sp. 28 plasmid pSD10, complete
           sequence.
          Length = 491

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 21/61 (34%), Positives = 28/61 (45%), Gaps = 2/61 (3%)
 Frame = -2

Query: 541 PPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCS--PGNNEPNSGGSHDPMAPPSP 368
           PPPVS L R   +  ++P     S  P+ +  A +  S  P  +   S   H P AP SP
Sbjct: 405 PPPVSSLSRSPALSSATPAYPRASRPPAWTSNANDSPSSAPSASSRTSPAEHGPTAPDSP 464

Query: 367 P 365
           P
Sbjct: 465 P 465



>gb:AE006188_216406 Pasteurella multocida subsp. multocida str. Pm70
           section 155 of 204 of the complete
           genome.>gb:AE004439_1119136 Pasteurella multocida subsp.
           multocida str. Pm70, complete genome.
          Length = 348

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 19/59 (32%), Positives = 24/59 (40%)
 Frame = -2

Query: 541 PPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSPP 365
           PPPV P+       +  PD  P    P           P N  P++G    P APP+PP
Sbjct: 36  PPPVQPIQPAPPAHQQ-PDAAPNIPAP-----------PKNQAPDTGAKEAPPAPPAPP 82



>sp|P46379|BAT3_HUMAN Large proline-rich protein BAT3
            (HLA-B-associated transcript 3) (G3).>pir|A35098|A35098
            MHC class III histocompatibility antigen HLA-B-associated
            transcript 3 - human>gb:HUMBAT3A_2029524 Human
            HLA-B-associated transcript 3 (BAT3) mRNA, complete
            cds.>gb:HUMBAT3B2_2029525 Human HLA-B-associated
            transcript 3 (BAT3) gene, 3' end.
          Length = 1132

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = -2

Query: 550  GEQPPPVSPLPRE-DGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHD 389
            G+ P P+   P E  G  R+SP+ + ++ +P+P   A E  S G      GGS D
Sbjct: 944  GDPPQPLPEEPMEVQGAERASPEPQRENASPAPGTTAEEAMSRGPPPAPEGGSRD 998



>gb:BC081280_2562170 Xenopus laevis hypothetical protein LOC446952,
            mRNA (cDNA clone IMAGE:7011109), partial cds.
          Length = 1804

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 19/68 (27%), Positives = 29/68 (42%), Gaps = 3/68 (4%)
 Frame = -2

Query: 547  EQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEH---CSPGNNEPNSGGSHDPMAP 377
            E PPP +  P+       +  QK K+  P   R   +     S  ++ P+     +  AP
Sbjct: 1543 ETPPPKTAPPKVVSAKPKAKPQKTKAEPPPKKRKQWKEEFSSSQSDSSPDMQSDEEEFAP 1602

Query: 376  PSPPIIQR 353
            P PPI+ R
Sbjct: 1603 PPPPIVTR 1610



>gb:AF165985_2057551 Mus musculus iroquois-class homeobox protein
           Irx5 (Irx5) mRNA, partial cds.
          Length = 441

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 25/72 (34%), Positives = 30/72 (41%), Gaps = 6/72 (8%)
 Frame = -2

Query: 562 RHDNGEQPPPVSPL-PREDGVFRSSPDQKPK--STTPSPSRFAMEHCSPGNNEPNSGGS- 395
           RHD   +PP      P      R + D  P   ++ P+P      H S G   P SGGS 
Sbjct: 259 RHDELPRPPRAGESSPAGPATARLAEDAGPHYPASVPAPG----PHPSAGELPPGSGGSS 314

Query: 394 --HDPMAPPSPP 365
             H P  PP PP
Sbjct: 315 VIHSPPPPPPPP 326



>gb:HUMORFA05_2035301 Homo sapiens KIAA0054 mRNA, partial cds.
          Length = 1943

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 19/66 (28%), Positives = 30/66 (45%)
 Frame = -2

Query: 547  EQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSP 368
            EQP  + P P +    +S  +Q+P+   P P         P N   NS  +H P +PP+ 
Sbjct: 1390 EQPNQIPPQPNQVVQQQSQLNQQPQQ--PPPQLSPAYQAGPNNAFFNSAVAHRPQSPPAE 1447

Query: 367  PIIQRE 350
             +I  +
Sbjct: 1448 AVIPEQ 1453



>gb:BC070062_1988407 Homo sapiens Ras and Rab interactor 3, mRNA
           (cDNA clone MGC:87258 IMAGE:30332851), complete cds.
          Length = 908

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 19/69 (27%), Positives = 27/69 (39%), Gaps = 4/69 (5%)
 Frame = -2

Query: 547 EQPP----PVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMA 380
           +QPP    P  PLP        +    P+   P P    ++ CSP    P     + P A
Sbjct: 250 DQPPLGNCPARPLPPTSDATSPTSRWAPRCPPPPPPVLPLQPCSPAQPPPLPAKKNLPTA 309

Query: 379 PPSPPIIQR 353
           PP   + +R
Sbjct: 310 PPRRRVSER 318



>gb:AP005631_1855111 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBb0049K19.
          Length = 334

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 20/60 (33%), Positives = 28/60 (46%)
 Frame = -2

Query: 544 QPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSPP 365
           QPPP    PRE G  +++      ST     R A  HC+      N   +++P+ PP PP
Sbjct: 60  QPPPP---PRERGRHQATAAPATSSTAAPGLRRARHHCA----RHNLAATNNPLPPPPPP 112



>gb:AF020261_1761619 Santalum album proline rich protein mRNA,
           complete cds.
          Length = 326

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 21/59 (35%), Positives = 24/59 (40%)
 Frame = -2

Query: 541 PPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSPP 365
           PP     PR  G    SP   P S +PSP   +    SP  + P   G  D    PSPP
Sbjct: 165 PPTDGETPRPPGPRSPSPSPGPPSCSPSPKSPSPPASSPPRSRP---GPPDYTTSPSPP 220



>gb:VURNAEXT3_1727444 V.unguiculata mRNA for extensine-like protein,
           ext3.
          Length = 242

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 22/70 (31%), Positives = 29/70 (41%), Gaps = 1/70 (1%)
 Frame = -2

Query: 571 YRKRHDNGEQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSH 392
           Y+  H   + PPP SP P     ++S P   P S +P P  +      P  + P      
Sbjct: 66  YKDPHYEYKSPPPPSPSPPPPYYYKSPP---PPSPSPPPPYYYKSPPPPSPSPPPPYYYK 122

Query: 391 DPMAP-PSPP 365
            P  P PSPP
Sbjct: 123 SPPPPRPSPP 132



>gb:VCA242540_1726990 Volvox carteri mRNA for hydroxyproline-rich
           glycoprotein (HRGP gene).
          Length = 409

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 21/59 (35%), Positives = 23/59 (38%)
 Frame = -2

Query: 541 PPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSPP 365
           PPP  P P       S P   P S  PSP         P +  P+   S  P  PPSPP
Sbjct: 140 PPPPPPPPPSPSPPPSPPPSPPPSPPPSPPP-----SPPPSPPPSPPPSPPPRPPPSPP 193



 Score = 32.3 bits (72), Expect = 9.7
 Identities = 19/59 (32%), Positives = 21/59 (35%)
 Frame = -2

Query: 541 PPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSPP 365
           PPP SPLP      + SP   P    P P+        P  N P       P   P PP
Sbjct: 286 PPPPSPLPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPPPP 344



 Score = 32.3 bits (72), Expect = 9.7
 Identities = 20/58 (34%), Positives = 22/58 (37%)
 Frame = -2

Query: 538 PPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSPP 365
           PP SP P       S P   P    PSP+  +    SP    P       P  PPSPP
Sbjct: 192 PPPSPPP-------SPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSPP 242



>gb:CAR6770_1645444 Cicer arietinum mRNA for extensin, partial.
          Length = 192

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 21/60 (35%), Positives = 26/60 (43%), Gaps = 1/60 (1%)
 Frame = -2

Query: 541 PPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAP-PSPP 365
           PPP SP P     ++S P   P S +P P  +      P  + P     H P  P PSPP
Sbjct: 9   PPPPSPSPPPPYYYKSPP---PPSPSPPPPYYYKSPPPPSPSPPPPYYYHSPPPPSPSPP 65



>gb:AB008227_1510367 Adiantum capillus-veneris AcExt1 mRNA for
           Extensin, complete cds.
          Length = 207

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 19/61 (31%), Positives = 26/61 (42%)
 Frame = -2

Query: 547 EQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSP 368
           + PPP SP P    +++S P   P   TPSP  +      P +  P     +    PPS 
Sbjct: 135 KSPPPPSPSPPPPYIYKSPP---PPPCTPSPPPYFYSSPPPPSPSPPPPYQYKSPPPPSH 191

Query: 367 P 365
           P
Sbjct: 192 P 192



>gb:AJ630366_1422764 Canis familiaris MHC class II region on
           chromosome CFA12, partial sequence, BAC clone 21p19,
           containing partial col11a2 gene, RXRB, SLC39A7, HSD17B8,
           RING1, VPS52, RPS18 and B3GALT4 genes, C12H6orf11 ORF,
           KE2, RAB2L, TAPBP, ZNF297 and DAXX genes.
          Length = 533

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 28/72 (38%), Positives = 36/72 (50%), Gaps = 10/72 (13%)
 Frame = -2

Query: 550 GEQPPPVSPLPRE---DGVFRSSPDQK-PKSTTPSP-SRFAMEHCSPG-----NNEPNSG 401
           GEQ  P  P P E   DG+  S  D + P S++P+P S+ A     PG     ++ P  G
Sbjct: 56  GEQQTP-EPEPGEAGRDGMGDSGRDSRSPDSSSPNPLSQGAPPPSPPGLPLPPSSAPTLG 114

Query: 400 GSHDPMAPPSPP 365
           GS  P  PP PP
Sbjct: 115 GSGAPPPPPMPP 126



>gb:AF016886_1232857 Strongylocentrotus purpuratus paired box
           protein (suPaxB) mRNA, complete cds.
          Length = 601

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 31/114 (27%), Positives = 47/114 (41%), Gaps = 9/114 (7%)
 Frame = -2

Query: 688 SCCGKSSVADCALWLFCCWCSLAQEVRTG--NSYDIVEDKFYRKRHDNGEQPPPVSPLPR 515
           S CGK +V   +        S+ + +R    N Y + E    RK+    E   P   LP 
Sbjct: 159 SICGKETVPSVS--------SINRILRNKIVNGYVMEEATLTRKKQQIAELDLPDEALPT 210

Query: 514 EDGVFRSSPDQ-----KPKSTTPSPSRFAMEHCSPGNNEPNSGG--SHDPMAPP 374
           +  + R +P Q       + TT +P++FA  + S     P +GG   H P   P
Sbjct: 211 QVTIQRPTPQQLMAHNSQQPTTITPAQFAQYYSSLQQQSPQAGGYPIHVPTTSP 264



>gb:AE016959_1022024 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC092749_1735613
           Genomic sequence for Oryza sativa (japonica
           cultivar-group) cultivar Nipponbare clone OSJNBb0023M11,
           from chromosome 10, complete
           sequence.>gb:AE017081_1751843 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 35 of 77 of the
           complete sequence.
          Length = 301

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 27/103 (26%), Positives = 36/103 (34%), Gaps = 11/103 (10%)
 Frame = -2

Query: 637 CWCSLAQEVRTGNSYD--IVEDKFYRKRHDNGEQPPPVSPLPREDGVFRSSPDQKPKSTT 464
           C C+  Q V+ G      +  D       +NG  PPP +  P  D +    P   P S T
Sbjct: 137 CKCARVQLVKNGKKIAAFVPNDGCLNFIKENGPVPPPGTAAPANDALPPKGPAPSPGSAT 196

Query: 463 PSPSRFAMEHCSPGNNEP---------NSGGSHDPMAPPSPPI 362
             P        SPG   P         ++    DP  PP  P+
Sbjct: 197 SLP--------SPGTAVPPLRTAALAADASLPGDPATPPGSPV 231



>gb:AE017319_441312 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 11 of 12 of the complete
           genome.>gb:AE017285_1074473 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 440

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 3/67 (4%)
 Frame = -2

Query: 556 DNGEQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFA--MEHCSPGNNEPN-SGGSHDP 386
           D+ +     SP P +D V        P   + +PS  A  +E  +P ++  + SGG H P
Sbjct: 8   DDAQTDAHESPSP-DDTVIDGGTSPLPSEASEAPSGDAAPVEAATPPDDPASASGGDHPP 66

Query: 385 MAPPSPP 365
             PPSPP
Sbjct: 67  STPPSPP 73



>pir|S49915|S49915 extensin-like protein - maize>gb:ZMEXTENS_1731842
           Z.mays (B73) gene for extensin-like protein.
          Length = 1188

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 17/61 (27%), Positives = 25/61 (40%)
 Frame = -2

Query: 547 EQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSP 368
           + PPP +P+       +S P   P  +TP P  +     S  ++ P       P   PSP
Sbjct: 637 KSPPPPTPVSSPPPPEKSPPPPPPAKSTPPPEEYPTPPTSVKSSPPPEKSLPPPTLIPSP 696

Query: 367 P 365
           P
Sbjct: 697 P 697



>pir|T09024|T09024 proline-rich protein T27E11.90 - Arabidopsis
           thaliana>gb:ATCHRIV67_1546665 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           67.>gb:ATT27E11_1555521 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T27E11, partial sequence (ESSA
           project).
          Length = 577

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 22/59 (37%), Positives = 25/59 (42%), Gaps = 1/59 (1%)
 Frame = -2

Query: 541 PPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEP-NSGGSHDPMAPPSP 368
           P P SPLP       SSP   P S  PSP        +PG + P  S G   P+  P P
Sbjct: 221 PGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGP 279



>pir|S54156|S54156 extensin-like protein - cowpea (fragment)
          Length = 242

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 22/70 (31%), Positives = 29/70 (41%), Gaps = 1/70 (1%)
 Frame = -2

Query: 571 YRKRHDNGEQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSH 392
           Y+  H   + PPP SP P     ++S P   P S +P P  +      P  + P      
Sbjct: 66  YKDPHYEYKSPPPPSPSPPPPYYYKSPP---PPSPSPPPPYYYKSPPPPSPSPPPPYYYK 122

Query: 391 DPMAP-PSPP 365
            P  P PSPP
Sbjct: 123 SPPPPRPSPP 132



>pir|H83619|H83619 hypothetical protein PA0197 [imported] -
           Pseudomonas aeruginosa (strain PAO1)>gb:AE004458_54432
           Pseudomonas aeruginosa PAO1, section 19 of 529 of the
           complete genome.>gb:AF190125_486811 Pseudomonas
           aeruginosa TonB2 (tonB2), ExbB (exbB), and ExbD (exbD)
           genes, complete cds.>gb:AE004091_968532 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 270

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 1/64 (1%)
 Frame = -2

Query: 556 DNGEQPPPVSPLPREDGVFRSSPDQKPK-STTPSPSRFAMEHCSPGNNEPNSGGSHDPMA 380
           +N  +PPP  P+P+        P  KPK    P P+  A+E   P   +P +     P A
Sbjct: 121 ENAVKPPPPKPVPK--------PKPKPKPQPRPKPAPKAVEPAPPAPPQPAA-----PPA 167

Query: 379 PPSP 368
           PP+P
Sbjct: 168 PPAP 171



>sp|Q9JKQ4|IRX5_MOUSE Iroquois-class homeodomain protein IRX-5
           (Iroquois homeobox protein 5) (Homeodomain protein
           IRXB2).>gb:AK004747_1152560 Mus musculus adult male lung
           cDNA, RIKEN full-length enriched library,
           clone:1200013N09 product:iroquois related homeobox 5
           (Drosophila), full insert sequence.>gb:AF230074_2059998
           Mus musculus iroquois homeobox protein 5 IRX-5 (Irx5)
           mRNA, complete cds.>gb:BC051959_2100861 Mus musculus
           Iroquois related homeobox 5 (Drosophila), mRNA (cDNA
           clone MGC:62229 IMAGE:6404946), complete
           cds.>gb:BC056994_2102519 Mus musculus Iroquois related
           homeobox 5 (Drosophila), mRNA (cDNA clone MGC:66960
           IMAGE:5716910), complete cds.
          Length = 484

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 25/72 (34%), Positives = 30/72 (41%), Gaps = 6/72 (8%)
 Frame = -2

Query: 562 RHDNGEQPPPVSPL-PREDGVFRSSPDQKPK--STTPSPSRFAMEHCSPGNNEPNSGGS- 395
           RHD   +PP      P      R + D  P   ++ P+P      H S G   P SGGS 
Sbjct: 259 RHDELPRPPRAGESSPAGPATARLAEDAGPHYPASVPAPG----PHPSAGELPPGSGGSS 314

Query: 394 --HDPMAPPSPP 365
             H P  PP PP
Sbjct: 315 VIHSPPPPPPPP 326



>sp|P42694|HELZ_HUMAN Potential helicase with zinc-finger domain.
          Length = 1942

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 19/66 (28%), Positives = 30/66 (45%)
 Frame = -2

Query: 547  EQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSP 368
            EQP  + P P +    +S  +Q+P+   P P         P N   NS  +H P +PP+ 
Sbjct: 1389 EQPNQIPPQPNQVVQQQSQLNQQPQQ--PPPQLSPAYQAGPNNAFFNSAVAHRPQSPPAE 1446

Query: 367  PIIQRE 350
             +I  +
Sbjct: 1447 AVIPEQ 1452



>gb:HUMORFKG1L_2035335 Homo sapiens KIAA0059 mRNA, partial cds.
          Length = 724

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 29/85 (34%), Positives = 37/85 (43%), Gaps = 16/85 (18%)
 Frame = -2

Query: 568 RKRHDNGEQPPPVSPLPREDG--------VFRS-------SPDQKPKSTTPSPSRFAMEH 434
           ++R   GE P  +SP P  +G        + RS       SP     S TP+ SR     
Sbjct: 364 QERQSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHF 423

Query: 433 CSPGNNEPNSG-GSHDPMAPPSPPI 362
             PG NEP+SG  S  P  P S P+
Sbjct: 424 HRPG-NEPSSGRNSPLPYRPDSRPL 447



>gb:AL133384_1918452 Human DNA sequence from clone RP11-317F20 on
           chromosome 10 Contains the 3' end of the ABLIM1 gene for
           actin binding LIM protein 1, a pseudogene similar to
           part of small nuclear ribonucleoprotein polypeptide B
           (SNRPB2), the 5' end of a novel gene (FLJ14564)
           (FLJ14564) and a CpG island, complete
           sequence.>gb:AL354873_1923489 Human DNA sequence from
           clone RP11-108K1 on chromosome 10 Contains a
           peptidylprolyl isomerase A (cyclophilin A) (PPIA)
           pseudogene, the 5' end of the ABLIM1 gene for actin
           binding LIM protein 1 and a CpG island, complete
           sequence.
          Length = 718

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 29/85 (34%), Positives = 37/85 (43%), Gaps = 16/85 (18%)
 Frame = -2

Query: 568 RKRHDNGEQPPPVSPLPREDG--------VFRS-------SPDQKPKSTTPSPSRFAMEH 434
           ++R   GE P  +SP P  +G        + RS       SP     S TP+ SR     
Sbjct: 358 QERQSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHF 417

Query: 433 CSPGNNEPNSG-GSHDPMAPPSPPI 362
             PG NEP+SG  S  P  P S P+
Sbjct: 418 HRPG-NEPSSGRNSPLPYRPDSRPL 441



>gb:AL133384_1918451 Human DNA sequence from clone RP11-317F20 on
           chromosome 10 Contains the 3' end of the ABLIM1 gene for
           actin binding LIM protein 1, a pseudogene similar to
           part of small nuclear ribonucleoprotein polypeptide B
           (SNRPB2), the 5' end of a novel gene (FLJ14564)
           (FLJ14564) and a CpG island, complete
           sequence.>gb:AL354873_1923490 Human DNA sequence from
           clone RP11-108K1 on chromosome 10 Contains a
           peptidylprolyl isomerase A (cyclophilin A) (PPIA)
           pseudogene, the 5' end of the ABLIM1 gene for actin
           binding LIM protein 1 and a CpG island, complete
           sequence.
          Length = 778

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 29/85 (34%), Positives = 37/85 (43%), Gaps = 16/85 (18%)
 Frame = -2

Query: 568 RKRHDNGEQPPPVSPLPREDG--------VFRS-------SPDQKPKSTTPSPSRFAMEH 434
           ++R   GE P  +SP P  +G        + RS       SP     S TP+ SR     
Sbjct: 418 QERQSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHF 477

Query: 433 CSPGNNEPNSG-GSHDPMAPPSPPI 362
             PG NEP+SG  S  P  P S P+
Sbjct: 478 HRPG-NEPSSGRNSPLPYRPDSRPL 501



>gb:AL133384_1918450 Human DNA sequence from clone RP11-317F20 on
           chromosome 10 Contains the 3' end of the ABLIM1 gene for
           actin binding LIM protein 1, a pseudogene similar to
           part of small nuclear ribonucleoprotein polypeptide B
           (SNRPB2), the 5' end of a novel gene (FLJ14564)
           (FLJ14564) and a CpG island, complete
           sequence.>gb:AL354873_1923492 Human DNA sequence from
           clone RP11-108K1 on chromosome 10 Contains a
           peptidylprolyl isomerase A (cyclophilin A) (PPIA)
           pseudogene, the 5' end of the ABLIM1 gene for actin
           binding LIM protein 1 and a CpG island, complete
           sequence.
          Length = 702

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 29/85 (34%), Positives = 37/85 (43%), Gaps = 16/85 (18%)
 Frame = -2

Query: 568 RKRHDNGEQPPPVSPLPREDG--------VFRS-------SPDQKPKSTTPSPSRFAMEH 434
           ++R   GE P  +SP P  +G        + RS       SP     S TP+ SR     
Sbjct: 342 QERQSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHF 401

Query: 433 CSPGNNEPNSG-GSHDPMAPPSPPI 362
             PG NEP+SG  S  P  P S P+
Sbjct: 402 HRPG-NEPSSGRNSPLPYRPDSRPL 425



>gb:AP004275_1839616 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC clone:P0453E05.
          Length = 1627

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 22/65 (33%), Positives = 27/65 (41%), Gaps = 6/65 (9%)
 Frame = -2

Query: 541  PPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNN------EPNSGGSHDPMA 380
            PPP  P P   GV  ++P   P    P P R  +   SP         +P+SG    P  
Sbjct: 899  PPPPPPPPPRSGVGGNTPPAPP----PPPLRSTVPAISPPPPPPPPPLKPSSGAPCPPPP 954

Query: 379  PPSPP 365
            PP PP
Sbjct: 955  PPPPP 959



>gb:AE016814_1745898 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome I, complete sequence.
          Length = 768

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 22/73 (30%), Positives = 29/73 (39%), Gaps = 13/73 (17%)
 Frame = -2

Query: 544 QPPPVSPLPREDGVFRSSPDQKPKSTTPS-----------PSRFAMEHCSPGNNEPNSGG 398
           +P P  P+   +    S PD +P +  PS           P     E   PGN+EP+ G 
Sbjct: 242 EPQPDHPISPPESEQPSDPDTQPPNDPPSFDPQPDQPVERPDLDRPEPEKPGNDEPSEGA 301

Query: 397 SHDPMAP--PSPP 365
              P  P  P PP
Sbjct: 302 PEFPTNPEEPQPP 314



>gb:SOYHRGPB_1716023 Soybean hydroxyproline-rich glycoprotein
           (sbHRGP2) mRNA, 3' end.
          Length = 169

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 21/60 (35%), Positives = 26/60 (43%), Gaps = 1/60 (1%)
 Frame = -2

Query: 541 PPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAP-PSPP 365
           PPP SP P     ++S P   P S +P P  +      P  + P     H P  P PSPP
Sbjct: 9   PPPPSPSPPPPYYYKSPP---PPSPSPPPPYYYHSPPPPSPSPPPPYYYHSPPPPSPSPP 65



>gb:CR382131_1664251 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 517

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 21/65 (32%), Positives = 28/65 (43%), Gaps = 6/65 (9%)
 Frame = -2

Query: 538 PPVSPL---PREDGVFRSSPDQKPKSTTPSPSRFAMEH---CSPGNNEPNSGGSHDPMAP 377
           PP SPL   P+      S+P Q+P+    SP R  +      +PG N         P  P
Sbjct: 385 PPSSPLGQEPQGPSASPSTPKQQPQPLPMSPGREVLSPGNPLTPGTNTGTDATPLSPRTP 444

Query: 376 PSPPI 362
            SPP+
Sbjct: 445 LSPPV 449



>gb:CFHEPABC_1646282 Cylindrotheca fusiformis hepA, hepB, hepC
           genes.
          Length = 886

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 26/98 (26%), Positives = 39/98 (39%), Gaps = 2/98 (2%)
 Frame = -2

Query: 652 LWLFCCWCSLAQEVRTGNSYDIVEDKFYRKRHD--NGEQPPPVSPLPREDGVFRSSPDQK 479
           L L C  C+  + V      +  ++ +Y + +   N   PPP  P  R      + P   
Sbjct: 12  LQLLCLGCAAGEAVEN-RELNQEDEVWYSRMYQEVNSLTPPPTPPPTRPP----TRPPTP 66

Query: 478 PKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSPP 365
           P +  P+PS       SP N  P    +  P  PP+PP
Sbjct: 67  PPTRPPTPSPTPPPTPSP-NTPPTPPPTPPPTRPPTPP 103



>gb:AY536857_1612411 Arabidopsis thaliana putative protein kinase
           (At4g32710) mRNA, partial cds.
          Length = 236

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 21/64 (32%), Positives = 26/64 (40%)
 Frame = -2

Query: 553 NGEQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPP 374
           N   PPP SP  R  G         PK + P P      + SP N  PN+    +   PP
Sbjct: 145 NTASPPPPSPPRRRSG---------PKPSFPPPI-----NSSPPNPSPNTPSLPETSPPP 190

Query: 373 SPPI 362
            PP+
Sbjct: 191 KPPL 194



>gb:AY450930_1606694 Chlamydomonas reinhardtii plus agglutinin (SAG1)
            gene, complete cds; and unknown gene.
          Length = 3409

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 21/62 (33%), Positives = 28/62 (45%), Gaps = 2/62 (3%)
 Frame = -2

Query: 547  EQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDP--MAPP 374
            + P P  P P    +  S P  +P   TP PS  A    +P + +P    S +P   APP
Sbjct: 1137 DPPSPAPPSPMPPPLPTSPPSPEPVPPTPPPSPPAPPSPAPPSPQPLEPPSPEPPSPAPP 1196

Query: 373  SP 368
            SP
Sbjct: 1197 SP 1198



>gb:AC007945_1536371 Genomic sequence for Arabidopsis thaliana BAC
           F28C11 from chromosome I, complete sequence.
          Length = 752

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 22/69 (31%), Positives = 30/69 (43%), Gaps = 4/69 (5%)
 Frame = -2

Query: 556 DNGEQPPPV----SPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHD 389
           D+   PPP     SP P ED     +P  +     P PS+  ++   P +  PN G    
Sbjct: 89  DSTPSPPPPTSNESPSPPEDSETPPAPPNESNDNNPPPSQ-DLQSPPPSSPSPNVG---- 143

Query: 388 PMAPPSPPI 362
           P  P SPP+
Sbjct: 144 PTNPESPPL 152



>pir|T04455|T04455 hypothetical protein F4D11.90 - Arabidopsis
           thaliana>gb:AX088888_1461051 Sequence 13 from Patent
           WO0114563.>gb:AX825718_1475978 Sequence 16 from Patent
           WO03072763.>gb:ATCHRIV77_1547191 Arabidopsis thaliana
           DNA chromosome 4, contig fragment No.
           77.>gb:ATF4D11_1550641 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F4D11 (ESSAII project).
          Length = 731

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 21/64 (32%), Positives = 26/64 (40%)
 Frame = -2

Query: 553 NGEQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPP 374
           N   PPP SP  R  G         PK + P P      + SP N  PN+    +   PP
Sbjct: 152 NTASPPPPSPPRRRSG---------PKPSFPPPI-----NSSPPNPSPNTPSLPETSPPP 197

Query: 373 SPPI 362
            PP+
Sbjct: 198 KPPL 201



>pir|B86369|B86369 hypothetical protein F5O8.10 - Arabidopsis
           thaliana>gb:AE005172_891306 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AX088879_1461048 Sequence 4 from Patent
           WO0114563.>gb:AX825709_1475975 Sequence 7 from Patent
           WO03072763.>gb:F5O8_1678420 Arabidopsis thaliana
           chromosome 1 BAC F5O8 sequence, complete sequence.
          Length = 731

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 22/69 (31%), Positives = 30/69 (43%), Gaps = 4/69 (5%)
 Frame = -2

Query: 556 DNGEQPPPV----SPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHD 389
           D+   PPP     SP P ED     +P  +     P PS+  ++   P +  PN G    
Sbjct: 89  DSTPSPPPPTSNESPSPPEDSETPPAPPNESNDNNPPPSQ-DLQSPPPSSPSPNVG---- 143

Query: 388 PMAPPSPPI 362
           P  P SPP+
Sbjct: 144 PTNPESPPL 152



>pir|S54986|S54986 regulatory protein - Emericella
           nidulans>gb:EMEFIGA_1676613 Aspergillus nidulans
           regulatory protein (figA) gene, complete cds.
          Length = 980

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 19/58 (32%), Positives = 22/58 (37%)
 Frame = -2

Query: 541 PPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSP 368
           PPP  P P   G+  ++P   P    P P   A     P    P  GG   P   PSP
Sbjct: 455 PPPPPPPPAHPGLSGAAPPPPPPPPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPLPSP 512



>pir|S71560|S71560 early light-induced protein homolog SDi-1,
           drought-induced - common sunflower
          Length = 175

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 5/67 (7%)
 Frame = -2

Query: 505 VFRSSPDQKPKSTTPSPSR----FAME-HCSPGNNEPNSGGSHDPMAPPSPPIIQREDV* 341
           VF ++P  +  +TTPS SR    FA+   C   + +P++  S  P APP PP   +    
Sbjct: 7   VFMATPVAR-LTTTPSSSRRNINFAVVVRCMSQDQQPSTDASKTPSAPPPPPPAPKVSTK 65

Query: 340 HNEILRF 320
            +++L F
Sbjct: 66  FSDVLAF 72



>pir|T07623|T07623 extensin homolog HRGP2 - soybean (fragment)
          Length = 169

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 21/60 (35%), Positives = 26/60 (43%), Gaps = 1/60 (1%)
 Frame = -2

Query: 541 PPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAP-PSPP 365
           PPP SP P     ++S P   P S +P P  +      P  + P     H P  P PSPP
Sbjct: 9   PPPPSPSPPPPYYYKSPP---PPSPSPPPPYYYHSPPPPSPSPPPPYYYHSPPPPSPSPP 65



>pir|B38274|B38274 Y box-binding protein 2 - African clawed
           frog>gb:XELFRGY2_2581858 X.laevis sequence -specific
           binding protein (FRGY2) mRNA, complete cds.
          Length = 336

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 30/103 (29%), Positives = 42/103 (40%), Gaps = 13/103 (12%)
 Frame = -2

Query: 577 KFYRKRHDNGEQP--PPVSPLPREDGVF--RSSPDQKPKSTTPSPS--RFAMEHCSPGNN 416
           +FYR R D   +     VSP    +G     +SP Q+P+   P P   R         NN
Sbjct: 131 RFYRPRADTAGESGGEGVSPEQMSEGERGEETSPQQRPQRRRPPPFFYRRRFRRGPRPNN 190

Query: 415 EPNSGG-------SHDPMAPPSPPIIQREDV*HNEILRFRLKF 308
           + N G        + DP+AP S  +   +D       RFR +F
Sbjct: 191 QQNQGAEVTEQSENKDPVAPTSEALASGDDPQRPPPRRFRQRF 233



>sp|P21574|YB56_XENLA Cytoplasmic RNA-binding protein P56 (Y box
           binding protein-2) (Y-box transcription factor) (MRNP4).
          Length = 336

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 30/103 (29%), Positives = 42/103 (40%), Gaps = 13/103 (12%)
 Frame = -2

Query: 577 KFYRKRHDNGEQP--PPVSPLPREDGVF--RSSPDQKPKSTTPSPS--RFAMEHCSPGNN 416
           +FYR R D   +     VSP    +G     +SP Q+P+   P P   R         NN
Sbjct: 131 RFYRPRADTAGESGGEGVSPEQMSEGERGEETSPQQRPQRRRPPPFFYRRRFRRGPRPNN 190

Query: 415 EPNSGG-------SHDPMAPPSPPIIQREDV*HNEILRFRLKF 308
           + N G        + DP+AP S  +   +D       RFR +F
Sbjct: 191 QQNQGAEVTEQSENKDPVAPTSEALASGDDPQRPPPRRFRQRF 233



>sp|Q9FPQ6|GP1_CHLRE Vegetative cell wall protein gp1 precursor
           (Hydroxyproline-rich glycoprotein
           1).>gb:AF309494_1784995 Chlamydomonas reinhardtii
           vegetative cell wall protein gp1 (GP1) gene, complete
           cds.
          Length = 555

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 22/60 (36%), Positives = 24/60 (40%), Gaps = 2/60 (3%)
 Frame = -2

Query: 538 PPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGG--SHDPMAPPSPP 365
           PPV P P        +P   P    PSPS  A     P +  P S    S  P APP PP
Sbjct: 209 PPVPPSPAPPSPPSPAPPSPPSPAPPSPSPPAPPSPVPPSPAPPSPAPPSPKPPAPPPPP 268



>sp|P55196|AF6_HUMAN AF-6 protein.>gb:AB011399_1864355 Homo sapiens
            gene for AF-6, complete cds.
          Length = 1816

 Score = 33.1 bits (74), Expect = 5.7
 Identities = 20/72 (27%), Positives = 30/72 (41%), Gaps = 8/72 (11%)
 Frame = -2

Query: 583  EDKFYRKRHDNGE--------QPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCS 428
            +DK+   R  +G+        +PPP  P P  DGVF S+  Q P +   S +    +   
Sbjct: 1730 QDKYSSTRKSHGDLLPAPLKPRPPPCQPRPASDGVFLSNSFQPPSAKANSTAHKKGQPLP 1789

Query: 427  PGNNEPNSGGSH 392
            P     +   SH
Sbjct: 1790 PPKKSSSYHPSH 1801



>gb:CHE441113_2396849 Crane hepatitis B virus preS/S gene for
           preS/surface protein and pol gene for polymerase,
           isolate CCHBV 3.
          Length = 327

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 4/35 (11%)
 Frame = -2

Query: 547 EQPPPVSPLPREDG----VFRSSPDQKPKSTTPSP 455
           + PPPV+  P ED      FRS  +++PK TT SP
Sbjct: 84  QNPPPVTWTPEEDQKAREFFRSYQEERPKETTTSP 118



>gb:AY261359_2319383 Bovine herpesvirus 5 strain SV507/99, complete
            genome.
          Length = 3204

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 26/72 (36%), Positives = 30/72 (41%), Gaps = 6/72 (8%)
 Frame = -2

Query: 541  PPPVSPLPREDGVFRSSP-DQKPKSTTPSPSRFA-----MEHCSPGNNEPNSGGSHDPMA 380
            PP VSP PR+    R SP D  P    P+P+  A          P    P S    D  A
Sbjct: 2813 PPAVSPPPRQP---RPSPADAGPPGAAPAPAPPAPPAPPAPPAPPAPPAPPSQPRADGPA 2869

Query: 379  PPSPPIIQREDV 344
            PP PPI    +V
Sbjct: 2870 PPGPPIAASRNV 2881



>gb:AY150312_2301429 PRRSV HB-1(sh)/2002, complete genome.
          Length = 2503

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 26/77 (33%), Positives = 34/77 (44%), Gaps = 16/77 (20%)
 Frame = -2

Query: 541  PPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHC-SP---GNNEPNS------GG-- 398
            PPP    PR+    +S P+ KP    P+P R     C SP   G+N PN       GG  
Sbjct: 814  PPPPRVQPRKTKSVKSLPEDKP---VPAPRRKVRSGCGSPVLMGDNVPNGSEDLTVGGPL 870

Query: 397  ----SHDPMAPPSPPII 359
                  +PM P S P++
Sbjct: 871  NFPTPSEPMTPMSEPVL 887



>gb:AY032626_2290133 Porcine reproductive and respiratory syndrome
            virus strain CH-1a, complete genome.
          Length = 2503

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 27/77 (35%), Positives = 34/77 (44%), Gaps = 16/77 (20%)
 Frame = -2

Query: 541  PPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHC-SP---GNNEPNS------GGSH 392
            PPP    PR+    +S P+ KP    P+P R     C SP   G+N PN       GG  
Sbjct: 814  PPPPRVQPRKTKPVKSLPENKP---VPAPRRKVGSDCGSPILMGDNVPNGWEDFAVGGPL 870

Query: 391  D------PMAPPSPPII 359
            D      PM P S P++
Sbjct: 871  DFPTPSEPMTPLSEPVL 887



>gb:AB083478_2047738 Mus musculus Pclo mRNA for Piccolo, complete
           cds.
          Length = 4969

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 5/69 (7%)
 Frame = -2

Query: 547 EQPPPVSPLPREDGVFRSSPDQ----KPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMA 380
           +QP P  P P++    +  P Q    KP+   P+P++   +  +P   +P   G   P A
Sbjct: 437 QQPTPAKPQPQQPTPAKPQPQQPTPAKPQPQQPTPAKPQPQQPTPAKPQPQQPGLGKPSA 496

Query: 379 -PPSPPIIQ 356
             PS  I Q
Sbjct: 497 QQPSKSISQ 505



>gb:AB083477_2047737 Mus musculus Pclo mRNA for Piccolo, complete
           cds.
          Length = 5165

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 5/69 (7%)
 Frame = -2

Query: 547 EQPPPVSPLPREDGVFRSSPDQ----KPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMA 380
           +QP P  P P++    +  P Q    KP+   P+P++   +  +P   +P   G   P A
Sbjct: 437 QQPTPAKPQPQQPTPAKPQPQQPTPAKPQPQQPTPAKPQPQQPTPAKPQPQQPGLGKPSA 496

Query: 379 -PPSPPIIQ 356
             PS  I Q
Sbjct: 497 QQPSKSISQ 505



>gb:AF005654_1875970 Homo sapiens actin-binding double-zinc-finger
           protein (abLIM) mRNA, complete cds.
          Length = 778

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 29/85 (34%), Positives = 37/85 (43%), Gaps = 16/85 (18%)
 Frame = -2

Query: 568 RKRHDNGEQPPPVSPLPREDG--------VFRS-------SPDQKPKSTTPSPSRFAMEH 434
           ++R   GE P  +SP P  +G        + RS       SP     S TP+ SR     
Sbjct: 418 QERQSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHF 477

Query: 433 CSPGNNEPNSG-GSHDPMAPPSPPI 362
             PG NEP+SG  S  P  P S P+
Sbjct: 478 HRPG-NEPSSGRNSPLPYRPDSLPL 501



>gb:AP006161_1861110 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:B1267B06.
          Length = 162

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 17/47 (36%), Positives = 25/47 (53%)
 Frame = -2

Query: 748 LYGGFWRIQMRKRYNLPSYNSCCGKSSVADCALWLFCCWCSLAQEVR 608
           +Y  F+R +MR +Y L        +   ADC +  FC  C+L+QE R
Sbjct: 85  VYSCFYRAKMRSQYGLQ-------EKPCADCPVHFFCEPCALSQEYR 124



>gb:AP004762_1844615 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0686H11.
          Length = 249

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 25/65 (38%), Positives = 32/65 (49%)
 Frame = -2

Query: 562 RHDNGEQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPM 383
           R D   QPPP S L  +D   + +P +   STTP+PSR A+   SP +  P  G      
Sbjct: 101 RVDRRLQPPPPS-LAIDDA--KGNPRRSTSSTTPTPSRQAL--ASPSSTPPLGG------ 149

Query: 382 APPSP 368
            PP P
Sbjct: 150 -PPPP 153



>gb:AP000735_1820573 Arabidopsis thaliana genomic DNA, chromosome 3,
           TAC clone:K13E13.
          Length = 956

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 19/60 (31%), Positives = 30/60 (50%)
 Frame = -2

Query: 541 PPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSPPI 362
           PP  SP+P +   + +SP +K +   PSPS    +  SP +   +S     P+  P PP+
Sbjct: 603 PPLESPVPNDP--YDASPIKKRRPQPPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPV 660



>gb:AF327424_1786793 Arabidopsis thaliana unknown protein
           (At2g45010) mRNA, partial cds.
          Length = 238

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 30/107 (28%), Positives = 47/107 (43%), Gaps = 2/107 (1%)
 Frame = -2

Query: 748 LYGGFWRIQMRKRYNLPSYNSCCGKSSVADCALWLFCC--WCSLAQEVRTGNSYDIVEDK 575
           +Y G +R +++K+Y+L   N+ C    V        CC  WC+L QE R   ++  + D 
Sbjct: 149 IYSGLFRQELQKKYHLK--NAPCDHCMV-------HCCLHWCALCQEHREMKNH--LSDT 197

Query: 574 FYRKRHDNGEQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEH 434
                      PPPV  +  E+    SS      S++ SPS    +H
Sbjct: 198 --EASSSTTMDPPPVQEMNTEERRDASS------SSSSSPSSAKSQH 236



>gb:PCC17D7_1699148 P. carinii cosmid 17D7.
          Length = 902

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 21/71 (29%), Positives = 27/71 (38%), Gaps = 7/71 (9%)
 Frame = -2

Query: 556 DNGEQPP-------PVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGG 398
           D G QPP       P  P P  D    S PD +P+  +   S+   +     N    S  
Sbjct: 691 DPGSQPPSKPGPQPPSDPQPPSDLKPPSKPDARPRPPSDPSSQQDPDTSLSSNPTSTSSS 750

Query: 397 SHDPMAPPSPP 365
              P +PP PP
Sbjct: 751 EPPPPSPPPPP 761



>gb:PCC11H121B_1699140 P. carinii cosmids PC11H11 and
           1B2.>gb:PCW01B2_1699539 Pneumocystis carinii telomeric
           cosmid, W01B2.
          Length = 897

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 18/63 (28%), Positives = 25/63 (39%)
 Frame = -2

Query: 553 NGEQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPP 374
           N +  PP+ P           P  KP S  PS      +  +  ++ P S  S +P  PP
Sbjct: 667 NADSQPPLDP----------QPPSKPDSNPPSDPSSQQDPDTSLSSNPTSTSSSEPPPPP 716

Query: 373 SPP 365
            PP
Sbjct: 717 PPP 719



>gb:PCC11A11_1699130 P. carinii cosmid 11A11.
          Length = 902

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 21/71 (29%), Positives = 27/71 (38%), Gaps = 7/71 (9%)
 Frame = -2

Query: 556 DNGEQPP-------PVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGG 398
           D G QPP       P  P P  D    S PD +P+  +   S+   +     N    S  
Sbjct: 691 DPGSQPPSKPGPQPPSDPQPPSDLKPPSKPDARPRPPSDPSSQQDPDTSLSSNPTSTSSS 750

Query: 397 SHDPMAPPSPP 365
              P +PP PP
Sbjct: 751 EPPPPSPPPPP 761



>gb:AY097182_1576324 Lycopersicon cheesmanii LA483 fw2.2 gene,
           complete cds; and ORF44 gene, complete sequence.
          Length = 163

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 17/47 (36%), Positives = 26/47 (55%)
 Frame = -2

Query: 748 LYGGFWRIQMRKRYNLPSYNSCCGKSSVADCALWLFCCWCSLAQEVR 608
           LY  F+R +MR +Y+L        ++   DC + +FC  C+L QE R
Sbjct: 89  LYSCFYRFKMRGQYDLE-------EAPCVDCLVHVFCEPCALCQEYR 128



>gb:AB013390_1512068 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K9I9.>gb:AY337456_1600411 Arabidopsis thaliana
           formin-like protein AtFH6 mRNA, complete cds.
          Length = 899

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 23/75 (30%), Positives = 31/75 (41%), Gaps = 15/75 (20%)
 Frame = -2

Query: 541 PPPVSPLPREDGVFR------------SSPDQKPKSTTPSPSRFAMEH---CSPGNNEPN 407
           PPP    PR+  + R            +SP +K    TPSP   A+E     S G+ E +
Sbjct: 391 PPPPQKRPRDFQMLRKVTNSEATTNSTTSPSRKQAFKTPSPKTKAVEEVNSVSAGSLEKS 450

Query: 406 SGGSHDPMAPPSPPI 362
             G  DP  P   P+
Sbjct: 451 GDGDTDPSKPKLKPL 465



>gb:AF004917_1231183 Drosophila melanogaster cup mRNA, complete cds.
          Length = 1132

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 21/61 (34%), Positives = 27/61 (44%)
 Frame = -2

Query: 547 EQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSP 368
           E PPP  P          +P Q P +T  +    + EH    ++E NS    DP APP P
Sbjct: 68  EYPPPPPP---------PTPVQAPLATKATALNASQEH---DDDEANSEKWEDPCAPPPP 115

Query: 367 P 365
           P
Sbjct: 116 P 116



>pir|E84885|E84885 hypothetical protein At2g45010 [imported] -
           Arabidopsis thaliana>gb:AC007659_1536058 Arabidopsis
           thaliana chromosome II section 241 of 255 of the
           complete sequence. Sequence from clones T13E15,
           T14P1.>gb:AY087375_1572407 Arabidopsis thaliana clone
           34688 mRNA, complete sequence.>gb:AY120733_1579615
           Arabidopsis thaliana unknown protein (At2g45010) mRNA,
           complete cds.>gb:BT000360_1634638 Arabidopsis thaliana
           unknown protein (At2g45010) mRNA, complete
           cds.>gb:BT000899_1635154 Arabidopsis thaliana clone
           C105033 unknown protein (At2g45010) mRNA, complete
           cds.>gb:AK118360_1816343 Arabidopsis thaliana At2g45010
           mRNA for unknown protein, complete cds, clone:
           RAFL19-63-A04.
          Length = 244

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 30/107 (28%), Positives = 47/107 (43%), Gaps = 2/107 (1%)
 Frame = -2

Query: 748 LYGGFWRIQMRKRYNLPSYNSCCGKSSVADCALWLFCC--WCSLAQEVRTGNSYDIVEDK 575
           +Y G +R +++K+Y+L   N+ C    V        CC  WC+L QE R   ++  + D 
Sbjct: 149 IYSGLFRQELQKKYHLK--NAPCDHCMV-------HCCLHWCALCQEHREMKNH--LSDT 197

Query: 574 FYRKRHDNGEQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEH 434
                      PPPV  +  E+    SS      S++ SPS    +H
Sbjct: 198 --EASSSTTMDPPPVQEMNTEERRDASS------SSSSSPSSAKSQH 236



>pir|E96710|E96710 hypothetical protein F24J5.15 [imported] -
           Arabidopsis thaliana>gb:AE005173_894482 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:F24J5_1678005 Arabidopsis thaliana
           chromosome 1 BAC F24J5 sequence, complete sequence.
          Length = 160

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 18/47 (38%), Positives = 24/47 (51%)
 Frame = -2

Query: 748 LYGGFWRIQMRKRYNLPSYNSCCGKSSVADCALWLFCCWCSLAQEVR 608
           LY  F+R ++R +YNL     CC      DC +   C  C+L QE R
Sbjct: 79  LYSCFYRTKLRAQYNLKE-RPCC------DCCVHFCCEPCALCQEYR 118



>sp|Q865B7|PPG1_BOVIN Peroxisome proliferator activated receptor
           gamma coactivator 1 alpha (PPAR gamma coactivator-1
           alpha) (PPARGC-1 alpha) (PGC-1
           alpha).>gb:AB106107_1410515 Bos taurus PPARGC-1 mRNA for
           peroxisome proliferator activated
           receptor,gamma,coactivator 1, complete cds.
          Length = 796

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 7/53 (13%)
 Frame = -2

Query: 538 PPVSPLPR--EDGVFRSSPDQKP--KSTTPSPS---RFAMEHCSPGNNEPNSG 401
           PP +P  +  +D  FR+SP  KP  K+  P PS   R++   C+ G+N    G
Sbjct: 294 PPTTPPHKANQDNPFRASPKLKPSCKTVVPPPSKKARYSESSCTQGSNSTKKG 346



>sp|Q9VMA3|CUP_DROME Cup protein (Oskar ribonucleoprotein complex
           147 kDa subunit).>gb:AE014134_1127870 Drosophila
           melanogaster chromosome 2L, complete
           sequence.>gb:AE003614_1217977 Drosophila melanogaster
           chromosome 2L, section 23 of 83 of the complete
           sequence.>gb:AY069707_1294437 Drosophila melanogaster
           LD47924 full length cDNA.
          Length = 1132

 Score = 32.7 bits (73), Expect = 7.4
 Identities = 21/61 (34%), Positives = 27/61 (44%)
 Frame = -2

Query: 547 EQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSP 368
           E PPP  P          +P Q P +T  +    + EH    ++E NS    DP APP P
Sbjct: 68  EYPPPPPP---------PTPVQAPLATKATALNASQEH---DDDEANSEKWEDPCAPPPP 115

Query: 367 P 365
           P
Sbjct: 116 P 116



>gb:BC074257_2557772 Xenopus laevis MGC84010 protein, mRNA (cDNA
           clone MGC:84010 IMAGE:6946497), complete cds.
          Length = 1158

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 23/66 (34%), Positives = 27/66 (40%)
 Frame = -2

Query: 559 HDNGEQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMA 380
           H   + PPP  PLP       SS +Q P    P P  F +    P    P + G   P  
Sbjct: 585 HAESQSPPPPPPLP-------SSAEQPPPP--PLPISFDVPPPPP---LPETSGIPPPPP 632

Query: 379 PPSPPI 362
           PP PPI
Sbjct: 633 PPPPPI 638



>gb:AY277968_2524180 Takifugu rubripes transcription factor Sox17
           (Sox17) gene, complete cds.
          Length = 399

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 8/49 (16%)
 Frame = -2

Query: 496 SSPDQKPKSTT--------PSPSRFAMEHCSPGNNEPNSGGSHDPMAPP 374
           S+P+Q P+ +T        P+P      HCSPG+ + + GG      PP
Sbjct: 273 SAPEQPPQPSTLPPAYMGCPNPLALYYTHCSPGHTKRHPGGPGQLSPPP 321



>gb:AY149116_2515201 Xenopus laevis transcription factor Sox10 mRNA,
           complete cds.>gb:AY157667_2516012 Xenopus laevis HMG
           transcription factor (Sox10) mRNA, complete cds.
          Length = 446

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 26/90 (28%), Positives = 38/90 (42%), Gaps = 4/90 (4%)
 Frame = -2

Query: 622 AQEVRTGNSYDIVEDKFYRKRHDNGEQPPPVSPLPRE-DGVFRSSPDQKPKSTTPSPSRF 446
           A+ +R  +  D  + K+  +R  NG+      P P E DG   +             S  
Sbjct: 151 AERLRMQHKKDHPDYKYQPRRRKNGK------PSPGEGDGSSEAEGGAASIQAHYKNSHL 204

Query: 445 AMEHCSP---GNNEPNSGGSHDPMAPPSPP 365
              H SP   GN+E ++G SH P  PP+ P
Sbjct: 205 DHRHGSPMSDGNSEHSTGQSHGPPTPPTTP 234



>gb:BC083185_2108578 Mus musculus cDNA sequence BC059845, mRNA (cDNA
           clone MGC:90743 IMAGE:6855048), complete cds.
          Length = 1424

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 24/76 (31%), Positives = 27/76 (35%), Gaps = 17/76 (22%)
 Frame = -2

Query: 541 PPPVSPLPREDGVFRSSPDQ-----KPKSTTPSP------------SRFAMEHCSPGNNE 413
           PPP  P PR      +SPD       P S   SP            + F+ E   PG   
Sbjct: 750 PPPPPPPPRASAEPAASPDPPSALASPGSGLSSPGPKPGDSGYETETPFSPEGAFPGGGA 809

Query: 412 PNSGGSHDPMAPPSPP 365
               G   P APP PP
Sbjct: 810 AKEEGVPRPRAPPEPP 825



>gb:AF528099_1906061 Homo sapiens transforming acidic coiled coil 2,
            long isoform (TACC2) mRNA, complete cds.
          Length = 2948

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 20/58 (34%), Positives = 24/58 (41%), Gaps = 1/58 (1%)
 Frame = -2

Query: 547  EQPPPVSPLPREDG-VFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAP 377
            EQP P  P+P  DG V  SSP +  ++  P     A E        P  G S  P  P
Sbjct: 1777 EQPGPERPIPAGDGKVCVSSPPEPDETHDPKLQHLAPEELHTDRESPRPGPSMLPSVP 1834



>gb:AP004797_1845217 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0547F09.
          Length = 279

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 21/59 (35%), Positives = 26/59 (44%)
 Frame = -2

Query: 541 PPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSPP 365
           PPPV+P+P       S P   P + TPS +       SP    P+   S  PMAP   P
Sbjct: 149 PPPVAPVPMPSPA-SSPPSPAPAAATPSLAP------SPVATTPSPSPSVSPMAPAPAP 200



>gb:VURNEXT26_1727446 V.unguiculata mRNA for extensine-like protein,
           ext26.
          Length = 164

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 21/62 (33%), Positives = 27/62 (43%), Gaps = 1/62 (1%)
 Frame = -2

Query: 547 EQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAP-PS 371
           + PPP SP P    V++S P   P S +P P  +      P  + P       P  P PS
Sbjct: 90  KSPPPPSPSPPPPYVYKSPP---PPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPS 146

Query: 370 PP 365
           PP
Sbjct: 147 PP 148



 Score = 32.3 bits (72), Expect = 9.7
 Identities = 21/62 (33%), Positives = 27/62 (43%), Gaps = 1/62 (1%)
 Frame = -2

Query: 547 EQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAP-PS 371
           + PPP SP P    V++S P   P S +P P  +      P  + P       P  P PS
Sbjct: 10  KSPPPPSPSPPPPYVYKSPP---PPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPS 66

Query: 370 PP 365
           PP
Sbjct: 67  PP 68



>gb:PCC22C8_1699168 P. carinii cosmid 22C8.
          Length = 874

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 20/61 (32%), Positives = 26/61 (42%), Gaps = 1/61 (1%)
 Frame = -2

Query: 544 QPPPVSPL-PREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSP 368
           +PPP  PL PR        P  KP    PS      +  +  ++ P S  S +P  PP P
Sbjct: 737 EPPPQPPLDPR--------PPSKPDPNPPSDPSSQQDPDTSLSSNPTSTSSSEPPPPPPP 788

Query: 367 P 365
           P
Sbjct: 789 P 789



>gb:PCC11H121B_1699137 P. carinii cosmids PC11H11 and
           1B2.>gb:PCW01B2_1699536 Pneumocystis carinii telomeric
           cosmid, W01B2.
          Length = 874

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 20/61 (32%), Positives = 26/61 (42%), Gaps = 1/61 (1%)
 Frame = -2

Query: 544 QPPPVSPL-PREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSP 368
           +PPP  PL PR        P  KP    PS      +  +  ++ P S  S +P  PP P
Sbjct: 737 EPPPQPPLDPR--------PPSKPDPNPPSDPSSQQDPDTSLSSNPTSTSSSEPPPPPPP 788

Query: 367 P 365
           P
Sbjct: 789 P 789



>gb:OSJN00185_1696383 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0080E14, complete
           sequence.>gb:OSJN00228_1697039 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0022F16, complete
           sequence.
          Length = 1494

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 18/60 (30%), Positives = 24/60 (40%)
 Frame = -2

Query: 544 QPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSPP 365
           +P PV P   E     S+ D    +  P PS+    +   GN    S  +H    PP PP
Sbjct: 249 EPAPVVPQEGEASGVGSTEDALLLTFRPGPSQRRSANTGDGNQPEGSNHNHQGSPPPPPP 308



>gb:AY676932_1621978 Oryza sativa (indica cultivar-group)
           transcription factor WRKY35 (WRKY35) mRNA, complete
           cds.>gb:AP005828_1858602 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0702F05.>gb:AP007223_1863283 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0046E09.
          Length = 391

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 20/57 (35%), Positives = 24/57 (42%)
 Frame = -2

Query: 550 GEQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMA 380
           G  PPP   L      F S P   P  +    S F+MEH    + EP  GG H  M+
Sbjct: 278 GPPPPPDDALGGGCNNFSSPPFVSPAGSAAGESYFSMEH----SYEPRGGGGHFVMS 330



>gb:AY091043_1574272 Arabidopsis thaliana unknown protein
           (At3g19020) mRNA, partial cds.
          Length = 712

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 19/60 (31%), Positives = 30/60 (50%)
 Frame = -2

Query: 541 PPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSPPI 362
           PP  SP+P +   + +SP +K +   PSPS    +  SP +   +S     P+  P PP+
Sbjct: 603 PPLESPVPNDP--YDASPIKKCRPQPPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPV 660



>gb:AC073166_1540981 Oryza sativa chromosome 10 BAC OSJNBb0064P21
           genomic sequence, complete sequence.
          Length = 1302

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 27/96 (28%), Positives = 43/96 (44%), Gaps = 6/96 (6%)
 Frame = -2

Query: 637 CWCSLAQEVRTGNSYDIVEDKFYRKRHDNGEQPPPVSPLPREDG----VFRSSPDQKPKS 470
           C+  +++ V T      VED F  +   +   P P +P P + G    V   +P Q   +
Sbjct: 663 CYDMVSRRVFTSRHVTFVEDVFPFR---DAPSPRPSAPPPPDHGDDTIVLLPAPAQHVVT 719

Query: 469 TT-PSPSRFAMEHCSPGNNEPNSGG-SHDPMAPPSP 368
               +P+  A    SP ++ P+S   +HD   PPSP
Sbjct: 720 PVGTAPAHDAASPPSPASSTPSSAAPAHDVAPPPSP 755



>gb:AY035848_1424241 Sus scrofa clone D2A basic proline-rich protein
           mRNA, complete cds.
          Length = 511

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 19/64 (29%), Positives = 23/64 (35%), Gaps = 5/64 (7%)
 Frame = -2

Query: 550 GEQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRF-----AMEHCSPGNNEPNSGGSHDP 386
           G +PPP  P P       + P  +P    P P+       A  H  P    P  G  H P
Sbjct: 118 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPAGGLQQGPAPSHVGPKKKPPPPGAGHPP 177

Query: 385 MAPP 374
             PP
Sbjct: 178 RPPP 181



>gb:AY035847_1424240 Sus scrofa clone TP23 basic proline-rich
           protein mRNA, complete cds.
          Length = 566

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 19/64 (29%), Positives = 23/64 (35%), Gaps = 5/64 (7%)
 Frame = -2

Query: 550 GEQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRF-----AMEHCSPGNNEPNSGGSHDP 386
           G +PPP  P P       + P  +P    P P+       A  H  P    P  G  H P
Sbjct: 118 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPAGGLQQGPAPSHVGPKKKPPPPGAGHPP 177

Query: 385 MAPP 374
             PP
Sbjct: 178 RPPP 181



>gb:PFATRAPC_1394099 Plasmodium falciparum thrombospondin related
           anonymous protein (TRAP) gene, 5' end.
          Length = 565

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 5/78 (6%)
 Frame = -2

Query: 568 RKRHDNGEQPPPVSPLPREDGVFRSSP-----DQKPKSTTPSPSRFAMEHCSPGNNEPNS 404
           R+  D  ++P    P PR D      P     D  P+  +P+P     E+ +  + + N 
Sbjct: 290 REPLDVPDEPEDDQPRPRGDNFAVEKPNENIIDNNPQEPSPNPEEGKGENRNGFDLDENP 349

Query: 403 GGSHDPMAPPSPPIIQRE 350
               +P  PP+P I Q+E
Sbjct: 350 ENPSNPENPPNPDIPQQE 367



>gb:AY060680_1292485 Drosophila melanogaster GH11848 full length
           cDNA.
          Length = 598

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 17/60 (28%), Positives = 23/60 (38%)
 Frame = -2

Query: 541 PPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSPPI 362
           PPP+ P+     V   +P           S F   H + G        S  P APP+PP+
Sbjct: 469 PPPMMPVSLPTSVAIPNPSLHESKVFSPYSPFFNPHAAAGQANGGPAPSAPPAAPPAPPV 528



>gb:CR858106_1182293 Pongo pygmaeus mRNA; cDNA DKFZp468F1911 (from
           clone DKFZp468F1911).
          Length = 683

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 29/85 (34%), Positives = 37/85 (43%), Gaps = 16/85 (18%)
 Frame = -2

Query: 568 RKRHDNGEQPPPVSPLPREDG--------VFRS-------SPDQKPKSTTPSPSRFAMEH 434
           ++R   GE P  +SP P  +G        + RS       SP     S TP+ SR     
Sbjct: 370 QERQSLGESPRTLSPTPSAEGYQDVRDRMIQRSTSQGSINSPVYSRHSYTPTTSRSPQHF 429

Query: 433 CSPGNNEPNSG-GSHDPMAPPSPPI 362
             PG NEP+SG  S  P  P S P+
Sbjct: 430 HRPG-NEPSSGRNSPLPYRPDSRPL 453



>gb:AE016959_1023665 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC051633_1540154 Oryza sativa
            chromosome 10 BAC OSJNBb0015I11 genomic sequence,
            complete sequence.>gb:AE017116_1753484 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 70 of 77
            of the complete sequence.
          Length = 1417

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 27/96 (28%), Positives = 43/96 (44%), Gaps = 6/96 (6%)
 Frame = -2

Query: 637  CWCSLAQEVRTGNSYDIVEDKFYRKRHDNGEQPPPVSPLPREDG----VFRSSPDQKPKS 470
            C+  +++ V T      VED F  +   +   P P +P P + G    V   +P Q   +
Sbjct: 761  CYDMVSRRVFTSRHVTFVEDVFPFR---DAPSPRPSAPPPPDHGDDTIVLLPAPAQHVVT 817

Query: 469  TT-PSPSRFAMEHCSPGNNEPNSGG-SHDPMAPPSP 368
                +P+  A    SP ++ P+S   +HD   PPSP
Sbjct: 818  PVGTAPAHDAASPPSPASSTPSSAAPAHDVAPPPSP 853



>gb:AE016959_1020786 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC025098_1539376 Oryza sativa
            (japonica cultivar-group) chromosome 10 clone
            OSJNBa0020E23, complete sequence.>gb:AE017052_1750605
            Oryza sativa (japonica cultivar-group) chromosome 10,
            section 6 of 77 of the complete sequence.
          Length = 1803

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 27/96 (28%), Positives = 43/96 (44%), Gaps = 6/96 (6%)
 Frame = -2

Query: 637  CWCSLAQEVRTGNSYDIVEDKFYRKRHDNGEQPPPVSPLPREDG----VFRSSPDQKPKS 470
            C+  +++ V T      VED F  +   +   P P +P P + G    V   +P Q   +
Sbjct: 761  CYDMVSRRVFTSRHVTFVEDVFPFR---DAPSPRPSAPPPPDHGDDTIVLLPAPAQHVVT 817

Query: 469  TT-PSPSRFAMEHCSPGNNEPNSGG-SHDPMAPPSP 368
                +P+  A    SP ++ P+S   +HD   PPSP
Sbjct: 818  PVGTAPAHDAASPPSPASSTPSSAAPAHDVAPPPSP 853



>gb:AE014186_938047 Plasmodium falciparum 3D7 chromosome 11 complete
           sequence.>gb:AE014837_1228781 Plasmodium falciparum 3D7
           chromosome 11 section 2 of 8 of the complete sequence.
          Length = 1477

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 26/81 (32%), Positives = 34/81 (41%), Gaps = 4/81 (4%)
 Frame = -2

Query: 598 SYDIVEDKFYRKRHDNGEQPPPVSPL--PREDGVFRSSPDQKPKST-TPSPSRFAMEHCS 428
           S  I  D  + K   +       SPL  P       SSP   P S+ + SPS       S
Sbjct: 523 SKGICSDSIFYKSSQSKSSSQLSSPLSSPLSSPSPSSSPSSSPSSSPSSSPSSSPSPSSS 582

Query: 427 PG-NNEPNSGGSHDPMAPPSP 368
           P  ++ P+S  S  P +PPSP
Sbjct: 583 PSPSSSPSSSPSSSPSSPPSP 603



>gb:BA000035_714994 Corynebacterium efficiens YS-314 DNA, complete
           genome.
          Length = 780

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 23/75 (30%), Positives = 31/75 (41%), Gaps = 14/75 (18%)
 Frame = -2

Query: 547 EQPP--PVSPLPREDGVFRSSPDQKPKST----TPSPSRFAMEHCSPGNNEPNSGG---- 398
           EQP   P  P P+E    +  P Q  +S      P+P+    E   P +  P SGG    
Sbjct: 562 EQPTWNPTRPTPQEQSAQQQMPSQPQESRQHPKAPAPAAAPDEPEEPESPAPRSGGWGEP 621

Query: 397 ----SHDPMAPPSPP 365
                  P+APP+ P
Sbjct: 622 VKIGDEQPVAPPAAP 636



>gb:AF071081_476065 Mycobacterium tuberculosis proline-rich mucin
           homolog gene, complete cds.
          Length = 763

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 18/59 (30%), Positives = 23/59 (38%)
 Frame = -2

Query: 538 PPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSPPI 362
           PP +P P      +S P   P+   P      ME        P+      P APP+PPI
Sbjct: 184 PPAAPWPPVPAAPKSKPASPPRPPAPPMPATPMEFPPLPPVPPDPISKETPPAPPAPPI 242



>gb:CR555308_109988 Azoarcus sp. EbN1 plasmid 2.
          Length = 213

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 11/62 (17%)
 Frame = -2

Query: 520 PREDGVFRSSPDQKPKSTT---------PSPS--RFAMEHCSPGNNEPNSGGSHDPMAPP 374
           P+  G+ RS+P   P+ST+         PSP+   +A    +P +     G SH P APP
Sbjct: 6   PKRPGLGRSTPAVAPRSTSTRRCSTAAPPSPACATWATAWLAP-SGRAYYGASHTPSAPP 64

Query: 373 SP 368
           SP
Sbjct: 65  SP 66



>pir|D96711|D96711 hypothetical protein F24J5.8 [imported] -
           Arabidopsis thaliana>gb:AE005173_894489 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AY035076_1559848 Arabidopsis thaliana
           putative protein kinase (At1g68690) mRNA, complete
           cds.>gb:AY113877_1578288 Arabidopsis thaliana putative
           protein kinase (At1g68690) mRNA, complete
           cds.>gb:F24J5_1677998 Arabidopsis thaliana chromosome 1
           BAC F24J5 sequence, complete sequence.
          Length = 708

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 17/61 (27%), Positives = 24/61 (39%)
 Frame = -2

Query: 547 EQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAPPSP 368
           + PPP SP         S P ++P  + PSP         P  + P+        +PP P
Sbjct: 165 QSPPPPSP--------PSPPSERPTQSPPSPPSERPTQSPPPPSPPSPPSDRPSQSPPPP 216

Query: 367 P 365
           P
Sbjct: 217 P 217



>pir|T11622|T11622 extensin class 1 precursor -
           cowpea>gb:VUEXT26GN_1727427 V.unguiculata Ext26G gene.
          Length = 489

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 21/62 (33%), Positives = 27/62 (43%), Gaps = 1/62 (1%)
 Frame = -2

Query: 547 EQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAP-PS 371
           + PPP SP P    V++S P   P S +P P  +      P  + P       P  P PS
Sbjct: 415 KSPPPPSPSPPPPYVYKSPP---PPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPS 471

Query: 370 PP 365
           PP
Sbjct: 472 PP 473



 Score = 32.3 bits (72), Expect = 9.7
 Identities = 21/62 (33%), Positives = 27/62 (43%), Gaps = 1/62 (1%)
 Frame = -2

Query: 547 EQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAP-PS 371
           + PPP SP P    V++S P   P S +P P  +      P  + P       P  P PS
Sbjct: 335 KSPPPPSPSPPPPYVYKSPP---PPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPS 391

Query: 370 PP 365
           PP
Sbjct: 392 PP 393



 Score = 32.3 bits (72), Expect = 9.7
 Identities = 21/62 (33%), Positives = 27/62 (43%), Gaps = 1/62 (1%)
 Frame = -2

Query: 547 EQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAP-PS 371
           + PPP SP P    V++S P   P S +P P  +      P  + P       P  P PS
Sbjct: 207 KSPPPPSPSPPPPYVYKSPP---PPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPS 263

Query: 370 PP 365
           PP
Sbjct: 264 PP 265



 Score = 32.3 bits (72), Expect = 9.7
 Identities = 21/62 (33%), Positives = 27/62 (43%), Gaps = 1/62 (1%)
 Frame = -2

Query: 547 EQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAP-PS 371
           + PPP SP P    V++S P   P S +P P  +      P  + P       P  P PS
Sbjct: 143 KSPPPPSPSPPPPYVYKSPP---PPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPS 199

Query: 370 PP 365
           PP
Sbjct: 200 PP 201



 Score = 32.3 bits (72), Expect = 9.7
 Identities = 21/62 (33%), Positives = 27/62 (43%), Gaps = 1/62 (1%)
 Frame = -2

Query: 547 EQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEHCSPGNNEPNSGGSHDPMAP-PS 371
           + PPP SP P    V++S P   P S +P P  +      P  + P       P  P PS
Sbjct: 79  KSPPPPSPSPPPPYVYKSPP---PPSPSPPPPYYYKSPPPPSPSPPPPYYYKSPPPPSPS 135

Query: 370 PP 365
           PP
Sbjct: 136 PP 137



>pir|S25299|S25299 extensin precursor - tomato>gb:TOMEXTENB_1725649
           L.esculentum extensin (class II) gene, complete cds.
          Length = 322

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 22/67 (32%), Positives = 27/67 (40%), Gaps = 8/67 (11%)
 Frame = -2

Query: 541 PPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFAMEH--------CSPGNNEPNSGGSHDP 386
           PPPV   P         P  KPKS  P P+  + EH         +P    P +  SH+ 
Sbjct: 105 PPPVYYSPPPPVYHEPPPTYKPKSPPPPPTP-SYEHPKTPSPLPPTPSYEHPKTPPSHEH 163

Query: 385 MAPPSPP 365
              PSPP
Sbjct: 164 PKTPSPP 170



>pir|S37781|S37781 retinoid X receptor beta - human
          Length = 533

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 26/72 (36%), Positives = 34/72 (47%), Gaps = 10/72 (13%)
 Frame = -2

Query: 550 GEQPPPVSPLPRE---DGVFRSSPDQK-PKSTTPSPSRFAMEHCSPG------NNEPNSG 401
           GEQ  P  P P E   DG+  S  D + P S++P+P    +   SP       +  P+ G
Sbjct: 56  GEQQTP-EPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLG 114

Query: 400 GSHDPMAPPSPP 365
           GS  P  PP PP
Sbjct: 115 GSGGPPPPPMPP 126



>sp|O95487|S24B_HUMAN Protein transport protein Sec24B
           (SEC24-related protein B).>gb:HSA131245_2000206 Homo
           sapiens mRNA for Sec24 protein (Sec24B isoform).
          Length = 1268

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 16/53 (30%), Positives = 20/53 (37%)
 Frame = -2

Query: 601 NSYDIVEDKFYRKRHDNGEQPPPVSPLPREDGVFRSSPDQKPKSTTPSPSRFA 443
           NSYD +E   Y     +    P   P P  D     +P   P    P PS+ A
Sbjct: 404 NSYDALEGGSYPDMLSSSASSPAPDPAPEPDPASAPAPASAPAPVVPQPSKMA 456



>sp|P39653|DEXT_STRDO Dextranase precursor (EC 3.2.1.11)
            (Alpha-1,6-glucan-6- glucanohydrolase).>pir|T30291|T30291
            dextranase - Streptococcus sobrinus>gb:STRDEXTRAN_193282
            Streptococcus sobrinus dextranase precursor, gene,
            complete cds.
          Length = 1337

 Score = 32.3 bits (72), Expect = 9.7
 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 2/59 (3%)
 Frame = -2

Query: 514  EDGVFRSSPDQKPKSTTP--SPSRFAMEHCSPGNNEPNSGGSHDPMAPPSPPIIQREDV 344
            +D    SS DQ  KSTTP   P   + E      ++PN+  S      PS P++  + V
Sbjct: 1156 QDSTKGSSADQSGKSTTPEDGPDNSSPEDPETKPSDPNTDTSDQEQVKPSLPVVPNQTV 1214


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 843,311,883
Number of Sequences: 1806583
Number of extensions: 18671053
Number of successful extensions: 63697
Number of sequences better than 10.0: 166
Number of HSP's better than 10.0 without gapping: 55345
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 62573
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 47358445219
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)