BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig9477
         (786 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP004868_1846277 Oryza sativa (japonica cultivar-group) genom...   214   1e-54   
gb:AY087566_1572596 Arabidopsis thaliana clone 36702 mRNA, compl...   210   2e-53   
gb:AK175903_1817891 Arabidopsis thaliana mRNA for putative LEA p...   210   3e-53   
pir|T08400|T08400 late embryonic abundant protein EMB8 homolog F...   210   3e-53   Arabidopsis thaliana [mouse-ear cress]
sp|Q40863|EMB8_PICGL|EMB8_PICGL Embryogenesis-associated protein EMB8.>pir|...   192   6e-48   Picea glauca
gb:AF429302_2065605 Mus musculus lung alpha/beta hydrolase fold ...    80   3e-14   
gb:BC086351_2109542 Rattus norvegicus abhydrolase domain contain...    79   1e-13   
gb:BC081676_2562465 Danio rerio zgc:92800, mRNA (cDNA clone MGC:...    79   1e-13   
gb:BC021196_1977411 Homo sapiens abhydrolase domain containing 3...    76   8e-13   
gb:AF007152_1876054 Homo sapiens clone 23649 and 23755 unknown m...    76   8e-13   
gb:AY060941_1292745 Drosophila melanogaster GM08242 full length ...    74   3e-12   
gb:AE013599_1130790 Drosophila melanogaster chromosome 2R, compl...    73   5e-12   
gb:AF189764_2058438 Mus musculus alpha/beta hydrolase-1 mRNA, co...    73   7e-12   
gb:BC046710_2549699 Xenopus laevis abhydrolase domain containing...    72   1e-11   
gb:AY033290_1934611 Homo sapiens lung alpha/beta hydrolase prote...    71   3e-11   
gb:AP003235_1825905 Oryza sativa (japonica cultivar-group) genom...    66   8e-10   
gb:AB024032_1515773 Arabidopsis thaliana genomic DNA, chromosome...    65   2e-09   
gb:AC105769_1738206 Oryza sativa (japonica cultivar-group) chrom...    64   3e-09   
gb:AE016816_1746839 Ashbya gossypii (= Eremothecium gossypii) AT...    63   7e-09   
gb:CR382124_1656594 Kluyveromyces lactis strain NRRL Y-1140 chro...    63   7e-09   
gb:CR382128_1661125 Yarrowia lipolytica chromosome B of strain C...    62   1e-08   
gb:NC65E11_1688662 Neurospora crassa DNA linkage group V Cosmid ...    60   6e-08   
gb:AE004969_61369 Neisseria gonorrhoeae FA 1090, complete genome.      60   6e-08   
gb:BC078041_2560680 Xenopus laevis ABHD3 protein, mRNA (cDNA clo...    58   2e-07   
gb:CNS07EGE_1373677 chromosome VII of strain GB-M1 of Encephalit...    58   2e-07   
pir|F81794|F81794 conserved hypothetical protein NMA2211 [import...    58   2e-07   Neisseria meningitidis serogroup A
pir|A81217|A81217 conserved hypothetical protein NMB0276 [import...    58   2e-07   Neisseria meningitidis serogroup B
gb:CR382135_1668085 Debaryomyces hansenii chromosome C of strain...    56   9e-07   
pir|F86467|F86467 hypothetical protein F7P12.5 - Arabidopsis tha...    55   1e-06   Arabidopsis thaliana [mouse-ear cress]
sp|Q03649|YM60_YEAST|YM60_YEAST Hypothetical UPF0017 protein YMR210w.>pir|S...    54   3e-06   Saccharomyces cerevisiae [brewer's yeast]
pir|T02712|T02712 similar to late embryogenesis abundant protein...    54   3e-06   Arabidopsis thaliana [mouse-ear cress]
gb:CR382125_1658305 Kluyveromyces lactis strain NRRL Y-1140 chro...    54   4e-06   
gb:CR380959_1653920 Candida glabrata strain CBS138 chromosome M ...    54   4e-06   
gb:CR380952_1650386 Candida glabrata strain CBS138 chromosome F ...    53   7e-06   
gb:BX571860_785258 Photorhabdus luminescens subsp. laumondii TTO...    52   1e-05   
gb:CR628336_111709 Legionella pneumophila str. Paris complete ge...    52   2e-05   
gb:CEY60A3A_1370787 Caenorhabditis elegans YAC Y60A3A, complete ...    51   2e-05   
gb:BX321860_773617 Nitrosomonas europaea ATCC 19718, complete ge...    51   2e-05   
gb:BC047183_2549847 Danio rerio abhydrolase domain containing 2,...    51   3e-05   
gb:BT020727_1436085 Bos taurus abhydrolase domain containing 2 (...    50   6e-05   
gb:AE017354_459990 Legionella pneumophila subsp. pneumophila str...    50   6e-05   
gb:BC089477_2110841 Mus musculus cDNA clone MGC:107122 IMAGE:674...    49   1e-04   
gb:AF201730_2058878 Mus musculus alpha/beta hydrolase-2 fold pro...    49   1e-04   
gb:BC019248_1976765 Homo sapiens abhydrolase domain containing 2...    49   1e-04   
gb:AK008690_1154736 Mus musculus adult male stomach cDNA, RIKEN ...    49   1e-04   
sp|Q02891|YP95_YEAST|YP95_YEAST Hypothetical UPF0017 protein YPL095c.>pir|S...    49   1e-04   Saccharomyces cerevisiae [brewer's yeast]
sp|P08910|LBH2_HUMAN|LBH2_HUMAN Abhydrolase domain containing protein 2 (Pr...    49   1e-04   Homo sapiens [man]
gb:AE017294_434140 Leptospira interrogans serovar Copenhageni st...    48   2e-04   
gb:CR628337_114603 Legionella pneumophila str. Lens complete gen...    48   2e-04   
gb:AE011368_272192 Leptospira interrogans serovar lai str. 56601...    48   2e-04   
gb:AE016815_1746431 Ashbya gossypii (= Eremothecium gossypii) AT...    47   3e-04   
pir|AH0022|AH0022 conserved hypothetical protein YPO0180 [import...    47   3e-04   Yersinia pestis
sp|Q18610|YYC5_CAEEL|YYC5_CAEEL Hypothetical UPF0017 protein C44C1.5 in chr...    47   5e-04   Caenorhabditis elegans [roundworm]
gb:AB012577_1511864 Saccharomyces cerevisiae EHT1 gene for alcoh...    45   0.001   
gb:BA000031_708250 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    45   0.001   
sp|P38295|YB27_YEAST|YB27_YEAST Hypothetical UPF0017 protein YBR177c.>pir|S...    45   0.001   Saccharomyces cerevisiae [brewer's yeast]
gb:AY081700_1568960 Arabidopsis thaliana unknown protein (At5g49...    45   0.002   
gb:AE008859_245096 Salmonella typhimurium LT2, section 163 of 22...    44   0.003   
gb:CP000026_78027 Salmonella enterica subsp. enterica serovar Pa...    44   0.003   
gb:AL646060_545491 Ralstonia solanacearum GMI1000 chromosome, co...    44   0.003   
gb:CR378663_93713 Photobacterium profundum SS9; segment 1/12.          44   0.003   
pir|AB1823|AB1823 hypothetical protein alr0130 [imported] - Nost...    44   0.004   Nostoc sp. PCC 7120
gb:CR382139_1672550 Debaryomyces hansenii chromosome G of strain...    43   0.006   
gb:AL591136_2070538 Mouse DNA sequence from clone RP23-273P3 on ...    43   0.008   
gb:AK042032_1166184 Mus musculus 3 days neonate thymus cDNA, RIK...    43   0.008   
gb:BA000039_726124 Thermosynechococcus elongatus BP-1 DNA, compl...    43   0.008   
gb:AE016767_328104 Escherichia coli CFT073 section 13 of 18 of t...    43   0.008   
pir|D91154|D91154 hypothetical protein ECs4204 [imported] - Esch...    43   0.008   Escherichia coli O157:H7
sp|P45524|YHET_ECOLI|YHET_ECOLI Hypothetical UPF0017 protein yheT.>pir|D651...    43   0.008   Escherichia coli [E. coli]
gb:AE017316_440478 Desulfovibrio vulgaris subsp. vulgaris str. H...    42   0.013   
gb:BX950851_842794 Erwinia carotovora subsp. atroseptica SCRI104...    41   0.022   
gb:BA000037_723873 Vibrio vulnificus YJ016 DNA, chromosome I, co...    41   0.029   
gb:AE016992_373790 Shigella flexneri 2a str. 2457T section 15 of...    41   0.029   
gb:AE016801_336028 Vibrio vulnificus CMCP6 chromosome I section ...    41   0.029   
gb:AE005674_72956 Shigella flexneri 2a str. 301, complete genome.      41   0.029   
gb:BA000045_743872 Gloeobacter violaceus PCC 7421 DNA, complete ...    40   0.038   
gb:BC012476_1973634 Homo sapiens hypothetical protein LOC116236,...    40   0.064   
gb:AE017351_1759276 Cryptococcus neoformans var. neoformans JEC2...    40   0.064   
gb:AX503748_1469678 Sequence 7 from Patent WO0229042.>gb:AY35821...    40   0.064   
gb:BX572093_796770 Prochlorococcus marinus MED4 complete genome;...    39   0.084   
gb:AK018696_1159694 Mus musculus 2 days neonate thymus thymic ce...    39   0.11    
gb:BX842649_824072 Bdellovibrio bacteriovorus complete genome, s...    39   0.14    
gb:AE015533_315295 Shewanella oneidensis MR-1 section 82 of 457 ...    39   0.14    
gb:AE016793_334496 Pseudomonas putida KT2440 section 20 of 21 of...    37   0.54    
pir|F83600|F83600 conserved hypothetical protein PA0368 [importe...    37   0.54    Pseudomonas aeruginosa
sp|P73879|Y264_SYNY3|Y264_SYNY3 Hypothetical UPF0017 protein slr0264.>pir|S...    37   0.54    Synechocystis sp.
gb:PSA251333_1701935 Pisum sativum aair gene for acetohydroxy ac...    36   0.93    
gb:AP008231_580636 Synechococcus elongatus PCC 6301 DNA, complet...    36   0.93    
sp|O82043|ILV5_PEA|ILV5_PEA Ketol-acid reductoisomerase, chloroplast prec...    36   0.93    Pisum sativum [garden pea]
gb:AF193866_487044 Alcanivorax borkumensis aldehyde dehydrogenas...    35   1.2     
gb:CR522870_99298 Desulfotalea psychrophila LSv54 chromosome.          35   1.2     
gb:BX294140_767462 Pirellula sp. strain 1 complete genome; segme...    35   2.1     
gb:CP000020_870392 Vibrio fischeri ES114 chromosome I, complete ...    33   6.0     
gb:MMU63386_2122852 Mus musculus nuclear transcriptional repress...    33   7.8     
gb:AP005419_1851478 Oryza sativa (japonica cultivar-group) genom...    33   7.8     
pir|I53172|I53172 RAE-28 - mouse>gb:S73882_2139192 rae-28=polyho...    33   7.8     Mus sp. [mice]
pir|G81544|G81544 conserved hypothetical protein CP0739 [importe...    33   7.8     Chlamydia pneumoniae
pir|G72126|G72126 ct338 hypothetical protein - Chlamydophila pne...    33   7.8     Chlamydia pneumoniae
sp|Q64028|PHC1_MOUSE|PHC1_MOUSE Polyhomeotic-like protein 1 (Early developm...    33   7.8     Mus musculus [mouse]


>gb:AP004868_1846277 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0048B08.
          Length = 469

 Score =  214 bits (545), Expect = 1e-54
 Identities = 102/149 (68%), Positives = 118/149 (79%)
 Frame = +2

Query: 2   FNIVYDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXX 181
           FN VYD+ALA AL  IFKKHALLFE + GEYNIP AANA++V++FDEG+TRVSFGFK   
Sbjct: 271 FNNVYDRALAKALRNIFKKHALLFEGLEGEYNIPKAANARSVRDFDEGLTRVSFGFKSVD 330

Query: 182 XXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWV 361
                      IK+V IPLLCIQA NDPIAPSRGIPR+DI+ NPNCLLIVTPQGGHLGWV
Sbjct: 331 DYYSNSSSSDSIKNVSIPLLCIQADNDPIAPSRGIPREDIKANPNCLLIVTPQGGHLGWV 390

Query: 362 AGSDAPTGAPWTDPIVMDFLDSLVQAKSA 448
           AG DAP G PWTDPI+M+FL+ +   K++
Sbjct: 391 AGEDAPFGCPWTDPIIMEFLEYVHNEKNS 419



>gb:AY087566_1572596 Arabidopsis thaliana clone 36702 mRNA, complete
           sequence.
          Length = 408

 Score =  210 bits (535), Expect = 2e-53
 Identities = 98/140 (70%), Positives = 114/140 (81%)
 Frame = +2

Query: 2   FNIVYDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXX 181
           FN VYDKAL+ +L +IF KH+LLFEDIGGE+NIPLAANA+TV++FD+G+TRVSFGFK   
Sbjct: 245 FNNVYDKALSKSLRRIFSKHSLLFEDIGGEFNIPLAANAETVRDFDDGLTRVSFGFKSVD 304

Query: 182 XXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWV 361
                      IK V IPLLCIQAANDPIAP RGIPR DI+ NPNC+LIVTP+GGHLGWV
Sbjct: 305 EYYSKSSSSKAIKHVRIPLLCIQAANDPIAPERGIPRDDIKSNPNCVLIVTPRGGHLGWV 364

Query: 362 AGSDAPTGAPWTDPIVMDFL 421
           AG +AP GAPWTD +VM+FL
Sbjct: 365 AGEEAPNGAPWTDQVVMEFL 384



>gb:AK175903_1817891 Arabidopsis thaliana mRNA for putative LEA
           protein, complete cds, clone: RAFL22-54-P03.
          Length = 408

 Score =  210 bits (534), Expect = 3e-53
 Identities = 98/140 (70%), Positives = 114/140 (81%)
 Frame = +2

Query: 2   FNIVYDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXX 181
           FN VYDKAL+ +L +IF KH+LLFEDIGGE+NIPLAANA+TV++FD+G+TRVSFGFK   
Sbjct: 245 FNNVYDKALSKSLRRIFSKHSLLFEDIGGEFNIPLAANAETVRDFDDGLTRVSFGFKSVD 304

Query: 182 XXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWV 361
                      IK V IPLLCIQAANDPIAP RGIPR DI+ NPNC+LIVTP+GGHLGWV
Sbjct: 305 EYYSKSSSSKAIKHVRIPLLCIQAANDPIAPERGIPRDDIKANPNCVLIVTPRGGHLGWV 364

Query: 362 AGSDAPTGAPWTDPIVMDFL 421
           AG +AP GAPWTD +VM+FL
Sbjct: 365 AGEEAPNGAPWTDQVVMEFL 384



>pir|T08400|T08400 late embryonic abundant protein EMB8 homolog
           F18B3.70 - Arabidopsis thaliana>gb:ATF18B3_1549083
           Arabidopsis thaliana DNA chromosome 3, BAC clone F18B3.
          Length = 408

 Score =  210 bits (534), Expect = 3e-53
 Identities = 98/140 (70%), Positives = 114/140 (81%)
 Frame = +2

Query: 2   FNIVYDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXX 181
           FN VYDKAL+ +L +IF KH+LLFEDIGGE+NIPLAANA+TV++FD+G+TRVSFGFK   
Sbjct: 245 FNNVYDKALSKSLRRIFSKHSLLFEDIGGEFNIPLAANAETVRDFDDGLTRVSFGFKSVD 304

Query: 182 XXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWV 361
                      IK V IPLLCIQAANDPIAP RGIPR DI+ NPNC+LIVTP+GGHLGWV
Sbjct: 305 EYYSKSSSSKAIKHVRIPLLCIQAANDPIAPERGIPRDDIKANPNCVLIVTPRGGHLGWV 364

Query: 362 AGSDAPTGAPWTDPIVMDFL 421
           AG +AP GAPWTD +VM+FL
Sbjct: 365 AGEEAPNGAPWTDQVVMEFL 384



>sp|Q40863|EMB8_PICGL Embryogenesis-associated protein
           EMB8.>pir|T09290|T09290 late embryonic abundant protein
           EMB8 - white spruce>gb:PIAEMB8R_1700291 Picea glauca
           late embryogenesis abundant protein (EMB8) mRNA,
           complete cds.
          Length = 457

 Score =  192 bits (488), Expect = 6e-48
 Identities = 92/143 (64%), Positives = 107/143 (74%)
 Frame = +2

Query: 2   FNIVYDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXX 181
           FN VYDKALA  L +IF KH  LFE I GEYNIP  A A++V++FD G+TRVSFGF+   
Sbjct: 275 FNNVYDKALARGLRQIFPKHTRLFEGIEGEYNIPTVAKARSVRDFDGGLTRVSFGFQSVG 334

Query: 182 XXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWV 361
                      IK V   LLCIQA+NDPIAPSRGIP +DI+ENPNCLL+VTP GGHLGWV
Sbjct: 335 DYYSNSSSSLSIKYVQTSLLCIQASNDPIAPSRGIPWEDIKENPNCLLVVTPNGGHLGWV 394

Query: 362 AGSDAPTGAPWTDPIVMDFLDSL 430
           AG DAP GAPWTDP+VM++L+ L
Sbjct: 395 AGDDAPFGAPWTDPLVMEYLEVL 417



>gb:AF429302_2065605 Mus musculus lung alpha/beta hydrolase fold
           protein 3 mRNA, complete cds.>gb:BC026770_2095535 Mus
           musculus abhydrolase domain containing 3, mRNA (cDNA
           clone MGC:30497 IMAGE:4234600), complete cds.
          Length = 411

 Score = 80.5 bits (197), Expect = 3e-14
 Identities = 42/143 (29%), Positives = 76/143 (53%)
 Frame = +2

Query: 8   IVYDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXXXX 187
           ++++  L   L    KKH  +F +   + ++     AK+++EFD+  T V FG++     
Sbjct: 265 LLFNYYLTTCLQSSVKKHRHMFVE---QIDMDQVMKAKSIREFDKRFTAVMFGYRTLDDY 321

Query: 188 XXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWVAG 367
                    +KSV IP+LC+ A +D  +PS  IP +  ++NPN  L++T  GGH+G++ G
Sbjct: 322 YTDASPNRRLKSVGIPVLCLNATDDVFSPSHAIPIETAKQNPNVALVLTAYGGHIGFLEG 381

Query: 368 SDAPTGAPWTDPIVMDFLDSLVQ 436
              P    + D +   F+ ++V+
Sbjct: 382 I-WPRQCTYMDRVFKQFVQAMVE 403



>gb:BC086351_2109542 Rattus norvegicus abhydrolase domain containing
           1 (predicted), mRNA (cDNA clone MGC:105659
           IMAGE:7302778), complete cds.
          Length = 412

 Score = 79.0 bits (193), Expect = 1e-13
 Identities = 32/121 (26%), Positives = 70/121 (57%)
 Frame = +2

Query: 5   NIVYDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXXX 184
           ++++++ L   LC++  ++    E +    ++  A  A+T+++ DE  T V+FG+K    
Sbjct: 255 SLLFNQPLTAGLCRLVARNRKSIEKV---LDVDFAIKARTIRQLDERYTSVAFGYKDCAA 311

Query: 185 XXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWVA 364
                     + ++C P+LC+ AA+DP +P + +P +  +++P   L++T +GGH+G++ 
Sbjct: 312 YYHASSPRTKVDAICTPVLCLNAADDPFSPVQALPLQAAQKSPYVALLITARGGHIGFLE 371

Query: 365 G 367
           G
Sbjct: 372 G 372



>gb:BC081676_2562465 Danio rerio zgc:92800, mRNA (cDNA clone
           MGC:92800 IMAGE:7088867), complete cds.
          Length = 412

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 37/119 (31%), Positives = 66/119 (55%)
 Frame = +2

Query: 11  VYDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXXXXX 190
           +++  L + L     +H  + E    +Y+I     AKT++EFDE  T + FG+       
Sbjct: 266 LFNSYLTSCLQASVDRHRTILEK---KYDIDHVMKAKTIREFDERFTSIMFGYPSNDDYY 322

Query: 191 XXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWVAG 367
                   +KSV +P+LC+ AA+D  +P+  IP + +++NP+  L++T  GGH+G++ G
Sbjct: 323 RDASPIHKVKSVQVPMLCLNAADDVFSPNHAIPVEAVKQNPSVALLITCHGGHIGFLEG 381



>gb:BC021196_1977411 Homo sapiens abhydrolase domain containing 3,
           mRNA (cDNA clone MGC:11259 IMAGE:3942164), complete cds.
          Length = 409

 Score = 75.9 bits (185), Expect = 8e-13
 Identities = 40/143 (27%), Positives = 75/143 (52%)
 Frame = +2

Query: 8   IVYDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXXXX 187
           ++++  L   L     KH  +F     + ++     AK+++EFD+  T V FG++     
Sbjct: 265 LLFNYYLTTCLQSSVNKHRHMFVK---QVDMDHVMKAKSIREFDKRFTSVMFGYQTIDDY 321

Query: 188 XXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWVAG 367
                    +KSV IP+LC+ + +D  +PS  IP +  ++NPN  L++T  GGH+G++ G
Sbjct: 322 YTDASPSPRLKSVGIPVLCLNSVDDVFSPSHAIPIETAKQNPNVALVLTSYGGHIGFLEG 381

Query: 368 SDAPTGAPWTDPIVMDFLDSLVQ 436
              P  + + D +   F+ ++V+
Sbjct: 382 I-WPRQSTYMDRVFKQFVQAMVE 403



>gb:AF007152_1876054 Homo sapiens clone 23649 and 23755 unknown
           mRNA, partial cds.
          Length = 442

 Score = 75.9 bits (185), Expect = 8e-13
 Identities = 40/143 (27%), Positives = 75/143 (52%)
 Frame = +2

Query: 8   IVYDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXXXX 187
           ++++  L   L     KH  +F     + ++     AK+++EFD+  T V FG++     
Sbjct: 298 LLFNYYLTTCLQSSVNKHRHMFVK---QVDMDHVMKAKSIREFDKRFTSVMFGYQTIDDY 354

Query: 188 XXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWVAG 367
                    +KSV IP+LC+ + +D  +PS  IP +  ++NPN  L++T  GGH+G++ G
Sbjct: 355 YTDASPSPRLKSVGIPVLCLNSVDDVFSPSHAIPIETAKQNPNVALVLTSYGGHIGFLEG 414

Query: 368 SDAPTGAPWTDPIVMDFLDSLVQ 436
              P  + + D +   F+ ++V+
Sbjct: 415 I-WPRQSTYMDRVFKQFVQAMVE 436



>gb:AY060941_1292745 Drosophila melanogaster GM08242 full length
           cDNA.
          Length = 525

 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 36/123 (29%), Positives = 61/123 (49%), Gaps = 2/123 (1%)
 Frame = +2

Query: 5   NIVYDKALANALCKIFKKHALLFEDI--GGEYNIPLAANAKTVKEFDEGITRVSFGFKXX 178
           N +  + LA +LC+  + H  ++ DI    + +I      KT+KEFD   T   FG+   
Sbjct: 331 NSLLGRHLAGSLCRTLRNHLDIYRDIYQDSDIDIQRILRCKTIKEFDAHFTAKQFGYAHV 390

Query: 179 XXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGW 358
                       +  + +PLLC+ AA+DP  P   IP K   +  +  +++T +GGH+G+
Sbjct: 391 NDYYSDATLHNKLDHISVPLLCLSAADDPFQPLDAIPIKAANQCTHVAIVITARGGHIGF 450

Query: 359 VAG 367
           + G
Sbjct: 451 LEG 453



>gb:AE013599_1130790 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003834_1226894 Drosophila melanogaster
           chromosome 2R, section 16 of 74 of the complete
           sequence.
          Length = 525

 Score = 73.2 bits (178), Expect = 5e-12
 Identities = 36/123 (29%), Positives = 61/123 (49%), Gaps = 2/123 (1%)
 Frame = +2

Query: 5   NIVYDKALANALCKIFKKHALLFEDI--GGEYNIPLAANAKTVKEFDEGITRVSFGFKXX 178
           N +  + LA +LC+  + H  ++ DI    + +I      KT+KEFD   T   FG+   
Sbjct: 331 NSLLGRHLAGSLCRTLRNHLDIYRDIYQDSDIDIQRILRCKTIKEFDALFTAKQFGYAHV 390

Query: 179 XXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGW 358
                       +  + +PLLC+ AA+DP  P   IP K   +  +  +++T +GGH+G+
Sbjct: 391 NDYYSDATLHNKLDHISVPLLCLSAADDPFQPLDAIPIKAANQCTHVAIVITARGGHIGF 450

Query: 359 VAG 367
           + G
Sbjct: 451 LEG 453



>gb:AF189764_2058438 Mus musculus alpha/beta hydrolase-1 mRNA,
           complete cds.>gb:BC013505_2091789 Mus musculus
           abhydrolase domain containing 1, mRNA (cDNA clone
           MGC:19172 IMAGE:4224364), complete cds.
          Length = 412

 Score = 72.8 bits (177), Expect = 7e-12
 Identities = 31/121 (25%), Positives = 67/121 (55%)
 Frame = +2

Query: 5   NIVYDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXXX 184
           ++++++ L   LC++  ++    E +    ++  A  A+T+++ DE  T V+FG+K    
Sbjct: 255 SLLFNQPLTAGLCRLVARNRKPIEKV---LDVDFAIKARTIRQLDERYTSVAFGYKDCAA 311

Query: 185 XXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWVA 364
                     + ++  P+LC+ AA+DP +P    P +  +++P   L++T +GGH+G++ 
Sbjct: 312 YYQAASPRTKVDAIHTPVLCLNAADDPFSPVHAFPLQAAQKSPYVALLITARGGHIGFLE 371

Query: 365 G 367
           G
Sbjct: 372 G 372



>gb:BC046710_2549699 Xenopus laevis abhydrolase domain containing 3,
           mRNA (cDNA clone MGC:53257 IMAGE:5569806), complete cds.
          Length = 411

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 38/150 (25%), Positives = 76/150 (50%)
 Frame = +2

Query: 8   IVYDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXXXX 187
           ++++ +L  +L +  ++H  +   IG   N+     +++++EFDE  T V +GF      
Sbjct: 246 LLFNYSLNKSLRRATEQHRHV---IGKAVNVDHILQSRSIREFDERYTSVVWGFPSCDDY 302

Query: 188 XXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWVAG 367
                    +  +  P+LC+ AA+DP +PS  IP      NP+  L++   GGH+G++ G
Sbjct: 303 YTQASPDFKLSHIRTPVLCLNAADDPFSPSAAIPVSKASSNPHVALLIPAHGGHIGFLEG 362

Query: 368 SDAPTGAPWTDPIVMDFLDSLVQAKSAVDL 457
              PT   + D +   F+ +++  +  ++L
Sbjct: 363 L-LPTHQRYMDRVFQQFVGAILDHRDELNL 391



>gb:AY033290_1934611 Homo sapiens lung alpha/beta hydrolase protein
           1 mRNA, complete cds.>gb:BC039576_1982571 Homo sapiens
           abhydrolase domain containing 1, transcript variant 1,
           mRNA (cDNA clone MGC:48700 IMAGE:5744853), complete cds.
          Length = 405

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 32/121 (26%), Positives = 69/121 (57%)
 Frame = +2

Query: 5   NIVYDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXXX 184
           ++++++ L   LC++ +++  + E +    +I     A+T+++FDE  T V+FG++    
Sbjct: 247 SLLFNQPLTAGLCQLVERNRKVIEKV---VDIDFVLQARTIRQFDERYTSVAFGYQDCVT 303

Query: 185 XXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWVA 364
                     I ++ IP+L + AA+DP +P   +P +  + +P   L++T +GGH+G++ 
Sbjct: 304 YYKAASPRTKIDAIRIPVLYLSAADDPFSPVCALPIQAAQHSPYVALLITARGGHIGFLE 363

Query: 365 G 367
           G
Sbjct: 364 G 364



>gb:AP003235_1825905 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0039A07.
          Length = 582

 Score = 65.9 bits (159), Expect = 8e-10
 Identities = 42/143 (29%), Positives = 65/143 (45%)
 Frame = +2

Query: 14  YDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXXXXXX 193
           YDKALA  L    K H  +   +     I     +++++EFD   T +   ++       
Sbjct: 281 YDKALAFGLKGYAKLHEPVLVRLANWEGIK---KSRSIREFDHHATCMVAKYETVDTYYR 337

Query: 194 XXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWVAGSD 373
                  + +V +PLLC+ A +DP+     IP  +   N N +L  TP GGHL +  G  
Sbjct: 338 RCSSASYVGNVSVPLLCVNALDDPLCTREAIPWDECRANKNIVLATTPNGGHLAFFQGLT 397

Query: 374 APTGAPWTDPIVMDFLDSLVQAK 442
           A  G  W    V +FL +L+ +K
Sbjct: 398 A--GRLWWVGAVSEFLFALLDSK 418



>gb:AB024032_1515773 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K9P8.
          Length = 537

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 40/146 (27%), Positives = 65/146 (44%)
 Frame = +2

Query: 11  VYDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXXXXX 190
           VYD+ L   L    + H  +   I     I     +++V+EFD   TR+   F+      
Sbjct: 275 VYDRMLTIGLQGYAQLHHSIISRIADWEGIK---KSRSVREFDNYATRLVAKFETTDTYY 331

Query: 191 XXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWVAGS 370
                   +++V +PLLCI A +DP+     IP  +   N N +L  T  GGHL +  G 
Sbjct: 332 RRSSSSQYVENVAVPLLCISALDDPVCTREAIPWDECRANKNIVLATTTHGGHLAYYEGL 391

Query: 371 DAPTGAPWTDPIVMDFLDSLVQAKSA 448
            A   + W   +V ++ + L+ +  A
Sbjct: 392 TA--SSMWWTRVVHEYFEVLLSSPFA 415



>gb:AC105769_1738206 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1301_G07, complete
           sequence.>gb:AC108502_1738519 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OJ1378_A04, complete
           sequence.
          Length = 581

 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 43/139 (30%), Positives = 62/139 (44%)
 Frame = +2

Query: 14  YDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXXXXXX 193
           YDKALA  L    K H  +   +    +I     +++++EFD   T V   ++       
Sbjct: 280 YDKALAIGLKGYAKLHQPVLARLANWEDI---RKSRSIREFDRHATCVVAKYETVDTFYR 336

Query: 194 XXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWVAGSD 373
                  I +V +PLLCI A +DP+     IP  +   N N +L   P GGHL +  G  
Sbjct: 337 RCSSANYISNVSVPLLCISALDDPLCTREAIPWDECRANKNIVLATAPNGGHLAFFQGLT 396

Query: 374 APTGAPWTDPIVMDFLDSL 430
           A  G  W    V +FL +L
Sbjct: 397 A--GKLWWVGAVSEFLLAL 413



>gb:AE016816_1746839 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome III, complete sequence.
          Length = 455

 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 28/80 (35%), Positives = 42/80 (52%)
 Frame = +2

Query: 119 KTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKD 298
           +T+++FD   T   FGF               +  V  PLL I A +DPI  S  +PR++
Sbjct: 311 QTIEDFDNEFTAKMFGFNTSYEYYRHASSVNRLPQVRTPLLAINALDDPIVGSEALPRRE 370

Query: 299 IEENPNCLLIVTPQGGHLGW 358
           +  NP  +L+ T +GGH+GW
Sbjct: 371 VAINPYVVLLETSKGGHIGW 390



>gb:CR382124_1656594 Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 440

 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 36/118 (30%), Positives = 55/118 (46%), Gaps = 3/118 (2%)
 Frame = +2

Query: 14  YDKALANALCKIFKKHALLFE---DIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXXX 184
           Y  ALA  L K+   H  + +   ++   Y   L    KTV+EFD   T   FGF     
Sbjct: 273 YTPALAKNLVKLTTSHLDVLKQNPEMARMYADHLH-EVKTVEEFDNFFTARMFGFNTSFE 331

Query: 185 XXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGW 358
                     +  +  PLL + A +DPI     +P ++++ NP  L++ T +GGH+GW
Sbjct: 332 YYRHGTSSNRLNKLRTPLLILNALDDPIVGCEALPYREVQSNPYTLMLTTTRGGHIGW 389



>gb:CR382128_1661125 Yarrowia lipolytica chromosome B of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 480

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 31/116 (26%), Positives = 55/116 (47%)
 Frame = +2

Query: 11  VYDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXXXXX 190
           +Y+  +A  L ++ + H  + +     Y+  L    K++ +FD   T   FGF       
Sbjct: 313 LYNPQMAKNLLRMLRNHREVMKR-NPIYDESLTKQVKSIVDFDNLFTAPMFGFDTATDYY 371

Query: 191 XXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGW 358
                   I ++ +P L + A +DP+AP   +P  +I+ NP  ++  T  GGH+GW
Sbjct: 372 RHGSSCNRIMNIRVPTLILHALDDPVAPGFQLPYHEIKRNPYTVMAATNHGGHIGW 427



>gb:NC65E11_1688662 Neurospora crassa DNA linkage group V Cosmid
           contig 65E11.
          Length = 352

 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 37/135 (27%), Positives = 63/135 (46%)
 Frame = +2

Query: 113 NAKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPR 292
           N   + EFD  +  V++G+               +  + IP + + AA+DPIA    IP 
Sbjct: 212 NITYLNEFDREVQTVTWGYPTEDAYYRDASSCDAVLGIRIPFMALSAADDPIAVEEAIPY 271

Query: 293 KDIEENPNCLLIVTPQGGHLGWVAGSDAPTGAPWTDPIVMDFLDSLVQAKSAVDLEVANG 472
           ++I++NP  +L +T  GGHL W        G  W    + +FL+     K A D+++ + 
Sbjct: 272 QEIKQNPYTVLCLTSLGGHLSWFELG----GGRWHTRPICNFLN-----KMAFDIDL-DA 321

Query: 473 SVTDATNTFTAVWAT 517
              DA + F + + T
Sbjct: 322 IKPDACDKFDSQFRT 336



>gb:AE004969_61369 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 319

 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 35/112 (31%), Positives = 47/112 (41%)
 Frame = +2

Query: 92  YNIPLAANAKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIA 271
           +    AA  KT+ EFD+  T    GF               +K V  PLL + AANDP  
Sbjct: 203 FQTAFAAGCKTLGEFDDRFTAPLHGFADRHDYYRQTSCKPLLKHVAKPLLLLNAANDPFL 262

Query: 272 PSRGIPRKDIEENPNCLLIVTPQGGHLGWVAGSDAPTGAPWTDPIVMDFLDS 427
           P   +PR D E +    L     GGH G+V+ +       W    V+ + DS
Sbjct: 263 PPEALPRAD-EASEAVTLFQPAHGGHAGFVSSTGGRLHLQWLPQTVLSYFDS 313



>gb:BC078041_2560680 Xenopus laevis ABHD3 protein, mRNA (cDNA clone
           IMAGE:5435385), partial cds.
          Length = 500

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 24/94 (25%), Positives = 50/94 (53%)
 Frame = +2

Query: 80  IGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAAN 259
           I  + ++     ++T++E+DE  T  ++ ++              +  +  P+LC+ + +
Sbjct: 378 ISQKVDVDHVLESQTLREYDERYTAPAYDYQSCDEYYRKASPDHRLGKIQTPVLCLCSLD 437

Query: 260 DPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWV 361
           DP +PS  IP  ++  NPN  L++T  GGH+G++
Sbjct: 438 DPFSPSDAIPLAEVSSNPNVALLITTHGGHIGFL 471



>gb:CNS07EGE_1373677 chromosome VII of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 372

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 30/136 (22%), Positives = 65/136 (47%)
 Frame = +2

Query: 14  YDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXXXXXX 193
           +++ LA    +   ++  +F+  G  Y++ +     +V++ D  +T   F  K       
Sbjct: 239 FNRLLAMNFVRYMSRNRDVFKSAG--YDVDVIKRCSSVQQIDMMVTTKIFDIKDVDEYYK 296

Query: 194 XXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWVAGSD 373
                  I+ + +P + +   +DPI P+  I ++    N N LL++  +GGHLG+++   
Sbjct: 297 NQSSVNYIEKISVPFIILNTYDDPIIPAFSIDKEICMRNKNVLLVIAHKGGHLGFLSNR- 355

Query: 374 APTGAPWTDPIVMDFL 421
             T   W + +++DF+
Sbjct: 356 --TDRTWAEDVLVDFV 369



>pir|F81794|F81794 conserved hypothetical protein NMA2211 [imported]
           - Neisseria meningitidis (strain Z2491 serogroup
           A)>gb:NMA7Z2491_155078 Neisseria meningitidis serogroup
           A strain Z2491 complete genome; segment 7/7.
          Length = 318

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 34/112 (30%), Positives = 46/112 (41%)
 Frame = +2

Query: 92  YNIPLAANAKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIA 271
           +    AA  KT+ EFD+  T    GF               +K V  PLL + A NDP  
Sbjct: 202 FQTAFAAGCKTLGEFDDRFTAPLHGFADRHDYYRQTSCKPLLKHVAKPLLLLNAVNDPFL 261

Query: 272 PSRGIPRKDIEENPNCLLIVTPQGGHLGWVAGSDAPTGAPWTDPIVMDFLDS 427
           P   +PR D E +    L     GGH+G+V  +       W    V+ + DS
Sbjct: 262 PPEALPRAD-EVSEAVTLFQPTHGGHVGFVGSTGGRLHLQWLPQTVLSYFDS 312



>pir|A81217|A81217 conserved hypothetical protein NMB0276 [imported]
           - Neisseria meningitidis (strain MC58 serogroup
           B)>gb:AE002384_45754 Neisseria meningitidis serogroup B
           strain MC58 section 26 of 206 of the complete
           genome.>gb:AE002098_895867 Neisseria meningitidis
           serogroup B strain MC58 complete genome.
          Length = 318

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 34/112 (30%), Positives = 47/112 (41%)
 Frame = +2

Query: 92  YNIPLAANAKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIA 271
           +    AA  KT+ EFD+  T    GF               +K V  PLL + A NDP  
Sbjct: 202 FQTAFAAGCKTLGEFDDRFTAPLHGFADRHDYYRQTSCKPLLKHVAKPLLLLNAVNDPFL 261

Query: 272 PSRGIPRKDIEENPNCLLIVTPQGGHLGWVAGSDAPTGAPWTDPIVMDFLDS 427
           P   +PR D E +    L     GGH+G+V+ +       W    V+ + DS
Sbjct: 262 PPEALPRAD-EVSEAVTLFQPAYGGHVGFVSSTGGRLHLQWLPQTVLSYFDS 312



>gb:CR382135_1668085 Debaryomyces hansenii chromosome C of strain
           CBS767 of Debaryomyces hansenii.
          Length = 460

 Score = 55.8 bits (133), Expect = 9e-07
 Identities = 27/79 (34%), Positives = 38/79 (48%)
 Frame = +2

Query: 122 TVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDI 301
           T+K FDE  T   FGF               +  V +PL+ + + +DPI   R +P  ++
Sbjct: 331 TLKAFDENFTSKLFGFNCADEYYRHASPIQRLLKVRVPLVIVNSIDDPIIGYRTLPFSEV 390

Query: 302 EENPNCLLIVTPQGGHLGW 358
             NP   L+ T  GGHLGW
Sbjct: 391 RLNPFTALVTTTTGGHLGW 409



>pir|F86467|F86467 hypothetical protein F7P12.5 - Arabidopsis
           thaliana>gb:AE005172_892234 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC023913_1539259 Arabidopsis thaliana
           chromosome 1 BAC F7P12 genomic sequence, complete
           sequence.>gb:F23M19_1677942 Arabidopsis thaliana
           chromosome 1 BAC F23M19 sequence, complete sequence.
          Length = 530

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 33/119 (27%), Positives = 52/119 (43%)
 Frame = +2

Query: 11  VYDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXXXXX 190
           +YDKAL   L    + H   F  +     I     ++++++FD   T +   F+      
Sbjct: 280 LYDKALTIGLQGYAQLHEPQFLRLANWEGIK---KSRSIRDFDNHATCLVGKFETVDTYY 336

Query: 191 XXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWVAG 367
                   + +V +PLLCI A +DP+     IP  +   N N +L  T  GGHL +  G
Sbjct: 337 RKSSSTQYVGNVAVPLLCISALDDPLCTKEAIPWDECRANKNIVLATTNHGGHLAFFEG 395



>sp|Q03649|YM60_YEAST Hypothetical UPF0017 protein
           YMR210w.>pir|S55092|S55092 hypothetical protein YMR210w
           - yeast (Saccharomyces cerevisiae)>gb:SC8261X_1705535
           S.cerevisiae chromosome XIII cosmid 8261.
          Length = 449

 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 33/118 (27%), Positives = 54/118 (45%), Gaps = 3/118 (2%)
 Frame = +2

Query: 14  YDKALANALCKIFKKHALLFEDIGGEYNIPLAANAK---TVKEFDEGITRVSFGFKXXXX 184
           Y  AL + L ++ + H    E+   ++   +  + K   TV++FD  +T   FG+K    
Sbjct: 280 YSPALGHNLLRMVRNHLSTLEE-NPDFKDVIEKHLKKIRTVRQFDNLLTGPMFGYKNAEE 338

Query: 185 XXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGW 358
                     I  +  P + + A +DPI     +P   I+ NP  LL+ T  GGH+GW
Sbjct: 339 YYKNASSYKRIPGIRTPFIALHAQDDPIVGG-DLPIDQIKSNPYTLLLETSTGGHVGW 395



>pir|T02712|T02712 similar to late embryogenesis abundant proteins
           [imported] - Arabidopsis thaliana>gb:AC005313_1532553
           Arabidopsis thaliana chromosome 2 clone T18E12 map
           CIC11A04, complete sequence.
          Length = 1805

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 44/154 (28%), Positives = 71/154 (46%), Gaps = 2/154 (1%)
 Frame = +2

Query: 17  DKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXXXXXXX 196
           D+ L   L +I   +  LF+     +++  A  +K+V+EFD+ ++ V++G +        
Sbjct: 326 DQQLTRGLVEILLANKELFQGRAKAFDVGKALCSKSVREFDKALSMVTYGCESIEDFYSS 385

Query: 197 XXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWVAGSDA 376
                 I  V +PLL IQ  ND + P   IPR  I ENP   L++     +L      D 
Sbjct: 386 CATREVIGEVKVPLLFIQ--NDDVVPPYTIPRSSIAENPFTSLLLCSSSPNL-----IDG 438

Query: 377 PTGA-PWTDPIV-MDFLDSLVQAKSAVDLEVANG 472
            T A  W   +  +DF    +Q  +AV+L +  G
Sbjct: 439 RTVAVSWCQDLAKIDFPMLAMQWLTAVELGLLKG 472



>gb:CR382125_1658305 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 449

 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 31/112 (27%), Positives = 51/112 (45%)
 Frame = +2

Query: 95  NIPLAANAKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAP 274
           N+  A       +FD+  T  + GF+              + ++ +P L I + +DP+  
Sbjct: 337 NLKKAKQFTDPSQFDDIFTAKAVGFEDSWSYYRVGSSINRLPTINVPTLVINSKDDPVIG 396

Query: 275 SRGIPRKDIEENPNCLLIVTPQGGHLGWVAGSDAPTGAPWTDPIVMDFLDSL 430
            + IP K+ EENP+ LLI T  GGHL ++  +       W    V  + D+L
Sbjct: 397 DKCIPVKEAEENPHVLLIETDLGGHLAYLEKNH----DSWATKQVAQYFDAL 444



>gb:CR380959_1653920 Candida glabrata strain CBS138 chromosome M
           complete sequence.
          Length = 453

 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 27/89 (30%), Positives = 43/89 (48%)
 Frame = +2

Query: 95  NIPLAANAKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAP 274
           N+  A   KT+ +FD   T    GFK              + ++ IPLL I A +DP+  
Sbjct: 341 NLQKAFKFKTIADFDSTYTAPCLGFKSAMDYYKSASSINRLPNIKIPLLSINARDDPVVG 400

Query: 275 SRGIPRKDIEENPNCLLIVTPQGGHLGWV 361
             G+P   +++NP+ +   T  GGHL ++
Sbjct: 401 PEGVPFDLMKQNPHVVHCETDIGGHLAYL 429



>gb:CR380952_1650386 Candida glabrata strain CBS138 chromosome F
           complete sequence.
          Length = 443

 Score = 52.8 bits (125), Expect = 7e-06
 Identities = 38/159 (23%), Positives = 65/159 (40%), Gaps = 8/159 (5%)
 Frame = +2

Query: 11  VYDKALANALCKIFKKHALLFEDIGGEYNIPL-----AANAKTVKEFDEGITRVSFGFKX 175
           VY   L   L ++ K H    E++       +     AAN K+V  FD+  T   FG++ 
Sbjct: 271 VYSPKLTQNLLRLVKSHE---EELTKNEKFRIKYESYAANLKSVTRFDDLFTGPMFGYRD 327

Query: 176 XXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLG 355
                        +  +  P + I +A+DPI   + +       NP   LI T  GGH+ 
Sbjct: 328 AEDYYQNSSSYKRLLGIRTPYIAINSADDPIVGYQALHENMFRANPYTTLIRTSIGGHIA 387

Query: 356 WVAGSDAPTGAPWTDP---IVMDFLDSLVQAKSAVDLEV 463
           W    D      +T+P   ++ D+   +V    A+++ +
Sbjct: 388 WF--KDMKGDRWYTEPACKLIADYHSKIVSQDHAINVNI 424



>gb:BX571860_785258 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 2/17.
          Length = 325

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 40/146 (27%), Positives = 67/146 (45%), Gaps = 1/146 (0%)
 Frame = +2

Query: 2   FNIVYDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXX 181
           F+ VY++ L N+L +   +  L +       N+      K ++EFDE +T    GFK   
Sbjct: 182 FSHVYERYLLNSLKRNATRKLLRYPG-SLPINLSQVKGLKHIREFDEIVTAKIHGFKNAA 240

Query: 182 XXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENP-NCLLIVTPQGGHLGW 358
                      +  + +PLL I A +DP      IP  D++  P N    +T  GGH+G+
Sbjct: 241 DYYHQCSALPRLPDITVPLLIIHAKDDPFMAPEVIP--DLKMLPKNIEYQMTEYGGHVGF 298

Query: 359 VAGSDAPTGAPWTDPIVMDFLDSLVQ 436
           V+GS       W +  + ++L S ++
Sbjct: 299 VSGS-LKKPQMWLEQRIPNWLSSYLE 323



>gb:CR628336_111709 Legionella pneumophila str. Paris complete
           genome.
          Length = 327

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 41/146 (28%), Positives = 64/146 (43%), Gaps = 6/146 (4%)
 Frame = +2

Query: 2   FNIVYDKALANALCKIFKKHALLFEDIGGEYNIPLAAN----AKTVKEFDEGITRVSFGF 169
           F+ +Y   L + L +IF K       +    N P + N     KT  +FDE IT    GF
Sbjct: 184 FSRLYQAYLLSRLRRIFLKK------LNHLNNSPFSKNDLLSLKTFWDFDEQITAPINGF 237

Query: 170 KXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGH 349
           K              +K++  P L I A +DP      IP  + E +    L ++  GGH
Sbjct: 238 KSAHEYYQKASSRQYLKNISTPTLIIHAQDDPFMTPDVIPTLE-ELSSQTTLELSEYGGH 296

Query: 350 LGWVAGSDAPTGAP--WTDPIVMDFL 421
           +G++AG+   +  P  W +  + +FL
Sbjct: 297 VGFIAGTGKSSSQPVYWLEQRIPEFL 322



>gb:CEY60A3A_1370787 Caenorhabditis elegans YAC Y60A3A, complete
           sequence.
          Length = 375

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 28/122 (22%), Positives = 56/122 (45%)
 Frame = +2

Query: 8   IVYDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXXXX 187
           ++++  +A  L  +   +  LF D+    N+     +KT++ FDE      FGFK     
Sbjct: 234 MLFNSFIAKNLTSLVSPYRHLFADLIDFDNV---CKSKTIRGFDENFIVPMFGFKDCAEY 290

Query: 188 XXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWVAG 367
                    +  + +P + + + +D  +P   IP  DI ++ + + I+T  GGH  ++  
Sbjct: 291 YTTASLATKVAKIKVPCVTLNSYDDYFSPIECIPTADIMQSDHVVGIITNHGGHTAFMES 350

Query: 368 SD 373
           +D
Sbjct: 351 AD 352



>gb:BX321860_773617 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 5/10.
          Length = 341

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 34/115 (29%), Positives = 51/115 (44%)
 Frame = +2

Query: 86  GEYNIPLAANAKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDP 265
           G  N    A  +++ EFD  +T    GF+              + SV +P L I A NDP
Sbjct: 221 GLLNARAVAACRSLYEFDNLVTAPLHGFRDTDDYWRQSSSKPWLGSVQVPTLLINARNDP 280

Query: 266 IAPSRGIPRKDIEENPNCLLIVTPQGGHLGWVAGSDAPTGAPWTDPIVMDFLDSL 430
             P   +P+K  E +    L    QGGH+G++ G+  P    W    +++F  SL
Sbjct: 281 FLPESVLPQKS-EVSSFVSLEFPQQGGHVGFIQGT-FPGKLDWLPQRIIEFFSSL 333



>gb:BC047183_2549847 Danio rerio abhydrolase domain containing 2,
           mRNA (cDNA clone MGC:55722 IMAGE:3816056), complete cds.
          Length = 432

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 34/147 (23%), Positives = 65/147 (44%), Gaps = 6/147 (4%)
 Frame = +2

Query: 14  YDKALANALCKIFKKHALLFEDIGGEY---NIPLAANAKTVKEFDEGITRVSFGFKXXXX 184
           Y+  +A+ + KI   H  +   +G +     +     A ++ + D+ I R   G      
Sbjct: 261 YNFLMADNMKKIILSHRGVLFGVGSKMVDSELSRLYTATSLMQIDDNIMRKFHGHNSLKE 320

Query: 185 XXXXXXXXXXIKSVCIPLLCIQAANDPIAPSR--GIPRKDIEENPNCLLIVTPQGGHLGW 358
                     I ++ +PLL + + +DP+  +    IPR   E+  N +  +T  GGHLG+
Sbjct: 321 YYEKESCVHYIHNINVPLLLVNSVDDPLVHNSLLTIPRTLAEKKENVVFALTLHGGHLGF 380

Query: 359 VAGSDA-PTGAPWTDPIVMDFLDSLVQ 436
             G+   P    W D +++D+  ++ Q
Sbjct: 381 FEGAVLFPQPLTWMDKVIVDYATAMCQ 407



>gb:BT020727_1436085 Bos taurus abhydrolase domain containing 2
           (ABHD2), mRNA, complete cds.
          Length = 425

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 26/110 (23%), Positives = 52/110 (47%), Gaps = 3/110 (2%)
 Frame = +2

Query: 116 AKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSR--GIP 289
           A ++ + D+ + R   G+               +  + +PL+ + AA+DP+       IP
Sbjct: 297 ATSLMQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHESLLAIP 356

Query: 290 RKDIEENPNCLLIVTPQGGHLGWVAGSDA-PTGAPWTDPIVMDFLDSLVQ 436
           +   E+  N + ++   GGHLG+  GS   P    W D +V+++ +++ Q
Sbjct: 357 KSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQ 406



>gb:AE017354_459990 Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1, complete genome.
          Length = 327

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 38/142 (26%), Positives = 62/142 (43%), Gaps = 2/142 (1%)
 Frame = +2

Query: 2   FNIVYDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXX 181
           F+ +Y   L + L +IF K      +    ++     + KT  +FDE IT    GFK   
Sbjct: 184 FSRLYQAYLLSRLRRIFLKKLNHLNN--SPFSKSDLLSLKTFWDFDERITAPINGFKNAH 241

Query: 182 XXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWV 361
                      +K++  P L I A +DP      IP    E +    L ++  GGH+G++
Sbjct: 242 EYYQKASSRQYLKNITTPTLIIHAQDDPFMTPDAIPASK-ELSSQTTLELSEYGGHVGFI 300

Query: 362 AGSDAPTGAP--WTDPIVMDFL 421
           AG+   +  P  W +  + +FL
Sbjct: 301 AGTGKNSSQPVYWLEQRIPEFL 322



>gb:BC089477_2110841 Mus musculus cDNA clone MGC:107122
           IMAGE:6741521, complete cds.
          Length = 425

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 26/110 (23%), Positives = 52/110 (47%), Gaps = 3/110 (2%)
 Frame = +2

Query: 116 AKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSR--GIP 289
           A ++ + D+ + R   G+               +  + +PL+ + AA+DP+       IP
Sbjct: 297 ATSLMQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHESLLTIP 356

Query: 290 RKDIEENPNCLLIVTPQGGHLGWVAGSDA-PTGAPWTDPIVMDFLDSLVQ 436
           +   E+  N + ++   GGHLG+  GS   P    W D +V+++ +++ Q
Sbjct: 357 KSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQ 406



>gb:AF201730_2058878 Mus musculus alpha/beta hydrolase-2 fold
           protein (LABH-2) mRNA, complete cds.>gb:AF546701_2067961
           Mus musculus a/b hydrolase II (Abhd2) mRNA, complete
           cds.>gb:BC027098_2095751 Mus musculus abhydrolase domain
           containing 2, mRNA (cDNA clone MGC:35944 IMAGE:5356667),
           complete cds.
          Length = 425

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 26/110 (23%), Positives = 52/110 (47%), Gaps = 3/110 (2%)
 Frame = +2

Query: 116 AKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSR--GIP 289
           A ++ + D+ + R   G+               +  + +PL+ + AA+DP+       IP
Sbjct: 297 ATSLMQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHESLLTIP 356

Query: 290 RKDIEENPNCLLIVTPQGGHLGWVAGSDA-PTGAPWTDPIVMDFLDSLVQ 436
           +   E+  N + ++   GGHLG+  GS   P    W D +V+++ +++ Q
Sbjct: 357 KSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQ 406



>gb:BC019248_1976765 Homo sapiens abhydrolase domain containing 2,
           transcript variant 1, mRNA (cDNA clone MGC:26249
           IMAGE:4826878), complete cds.
          Length = 425

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 26/110 (23%), Positives = 52/110 (47%), Gaps = 3/110 (2%)
 Frame = +2

Query: 116 AKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSR--GIP 289
           A ++ + D+ + R   G+               +  + +PL+ + AA+DP+       IP
Sbjct: 297 ATSLMQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHESLLTIP 356

Query: 290 RKDIEENPNCLLIVTPQGGHLGWVAGSDA-PTGAPWTDPIVMDFLDSLVQ 436
           +   E+  N + ++   GGHLG+  GS   P    W D +V+++ +++ Q
Sbjct: 357 KSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQ 406



>gb:AK008690_1154736 Mus musculus adult male stomach cDNA, RIKEN
           full-length enriched library, clone:2210009N18
           product:ALPHA/BETA HYDROLASE-2 FOLD PROTEIN, full insert
           sequence.
          Length = 425

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 26/110 (23%), Positives = 52/110 (47%), Gaps = 3/110 (2%)
 Frame = +2

Query: 116 AKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSR--GIP 289
           A ++ + D+ + R   G+               +  + +PL+ + AA+DP+       IP
Sbjct: 297 ATSLMQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHESLLTIP 356

Query: 290 RKDIEENPNCLLIVTPQGGHLGWVAGSDA-PTGAPWTDPIVMDFLDSLVQ 436
           +   E+  N + ++   GGHLG+  GS   P    W D +V+++ +++ Q
Sbjct: 357 KSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQ 406



>sp|Q02891|YP95_YEAST Hypothetical UPF0017 protein
           YPL095c.>pir|S61971|S61971 hypothetical protein YPL095c
           - yeast (Saccharomyces cerevisiae)>gb:AY692561_1622608
           Saccharomyces cerevisiae clone FLH113102.01X YPL095C
           gene, complete cds.>gb:SCU43281_1710317 Saccharomyces
           cerevisiae chromosome XVI cosmid 8059/8047.
          Length = 456

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 28/89 (31%), Positives = 37/89 (41%)
 Frame = +2

Query: 95  NIPLAANAKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAP 274
           N+  A     + EFD   T  S G                + ++ IP L I A +DP+  
Sbjct: 344 NLEKAEKFTDILEFDNLFTAPSMGLPDGLTYYRKASSINRLPNIKIPTLIINATDDPVTG 403

Query: 275 SRGIPRKDIEENPNCLLIVTPQGGHLGWV 361
              IP K   ENP  LL  T  GGHL ++
Sbjct: 404 ENVIPYKQARENPCVLLCETDLGGHLAYL 432



>sp|P08910|LBH2_HUMAN Abhydrolase domain containing protein 2
           (Protein PHPS1-2).>pir|A31026|A31026 probable membrane
           receptor protein - human>gb:AF546700_1906543 Homo
           sapiens androgen regulated a/b hydrolase II (ABHD2)
           mRNA, complete cds.>gb:BC090052_1990059 Homo sapiens
           abhydrolase domain containing 2, transcript variant 2,
           mRNA (cDNA clone MGC:111112 IMAGE:30388486), complete
           cds.>gb:HSHPS12_2014222 Human pHS1-2 mRNA with ORF
           homologous to membrane receptor proteins.
          Length = 425

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 26/110 (23%), Positives = 52/110 (47%), Gaps = 3/110 (2%)
 Frame = +2

Query: 116 AKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSR--GIP 289
           A ++ + D+ + R   G+               +  + +PL+ + AA+DP+       IP
Sbjct: 297 ATSLMQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHESLLTIP 356

Query: 290 RKDIEENPNCLLIVTPQGGHLGWVAGSDA-PTGAPWTDPIVMDFLDSLVQ 436
           +   E+  N + ++   GGHLG+  GS   P    W D +V+++ +++ Q
Sbjct: 357 KSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQ 406



>gb:AE017294_434140 Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130, chromosome I, section 8 of 14 of the
           complete sequence.>gb:AE016823_1067151 Leptospira
           interrogans serovar Copenhageni str. Fiocruz L1-130,
           chromosome I, complete sequence.
          Length = 336

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 29/113 (25%), Positives = 52/113 (46%), Gaps = 2/113 (1%)
 Frame = +2

Query: 107 AANAKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGI 286
           A   KT  EFD+ +T   FG+K              I  +    + I + +DP+ P    
Sbjct: 223 AFQTKTFYEFDDRVTAPFFGYKDAKEYYMDCSCVRYIPDIRHSGIIIHSEDDPVVPPFDW 282

Query: 287 PRKDIEENPNCLLIVTPQGGHLGWVAG--SDAPTGAPWTDPIVMDFLDSLVQA 439
            + +    P+   I++P+GGH+G++     + P G  W + I++D+ D  V +
Sbjct: 283 EKIEWNRLPHIRTILSPKGGHVGFLTNPTPEIPDGR-WLNKIILDYFDLKVDS 334



>gb:CR628337_114603 Legionella pneumophila str. Lens complete
           genome.
          Length = 327

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 39/142 (27%), Positives = 60/142 (42%), Gaps = 2/142 (1%)
 Frame = +2

Query: 2   FNIVYDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXX 181
           F+ +Y   L + L +IF K            N  L+   KT  +FDE IT    GFK   
Sbjct: 184 FSRLYQAYLLSRLRRIFLKKLNHLNSSPFSKNDLLSL--KTFWDFDERITAPINGFKNAH 241

Query: 182 XXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWV 361
                      +K++  P L I A +DP      IP    E +    L ++  GGH+G++
Sbjct: 242 EYYQKASSRQYLKNITTPTLIIHAQDDPFMTPDAIPTSK-ELSSQTTLELSKYGGHVGFI 300

Query: 362 AGSDAPTGAP--WTDPIVMDFL 421
           A +   +  P  W +  + +FL
Sbjct: 301 AATGKSSSQPVYWLEQRIPEFL 322



>gb:AE011368_272192 Leptospira interrogans serovar lai str. 56601
           chromosome I, section 177 of 397 of the complete
           sequence.>gb:AE010300_1005591 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete sequence.
          Length = 336

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 29/113 (25%), Positives = 52/113 (46%), Gaps = 2/113 (1%)
 Frame = +2

Query: 107 AANAKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGI 286
           A   KT  EFD+ +T   FG+K              I  +    + I + +DP+ P    
Sbjct: 223 AFQTKTFYEFDDRVTAPFFGYKDAKEYYMDCSCVRYIPDIRHSGIIIHSEDDPVVPPFDW 282

Query: 287 PRKDIEENPNCLLIVTPQGGHLGWVAG--SDAPTGAPWTDPIVMDFLDSLVQA 439
            + +    P+   I++P+GGH+G++     + P G  W + I++D+ D  V +
Sbjct: 283 EKIEWNRLPHIRTILSPKGGHVGFLTDPTPEIPDGR-WLNKIILDYFDLKVDS 334



>gb:AE016815_1746431 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome II, complete sequence.
          Length = 450

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 29/113 (25%), Positives = 48/113 (42%), Gaps = 1/113 (0%)
 Frame = +2

Query: 95  NIPLAANAKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAP 274
           N+  A+     ++FD   T  + GFK              +  + +P L I A +DP+  
Sbjct: 337 NLARASTMACTRDFDNFFTAPALGFKNANDYYKAASPVNIVGKIRVPTLLINALDDPMVG 396

Query: 275 SRG-IPRKDIEENPNCLLIVTPQGGHLGWVAGSDAPTGAPWTDPIVMDFLDSL 430
           + G +P + +  N + LL  T  GGHL ++         PW    V +FL  +
Sbjct: 397 AEGFLPIEKLRSNKHILLCTTDIGGHLAYL----DKNYTPWMAGRVAEFLSKM 445



>pir|AH0022|AH0022 conserved hypothetical protein YPO0180 [imported]
           - Yersinia pestis (strain CO92)>gb:AE014000_302247
           Yersinia pestis KIM section 400 of 415 of the complete
           genome.>gb:AE017127_386033 Yersinia pestis biovar
           Medievalis str. 91001 section 1 of 16 of the complete
           genome.>gb:AJ414141_522035 Yersinia pestis strain CO92
           complete genome; segment 1/20.>gb:BX936398_838367
           Yersinia pseudotuberculosis IP32953 genome, complete
           sequence.>gb:AE009952_932430 Yersinia pestis KIM
           complete genome.>gb:AE017042_1142599 Yersinia pestis
           biovar Medievalis str. 91001 complete genome.
          Length = 326

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 38/124 (30%), Positives = 55/124 (44%), Gaps = 1/124 (0%)
 Frame = +2

Query: 2   FNIVYDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXX 181
           F+ VY + L N L K+     LL        N+      + V++FD+ IT    GF    
Sbjct: 182 FSRVYQRYLLNQL-KLNATRKLLQYPNSLPVNLFQLKKLRRVRDFDDAITAKIHGFNDAG 240

Query: 182 XXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENP-NCLLIVTPQGGHLGW 358
                      +  + +PLL I A +DP   +  IP  +IE  P N    +T  GGH+G+
Sbjct: 241 DYYRRCSALPLLPQIRVPLLIIHAKDDPFMTAEVIP--NIETLPDNIDYQLTEHGGHVGF 298

Query: 359 VAGS 370
           V GS
Sbjct: 299 VGGS 302



>sp|Q18610|YYC5_CAEEL Hypothetical UPF0017 protein C44C1.5 in
           chromosome X.>pir|T29568|T29568 hypothetical protein
           C44C1.5 - Caenorhabditis elegans>gb:U41030_1403738
           Caenorhabditis elegans cosmid C44C1, complete sequence.
          Length = 375

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 27/122 (22%), Positives = 52/122 (42%)
 Frame = +2

Query: 8   IVYDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXXXX 187
           ++++  +A  L  + + +  LF+D+    +        TV+ FD       +GFK     
Sbjct: 234 LIFNSFIAKNLVDMVRPYRELFKDM---VDFDEVCRCNTVRGFDRSFVIPMYGFKSCDDY 290

Query: 188 XXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWVAG 367
                    +  + IP + + + +D  +P   IP  DI E+     I+T  GGH  ++  
Sbjct: 291 YRQATLATKVDKIKIPCVTLNSVDDYFSPVECIPTLDIMESDYVCGIITNHGGHTAFMES 350

Query: 368 SD 373
           +D
Sbjct: 351 AD 352



>gb:AB012577_1511864 Saccharomyces cerevisiae EHT1 gene for alcohol
           acyl transferase, complete cds.
          Length = 451

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 1/90 (1%)
 Frame = +2

Query: 95  NIPLAANAKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDP-IA 271
           N+  A + K+ +EFDE  T  + GF               + ++ +P L I + +DP + 
Sbjct: 340 NLIKAKSFKSTREFDEVYTAPALGFPNAMEYYKAASSINRVDTIRVPTLVINSRDDPVVG 399

Query: 272 PSRGIPRKDIEENPNCLLIVTPQGGHLGWV 361
           P +  P   +E+NP  L   T  GGHL ++
Sbjct: 400 PDQ--PYSIVEKNPRILYCRTDLGGHLAYL 427



>gb:BA000031_708250 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 1, complete sequence.
          Length = 335

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 34/124 (27%), Positives = 56/124 (45%), Gaps = 1/124 (0%)
 Frame = +2

Query: 2   FNIVYDKALANALCK-IFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXX 178
           F+ VY + L ++L +   +KH LL  ++   YN         + EFD+ IT    GFK  
Sbjct: 183 FSKVYRRYLLSSLKRNALQKHHLLHGELALSYNS--IKRVTRLYEFDDLITAPLHGFKDA 240

Query: 179 XXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGW 358
                       +  + +P L I A +DP      IP+  + +N +  L     GGH+G+
Sbjct: 241 QDYYDQCSGLSKLLQITLPTLIIHAKDDPFMTEEVIPKFVLPDNIDYRLF--EHGGHVGF 298

Query: 359 VAGS 370
           + G+
Sbjct: 299 LTGT 302



>sp|P38295|YB27_YEAST Hypothetical UPF0017 protein
           YBR177c.>pir|S46048|S46048 hypothetical protein YBR177c
           - yeast (Saccharomyces cerevisiae)>gb:SCYBR177C_1711416
           S.cerevisiae chromosome II reading frame ORF YBR177c.
          Length = 451

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 1/90 (1%)
 Frame = +2

Query: 95  NIPLAANAKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDP-IA 271
           N+  A + K+ +EFDE  T  + GF               + ++ +P L I + +DP + 
Sbjct: 340 NLIKAKSFKSTREFDEVYTAPALGFPNAMEYYKAASSINRVDTIRVPTLVINSRDDPVVG 399

Query: 272 PSRGIPRKDIEENPNCLLIVTPQGGHLGWV 361
           P +  P   +E+NP  L   T  GGHL ++
Sbjct: 400 PDQ--PYSIVEKNPRILYCRTDLGGHLAYL 427



>gb:AY081700_1568960 Arabidopsis thaliana unknown protein
           (At5g49950) mRNA, complete cds.>gb:AF370514_1792299
           Arabidopsis thaliana Unknown protein (K9P8.9) mRNA,
           complete cds.
          Length = 373

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 27/100 (27%), Positives = 43/100 (43%)
 Frame = +2

Query: 11  VYDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXXXXX 190
           VYD+ L   L    + H  +   I     I     +++V+EFD   TR+   F+      
Sbjct: 275 VYDRMLTIGLQGYAQLHHSIISRIADWEGIK---KSRSVREFDNYATRLVAKFETTDTYY 331

Query: 191 XXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEEN 310
                   +++V +PLLCI A +DP+     IP  +   N
Sbjct: 332 RRSSSSQYVENVAVPLLCISALDDPVCTREAIPWDECRAN 371



>gb:AE008859_245096 Salmonella typhimurium LT2, section 163 of 220
           of the complete genome.>gb:AE006468_1002178 Salmonella
           typhimurium LT2, complete genome.
          Length = 355

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 36/148 (24%), Positives = 61/148 (41%)
 Frame = +2

Query: 2   FNIVYDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXX 181
           F+ VY + L N L K      L         N+    + + ++EFD+ IT    GF    
Sbjct: 211 FSRVYQRYLLNLL-KANASRKLAAYPGSLPVNLAQLKSMRRIREFDDLITAKIHGFADAI 269

Query: 182 XXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWV 361
                      +  +  P L I A +DP      IP+ + +  P     +T  GGH+G++
Sbjct: 270 DYYRQCSAMPLLNQIAKPTLIIHAKDDPFMDHHVIPKAE-DLPPQVEYQLTEHGGHVGFI 328

Query: 362 AGSDAPTGAPWTDPIVMDFLDSLVQAKS 445
            G+       W +  + D+L + ++A S
Sbjct: 329 GGTPL-RPEMWLERRIPDWLTTYLEASS 355



>gb:CP000026_78027 Salmonella enterica subsp. enterica serovar
           Paratypi A str. ATCC 9150.
          Length = 358

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 36/148 (24%), Positives = 61/148 (41%)
 Frame = +2

Query: 2   FNIVYDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXX 181
           F+ VY + L N L K      L         N+    + + ++EFD+ IT    GF    
Sbjct: 214 FSRVYQRYLLNLL-KANASRKLAAYPGSLPVNLAQLKSMRRIREFDDLITAKIHGFADAI 272

Query: 182 XXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWV 361
                      +  +  P L I A +DP      IP+ + +  P     +T  GGH+G++
Sbjct: 273 DYYRQCSAMPLLNQIAKPTLIIHAKDDPFMDHHVIPKAE-DLPPQVEYQLTEHGGHVGFI 331

Query: 362 AGSDAPTGAPWTDPIVMDFLDSLVQAKS 445
            G+       W +  + D+L + ++A S
Sbjct: 332 GGTPL-RPEMWLERRIPDWLTTYLEASS 358



>gb:AL646060_545491 Ralstonia solanacearum GMI1000 chromosome,
           complete sequence; segment 4/19.
          Length = 371

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 30/124 (24%), Positives = 54/124 (43%)
 Frame = +2

Query: 2   FNIVYDKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXX 181
           F ++Y +     L +   K A   +   G Y+      A++  EFD  +T    G++   
Sbjct: 208 FGMLYTRMFLRTLKQ---KAAAKLDQHPGLYDRHAMLAARSFVEFDNLVTAPLHGYRNVY 264

Query: 182 XXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWV 361
                      ++ V +P+L + A NDP  P R +P    + +P+ +L     GGH+G++
Sbjct: 265 DYWTRASSKPVLRDVRVPVLVLNARNDPFLPGRHLPGPG-DVSPDVVLDQPLHGGHVGFL 323

Query: 362 AGSD 373
              D
Sbjct: 324 MRRD 327



>gb:CR378663_93713 Photobacterium profundum SS9; segment 1/12.
          Length = 320

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 27/80 (33%), Positives = 39/80 (48%)
 Frame = +2

Query: 131 EFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEEN 310
           +FDE +T    GFK              ++ V IPL  I A +DP      IP + +  +
Sbjct: 222 QFDELVTAPLHGFKDAADYYQQCSGIDKLQHVKIPLRIIHAKDDPFMTEAVIPVQPLPSH 281

Query: 311 PNCLLIVTPQGGHLGWVAGS 370
            +  L  TP GGH+G+V+GS
Sbjct: 282 VDYHL--TPNGGHVGFVSGS 299



>pir|AB1823|AB1823 hypothetical protein alr0130 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_681122 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 353

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 33/131 (25%), Positives = 50/131 (38%), Gaps = 3/131 (2%)
 Frame = +2

Query: 20  KALANALCKIFKKHALLFEDIG-GEYNIPLAANAKTVKEFDEGITRVSFGFKXXXXXXXX 196
           K L  ++ K  K  A    D   G  +      A T+ +FD  +     GF         
Sbjct: 206 KYLEQSIAKNLKNLAWRIHDYHPGTLDSEAIKRANTIWDFDNELVIKRLGFPSVETYYAA 265

Query: 197 XXXXXXIKSVCIPLLCIQAANDPIAPSRGIP--RKDIEENPNCLLIVTPQGGHLGWVAGS 370
                 +  +  P L I AA+DP+     +P  +   E NP   L++T  GGH+G++   
Sbjct: 266 SSPLQLLPEISKPSLIIYAADDPLFHPELVPELQATCESNPKIDLLMTRYGGHMGYLNSK 325

Query: 371 DAPTGAPWTDP 403
                A   DP
Sbjct: 326 KGQIQAQDADP 336



>gb:CR382139_1672550 Debaryomyces hansenii chromosome G of strain
           CBS767 of Debaryomyces hansenii.
          Length = 426

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 33/140 (23%), Positives = 58/140 (41%), Gaps = 4/140 (2%)
 Frame = +2

Query: 11  VYDKALANALCKIFKKHALLFE----DIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXX 178
           +++ AL + L K+ K +         ++  E N+          +FD   T  + G+   
Sbjct: 282 LFNPALTSFLNKLVKNNFTELNHHNPELFNEENLKRGMKQTKTWQFDSVYTCHTIGYSNP 341

Query: 179 XXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGW 358
                       I  +  P L + + +DP    R +P  ++E NP+  ++ T  GGHLG+
Sbjct: 342 FEYYRDASPVNRILKIHTPTLILNSTDDPAVGVR-LPWMEVENNPHLCMVETDLGGHLGY 400

Query: 359 VAGSDAPTGAPWTDPIVMDF 418
           V  S    G  W   +V +F
Sbjct: 401 VQSS----GKFWCVQLVEEF 416



>gb:AL591136_2070538 Mouse DNA sequence from clone RP23-273P3 on
           chromosome 11 Contains the 5' end of a novel gene, two
           novel genes, the Taok1 gene for TAO kinase 1, a
           eukaryotic translation initiation factor 2 subunit 1
           alpha (Eif2s1) pseudogene, a ribosomal protein S2 (Rps2)
           pseudogene, the Cryba1 gene for crystallin beta A1 and
           two CpG islands, complete sequence.
          Length = 459

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 19/76 (25%), Positives = 39/76 (51%), Gaps = 2/76 (2%)
 Frame = +2

Query: 215 IKSVCIPLLCIQAANDPIA--PSRGIPRKDIEENPNCLLIVTPQGGHLGWVAGSDAPTGA 388
           +    +P+LCI +A+DP+   P   +P +    NP   L+++  GGH G++     P   
Sbjct: 336 VDEAAVPVLCICSADDPVCGPPEHTLPAELFHSNPYFFLLLSHHGGHCGFLRPEPLPA-- 393

Query: 389 PWTDPIVMDFLDSLVQ 436
            W+  ++++   +L +
Sbjct: 394 -WSHEVILESFRALTE 408



>gb:AK042032_1166184 Mus musculus 3 days neonate thymus cDNA, RIKEN
           full-length enriched library, clone:A630053J01
           product:hypothetical alpha/beta-Hydrolases structure
           containing protein, full insert sequence.
          Length = 358

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 19/76 (25%), Positives = 39/76 (51%), Gaps = 2/76 (2%)
 Frame = +2

Query: 215 IKSVCIPLLCIQAANDPIA--PSRGIPRKDIEENPNCLLIVTPQGGHLGWVAGSDAPTGA 388
           +    +P+LCI +A+DP+   P   +P +    NP   L+++  GGH G++     P   
Sbjct: 235 VDEAAVPVLCICSADDPVCGPPEHTLPAELFHSNPYFFLLLSHHGGHCGFLRPEPLPA-- 292

Query: 389 PWTDPIVMDFLDSLVQ 436
            W+  ++++   +L +
Sbjct: 293 -WSHEVILESFRALTE 307



>gb:BA000039_726124 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 338

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 28/106 (26%), Positives = 44/106 (41%), Gaps = 2/106 (1%)
 Frame = +2

Query: 92  YNIPLAANAKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIA 271
           +++   A   T+  FD  +     GF               +  + IPL  + AA+DP+ 
Sbjct: 217 FDLNTVAKIDTIAGFDAALVIDRLGFSSVAEYYAASSPLPLLPQLRIPLWILYAADDPLF 276

Query: 272 PSRGIPR--KDIEENPNCLLIVTPQGGHLGWVAGSDAPTGAPWTDP 403
               +P      E NP   L+++ QGGH+G+   SD      W DP
Sbjct: 277 DPSLVPELLTIAEGNPALTLLLSEQGGHVGFT--SDRKCQRLWGDP 320



>gb:AE016767_328104 Escherichia coli CFT073 section 13 of 18 of the
           complete genome.>gb:AE014075_958688 Escherichia coli
           CFT073 complete genome.
          Length = 340

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 28/117 (23%), Positives = 52/117 (44%)
 Frame = +2

Query: 95  NIPLAANAKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAP 274
           N+    + + ++EFD+ IT    G+               +  +  P L I A +DP   
Sbjct: 225 NLTQLKSVRRIREFDDLITARIHGYADAIDYYRQCSAMPMLNRIAKPTLIIHAKDDPFMD 284

Query: 275 SRGIPRKDIEENPNCLLIVTPQGGHLGWVAGSDAPTGAPWTDPIVMDFLDSLVQAKS 445
            + IP+ +    P     +T  GGH+G++ G+       W +  + D+L + ++AKS
Sbjct: 285 HQVIPKPE-SLPPQVEYQLTEHGGHVGFIGGT-LLHPQMWLESRIPDWLTTYLEAKS 339



>pir|D91154|D91154 hypothetical protein ECs4204 [imported] -
           Escherichia coli  (strain O157:H7, substrain RIMD
           0509952)>pir|A86000|A86000 hypothetical protein yheT
           [imported] - Escherichia coli  (strain O157:H7,
           substrain EDL933)>gb:AE005174_68460 Escherichia coli
           O157:H7 EDL933, complete genome.>gb:BA000007_662216
           Escherichia coli O157:H7 DNA, complete genome.
          Length = 340

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 28/117 (23%), Positives = 52/117 (44%)
 Frame = +2

Query: 95  NIPLAANAKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAP 274
           N+    + + ++EFD+ IT    G+               +  +  P L I A +DP   
Sbjct: 225 NLAQLKSVRRIREFDDLITARIHGYADAIDYYRQCSAMPMLNRIAKPTLIIHAKDDPFMD 284

Query: 275 SRGIPRKDIEENPNCLLIVTPQGGHLGWVAGSDAPTGAPWTDPIVMDFLDSLVQAKS 445
            + IP+ +    P     +T  GGH+G++ G+       W +  + D+L + ++AKS
Sbjct: 285 HQVIPKPE-SLPPQVEYQLTEHGGHVGFIGGT-LLHPQMWLESRIPDWLTTYLEAKS 339



>sp|P45524|YHET_ECOLI Hypothetical UPF0017 protein
           yheT.>pir|D65129|D65129 hypothetical 38.5 kD protein in
           kifb-prkb intergenic region - Escherichia coli (strain
           K-12)>gb:ECOUW67_130910 Escherichia coli K-12
           chromosomal region from 67.4 to 76.0
           minutes.>gb:U00096_202353 Escherichia coli K-12 MG1655
           complete genome.
          Length = 340

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 28/117 (23%), Positives = 52/117 (44%)
 Frame = +2

Query: 95  NIPLAANAKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAP 274
           N+    + + ++EFD+ IT    G+               +  +  P L I A +DP   
Sbjct: 225 NLAQLKSVRRIREFDDLITARIHGYADAIDYYRQCSAMPMLNRIAKPTLIIHAKDDPFMD 284

Query: 275 SRGIPRKDIEENPNCLLIVTPQGGHLGWVAGSDAPTGAPWTDPIVMDFLDSLVQAKS 445
            + IP+ +    P     +T  GGH+G++ G+       W +  + D+L + ++AKS
Sbjct: 285 HQVIPKPE-SLPPQVEYQLTEHGGHVGFIGGT-LLHPQMWLESRIPDWLTTYLEAKS 339



>gb:AE017316_440478 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 8 of 12 of the complete
           genome.>gb:AE017285_1073639 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 325

 Score = 42.0 bits (97), Expect = 0.013
 Identities = 24/93 (25%), Positives = 38/93 (40%)
 Frame = +2

Query: 86  GEYNIPLAANAKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDP 265
           GE ++      +T +EFDE  T    GF               + ++ +P L + A +DP
Sbjct: 212 GEVDVSGLETMRTFREFDERFTAPLHGFSSALDYWTRASCAPHLAAIRVPTLVVNALDDP 271

Query: 266 IAPSRGIPRKDIEENPNCLLIVTPQGGHLGWVA 364
                  P  +   N    L V   GGH+G+V+
Sbjct: 272 FLSPSCFPWDEAVTNDALTLEVPLHGGHVGFVS 304



>gb:BX950851_842794 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 339

 Score = 41.2 bits (95), Expect = 0.022
 Identities = 27/92 (29%), Positives = 42/92 (45%), Gaps = 1/92 (1%)
 Frame = +2

Query: 98  IPLAANAKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPS 277
           +P     + ++EFD+ IT    GF+              +  +  PLL I A +DP    
Sbjct: 213 LPQLKRIRQLREFDDIITSRIHGFRDAADYYRRCSALPLLPHIRKPLLIIHAKDDPFMTP 272

Query: 278 RGIPRKDIEENP-NCLLIVTPQGGHLGWVAGS 370
             IP  D+ + P N    +T  GGH+G+V G+
Sbjct: 273 EVIP--DLSQLPSNIEYQLTEHGGHVGFVGGT 302



>gb:BA000037_723873 Vibrio vulnificus YJ016 DNA, chromosome I,
           complete sequence.
          Length = 325

 Score = 40.8 bits (94), Expect = 0.029
 Identities = 33/126 (26%), Positives = 59/126 (46%), Gaps = 3/126 (2%)
 Frame = +2

Query: 2   FNIVYDKALANALCK-IFKKHALLFEDIGGEYNIPLAANAKTVK--EFDEGITRVSFGFK 172
           F+ VY + L ++L +   +KH LL     GE ++   A  +  +  +FD+ IT    GF+
Sbjct: 183 FSRVYRRYLLSSLKRNALRKHHLL----AGELDLSYQAIKRVTRLYDFDDLITAPLHGFQ 238

Query: 173 XXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHL 352
                         ++ + IP   I A +DP      IP+  + +N +  L     GGH+
Sbjct: 239 DAADYYQQCSGLNKLRDIRIPTQIIHAKDDPFMTDAVIPKFVLPDNIDYRLF--DHGGHV 296

Query: 353 GWVAGS 370
           G+++G+
Sbjct: 297 GFLSGT 302



>gb:AE016992_373790 Shigella flexneri 2a str. 2457T section 15 of 16
           of the complete genome.>gb:AE014073_998540 Shigella
           flexneri 2a str. 2457T complete genome.
          Length = 340

 Score = 40.8 bits (94), Expect = 0.029
 Identities = 29/118 (24%), Positives = 54/118 (45%), Gaps = 1/118 (0%)
 Frame = +2

Query: 95  NIPLAANAKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAP 274
           N+    + + ++EFD+ IT    G+               +  +  P L I A +DP   
Sbjct: 225 NLAQLKSVRRIREFDDLITARIHGYADAIDYYRQCSAMPMLNRIAKPTLIIHAKDDPFMD 284

Query: 275 SRGIPRKDIEENPNCL-LIVTPQGGHLGWVAGSDAPTGAPWTDPIVMDFLDSLVQAKS 445
            + IP+   E  P+ +   +T  GGH+G++ G+       W +  + D+L + ++AKS
Sbjct: 285 HQVIPKP--ESLPSQVEYQLTEHGGHVGFIGGT-LLHPQMWLESRIPDWLTTYLEAKS 339



>gb:AE016801_336028 Vibrio vulnificus CMCP6 chromosome I section 5
           of 11 of the complete sequence.>gb:AE016795_1045752
           Vibrio vulnificus CMCP6 chromosome I complete sequence.
          Length = 325

 Score = 40.8 bits (94), Expect = 0.029
 Identities = 33/126 (26%), Positives = 59/126 (46%), Gaps = 3/126 (2%)
 Frame = +2

Query: 2   FNIVYDKALANALCK-IFKKHALLFEDIGGEYNIPLAANAKTVK--EFDEGITRVSFGFK 172
           F+ VY + L ++L +   +KH LL     GE ++   A  +  +  +FD+ IT    GF+
Sbjct: 183 FSRVYRRYLLSSLKRNALRKHHLL----AGELDLSYQAIKRVTRLYDFDDLITAPLHGFQ 238

Query: 173 XXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHL 352
                         ++ + IP   I A +DP      IP+  + +N +  L     GGH+
Sbjct: 239 DAADYYQQCSGLNKLRDIRIPTQIIHAKDDPFMTDAVIPKFVLPDNIDYRLF--DHGGHV 296

Query: 353 GWVAGS 370
           G+++G+
Sbjct: 297 GFLSGT 302



>gb:AE005674_72956 Shigella flexneri 2a str. 301, complete genome.
          Length = 340

 Score = 40.8 bits (94), Expect = 0.029
 Identities = 29/118 (24%), Positives = 54/118 (45%), Gaps = 1/118 (0%)
 Frame = +2

Query: 95  NIPLAANAKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAP 274
           N+    + + ++EFD+ IT    G+               +  +  P L I A +DP   
Sbjct: 225 NLAQLKSVRRIREFDDLITARIHGYADAIDYYRQCSAMPMLNRIAKPTLIIHAKDDPFMD 284

Query: 275 SRGIPRKDIEENPNCL-LIVTPQGGHLGWVAGSDAPTGAPWTDPIVMDFLDSLVQAKS 445
            + IP+   E  P+ +   +T  GGH+G++ G+       W +  + D+L + ++AKS
Sbjct: 285 HQVIPKP--ESLPSQVEYQLTEHGGHVGFIGGT-LLHPQMWLESRIPDWLTTYLEAKS 339



>gb:BA000045_743872 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 346

 Score = 40.4 bits (93), Expect = 0.038
 Identities = 24/108 (22%), Positives = 45/108 (41%), Gaps = 2/108 (1%)
 Frame = +2

Query: 125 VKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIE 304
           +++FD+ +    +GF               ++ + +P L I AA+DP+   R +   +  
Sbjct: 239 IRDFDDEMVIGYYGFASVEEYYRKTSGLYLLEELALPHLIIYAADDPMFDPRIVGELEQR 298

Query: 305 ENPN--CLLIVTPQGGHLGWVAGSDAPTGAPWTDPIVMDFLDSLVQAK 442
              N    L++T QGGH+  +          W     ++F D L  A+
Sbjct: 299 SAANRCARLVITAQGGHVAHIGRPSGEEDEFWALNRTLEFCDELTAAR 346



>gb:BC012476_1973634 Homo sapiens hypothetical protein LOC116236,
           mRNA (cDNA clone MGC:21749 IMAGE:4537124), complete cds.
          Length = 468

 Score = 39.7 bits (91), Expect = 0.064
 Identities = 18/76 (23%), Positives = 38/76 (50%), Gaps = 2/76 (2%)
 Frame = +2

Query: 215 IKSVCIPLLCIQAANDPIA--PSRGIPRKDIEENPNCLLIVTPQGGHLGWVAGSDAPTGA 388
           +    +P+LCI +A+DP+   P   +  +    NP   L+++  GGH G++     P   
Sbjct: 345 VDEAAVPVLCICSADDPVCGPPDHTLTTELFHSNPYFFLLLSRHGGHCGFLRQEPLPA-- 402

Query: 389 PWTDPIVMDFLDSLVQ 436
            W+  ++++   +L +
Sbjct: 403 -WSHEVILESFRALTE 417



>gb:AE017351_1759276 Cryptococcus neoformans var. neoformans JEC21
           chromosome 11, complete sequence.
          Length = 567

 Score = 39.7 bits (91), Expect = 0.064
 Identities = 17/51 (33%), Positives = 27/51 (52%)
 Frame = +2

Query: 215 IKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGWVAG 367
           +++V +PL  I A +DP+     +P  +   + +    VT  GGHLGW  G
Sbjct: 393 LRNVKVPLFAINAFDDPVVDGGALPLDEFVASSHIYTAVTGGGGHLGWFDG 443



>gb:AX503748_1469678 Sequence 7 from Patent
           WO0229042.>gb:AY358212_1947091 Homo sapiens clone
           DNA170281 PPWG6510 (UNQ6510) mRNA, complete cds.
          Length = 468

 Score = 39.7 bits (91), Expect = 0.064
 Identities = 18/76 (23%), Positives = 38/76 (50%), Gaps = 2/76 (2%)
 Frame = +2

Query: 215 IKSVCIPLLCIQAANDPIA--PSRGIPRKDIEENPNCLLIVTPQGGHLGWVAGSDAPTGA 388
           +    +P+LCI +A+DP+   P   +  +    NP   L+++  GGH G++     P   
Sbjct: 345 VDEAAVPVLCICSADDPVCGPPDHTLTTELFHSNPYFFLLLSRHGGHCGFLRQEPLPA-- 402

Query: 389 PWTDPIVMDFLDSLVQ 436
            W+  ++++   +L +
Sbjct: 403 -WSHEVILESFRALTE 417



>gb:BX572093_796770 Prochlorococcus marinus MED4 complete genome;
           segment 4/5.
          Length = 363

 Score = 39.3 bits (90), Expect = 0.084
 Identities = 40/152 (26%), Positives = 61/152 (40%), Gaps = 10/152 (6%)
 Frame = +2

Query: 5   NIVYDKALANALCKI----FKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFK 172
           N +Y K L   L +     FK   +LF        I      KT+ EFD   T  S+GFK
Sbjct: 220 NFLYQKWLMQRLKRQLWDGFKNEGILFPKSSLSKKIK---GLKTIGEFDANFTAPSWGFK 276

Query: 173 XXXXXXXXXXXXXXIKSV---CIPLLCIQAANDPIAP---SRGIPRKDIEENPNCLLIVT 334
                         I+++     P L I A +DP  P   +  +     E      +++T
Sbjct: 277 SLEDYYYQSSPIFRIQNLIKNLPPTLLIHAKDDPWVPYQSTLNLKNSLNESFDKLTILIT 336

Query: 335 PQGGHLGWVAGSDAPTGAPWTDPIVMDFLDSL 430
            +GGH G+ + +       W+D  V ++L SL
Sbjct: 337 NKGGHNGFHSNNGC-----WSDEAVKNWLLSL 363



>gb:AK018696_1159694 Mus musculus 2 days neonate thymus thymic cells
           cDNA, RIKEN full-length enriched library,
           clone:C920019P20 product:hypothetical
           alpha/beta-Hydrolases structure containing protein, full
           insert sequence.
          Length = 304

 Score = 38.9 bits (89), Expect = 0.11
 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 2/60 (3%)
 Frame = +2

Query: 215 IKSVCIPLLCIQAANDPIA--PSRGIPRKDIEENPNCLLIVTPQGGHLGWVAGSDAPTGA 388
           +    +P+LCI +A+DP+   P   +P +    NP   L+++  GGH G  A +    GA
Sbjct: 235 VDEAAVPVLCICSADDPVCGPPEHTLPAELFHSNPYFFLLLSHHGGHCGSCALNPCQHGA 294



>gb:BX842649_824072 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 4/11.
          Length = 334

 Score = 38.5 bits (88), Expect = 0.14
 Identities = 37/145 (25%), Positives = 58/145 (40%), Gaps = 2/145 (1%)
 Frame = +2

Query: 2   FNIVYDKALANALCKIFK-KHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXX 178
           FN VYD      L K+ + KH L    I  +Y IP  A   TV + D+  T  + GF   
Sbjct: 183 FNRVYDMRFVLRLRKLVEEKHRLGL--ITEKYEIPKWA---TVWDMDQIYTAPASGFASR 237

Query: 179 XXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCLLIVTPQGGHLGW 358
                       +  + +P   + +A+DP        R    ++    L +  +GGH+G+
Sbjct: 238 EDYYQRCSSIQYVSGIDVPTYTLTSADDPFVDVSDYLRAPFSKHVQ--LHIEKRGGHMGY 295

Query: 359 VAGSDAPTGAP-WTDPIVMDFLDSL 430
           +     P G   W D  + + L  L
Sbjct: 296 LHRQSLPVGGTRWLDYYLYEALRGL 320



>gb:AE015533_315295 Shewanella oneidensis MR-1 section 82 of 457 of
           the complete genome.>gb:AE014299_950892 Shewanella
           oneidensis MR-1 complete genome.
          Length = 327

 Score = 38.5 bits (88), Expect = 0.14
 Identities = 39/149 (26%), Positives = 59/149 (39%), Gaps = 9/149 (6%)
 Frame = +2

Query: 2   FNIVYDKALANALC-KIFKKHALLFEDIGGEYNIP--LAANAKTVKEFDEGITRVSFGFK 172
           F+ VY   L   L  K+ +K  L   D+ G  ++     AN  T  +FD+ +T    GF 
Sbjct: 179 FSTVYQSHLVKQLQHKVNQK--LTAPDLAGTMSLTPKQVANLNTFYDFDDKVTAPLHGFL 236

Query: 173 XXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPR-KDIEENPNCLLIVTPQGGH 349
                         +  +  P L + A +DP      IP    I E+    L     GGH
Sbjct: 237 GVEDYYTRASGLPYVNRITKPTLILHALDDPFMTDEVIPHPSQISEHVEYELHA--HGGH 294

Query: 350 LGWVAGSDAPTGAPW-----TDPIVMDFL 421
           +G++ G     G PW      +  ++DFL
Sbjct: 295 VGFIEG-----GTPWKPRYYLERRILDFL 318



>gb:AE016793_334496 Pseudomonas putida KT2440 section 20 of 21 of
           the complete genome.>gb:AE015451_949573 Pseudomonas
           putida KT2440 complete genome.
          Length = 330

 Score = 36.6 bits (83), Expect = 0.54
 Identities = 23/86 (26%), Positives = 37/86 (43%)
 Frame = +2

Query: 113 NAKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPR 292
           N +T  +FD  +T    GF+              +     P L I +++DP   S  +P 
Sbjct: 226 NLRTFWDFDGKVTAPLNGFRDAHDYYRRSSSHFFLGQNRTPTLIIHSSDDPFVSSHSLPT 285

Query: 293 KDIEENPNCLLIVTPQGGHLGWVAGS 370
              E +P     +  +GGH+G+V GS
Sbjct: 286 AR-ELSPQTRFELHDRGGHVGFVDGS 310



>pir|F83600|F83600 conserved hypothetical protein PA0368 [imported]
           - Pseudomonas aeruginosa (strain PAO1)>gb:AE004474_54603
           Pseudomonas aeruginosa PAO1, section 35 of 529 of the
           complete genome.>gb:AE004091_968703 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 332

 Score = 36.6 bits (83), Expect = 0.54
 Identities = 23/84 (27%), Positives = 38/84 (45%)
 Frame = +2

Query: 119 KTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKD 298
           +T  +FD  +T    GF               +  +  P L I +++DP   +R +P + 
Sbjct: 227 RTFWDFDGRVTAPLHGFADARDYYRRASSRYYLPDIRTPSLIIHSSDDPFVFARSLPDRS 286

Query: 299 IEENPNCLLIVTPQGGHLGWVAGS 370
            E  P   L +  +GGH+G+V GS
Sbjct: 287 -ELAPCTELELHARGGHVGFVDGS 309



>sp|P73879|Y264_SYNY3 Hypothetical UPF0017 protein
           slr0264.>pir|S75080|S75080 hypothetical protein slr0264
           - Synechocystis sp. (strain PCC 6803)>gb:BA000022_688721
           Synechocystis sp. PCC 6803 DNA, complete genome.
          Length = 369

 Score = 36.6 bits (83), Expect = 0.54
 Identities = 34/148 (22%), Positives = 57/148 (38%), Gaps = 12/148 (8%)
 Frame = +2

Query: 17  DKALANALCKIFKKHALLFEDIGGEYNIPLAANAKTVKEFDEGITRVSFGFKXXXXXXXX 196
           +KA+AN L ++  +   L     GE++      A T+  FD  +     G          
Sbjct: 225 EKAIANKLKELAWQ---LHRHHPGEFDSQAIERANTIWGFDHNLVIDRLGLASVEDYYEV 281

Query: 197 XXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENPNCL-------LIVTPQGGHLG 355
                 +  +  P L + AA+DP+          +EE P          L +TP+GGH+G
Sbjct: 282 SSALPLLSKIVKPTLLLYAADDPM-----FHPAIVEELPGLQNQLTGVDLQITPKGGHVG 336

Query: 356 WVAGSDAPTGA-----PWTDPIVMDFLD 424
           ++A       +      W     +D+LD
Sbjct: 337 YIANGPCQQASNDPDENWAIHRTLDWLD 364



>gb:PSA251333_1701935 Pisum sativum aair gene for acetohydroxy acid
           isomeroreductase, exons 1-9.
          Length = 581

 Score = 35.8 bits (81), Expect = 0.93
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 6/58 (10%)
 Frame = -1

Query: 507 TAVKVLVASVTLPFATSKSTADLACTRLS------RKSITMGSVQGAPVGASEPATHP 352
           TA+     ++  P A S +  +L+ ++LS      R+SIT+GS  GA   ++ PATHP
Sbjct: 10  TAISASSKTLAKPVAASFAPTNLSFSKLSPQSIRARRSITVGSALGATKVSAPPATHP 67



>gb:AP008231_580636 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 334

 Score = 35.8 bits (81), Expect = 0.93
 Identities = 24/93 (25%), Positives = 39/93 (41%), Gaps = 5/93 (5%)
 Frame = +2

Query: 110 ANAKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDP-----IAP 274
           A   T+++FD  +     GF+              +  + +P L + AA+DP     IAP
Sbjct: 224 AQVTTIQDFDNYLVAPRLGFQSSVDYYRASSPLPFLADLHVPGLVLYAADDPFFHPAIAP 283

Query: 275 SRGIPRKDIEENPNCLLIVTPQGGHLGWVAGSD 373
                    + NP   + +T  GGH+G+  G D
Sbjct: 284 ELA---AIAQRNPVLEIEITRHGGHVGYWQGRD 313



>sp|O82043|ILV5_PEA Ketol-acid reductoisomerase, chloroplast
           precursor (EC 1.1.1.86) (Acetohydroxy-acid
           reductoisomerase) (Alpha-keto-beta-hydroxylacil
           reductoisomerase).>pir|T06825|T06825 ketol-acid
           reductoisomerase (EC 1.1.1.86) - garden
           pea>gb:PSY17796_1702599 Pisum sativum mRNA for
           ketol-acid reductoisomerase.
          Length = 581

 Score = 35.8 bits (81), Expect = 0.93
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 6/58 (10%)
 Frame = -1

Query: 507 TAVKVLVASVTLPFATSKSTADLACTRLS------RKSITMGSVQGAPVGASEPATHP 352
           TA+     ++  P A S +  +L+ ++LS      R+SIT+GS  GA   ++ PATHP
Sbjct: 10  TAISASSKTLAKPVAASFAPTNLSFSKLSPQSIRARRSITVGSALGATKVSAPPATHP 67



>gb:AF193866_487044 Alcanivorax borkumensis aldehyde dehydrogenase
           (aldH) and PhaD (phaD) genes, complete cds; glyoxalase
           I-like protein (gloI) gene, partial cds; and unknown
           genes.
          Length = 334

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 20/76 (26%), Positives = 35/76 (46%)
 Frame = +2

Query: 134 FDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENP 313
           +D+ I    +GF+              +  +  P L +Q  +DP    + +PR++ E  P
Sbjct: 237 YDDQIIAPLYGFRSAWHYYAQCSAGPKLLQIRTPTLMLQNRDDPFMTPQTLPRQE-ELGP 295

Query: 314 NCLLIVTPQGGHLGWV 361
              L V+  GGH+G+V
Sbjct: 296 AVTLEVSDYGGHVGFV 311



>gb:CR522870_99298 Desulfotalea psychrophila LSv54 chromosome.
          Length = 330

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 25/103 (24%), Positives = 41/103 (39%)
 Frame = +2

Query: 119 KTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKD 298
           K  KEFD+  T    GFK              +  + +P + + + +DP       P + 
Sbjct: 218 KNFKEFDDCYTAPIHGFKNAEDYWQKCSCLPWLDKIKLPCMMVNSLDDPFLSKSCYPVEI 277

Query: 299 IEENPNCLLIVTPQGGHLGWVAGSDAPTGAPWTDPIVMDFLDS 427
             +     LI    GGH+G+VA +       W++ I   F+ S
Sbjct: 278 ARQTKQLHLIRPRYGGHVGFVALNREK--EYWSEAITKSFIRS 318



>gb:BX294140_767462 Pirellula sp. strain 1 complete genome; segment
           8/24.
          Length = 366

 Score = 34.7 bits (78), Expect = 2.1
 Identities = 23/107 (21%), Positives = 42/107 (39%)
 Frame = +2

Query: 113 NAKTVKEFDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPR 292
           +  +V E D+  T   FG+               ++S+  P L + A +DP+        
Sbjct: 264 SVSSVWELDDQFTAPRFGYDGAKDYYAENSAVDSMQSIRTPTLLLHAKDDPVVVPEVFEG 323

Query: 293 KDIEENPNCLLIVTPQGGHLGWVAGSDAPTGAPWTDPIVMDFLDSLV 433
            + E+N     ++   GGH G+   S       W +   + F DS++
Sbjct: 324 IEWEKNDALYPMLCESGGHTGFFDQS----RRRWHESATIAFFDSVL 366



>gb:CP000020_870392 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 322

 Score = 33.1 bits (74), Expect = 6.0
 Identities = 22/80 (27%), Positives = 34/80 (42%), Gaps = 1/80 (1%)
 Frame = +2

Query: 134 FDEGITRVSFGFKXXXXXXXXXXXXXXIKSVCIPLLCIQAANDPIAPSRGIPRKDIEENP 313
           FD  IT    G+               +  + IP   I + +DP   +  IP   +   P
Sbjct: 226 FDNLITAPMHGYAHAQDYYQQCSGLQFLDRIDIPTRIIHSKDDPFMTNAVIPTHPL---P 282

Query: 314 NCLLI-VTPQGGHLGWVAGS 370
           NC+   +T  GGH+G++ GS
Sbjct: 283 NCVHYQLTEHGGHVGFIDGS 302



>gb:MMU63386_2122852 Mus musculus nuclear transcriptional repressor
           Mph1 mRNA, complete cds.
          Length = 1012

 Score = 32.7 bits (73), Expect = 7.8
 Identities = 32/128 (25%), Positives = 59/128 (46%), Gaps = 5/128 (3%)
 Frame = +3

Query: 132 NLMKE*QEFHLDLSQRMIIIQTQVA-----QIQLKVSAFLYFASRLQMIQLLHQEESLER 296
           +L+++ Q+ HL   Q+ ++IQ Q+A     Q Q + S  L+ A+ LQ+ Q   Q++  ++
Sbjct: 378 SLIQQQQQIHLQ--QKQVVIQQQIAIHHQQQFQHRQSQLLHTATHLQLAQQQQQQQQQQQ 435

Query: 297 ILRKTQIVC**SHLKVAILDGWQVLMPQPELPGPTPL*WTS*TVLCKLNLLLIWRLRMGV 476
             ++ Q        +     G  +  PQP    PT     S +      L++   L+   
Sbjct: 436 QQQQQQ-------QQQQQQQGTTLTAPQPPQVPPTQQVPPSQSQQQAQTLVVQPMLQSSP 488

Query: 477 LQMPPTPS 500
           L +PP P+
Sbjct: 489 LTLPPEPT 496



>gb:AP005419_1851478 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0046G12.
          Length = 426

 Score = 32.7 bits (73), Expect = 7.8
 Identities = 16/45 (35%), Positives = 19/45 (42%)
 Frame = +1

Query: 373 CPNRSSLDRPHCDGLPRQSCAS*ICC*FGGCEWECYRCHQHLHGC 507
           C  + S    HC  LP+ SC    C    GC W C  C +   GC
Sbjct: 373 CEGQPSCCEGHCCSLPKPSCPECSC----GCVWSCKNCTE---GC 410



>pir|I53172|I53172 RAE-28 - mouse>gb:S73882_2139192
           rae-28=polyhomeotic protein homolog {clone Rae-2819}
           [mice, embryonal carcinoma F9 cells, mRNA, 3294 nt].
          Length = 1012

 Score = 32.7 bits (73), Expect = 7.8
 Identities = 32/128 (25%), Positives = 59/128 (46%), Gaps = 5/128 (3%)
 Frame = +3

Query: 132 NLMKE*QEFHLDLSQRMIIIQTQVA-----QIQLKVSAFLYFASRLQMIQLLHQEESLER 296
           +L+++ Q+ HL   Q+ ++IQ Q+A     Q Q + S  L+ A+ LQ+ Q   Q++  ++
Sbjct: 378 SLIQQQQQIHLQ--QKQVVIQQQIAYHHQQQFQHRQSQLLHTATHLQLAQQQQQQQQQQQ 435

Query: 297 ILRKTQIVC**SHLKVAILDGWQVLMPQPELPGPTPL*WTS*TVLCKLNLLLIWRLRMGV 476
             ++ Q        +     G  +  PQP    PT     S +      L++   L+   
Sbjct: 436 QQQQQQ-------QQQQQQQGTTLTAPQPPQVPPTQQVPPSQSQQQAQTLVVQPMLQSSP 488

Query: 477 LQMPPTPS 500
           L +PP P+
Sbjct: 489 LTLPPEPT 496



>pir|G81544|G81544 conserved hypothetical protein CP0739 [imported]
           - Chlamydophila pneumoniae (strain
           AR39)>gb:AE002232_44216 Chlamydophila pneumoniae AR39,
           section 60 of 94 of the complete
           genome.>gb:AE002161_886341 Chlamydophila pneumoniae
           AR39, complete genome.
          Length = 161

 Score = 32.7 bits (73), Expect = 7.8
 Identities = 18/43 (41%), Positives = 23/43 (53%)
 Frame = -2

Query: 380 LGHQNLPPIQDGHLEV*LSANNLGFPQYPFEGFLLMEQLDHLQ 252
           LGH  LPP+ D H E   S +N GF ++  EG   M  L  +Q
Sbjct: 22  LGHHRLPPLGDRHYEKFFSIHN-GFGKWEDEGIFPMRSLAKVQ 63



>pir|G72126|G72126 ct338 hypothetical protein - Chlamydophila
           pneumoniae  (strain CWL029)>pir|F86495|F86495 CT338
           hypothetical protein [imported] - Chlamydophila
           pneumoniae (strain J138)>gb:AE001589_36901 Chlamydia
           pneumoniae section 5 of 103 of the complete
           genome.>gb:AE017157_393385 Chlamydophila pneumoniae
           TW-183, section 1 of 4 of the complete
           genome.>gb:BA000008_663411 Chlamydophila pneumoniae J138
           genomic DNA, complete sequence.>gb:AE001363_941458
           Chlamydia pneumoniae, complete
           genome.>gb:AE009440_1027647 Chlamydophila pneumoniae
           TW-183, complete genome.
          Length = 265

 Score = 32.7 bits (73), Expect = 7.8
 Identities = 18/43 (41%), Positives = 23/43 (53%)
 Frame = -2

Query: 380 LGHQNLPPIQDGHLEV*LSANNLGFPQYPFEGFLLMEQLDHLQ 252
           LGH  LPP+ D H E   S +N GF ++  EG   M  L  +Q
Sbjct: 126 LGHHRLPPLGDRHYEKFFSIHN-GFGKWEDEGIFPMRSLAKVQ 167



>sp|Q64028|PHC1_MOUSE Polyhomeotic-like protein 1 (Early development
           regulator protein 1) (MPH1)
           (RAE-28).>gb:BC046535_2099279 Mus musculus
           polyhomeotic-like 1 (Drosophila), mRNA (cDNA clone
           MGC:51580 IMAGE:4935713), complete cds.
          Length = 1012

 Score = 32.7 bits (73), Expect = 7.8
 Identities = 32/128 (25%), Positives = 59/128 (46%), Gaps = 5/128 (3%)
 Frame = +3

Query: 132 NLMKE*QEFHLDLSQRMIIIQTQVA-----QIQLKVSAFLYFASRLQMIQLLHQEESLER 296
           +L+++ Q+ HL   Q+ ++IQ Q+A     Q Q + S  L+ A+ LQ+ Q   Q++  ++
Sbjct: 378 SLIQQQQQIHLQ--QKQVVIQQQIAIHHQQQFQHRQSQLLHTATHLQLAQQQQQQQQQQQ 435

Query: 297 ILRKTQIVC**SHLKVAILDGWQVLMPQPELPGPTPL*WTS*TVLCKLNLLLIWRLRMGV 476
             ++ Q        +     G  +  PQP    PT     S +      L++   L+   
Sbjct: 436 QQQQQQ-------QQQQQQQGTTLTAPQPPQVPPTQQVPPSQSQQQAQTLVVQPMLQSSP 488

Query: 477 LQMPPTPS 500
           L +PP P+
Sbjct: 489 LTLPPEPT 496


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 836,493,521
Number of Sequences: 1806583
Number of extensions: 18376221
Number of successful extensions: 43472
Number of sequences better than 10.0: 99
Number of HSP's better than 10.0 without gapping: 42037
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 43426
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 50250564011
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)