BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig9538
         (694 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:CR382137_1670419 Debaryomyces hansenii chromosome E of strain...    43   0.006   
gb:AE015941_320631 Clostridium tetani E88, section 6 of 10 of th...    42   0.014   
gb:AY137504_2076721 Mus musculus histidine-rich glycoprotein HRG...    40   0.039   
gb:AY135662_2076700 Mus musculus histidine-rich glycoprotein Hrg...    40   0.039   
gb:AF194028_2058601 Mus musculus histidine-rich glycoprotein (Hr...    40   0.039   
gb:AB055898_2046466 Mus musculus MMHRG gene for histidine-rich g...    40   0.039   
gb:AB055897_2046465 Mus musculus MMHRG mRNA for histidine-rich g...    40   0.039   
gb:PFAHRPA_1393792 P.lophurae histidine-rich protein mRNA, 3' end.     39   0.067   
gb:AE014187_938873 Plasmodium falciparum 3D7 chromosome 14 compl...    39   0.067   
pir|A54523|A54523 histidine-rich protein - Plasmodium lophurae (...    39   0.067   Plasmodium lophurae
gb:AJ783397_1813989 Gerbera hybrida partial gtt5 gene.                 38   0.20    
gb:AC123513_1192410 Dictyostelium discoideum strain AX4 chromoso...    38   0.20    
gb:BOL535757_1355803 Bactrocera oleae ovoB gene for zinc finger ...    37   0.25    
gb:BOL535757_1355802 Bactrocera oleae ovoB gene for zinc finger ...    37   0.25    
gb:BOL535756_1355801 Bactrocera oleae ovoA gene for zinc finger ...    37   0.25    
gb:BOL535756_1355800 Bactrocera oleae ovoA gene for zinc finger ...    37   0.25    
sp|P04929|HRPX_PLALO|HRPX_PLALO Histidine-rich glycoprotein precursor.>pir|...    37   0.25    Plasmodium lophurae
gb:AP004623_1842268 Oryza sativa (japonica cultivar-group) genom...    37   0.33    
gb:AY009089_2286060 Camelpox virus CMS, complete genome.               35   0.97    
pir|S35687|A60488 histidine-rich glycoprotein - bovine (fragments)     35   0.97    
pir|S54157|S54157 extensin-like protein - cowpea (fragment)            35   1.3     Vigna unguiculata
gb:AX647835_1472545 Sequence 2027 from Patent EP1270724.               35   1.7     
gb:A32895_1448490 R.prolixus thrombin inhibitor protein coding c...    34   2.2     
gb:AB055894_1408713 Bos taurus BTHRG mRNA for histidine-rich gly...    34   2.2     
gb:BX572593_799853 Rhodopseudomonas palustris CGA009 complete ge...    34   2.2     
gb:AP003571_1831039 Oryza sativa (japonica cultivar-group) genom...    34   2.8     
gb:CR382133_1666589 Debaryomyces hansenii chromosome A of strain...    34   2.8     
gb:AK017761_1159305 Mus musculus 8 days embryo whole body cDNA, ...    34   2.8     
gb:AX647837_1472546 Sequence 2029 from Patent EP1270724.               33   3.7     
gb:DMU47849_1380788 Drosophila melanogaster Lozenge (lz) mRNA, c...    33   3.7     
gb:CR749302_1180931 Homo sapiens mRNA; cDNA DKFZp779H1622 (from ...    33   3.7     
gb:AE014298_1124947 Drosophila melanogaster chromosome X, comple...    33   3.7     
sp|P04196|HRG_HUMAN|HRG_HUMAN Histidine-rich glycoprotein precursor (Histi...    33   3.7     Homo sapiens [man]
gb:CR382122_1654832 Kluyveromyces lactis strain NRRL Y-1140 chro...    33   4.8     
gb:CR380950_1649860 Candida glabrata strain CBS138 chromosome D ...    33   4.8     
gb:BC075450_2558553 Xenopus tropicalis HRG protein, mRNA (cDNA c...    33   6.3     
gb:AE014187_938830 Plasmodium falciparum 3D7 chromosome 14 compl...    33   6.3     
gb:AJ781003_2279196 Cacao swollen shoot virus complete genome.         32   8.2     
gb:AE008887_245623 Salmonella typhimurium LT2, section 191 of 22...    32   8.2     
pir|AF0949|AF0949 hypothetical protein STY3869 [imported] - Salm...    32   8.2     Salmonella enterica subsp. enterica serovar Typhi


>gb:CR382137_1670419 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 522

 Score = 42.7 bits (99), Expect = 0.006
 Identities = 24/66 (36%), Positives = 33/66 (50%)
 Frame = +1

Query: 154 LNAHHFNLHPSSSLGEGVVDTKSDEPLHSPLKGGEGNMKGRNEGSSDEDMVGNNDEYDSD 333
           + A  FNL P S   +         PL SPL+  +GN K R E + D++  G ND  D D
Sbjct: 94  VEAGPFNLSPISIPSKRSKSRNKKSPLRSPLQENKGN-KRREEATGDDEEYGYNDNNDMD 152

Query: 334 EDMVGN 351
            D+ G+
Sbjct: 153 NDLYGD 158



>gb:AE015941_320631 Clostridium tetani E88, section 6 of 10 of the
           complete genome.>gb:AE015927_963420 Clostridium tetani
           E88, complete genome.
          Length = 221

 Score = 41.6 bits (96), Expect = 0.014
 Identities = 15/35 (42%), Positives = 19/35 (54%)
 Frame = -1

Query: 382 CHCHKQYLHHCYQPYLHHCHIHHCYQPYLHHCSLH 278
           CHC    +HHC  P + HC +HH   P + HC  H
Sbjct: 85  CHCMHDCMHHCMNPGMDHC-MHHDMNPGMDHCMHH 118



>gb:AY137504_2076721 Mus musculus histidine-rich glycoprotein HRG
           (Hrg) gene, complete cds.
          Length = 536

 Score = 40.0 bits (92), Expect = 0.039
 Identities = 25/82 (30%), Positives = 33/82 (40%), Gaps = 2/82 (2%)
 Frame = -1

Query: 460 PCHCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHH--CYQPYLHHC 287
           PCH H+        P+ HH      P H    +  H + P+ HH H HH   + P+ HH 
Sbjct: 348 PCHGHR--------PHGHHPHSHHPPGHHSHGHHPHGHHPHSHHSHGHHPPGHHPHGHHP 399

Query: 286 SLHFFLSCFLPHPLGGNVKAHH 221
             H        HP G +   HH
Sbjct: 400 HGH--------HPHGHHPHGHH 413



>gb:AY135662_2076700 Mus musculus histidine-rich glycoprotein Hrg
           (Hrg1) mRNA, complete cds.
          Length = 536

 Score = 40.0 bits (92), Expect = 0.039
 Identities = 25/82 (30%), Positives = 33/82 (40%), Gaps = 2/82 (2%)
 Frame = -1

Query: 460 PCHCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHH--CYQPYLHHC 287
           PCH H+        P+ HH      P H    +  H + P+ HH H HH   + P+ HH 
Sbjct: 348 PCHGHR--------PHGHHPHSHHPPGHHSHGHHPHGHHPHSHHSHGHHPPGHHPHGHHP 399

Query: 286 SLHFFLSCFLPHPLGGNVKAHH 221
             H        HP G +   HH
Sbjct: 400 HGH--------HPHGHHPHGHH 413



>gb:AF194028_2058601 Mus musculus histidine-rich glycoprotein (Hrg)
           mRNA, complete cds.
          Length = 525

 Score = 40.0 bits (92), Expect = 0.039
 Identities = 25/82 (30%), Positives = 33/82 (40%), Gaps = 2/82 (2%)
 Frame = -1

Query: 460 PCHCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHH--CYQPYLHHC 287
           PCH H+        P+ HH      P H    +  H + P+ HH H HH   + P+ HH 
Sbjct: 337 PCHGHR--------PHGHHPHSHHPPGHHSHGHHPHGHHPHSHHSHGHHPPGHHPHGHHP 388

Query: 286 SLHFFLSCFLPHPLGGNVKAHH 221
             H        HP G +   HH
Sbjct: 389 HGH--------HPHGHHPHGHH 402



>gb:AB055898_2046466 Mus musculus MMHRG gene for histidine-rich
           glycoprotein, complete cds.>gb:BC011168_2091288 Mus
           musculus histidine-rich glycoprotein, mRNA (cDNA clone
           MGC:19088 IMAGE:4195766), complete cds.
          Length = 525

 Score = 40.0 bits (92), Expect = 0.039
 Identities = 25/82 (30%), Positives = 33/82 (40%), Gaps = 2/82 (2%)
 Frame = -1

Query: 460 PCHCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHH--CYQPYLHHC 287
           PCH H+        P+ HH      P H    +  H + P+ HH H HH   + P+ HH 
Sbjct: 337 PCHGHR--------PHGHHPHSHHPPGHHSHGHHPHGHHPHSHHSHGHHPPGHHPHGHHP 388

Query: 286 SLHFFLSCFLPHPLGGNVKAHH 221
             H        HP G +   HH
Sbjct: 389 HGH--------HPHGHHPHGHH 402



>gb:AB055897_2046465 Mus musculus MMHRG mRNA for histidine-rich
           glycoprotein, complete cds.
          Length = 525

 Score = 40.0 bits (92), Expect = 0.039
 Identities = 25/82 (30%), Positives = 33/82 (40%), Gaps = 2/82 (2%)
 Frame = -1

Query: 460 PCHCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHH--CYQPYLHHC 287
           PCH H+        P+ HH      P H    +  H + P+ HH H HH   + P+ HH 
Sbjct: 337 PCHGHR--------PHGHHPHSHHPPGHHSHGHHPHGHHPHSHHSHGHHPPGHHPHGHHP 388

Query: 286 SLHFFLSCFLPHPLGGNVKAHH 221
             H        HP G +   HH
Sbjct: 389 HGH--------HPHGHHPHGHH 402



>gb:PFAHRPA_1393792 P.lophurae histidine-rich protein mRNA, 3' end.
          Length = 140

 Score = 39.3 bits (90), Expect = 0.067
 Identities = 18/61 (29%), Positives = 26/61 (42%)
 Frame = -1

Query: 460 PCHCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHHCYQPYLHHCSL 281
           P H H  +    + P+ HH        H H  + HH + P+ HH H H  +  + HH   
Sbjct: 38  PHHHHHHH----HAPHHHHHHPWFHHHHHHPWFHHHHHHPWFHHHHHHDAHHHHHHHHDA 93

Query: 280 H 278
           H
Sbjct: 94  H 94



 Score = 35.0 bits (79), Expect = 1.3
 Identities = 20/66 (30%), Positives = 27/66 (40%), Gaps = 5/66 (7%)
 Frame = -1

Query: 460 PCHCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCH-----IHHCYQPYL 296
           P H H  +    + P+ HH        H H    HH + P+ HH H      HH + P+ 
Sbjct: 28  PHHHHHHH----HAPHHHH--------HHHHAPHHHHHHPWFHHHHHHPWFHHHHHHPWF 75

Query: 295 HHCSLH 278
           HH   H
Sbjct: 76  HHHHHH 81



 Score = 34.7 bits (78), Expect = 1.7
 Identities = 17/59 (28%), Positives = 23/59 (38%)
 Frame = -1

Query: 454 HCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHHCYQPYLHHCSLH 278
           H H  +    + P+ HH        H H  + HH +    HH H HH    + HH   H
Sbjct: 52  HHHPWFHHHHHHPWFHHH-------HHHPWFHHHHHHDAHHHHHHHHDAHHHHHHHDAH 103



 Score = 34.3 bits (77), Expect = 2.2
 Identities = 23/75 (30%), Positives = 31/75 (41%), Gaps = 4/75 (5%)
 Frame = -1

Query: 460 PCHCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIH----HCYQPYLH 293
           P H H  +    + P+ HH      P H H    HH + P+ HH H H    H + P+ H
Sbjct: 8   PHHHHHHH----HAPHHHHHHH-HAPHHHH----HHHHAPHHHHHHHHAPHHHHHHPWFH 58

Query: 292 HCSLHFFLSCFLPHP 248
           H   H +      HP
Sbjct: 59  HHHHHPWFHHHHHHP 73



>gb:AE014187_938873 Plasmodium falciparum 3D7 chromosome 14 complete
           sequence.>gb:AE014822_1227949 Plasmodium falciparum 3D7
           chromosome 14 section 7 of 13 of the complete sequence.
          Length = 3384

 Score = 39.3 bits (90), Expect = 0.067
 Identities = 18/60 (30%), Positives = 25/60 (41%)
 Frame = -1

Query: 457 CHCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHHCYQPYLHHCSLH 278
           CH H  Y       + HH + C    HCH  Y         H+ H +HC+  Y +H + H
Sbjct: 581 CHSHHNY-------HSHHNYHCHHNYHCHHNY---------HNHHNYHCHHNYHNHHNEH 624



 Score = 35.4 bits (80), Expect = 0.97
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%)
 Frame = -1

Query: 418 PYLHHRFLCRRPCH-CHKQYLHHCYQPYLHHC-HIHHCYQPYLHHCSLH 278
           PY HH    +   H CH  + +H +  Y  HC H +HC+  Y +H + H
Sbjct: 566 PYAHHTKQKKNSDHNCHSHHNYHSHHNY--HCHHNYHCHHNYHNHHNYH 612



>pir|A54523|A54523 histidine-rich protein - Plasmodium lophurae
           (fragment)
          Length = 140

 Score = 39.3 bits (90), Expect = 0.067
 Identities = 18/61 (29%), Positives = 26/61 (42%)
 Frame = -1

Query: 460 PCHCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHHCYQPYLHHCSL 281
           P H H  +    + P+ HH        H H  + HH + P+ HH H H  +  + HH   
Sbjct: 38  PHHHHHHH----HAPHHHHHHPWFHHHHHHPWFHHHHHHPWFHHHHHHDAHHHHHHHHDA 93

Query: 280 H 278
           H
Sbjct: 94  H 94



 Score = 35.0 bits (79), Expect = 1.3
 Identities = 20/66 (30%), Positives = 27/66 (40%), Gaps = 5/66 (7%)
 Frame = -1

Query: 460 PCHCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCH-----IHHCYQPYL 296
           P H H  +    + P+ HH        H H    HH + P+ HH H      HH + P+ 
Sbjct: 28  PHHHHHHH----HAPHHHH--------HHHHAPHHHHHHPWFHHHHHHPWFHHHHHHPWF 75

Query: 295 HHCSLH 278
           HH   H
Sbjct: 76  HHHHHH 81



 Score = 34.7 bits (78), Expect = 1.7
 Identities = 17/59 (28%), Positives = 23/59 (38%)
 Frame = -1

Query: 454 HCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHHCYQPYLHHCSLH 278
           H H  +    + P+ HH        H H  + HH +    HH H HH    + HH   H
Sbjct: 52  HHHPWFHHHHHHPWFHHH-------HHHPWFHHHHHHDAHHHHHHHHDAHHHHHHHDAH 103



 Score = 34.3 bits (77), Expect = 2.2
 Identities = 23/75 (30%), Positives = 31/75 (41%), Gaps = 4/75 (5%)
 Frame = -1

Query: 460 PCHCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIH----HCYQPYLH 293
           P H H  +    + P+ HH      P H H    HH + P+ HH H H    H + P+ H
Sbjct: 8   PHHHHHHH----HAPHHHHHHH-HAPHHHH----HHHHAPHHHHHHHHAPHHHHHHPWFH 58

Query: 292 HCSLHFFLSCFLPHP 248
           H   H +      HP
Sbjct: 59  HHHHHPWFHHHHHHP 73



>gb:AJ783397_1813989 Gerbera hybrida partial gtt5 gene.
          Length = 157

 Score = 37.7 bits (86), Expect = 0.20
 Identities = 24/84 (28%), Positives = 34/84 (40%), Gaps = 2/84 (2%)
 Frame = -1

Query: 478 CFLCRRPCHCHKQYLRCC--YQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHHCYQ 305
           C L ++ CH   Q +  C   Q   HH+FL    CH  ++  HH ++       I H + 
Sbjct: 61  CHLIQKSCHHQFQSINHCRLIQKSCHHQFLSISQCHLIQKSCHHQFR------SISHSHH 114

Query: 304 PYLHHCSLHFFLSCFLPHPLGGNV 233
               H     FLS  L  P   N+
Sbjct: 115 STRSHARRFHFLSFLLTPPFLQNI 138



 Score = 36.2 bits (82), Expect = 0.57
 Identities = 33/116 (28%), Positives = 49/116 (42%), Gaps = 27/116 (23%)
 Frame = -1

Query: 454 HCHKQYLRCCYQPYLHHRFLCRRPCH-----CHKQY--LHHCY--QPYLH-------HCH 323
           HCH     C      HH+F     CH     CH Q+  ++HC+  Q   H       HCH
Sbjct: 9   HCHLIQKSC------HHQFRSINHCHLIQKSCHHQFRSINHCHLIQKSCHHQFRSISHCH 62

Query: 322 I-----HHCYQPYLHHCSL------HFFLSCFLPHPLGGNVKAHHF*YQQLLHPNY 188
           +     HH +Q  ++HC L      H FLS    H +    K+ H  ++ + H ++
Sbjct: 63  LIQKSCHHQFQS-INHCRLIQKSCHHQFLSISQCHLI---QKSCHHQFRSISHSHH 114



>gb:AC123513_1192410 Dictyostelium discoideum strain AX4 chromosome
           2 map 2779865-2840915, *** SEQUENCING IN PROGRESS
           ***.>gb:AC117070_1207608 Dictyostelium discoideum
           chromosome 2 map 2097701-2233941 strain AX4, complete
           sequence.
          Length = 233

 Score = 37.7 bits (86), Expect = 0.20
 Identities = 18/59 (30%), Positives = 25/59 (42%)
 Frame = -1

Query: 424 YQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHHCYQPYLHHCSLHFFLSCFLPHP 248
           + P+ HH        H H  + HH +  + HH H HH +  + HH   H       PHP
Sbjct: 108 HHPHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHPHHH-----PHP 161



 Score = 37.7 bits (86), Expect = 0.20
 Identities = 25/88 (28%), Positives = 33/88 (37%)
 Frame = -1

Query: 454 HCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHHCYQPYLHHCSLHF 275
           H H  +    + P+ HH      P H H  + HH +  + HH H HH +  + HH   H 
Sbjct: 88  HHHHHHHHHPHHPH-HHPHHHHHPHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH 146

Query: 274 FLSCFLPHPLGGNVKAHHF*YQQLLHPN 191
                  HP        H      LHPN
Sbjct: 147 HHHHHHHHPHHHPHPHPHPHPHPHLHPN 174



 Score = 37.7 bits (86), Expect = 0.20
 Identities = 23/88 (26%), Positives = 34/88 (38%)
 Frame = -1

Query: 454 HCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHHCYQPYLHHCSLHF 275
           H H  +    +  + HH      P H H  + HH + P+ HH H HH +  + HH   H 
Sbjct: 74  HHHHHHHHHHHHHHHHHHHHHHHPHHPH-HHPHHHHHPHHHHHHHHHHHHHHHHHHHHHH 132

Query: 274 FLSCFLPHPLGGNVKAHHF*YQQLLHPN 191
                  H    +   HH  +    HP+
Sbjct: 133 HHHHHHHHHHHHHHHHHHHHHHPHHHPH 160



 Score = 33.9 bits (76), Expect = 2.8
 Identities = 21/71 (29%), Positives = 29/71 (40%)
 Frame = -1

Query: 460 PCHCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHHCYQPYLHHCSL 281
           P H H  +    +  + HH        H H  + HH +  + HH H HH + P+ HH   
Sbjct: 104 PHHHHHPHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHPH-HHPHP 161

Query: 280 HFFLSCFLPHP 248
           H       PHP
Sbjct: 162 H-------PHP 165



 Score = 33.5 bits (75), Expect = 3.7
 Identities = 17/61 (27%), Positives = 24/61 (39%)
 Frame = -1

Query: 460 PCHCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHHCYQPYLHHCSL 281
           P H H  +    +  + HH        H H  + HH +    HH H HH +  + HH   
Sbjct: 64  PHHPHHLHHHHHHHHHHHHHHHHHHHHHHHHHHPHHPHHHPHHHHHPHHHHHHHHHHHHH 123

Query: 280 H 278
           H
Sbjct: 124 H 124



 Score = 32.7 bits (73), Expect = 6.3
 Identities = 21/91 (23%), Positives = 32/91 (35%)
 Frame = -1

Query: 460 PCHCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHHCYQPYLHHCSL 281
           P H H  +    +  + HH        H H  + HH    + H  H HH +  + HH   
Sbjct: 67  PHHLHHHHHHHHHHHHHHHHHHHHHHHHHHPHHPHHHPHHHHHPHHHHHHHHHHHHHHHH 126

Query: 280 HFFLSCFLPHPLGGNVKAHHF*YQQLLHPNY 188
           H        H    +   HH  +    HP++
Sbjct: 127 HHHHHHHHHHHHHHHHHHHHHHHHHHHHPHH 157



>gb:BOL535757_1355803 Bactrocera oleae ovoB gene for zinc finger
           transcription factor.
          Length = 686

 Score = 37.4 bits (85), Expect = 0.25
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 7/60 (11%)
 Frame = -1

Query: 379 HCHKQYLHHCYQPYLHH----CHI---HHCYQPYLHHCSLHFFLSCFLPHPLGGNVKAHH 221
           H ++Q+ HH Y P  HH     HI   HH    + HH S +  LS  LP P   ++ AHH
Sbjct: 371 HAYQQHPHHPYGPTQHHHQQPHHIVSPHHMQHHHHHHSSDNSNLS--LPSPNAAHLSAHH 428



>gb:BOL535757_1355802 Bactrocera oleae ovoB gene for zinc finger
           transcription factor.>gb:BOL535759_1355805 Bactrocera
           oleae mRNA for zinc finger transcription factor (ovoB
           gene), long splice variant.
          Length = 752

 Score = 37.4 bits (85), Expect = 0.25
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 7/60 (11%)
 Frame = -1

Query: 379 HCHKQYLHHCYQPYLHH----CHI---HHCYQPYLHHCSLHFFLSCFLPHPLGGNVKAHH 221
           H ++Q+ HH Y P  HH     HI   HH    + HH S +  LS  LP P   ++ AHH
Sbjct: 371 HAYQQHPHHPYGPTQHHHQQPHHIVSPHHMQHHHHHHSSDNSNLS--LPSPNAAHLSAHH 428



>gb:BOL535756_1355801 Bactrocera oleae ovoA gene for zinc finger
           transcription factor.
          Length = 1096

 Score = 37.4 bits (85), Expect = 0.25
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 7/60 (11%)
 Frame = -1

Query: 379 HCHKQYLHHCYQPYLHH----CHI---HHCYQPYLHHCSLHFFLSCFLPHPLGGNVKAHH 221
           H ++Q+ HH Y P  HH     HI   HH    + HH S +  LS  LP P   ++ AHH
Sbjct: 781 HAYQQHPHHPYGPTQHHHQQPHHIVSPHHMQHHHHHHSSDNSNLS--LPSPNAAHLSAHH 838



>gb:BOL535756_1355800 Bactrocera oleae ovoA gene for zinc finger
           transcription factor.>gb:BOL535758_1355804 Bactrocera
           oleae mRNA for zinc finger transcription factor (ovoA
           gene), short splice variant.
          Length = 1162

 Score = 37.4 bits (85), Expect = 0.25
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 7/60 (11%)
 Frame = -1

Query: 379 HCHKQYLHHCYQPYLHH----CHI---HHCYQPYLHHCSLHFFLSCFLPHPLGGNVKAHH 221
           H ++Q+ HH Y P  HH     HI   HH    + HH S +  LS  LP P   ++ AHH
Sbjct: 781 HAYQQHPHHPYGPTQHHHQQPHHIVSPHHMQHHHHHHSSDNSNLS--LPSPNAAHLSAHH 838



>sp|P04929|HRPX_PLALO Histidine-rich glycoprotein
           precursor.>pir|A22692|KGZQHL histidine-rich glycoprotein
           precursor - Plasmodium lophurae>gb:PLHRP1_1395337
           Plasmodium gene fragment for histidine-rich protein.
          Length = 351

 Score = 37.4 bits (85), Expect = 0.25
 Identities = 17/57 (29%), Positives = 25/57 (43%)
 Frame = -1

Query: 448 HKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHHCYQPYLHHCSLH 278
           H  +    + P+ HH  L     H    + HH + P+ HH   HH + P+ HH   H
Sbjct: 149 HHHHHAAHHHPWFHHHHLGYHHHHAPHHHHHHHHAPHHHH---HHHHAPHHHHHHHH 202



 Score = 33.9 bits (76), Expect = 2.8
 Identities = 22/91 (24%), Positives = 34/91 (37%)
 Frame = -1

Query: 460 PCHCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHHCYQPYLHHCSL 281
           P H H  +    + P+ HH      P H H  +  H +  + HH H HH +  + HH   
Sbjct: 194 PHHHHHHH----HAPHHHHHHH-HAPHHHHHHHHGHHHHHHHHHGHHHHHHHHHGHHHHH 248

Query: 280 HFFLSCFLPHPLGGNVKAHHF*YQQLLHPNY 188
           H        H    +   HH  +    H ++
Sbjct: 249 HHHHDAHHHHHHHHDAHHHHHHHHDAHHHHH 279



 Score = 33.1 bits (74), Expect = 4.8
 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 6/55 (10%)
 Frame = -1

Query: 424 YQPYLHHRFLCRRPCHCHKQYLHH----CYQPYLHHCHI--HHCYQPYLHHCSLH 278
           ++ + HH        H H+++ HH     + P+ HH H+  HH + P+ HH   H
Sbjct: 130 HEEHHHHHHAAHH--HHHEEHHHHHHAAHHHPWFHHHHLGYHHHHAPHHHHHHHH 182



 Score = 32.7 bits (73), Expect = 6.3
 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 2/51 (3%)
 Frame = -1

Query: 424 YQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHH--CHIHHCYQPYLHHCSLH 278
           + P  HH  L     H H  + HH  + + HH   H HH  + + HH + H
Sbjct: 106 HHPPHHHHHLGHHHHHHHAAHHHHHEEHHHHHHAAHHHHHEEHHHHHHAAH 156



 Score = 32.3 bits (72), Expect = 8.2
 Identities = 15/55 (27%), Positives = 21/55 (38%)
 Frame = -1

Query: 454 HCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHHCYQPYLHH 290
           H H  +    +  + HH        H H  + HH +    HH H HH    + HH
Sbjct: 275 HHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHHHHHDAHHHHHHHHDAHHHHHH 329



 Score = 32.3 bits (72), Expect = 8.2
 Identities = 15/55 (27%), Positives = 21/55 (38%)
 Frame = -1

Query: 454 HCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHHCYQPYLHH 290
           H H  +    +  + HH        H H  + HH +    HH H HH    + HH
Sbjct: 265 HHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHHHHHDAHHHHHH 319



>gb:AP004623_1842268 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0705A05.>gb:AP005411_1851331 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBa0044E16.
          Length = 195

 Score = 37.0 bits (84), Expect = 0.33
 Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 1/33 (3%)
 Frame = -1

Query: 427 CYQPYLH-HRFLCRRPCHCHKQYLHHCYQPYLH 332
           C+QP LH HR  CR PCHC ++  H  +QP  H
Sbjct: 31  CHQPPLHPHR--CRPPCHCRRRAPHPHHQPSSH 61



>gb:AY009089_2286060 Camelpox virus CMS, complete genome.
          Length = 65

 Score = 35.4 bits (80), Expect = 0.97
 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 4/38 (10%)
 Frame = -1

Query: 382 CHCHKQYL----HHCYQPYLHHCHIHHCYQPYLHHCSL 281
           CHC   Y     HH Y  + H+ H HH Y+PY ++ SL
Sbjct: 21  CHCFHNYYPRPYHHYYYHHYHYHHYHH-YRPYHYYHSL 57



>pir|S35687|A60488 histidine-rich glycoprotein - bovine (fragments)
          Length = 445

 Score = 35.4 bits (80), Expect = 0.97
 Identities = 22/62 (35%), Positives = 27/62 (43%)
 Frame = -1

Query: 475 FLCRRPCHCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHHCYQPYL 296
           F  R P       LRC + P+        RP H H    HH + P+ HH H HH   P+ 
Sbjct: 273 FQARAPLPFPPPGLRCPHPPFGTKGN--HRPPHDHSSDEHHNHHPHGHHPHGHH---PHG 327

Query: 295 HH 290
           HH
Sbjct: 328 HH 329



>pir|S54157|S54157 extensin-like protein - cowpea (fragment)
          Length = 279

 Score = 35.0 bits (79), Expect = 1.3
 Identities = 32/104 (30%), Positives = 40/104 (38%), Gaps = 8/104 (7%)
 Frame = -1

Query: 484 LICFLCRRPCHCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHH-----CYQPYLHHC-- 326
           L+ F      H    +L  C   + HH  +   P H H   LHH        P LH    
Sbjct: 104 LLMFTSHHLLHLLPHHLHMCISRHHHHLPMSTSPHHHH--LLHHHLPMSTSHPLLHLLLH 161

Query: 325 HIHHCYQPYLHHCSLHFFLSCFL-PHPLGGNVKAHHF*YQQLLH 197
           H+H C   + HH  LH  L  F  PH L  ++  HH      LH
Sbjct: 162 HLHMCISHHHHHL-LHLRLPTFTSPHLL--HLLPHHLPMFTSLH 202



 Score = 33.9 bits (76), Expect = 2.8
 Identities = 25/76 (32%), Positives = 30/76 (39%), Gaps = 6/76 (7%)
 Frame = -1

Query: 454 HCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHC---HIHH---CYQPYLH 293
           H    +L  C  P+ HH  L R        +L H    +LH C   H HH      P+ H
Sbjct: 82  HLLPHHLPMCISPH-HHHLLHRHLLMFTSHHLLHLLPHHLHMCISRHHHHLPMSTSPHHH 140

Query: 292 HCSLHFFLSCFLPHPL 245
           H  LH  L     HPL
Sbjct: 141 HL-LHHHLPMSTSHPL 155



 Score = 33.5 bits (75), Expect = 3.7
 Identities = 19/59 (32%), Positives = 23/59 (38%), Gaps = 6/59 (10%)
 Frame = -1

Query: 409 HHRFLCRRPCHCHKQYLHHCYQPYLHHC------HIHHCYQPYLHHCSLHFFLSCFLPH 251
           HH  +C  P H H  + HH      HH       H+H C   + HH   H  L    PH
Sbjct: 209 HHLPMCISPHHHHLLH-HHLLMFTSHHLLHLLPHHLHMCISRHHHHLLHHHLLMSTSPH 266



 Score = 33.5 bits (75), Expect = 3.7
 Identities = 30/109 (27%), Positives = 36/109 (33%), Gaps = 19/109 (17%)
 Frame = -1

Query: 454 HCHKQYLRCCYQPYLHH-------RFLCRRPCHCHKQYLHHCYQPYLHHCHIHHCYQPYL 296
           H    +L  C   + HH        F      H    +LH C   + HH   HH      
Sbjct: 2   HLLHHHLHMCISHHRHHLLHHHLLMFTSHHLLHLLPHHLHMCISRHHHHLLHHHLLMFTS 61

Query: 295 HH------------CSLHFFLSCFLPHPLGGNVKAHHF*YQQLLHPNYL 185
           HH             SLH  L   LPH L   +  HH     LLH + L
Sbjct: 62  HHLLHLLPHHLPMFTSLH--LLHLLPHHLPMCISPHH---HHLLHRHLL 105



 Score = 33.1 bits (74), Expect = 4.8
 Identities = 33/116 (28%), Positives = 42/116 (36%), Gaps = 9/116 (7%)
 Frame = -1

Query: 472 LCRRPCHCHKQYLRC--CYQPYLHH-------RFLCRRPCHCHKQYLHHCYQPYLHHCHI 320
           +C    H H  +LR      P+L H        F      H    +L  C  P+ HH   
Sbjct: 165 MCISHHHHHLLHLRLPTFTSPHLLHLLPHHLPMFTSLHLLHLLPHHLPMCISPHHHHLLH 224

Query: 319 HHCYQPYLHHCSLHFFLSCFLPHPLGGNVKAHHF*YQQLLHPNYLKDGD*NDGHLM 152
           HH      HH  LH      LPH L   +  HH     LLH + L     +  HL+
Sbjct: 225 HHLLMFTSHHL-LH-----LLPHHLHMCISRHH---HHLLHHHLLMSTSPHHHHLL 271



 Score = 32.3 bits (72), Expect = 8.2
 Identities = 23/61 (37%), Positives = 27/61 (44%), Gaps = 3/61 (4%)
 Frame = -1

Query: 358 HHCYQPYLHHCHIHHCYQPYLHHCSLHF---FLSCFLPHPLGGNVKAHHF*YQQLLHPNY 188
           HH    +LH C  HH +   LHH  L F    L   LPH L   +  HH     LLH + 
Sbjct: 1   HHLLHHHLHMCISHHRHH-LLHHHLLMFTSHHLLHLLPHHLHMCISRHH---HHLLHHHL 56

Query: 187 L 185
           L
Sbjct: 57  L 57



>gb:AX647835_1472545 Sequence 2027 from Patent EP1270724.
          Length = 302

 Score = 34.7 bits (78), Expect = 1.7
 Identities = 15/57 (26%), Positives = 25/57 (43%), Gaps = 1/57 (1%)
 Frame = -1

Query: 454 HCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHC-HIHHCYQPYLHHC 287
           + H  ++  C      H ++C         Y+H C   ++H C H+H C   Y+H C
Sbjct: 206 YTHNVHVYMCIYTQCTHVYMCIYTHMYVCAYIHTCAHVHMHTCTHVHMCTCTYVHMC 262



 Score = 32.7 bits (73), Expect = 6.3
 Identities = 19/83 (22%), Positives = 30/83 (36%), Gaps = 13/83 (15%)
 Frame = -1

Query: 472 LCRRPCHCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHC----------- 326
           +C     C   Y+  C   Y+   ++      C   Y+H C   Y+H C           
Sbjct: 41  ICTYAHVCIYAYIHICTYVYMRI-YIYAHMYICVYTYMHICIYAYIHICTYVYMRIYTYT 99

Query: 325 --HIHHCYQPYLHHCSLHFFLSC 263
             +IH C   Y+H C+  +   C
Sbjct: 100 YAYIHICTYAYIHRCTYVYTYIC 122



>gb:A32895_1448490 R.prolixus thrombin inhibitor protein coding
           cDNA.
          Length = 368

 Score = 34.3 bits (77), Expect = 2.2
 Identities = 23/77 (29%), Positives = 28/77 (36%), Gaps = 6/77 (7%)
 Frame = -1

Query: 457 CHCHKQYLRCCYQPYLHHRFLCRRPCHCHKQ---YLHH---CYQPYLHHCHIHHCYQPYL 296
           C C K Y   C      +  LC   CH        LHH   C   + HH   HH +  + 
Sbjct: 134 CACPKIYYPVCGTDGETYPNLCVLECHMRMNPGLQLHHYGHCQHHHHHHPPPHHHHHHHP 193

Query: 295 HHCSLHFFLSCFLPHPL 245
           HH +      C  PH L
Sbjct: 194 HHTTEKPVEPCACPHAL 210



>gb:AB055894_1408713 Bos taurus BTHRG mRNA for histidine-rich
           glycoprotein, complete cds.
          Length = 546

 Score = 34.3 bits (77), Expect = 2.2
 Identities = 27/85 (31%), Positives = 36/85 (42%), Gaps = 4/85 (4%)
 Frame = -1

Query: 463 RPCHCHK--QYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCY--QPYLHHCHIHHCYQPYL 296
           RP H H   ++    + P+ HH        H H  + HH +  QP+ HH H HH   P+ 
Sbjct: 342 RPPHDHSSDEHHPHGHHPHGHHP-------HGHHPHGHHPHGHQPHGHHPHGHH---PHG 391

Query: 295 HHCSLHFFLSCFLPHPLGGNVKAHH 221
           HH   H        HP G +   HH
Sbjct: 392 HHPHGH--------HPHGHHPHGHH 408



>gb:BX572593_799853 Rhodopseudomonas palustris CGA009 complete
           genome; segment 1/16.
          Length = 94

 Score = 34.3 bits (77), Expect = 2.2
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = -1

Query: 415 YLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHHCYQPYLHHCSLHF 275
           Y HHR + R   H H+ + HH  +   H+ H HH +  Y HH   H+
Sbjct: 52  YRHHRHMHR---HHHRSHRHHHVRR--HYGHRHHHHHHYRHHHHRHW 93



>gb:AP003571_1831039 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0458E02.>gb:AP003573_1831110 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0523F01.
          Length = 117

 Score = 33.9 bits (76), Expect = 2.8
 Identities = 12/30 (40%), Positives = 16/30 (53%)
 Frame = -1

Query: 379 HCHKQYLHHCYQPYLHHCHIHHCYQPYLHH 290
           H H  + HH   P+ HH H HH +  + HH
Sbjct: 13  HHHHHHHHHTQPPHHHHNHHHHHHHGHHHH 42



 Score = 32.7 bits (73), Expect = 6.3
 Identities = 20/60 (33%), Positives = 26/60 (43%)
 Frame = -1

Query: 358 HHCYQPYLHHCHIHHCYQPYLHHCSLHFFLSCFLPHPLGGNVKAHHF*YQQLLHPNYLKD 179
           HH +  + HH H HH  QP  HH + H        H   G+   HH   QQ +    LK+
Sbjct: 6   HHHHHHHHHHHHHHHHTQPPHHHHNHHH-------HHHHGHHHHHHQQQQQRIVAKILKE 58



>gb:CR382133_1666589 Debaryomyces hansenii chromosome A of strain
           CBS767 of Debaryomyces hansenii.
          Length = 414

 Score = 33.9 bits (76), Expect = 2.8
 Identities = 20/64 (31%), Positives = 29/64 (45%)
 Frame = -1

Query: 412 LHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHHCYQPYLHHCSLHFFLSCFLPHPLGGNV 233
           LHH+F+ +      +Q+ H  +    HH H  H   P+ H    H  L+  L H L  + 
Sbjct: 45  LHHQFVQQHHHQLQEQHAHQQHALQQHHQHHQHHQHPHEHD---HDQLNSQLNHQLQQHN 101

Query: 232 KAHH 221
            AHH
Sbjct: 102 LAHH 105



>gb:AK017761_1159305 Mus musculus 8 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:5730510P18
           product:hypothetical Histidine-rich region/Prokaryotic
           membrane lipoprotein lipid attachment site containing
           protein, full insert sequence.
          Length = 143

 Score = 33.9 bits (76), Expect = 2.8
 Identities = 16/47 (34%), Positives = 21/47 (44%)
 Frame = -1

Query: 445 KQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHHCYQ 305
           K+ L     P   +  +C    H H Q +H C     HH HIHH Y+
Sbjct: 75  KEILNIHLGPLCSYANMCIHDPHVHTQ-VHTCKHMIAHHVHIHHTYK 120



>gb:AX647837_1472546 Sequence 2029 from Patent EP1270724.
          Length = 291

 Score = 33.5 bits (75), Expect = 3.7
 Identities = 17/86 (19%), Positives = 36/86 (41%), Gaps = 13/86 (15%)
 Frame = -1

Query: 475 FLCRRPCHCHKQYLRCCYQPYLH-------HRFLCRRPCHCHKQYLHHCYQPYLHHC--- 326
           + C   C C    +  C   ++H       H + C   C C    ++ C   ++H C   
Sbjct: 128 YTCVHVCICTYTRVYMCVYMHIHVYMCVYMHIYTCVHVCVCTYARVYMCVYAHMHVCTCV 187

Query: 325 --HIHHCYQPYLHHCS-LHFFLSCFL 257
             HI+ C   +++ C+ +H ++  ++
Sbjct: 188 CMHIYTCVHVHIYICTYIHMYIYTYI 213



>gb:DMU47849_1380788 Drosophila melanogaster Lozenge (lz) mRNA,
           complete cds.
          Length = 829

 Score = 33.5 bits (75), Expect = 3.7
 Identities = 14/32 (43%), Positives = 17/32 (53%)
 Frame = -1

Query: 373 HKQYLHHCYQPYLHHCHIHHCYQPYLHHCSLH 278
           H  +LHH Y PY HH H +H   P+  H   H
Sbjct: 108 HHHHLHHHYSPY-HHAHPYHPPHPHAPHHHHH 138



 Score = 32.7 bits (73), Expect = 6.3
 Identities = 18/49 (36%), Positives = 20/49 (40%)
 Frame = -1

Query: 334 HHCHIHHCYQPYLHHCSLHFFLSCFLPHPLGGNVKAHHF*YQQLLHPNY 188
           HH H+HH Y PY H    H       PHP   +   HH       HP Y
Sbjct: 108 HHHHLHHHYSPYHHAHPYH------PPHPHAPHHHHHH-------HPPY 143



>gb:CR749302_1180931 Homo sapiens mRNA; cDNA DKFZp779H1622 (from
           clone DKFZp779H1622).
          Length = 312

 Score = 33.5 bits (75), Expect = 3.7
 Identities = 20/59 (33%), Positives = 25/59 (42%), Gaps = 6/59 (10%)
 Frame = -1

Query: 379 HCHKQYLH----HCYQPYLHHCHIH--HCYQPYLHHCSLHFFLSCFLPHPLGGNVKAHH 221
           H HK + H    H + P+ HH H H  H   P+ HH   H        HP G +   HH
Sbjct: 137 HPHKHHSHEQHPHGHHPHAHHPHEHDTHRQHPHGHHPHGH--------HPHGHHPHGHH 187



 Score = 32.7 bits (73), Expect = 6.3
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 3/64 (4%)
 Frame = -1

Query: 454 HCHKQYLRCCYQPYLHHRF---LCRRPCHCHKQYLHHCYQPYLHHCHIHHCYQPYLHHCS 284
           H H+Q+    + P+ HH       R+  H H  + HH   P+ HH H HH   P+ HH  
Sbjct: 142 HSHEQHPHG-HHPHAHHPHEHDTHRQHPHGHHPHGHH---PHGHHPHGHH---PHGHHPH 194

Query: 283 LHFF 272
            H F
Sbjct: 195 CHDF 198



>gb:AE014298_1124947 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003446_1210129 Drosophila melanogaster
           chromosome X, section 30 of 74 of the complete
           sequence.>gb:AF217651_1252032 Drosophila melanogaster
           c11.1 gene, partial cds; lozenge (lz) and c12.1 genes,
           complete cds; and c12.2 gene, partial cds.
          Length = 826

 Score = 33.5 bits (75), Expect = 3.7
 Identities = 14/32 (43%), Positives = 17/32 (53%)
 Frame = -1

Query: 373 HKQYLHHCYQPYLHHCHIHHCYQPYLHHCSLH 278
           H  +LHH Y PY HH H +H   P+  H   H
Sbjct: 108 HHHHLHHHYSPY-HHAHPYHPPHPHAPHHHHH 138



 Score = 32.7 bits (73), Expect = 6.3
 Identities = 18/49 (36%), Positives = 20/49 (40%)
 Frame = -1

Query: 334 HHCHIHHCYQPYLHHCSLHFFLSCFLPHPLGGNVKAHHF*YQQLLHPNY 188
           HH H+HH Y PY H    H       PHP   +   HH       HP Y
Sbjct: 108 HHHHLHHHYSPYHHAHPYH------PPHPHAPHHHHHH-------HPPY 143



>sp|P04196|HRG_HUMAN Histidine-rich glycoprotein precursor
           (Histidine-proline rich glycoprotein)
           (HPRG).>pir|A01287|KGHUGH histidine-rich glycoprotein
           precursor - human>gb:AB005803_1863812 Homo sapiens DNA
           for histidine-rich glycoprotein, complete
           cds.>gb:BC069574_1988176 Homo sapiens histidine-rich
           glycoprotein, mRNA (cDNA clone MGC:97078 IMAGE:7262290),
           complete cds.>gb:HUMHRGA_2032177 Human histidine-rich
           glycoprotein mRNA, complete cds.
          Length = 525

 Score = 33.5 bits (75), Expect = 3.7
 Identities = 20/59 (33%), Positives = 25/59 (42%), Gaps = 6/59 (10%)
 Frame = -1

Query: 379 HCHKQYLH----HCYQPYLHHCHIH--HCYQPYLHHCSLHFFLSCFLPHPLGGNVKAHH 221
           H HK + H    H + P+ HH H H  H   P+ HH   H        HP G +   HH
Sbjct: 350 HPHKHHSHEQHPHGHHPHAHHPHEHDTHRQHPHGHHPHGH--------HPHGHHPHGHH 400



 Score = 32.7 bits (73), Expect = 6.3
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 3/64 (4%)
 Frame = -1

Query: 454 HCHKQYLRCCYQPYLHHRF---LCRRPCHCHKQYLHHCYQPYLHHCHIHHCYQPYLHHCS 284
           H H+Q+    + P+ HH       R+  H H  + HH   P+ HH H HH   P+ HH  
Sbjct: 355 HSHEQHPHG-HHPHAHHPHEHDTHRQHPHGHHPHGHH---PHGHHPHGHH---PHGHHPH 407

Query: 283 LHFF 272
            H F
Sbjct: 408 CHDF 411



>gb:CR382122_1654832 Kluyveromyces lactis strain NRRL Y-1140
           chromosome B of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 1036

 Score = 33.1 bits (74), Expect = 4.8
 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 1/42 (2%)
 Frame = +1

Query: 217 KSDEPLHSPLKGGEGN-MKGRNEGSSDEDMVGNNDEYDSDED 339
           K++    SP++G +GN  +   E   DED   +ND+ D+D+D
Sbjct: 78  KTEATEDSPIRGNQGNNQENSQENKDDEDDEDDNDDDDNDDD 119



>gb:CR380950_1649860 Candida glabrata strain CBS138 chromosome D
           complete sequence.
          Length = 919

 Score = 33.1 bits (74), Expect = 4.8
 Identities = 16/37 (43%), Positives = 26/37 (70%)
 Frame = +1

Query: 205 VVDTKSDEPLHSPLKGGEGNMKGRNEGSSDEDMVGNN 315
           V+D+K +EPL S   GGE N+   ++G+SD++  G+N
Sbjct: 350 VIDSKVEEPLTSA--GGEKNLFVEDDGNSDDEAKGSN 384



>gb:BC075450_2558553 Xenopus tropicalis HRG protein, mRNA (cDNA
           clone IMAGE:7017897), partial cds.>gb:BC089754_2566299
           Xenopus tropicalis cDNA clone IMAGE:7025331, partial
           cds.
          Length = 474

 Score = 32.7 bits (73), Expect = 6.3
 Identities = 16/51 (31%), Positives = 22/51 (43%)
 Frame = -1

Query: 454 HCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHHCYQP 302
           H HK      ++ + HH        H H    HH + P+ HH H HH + P
Sbjct: 308 HHHKHKHHPSHKGHKHH--------HHHHHPHHHGHPPHHHHHHHHHHHHP 350



>gb:AE014187_938830 Plasmodium falciparum 3D7 chromosome 14 complete
           sequence.>gb:AE014822_1227906 Plasmodium falciparum 3D7
           chromosome 14 section 7 of 13 of the complete sequence.
          Length = 876

 Score = 32.7 bits (73), Expect = 6.3
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 7/43 (16%)
 Frame = +1

Query: 247 KGGE-------GNMKGRNEGSSDEDMVGNNDEYDSDEDMVGNS 354
           KGGE       GNM   NE SSDE++  N D Y+++++  GNS
Sbjct: 122 KGGEDDNGLNNGNMLLSNEYSSDENIDDNGDVYENNDNGDGNS 164



>gb:AJ781003_2279196 Cacao swollen shoot virus complete genome.
          Length = 1868

 Score = 32.3 bits (72), Expect = 8.2
 Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 4/54 (7%)
 Frame = -1

Query: 379  HCHKQYLHHCYQPYLHHCHIHHCYQPYLH----HCSLHFFLSCFLPHPLGGNVK 230
            HC  Q+ H+     L H   H C QP       HC +    SCF+  P+  N++
Sbjct: 919  HCEHQWEHNKEITVLAHISCHFCKQPTNFKSRVHCPICKLTSCFMCSPIYCNIQ 972



>gb:AE008887_245623 Salmonella typhimurium LT2, section 191 of 220
           of the complete genome.>gb:AE006468_1002705 Salmonella
           typhimurium LT2, complete genome.
          Length = 292

 Score = 32.3 bits (72), Expect = 8.2
 Identities = 15/51 (29%), Positives = 21/51 (41%)
 Frame = -1

Query: 457 CHCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHHCYQ 305
           CH  K  +   YQ  L+      + CHC   Y H    P L+H     C++
Sbjct: 234 CHISKIKMGNLYQQRLNSPACQAKQCHCFLAYQHRLDIPLLNHLDASRCFR 284



>pir|AF0949|AF0949 hypothetical protein STY3869 [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)>gb:CP000026_78504 Salmonella enterica
           subsp. enterica serovar Paratypi A str. ATCC
           9150.>gb:AE016846_347568 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, section 13 of 16 of the
           complete genome.>gb:AL627279_543910 Salmonella enterica
           serovar Typhi (Salmonella typhi) strain CT18, complete
           chromosome; segment 15/20.>gb:AE014613_984900 Salmonella
           enterica subsp. enterica serovar Typhi Ty2, complete
           genome.
          Length = 292

 Score = 32.3 bits (72), Expect = 8.2
 Identities = 15/51 (29%), Positives = 21/51 (41%)
 Frame = -1

Query: 457 CHCHKQYLRCCYQPYLHHRFLCRRPCHCHKQYLHHCYQPYLHHCHIHHCYQ 305
           CH  K  +   YQ  L+      + CHC   Y H    P L+H     C++
Sbjct: 234 CHISKIKMGNLYQQRLNSPACQAKQCHCFLAYQHRLDIPLLNHLDASRCFR 284


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 660,103,215
Number of Sequences: 1806583
Number of extensions: 13573995
Number of successful extensions: 36836
Number of sequences better than 10.0: 40
Number of HSP's better than 10.0 without gapping: 31061
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 35290
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 40164081650
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)