BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig9417
         (752 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY078955_1568110 Arabidopsis thaliana AT5g19580/T20D1_100 mRN...   166   4e-40   
gb:AE005173_894351 Arabidopsis thaliana chromosome 1, bottom arm...   161   1e-38   
gb:AP003335_1828143 Oryza sativa (japonica cultivar-group) genom...   154   2e-36   
gb:AC144735_1744120 Oryza sativa (japonica cultivar-group) chrom...   139   7e-32   
pir|T06758|T06758 probable galactose oxidase (EC 1.1.3.9) F15B8....   138   9e-32   Arabidopsis thaliana [mouse-ear cress]
gb:AE005173_895099 Arabidopsis thaliana chromosome 1, bottom arm...   129   6e-29   
pir|H86278|H86278 F14L17.20 protein - Arabidopsis thaliana>gb:AE...   125   8e-28   Arabidopsis thaliana [mouse-ear cress]
pir|T45935|T45935 probable galactose oxidase (EC 1.1.3.9) F5K20....   123   4e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AY058872_1564408 Arabidopsis thaliana At1g19900/F6F9_4 mRNA, ...   119   8e-26   
pir|D86332|D86332 hypothetical protein F6F9.4 [imported] - Arabi...   119   8e-26   Arabidopsis thaliana [mouse-ear cress]
gb:BFU557245_1632906 Botryotinia fuckeliana glyox1 gene for glyo...    87   2e-16   
gb:AX716727_1473711 Sequence 11 from Patent EP1293562.>gb:AX7201...    87   2e-16   
gb:AX716725_1473710 Sequence 9 from Patent EP1293562.>gb:AX72011...    87   2e-16   
gb:UMA550626_1726823 Ustilago maydis glo2 gene for Glyoxaloxidas...    84   2e-15   
gb:AX716721_1473708 Sequence 5 from Patent EP1293562.>gb:AX72011...    84   2e-15   
gb:BA000045_742246 Gloeobacter violaceus PCC 7421 DNA, complete ...    79   7e-14   
gb:BX842628_1643901 Neurospora crassa DNA linkage group I BAC cl...    76   6e-13   
gb:BA000045_744326 Gloeobacter violaceus PCC 7421 DNA, complete ...    71   2e-11   
gb:BX571965_790122 Burkholderia pseudomallei strain K96243, chro...    69   1e-10   
gb:BA000030_701178 Streptomyces avermitilis MA-4680 genomic DNA,...    69   1e-10   
gb:AX716717_1473706 Sequence 1 from Patent EP1293562.>gb:AX71671...    66   6e-10   
gb:AE017341_1754216 Cryptococcus neoformans var. neoformans JEC2...    65   2e-09   
gb:PHAGLX2G_1700056 Phanerochaete chrysosporium glyoxal oxidase ...    64   2e-09   
pir|A48296|A48296 glyoxal oxidase (EC 1.2.3.-) precursor - basid...    64   2e-09   Phanerochaete chrysosporium
gb:AE017346_1757395 Cryptococcus neoformans var. neoformans JEC2...    63   5e-09   
gb:UMA550627_1726824 Ustilago maydis glo3 gene for Glyoxaloxidas...    60   4e-08   
gb:AX716723_1473709 Sequence 7 from Patent EP1293562.>gb:AX72011...    60   4e-08   
gb:PHAPPEGO_1700086 Phanerochaete chrysosporium peroxidase-produ...    60   6e-08   
gb:AE017345_1757111 Cryptococcus neoformans var. neoformans JEC2...    59   9e-08   
gb:AY055804_587237 Stigmatella aurantiaca putative copper-depend...    59   9e-08   
gb:BA000030_703105 Streptomyces avermitilis MA-4680 genomic DNA,...    59   1e-07   
gb:BX571965_791493 Burkholderia pseudomallei strain K96243, chro...    55   1e-06   
gb:SCO939114_176511 Streptomyces coelicolor A3(2) complete genom...    55   2e-06   
pir|A38084|A38084 galactose oxidase (EC 1.1.3.9) precursor [vali...    54   4e-06   Hypomyces rosellus
sp|Q01745|GAOA_DACDE|GAOA_DACDE Galactose oxidase precursor (EC 1.1.3.9) (G...    54   4e-06   Hypomyces rosellus
pir|AB2004|AB2004 hypothetical protein alr1584 [imported] - Nost...    50   3e-05   Nostoc sp. PCC 7120
gb:NCB1D14_1689577 Neurospora crassa genomic DNA, BAC contig B1D14.    45   0.001   
gb:SAFBFA_169468 S.aurantiaca fbfA and fbfB genes.                     44   0.002   
gb:CP000010_865205 Burkholderia mallei ATCC 23344 chromosome 1, ...    40   0.045   
gb:BX571965_791845 Burkholderia pseudomallei strain K96243, chro...    40   0.045   
gb:CP000011_868848 Burkholderia mallei ATCC 23344 chromosome 2, ...    39   0.10    
gb:BX571966_794911 Burkholderia pseudomallei strain K96243, chro...    39   0.10    
gb:AE015821_318199 Shewanella oneidensis MR-1 section 370 of 457...    33   5.5     
gb:AF067611_1238006 Caenorhabditis elegans cosmid C45G7, complet...    33   7.2     
pir|T33135|T33135 hypothetical protein C45G7.5 - Caenorhabditis ...    33   7.2     Caenorhabditis elegans [roundworm]


>gb:AY078955_1568110 Arabidopsis thaliana AT5g19580/T20D1_100 mRNA,
           complete cds.>gb:BT001150_1635405 Arabidopsis thaliana
           At5g19580/T20D1_100 mRNA, complete cds.
          Length = 594

 Score =  166 bits (420), Expect = 4e-40
 Identities = 83/167 (49%), Positives = 111/167 (66%), Gaps = 5/167 (2%)
 Frame = -1

Query: 749 ELTPTKIARMYHSTSAVLPDAKILVAGSNTHVSYDMKAKYPTDMRVEKFSPPYLAPALQK 570
           +L PT I RMYHS++ +LPD K+LV GSNT+  Y    ++PT++RVEKFSPPYL PAL  
Sbjct: 427 QLKPTTIPRMYHSSAIILPDGKVLVGGSNTNDGYKYNVEFPTELRVEKFSPPYLDPALAN 486

Query: 569 FRPQIVEKLSQTELVYGKNFNIHFKL-DDAADMSSIKVTMYPPPFTTHGYFEGQRMLILG 393
            RP+IV   +  ++ YG+ FN+   L +  A   ++KVTM  P FTTH      RMLILG
Sbjct: 487 IRPKIVTTGTPKQVKYGQFFNVKVDLKEKGATKGNLKVTMLAPAFTTHSISMNMRMLILG 546

Query: 392 LTSV----AKDTISAVAPSSGKLAPPGYYLIFVVHRGVPSKGLWVHI 264
           + +V    A   I AVAP +G +APPGYYLIF +++GVPS G W+ +
Sbjct: 547 VNNVKPAGAGYDIQAVAPPNGNIAPPGYYLIFAIYKGVPSTGEWIQV 593



>gb:AE005173_894351 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC002130_1530097 Genomic sequence
           for Arabidopsis thaliana BAC F1N21 from chromosome I,
           complete sequence.>gb:BT002818_1636411 Arabidopsis
           thaliana clone RAFL15-05-K06 (R20207) putative glyoxal
           oxidase (glx1) (At1g67290) mRNA, complete
           cds.>gb:BT004443_1637515 Arabidopsis thaliana clone
           U20207 putative glyoxal oxidase (glx1) (At1g67290) mRNA,
           complete cds.
          Length = 615

 Score =  161 bits (407), Expect = 1e-38
 Identities = 80/168 (47%), Positives = 106/168 (63%), Gaps = 6/168 (3%)
 Frame = -1

Query: 749 ELTPTKIARMYHSTSAVLPDAKILVAGSNTHVSYDMKAKYPTDMRVEKFSPPYLAPALQK 570
           EL P+ I R+YHS +  LPD K+LV GSNT+  Y    +YPT++R+EKFSPPYL PAL  
Sbjct: 447 ELAPSTIPRVYHSIAIALPDGKVLVGGSNTNNGYQFNVEYPTELRIEKFSPPYLDPALAN 506

Query: 569 FRPQIVEKLSQTELVYGKNFNIHFKL-DDAADMSSIKVTMYPPPFTTHGYFEGQRMLILG 393
            RP+IV   +  ++ YG+ F++  +L        ++ VTM  P FTTH      R+L+LG
Sbjct: 507 MRPRIVNTATPKQIKYGQMFDVKIELKQQNVAKENVMVTMLAPSFTTHSVSMNMRLLMLG 566

Query: 392 LTSVA-----KDTISAVAPSSGKLAPPGYYLIFVVHRGVPSKGLWVHI 264
           + +V         I AVAP SGKLAPPGYYL+F V+ GVPS G W+ I
Sbjct: 567 INNVKNVGGDNHQIQAVAPPSGKLAPPGYYLLFAVYNGVPSVGEWIQI 614



>gb:AP003335_1828143 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1144G04.
          Length = 624

 Score =  154 bits (389), Expect = 2e-36
 Identities = 81/166 (48%), Positives = 106/166 (63%), Gaps = 7/166 (4%)
 Frame = -1

Query: 746 LTPTKIARMYHSTSAVLPDAKILVAGSNTHVSYDMK-AKYPTDMRVEKFSPPYLAPALQK 570
           L P+ I RMYHSTSA+LPDA +LVAGSNT+ +Y+     +PT++RVE+F+PPYL+P L  
Sbjct: 455 LNPSNIPRMYHSTSALLPDATVLVAGSNTNSAYNFSGVDFPTEVRVERFTPPYLSPQLSP 514

Query: 569 FRPQI-VEKLSQTELVYGKNFNIHFKLD-DAADMSSIKVTMYPPPFTTHGYFEGQRMLIL 396
            RP I    +    + YG  F   F            KVTMY PPFTTHGY   QR+LIL
Sbjct: 515 NRPAIDAASVPGDGMRYGARFTFRFTTPAQGVGQGDFKVTMYAPPFTTHGYSMNQRLLIL 574

Query: 395 GLTSVA----KDTISAVAPSSGKLAPPGYYLIFVVHRGVPSKGLWV 270
            +T+ A    + T++  AP   +LAPPGYY+++VV +GVPSK  WV
Sbjct: 575 PVTAFAAQGQRHTVTVDAPPKPELAPPGYYMVYVVAKGVPSKAAWV 620



>gb:AC144735_1744120 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0001A14, complete sequence.
          Length = 622

 Score =  139 bits (349), Expect = 7e-32
 Identities = 75/169 (44%), Positives = 104/169 (61%), Gaps = 7/169 (4%)
 Frame = -1

Query: 746 LTPTKIARMYHSTSAVLPDAKILVAGSNTHVSYDMK-AKYPTDMRVEKFSPPYLAPALQK 570
           L  + +ARMYHSTSAVLPDA +LVAG NT+ +Y+     +PT++RVE+F+PPYL+  L  
Sbjct: 454 LAASTVARMYHSTSAVLPDATVLVAGGNTNAAYNFSGVDFPTEVRVERFAPPYLSRELTG 513

Query: 569 FRPQI-VEKLSQTELVYGKNFNIHFKLDDAA-DMSSIKVTMYPPPFTTHGYFEGQRMLIL 396
            R  I V  +    + YG  F   F    AA +   ++VTMY PPFTTHGY   QR+L+L
Sbjct: 514 NRAVIDVASVPAGGMRYGTKFTFRFHTPVAAVEWGDVRVTMYAPPFTTHGYSMNQRLLVL 573

Query: 395 GLTSVAKD----TISAVAPSSGKLAPPGYYLIFVVHRGVPSKGLWVHIK 261
            +   +       ++   P   +LAPPGYYL++VV + VPS+  WV I+
Sbjct: 574 PVAGFSAQGQMYELTVDTPRKPELAPPGYYLVYVVSKDVPSEAAWVKIQ 622



>pir|T06758|T06758 probable galactose oxidase (EC 1.1.3.9) F15B8.190
           [similarity] - Arabidopsis thaliana>gb:ATF15B8_1548682
           Arabidopsis thaliana DNA chromosome 3, BAC clone F15B8.
          Length = 547

 Score =  138 bits (348), Expect = 9e-32
 Identities = 72/168 (42%), Positives = 104/168 (61%), Gaps = 7/168 (4%)
 Frame = -1

Query: 743 TPTKIARMYHSTSAVLPDAKILVAGSNTHVSYDM-KAKYPTDMRVEKFSPPYLAPALQKF 567
           TP++  RMYHS++ +LPD ++LV GSN HV Y+    +YPTD+ +E +SPPYL       
Sbjct: 382 TPSR-PRMYHSSAILLPDGRVLVGGSNPHVYYNFTNVEYPTDLSLEAYSPPYLFFTSDPI 440

Query: 566 RPQIVEKLSQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQRMLILGLT 387
           RP+I+   S   L Y + FN+ F +     +  + V +  P FTTH +   QRM+IL L 
Sbjct: 441 RPKIL-LTSDKVLSYKRLFNVDFSIAQFLTVDLLSVRIVAPSFTTHSFAMNQRMVILKLL 499

Query: 386 SVAKDT------ISAVAPSSGKLAPPGYYLIFVVHRGVPSKGLWVHIK 261
           SV +D       +SA+ PS+ ++APPGYY+IF+VH G+PS   WV I+
Sbjct: 500 SVTRDQLTNSYRVSALGPSTAEIAPPGYYMIFLVHAGIPSSAAWVQIE 547



>gb:AE005173_895099 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC006434_1534221 Genomic sequence
           for Arabidopsis thaliana BAC F10A5, complete sequence.
          Length = 547

 Score =  129 bits (324), Expect = 6e-29
 Identities = 71/167 (42%), Positives = 98/167 (58%), Gaps = 7/167 (4%)
 Frame = -1

Query: 740 PTKIARMYHSTSAVLPDAKILVAGSNTHVSYDMKAK-YPTDMRVEKFSPPYLAPALQKFR 564
           P+ I RMYHS + +L D +ILV GSN H  Y+     +PT++R+E FSP YL       R
Sbjct: 382 PSTIPRMYHSIATLLRDGRILVGGSNPHAFYNFTGVLFPTELRLEAFSPSYLDTKYSSLR 441

Query: 563 PQIVEKLSQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQRMLILGLTS 384
           P IV+   QT + YG+   + F +      S +KVTM  P FTTH +   QR+L+L    
Sbjct: 442 PSIVDPRPQTTVNYGRVLRLRFIVSGRVK-SPVKVTMLFPSFTTHSFSMHQRLLVLDHVI 500

Query: 383 VAKDTISAV------APSSGKLAPPGYYLIFVVHRGVPSKGLWVHIK 261
             K  IS +       PSS  LAPPGYY++FVV++ +PS+GLWV ++
Sbjct: 501 SFKLGISKIYEVRVRTPSSAILAPPGYYMVFVVNQDIPSEGLWVRLQ 547



>pir|H86278|H86278 F14L17.20 protein - Arabidopsis
           thaliana>gb:AE005172_890436 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F14L17_1677461 Sequence of BAC F14L17 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 564

 Score =  125 bits (314), Expect = 8e-28
 Identities = 67/169 (39%), Positives = 102/169 (60%), Gaps = 8/169 (4%)
 Frame = -1

Query: 746 LTPTKIARMYHSTSAVLPDAKILVAGSNTHVSYDMKAK-YPTDMRVEKFSPPYLAPALQK 570
           LTPT+I RMYHS S +L D ++LV GSN H +Y+  A+ YPT++ +E + P YL P   +
Sbjct: 397 LTPTRIPRMYHSASLLLSDGRVLVGGSNPHRNYNFTARPYPTELSLEAYLPRYLDPQYAR 456

Query: 569 FRPQIVEKLSQTELVYGKNFNIHFKLDDAADM--SSIKVTMYPPPFTTHGYFEGQRMLIL 396
            RP I+       ++YG+ F + F +  A  M    + V +  P F+TH     QR+L+L
Sbjct: 457 VRPTIITVELAGNMLYGQAFAVTFAI-PAFGMFDGGVSVRLVAPSFSTHSTAMNQRLLVL 515

Query: 395 GLTSVAKDTISAV-----APSSGKLAPPGYYLIFVVHRGVPSKGLWVHI 264
            +  V++ ++ A       P++  +APPGYY++FVVHRG+PS  +WV I
Sbjct: 516 RVRRVSQLSVFAYKADVDGPTNSYVAPPGYYMMFVVHRGIPSVAVWVKI 564



>pir|T45935|T45935 probable galactose oxidase (EC 1.1.3.9) F5K20.250
           [similarity] - Arabidopsis thaliana>gb:ATF5K20_1550799
           Arabidopsis thaliana DNA chromosome 3, BAC clone
           F5K20.>gb:AY054205_1563027 Arabidopsis thaliana
           AT3g53950/F5K20_250 mRNA, complete
           cds.>gb:BT002692_1636295 Arabidopsis thaliana
           At3g53950/F5K20_250 gene, complete
           cds.>gb:AK117130_1815177 Arabidopsis thaliana At3g53950
           mRNA for unknown protein, complete cds, clone:
           RAFL16-66-K19.
          Length = 545

 Score =  123 bits (308), Expect = 4e-27
 Identities = 65/166 (39%), Positives = 100/166 (60%), Gaps = 5/166 (3%)
 Frame = -1

Query: 746 LTPTKIARMYHSTSAVLPDAKILVAGSNTHVSYDMKAKYPTDMRVEKFSPPYLAPALQKF 567
           L P  + RMYHST+ +LPD +IL+AGSN H  Y   A++PT++R+E FSP YL+P     
Sbjct: 381 LNPGTVPRMYHSTANLLPDGRILLAGSNPHYFYKFNAEFPTELRIEAFSPEYLSPDRANL 440

Query: 566 RPQIVEKLSQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQRMLILGLT 387
           RP+I +++ Q  + YG+ F++ F       +  I++     PF TH + +GQR++ L + 
Sbjct: 441 RPEI-QEIPQI-IRYGEVFDV-FVTVPLPVVGIIQMNWGSAPFATHSFSQGQRLVKLTVA 497

Query: 386 -----SVAKDTISAVAPSSGKLAPPGYYLIFVVHRGVPSKGLWVHI 264
                 V +  I   AP +G ++PPGYY+ F V++GVPS   W+ I
Sbjct: 498 PSVPDGVGRYRIQCTAPPNGAVSPPGYYMAFAVNQGVPSIARWIRI 543



>gb:AY058872_1564408 Arabidopsis thaliana At1g19900/F6F9_4 mRNA,
           complete cds.
          Length = 548

 Score =  119 bits (297), Expect = 8e-26
 Identities = 66/169 (39%), Positives = 95/169 (56%), Gaps = 7/169 (4%)
 Frame = -1

Query: 746 LTPTKIARMYHSTSAVLPDAKILVAGSNTHVSYDMKAK-YPTDMRVEKFSPPYLAPALQK 570
           L PT I RMYHS + +L D ++LV GSN H  Y+     +PT++ +E FSP YL      
Sbjct: 381 LRPTTIPRMYHSAAILLRDGRVLVGGSNPHAFYNYTGVLFPTELSLEAFSPVYLQREFSN 440

Query: 569 FRPQIVEKLSQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQRMLILG- 393
            RP+I+    Q+ + YG N  + F +       + KVTM  P FTTH +   QR+L+L  
Sbjct: 441 LRPKIISPEPQSMIKYGTNLKLKFSVTGEVTTPA-KVTMVFPTFTTHSFAMNQRVLVLDN 499

Query: 392 --LTSVAKDTISAV---APSSGKLAPPGYYLIFVVHRGVPSKGLWVHIK 261
              T   K  +  V    P S  +A PGYY+IFVV++ +PS+G+WV ++
Sbjct: 500 VKFTRKGKSPMYEVQVRTPRSANIAWPGYYMIFVVNQDIPSEGVWVKLE 548



>pir|D86332|D86332 hypothetical protein F6F9.4 [imported] -
           Arabidopsis thaliana>gb:AE005172_890952 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC007797_1536218 Arabidopsis thaliana
           chromosome I BAC F6F9 genomic sequence, complete
           sequence.
          Length = 504

 Score =  119 bits (297), Expect = 8e-26
 Identities = 66/169 (39%), Positives = 95/169 (56%), Gaps = 7/169 (4%)
 Frame = -1

Query: 746 LTPTKIARMYHSTSAVLPDAKILVAGSNTHVSYDMKAK-YPTDMRVEKFSPPYLAPALQK 570
           L PT I RMYHS + +L D ++LV GSN H  Y+     +PT++ +E FSP YL      
Sbjct: 337 LRPTTIPRMYHSAAILLRDGRVLVGGSNPHAFYNYTGVLFPTELSLEAFSPVYLQREFSN 396

Query: 569 FRPQIVEKLSQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQRMLILG- 393
            RP+I+    Q+ + YG N  + F +       + KVTM  P FTTH +   QR+L+L  
Sbjct: 397 LRPKIISPEPQSMIKYGTNLKLKFSVTGEVTTPA-KVTMVFPTFTTHSFAMNQRVLVLDN 455

Query: 392 --LTSVAKDTISAV---APSSGKLAPPGYYLIFVVHRGVPSKGLWVHIK 261
              T   K  +  V    P S  +A PGYY+IFVV++ +PS+G+WV ++
Sbjct: 456 VKFTRKGKSPMYEVQVRTPRSANIAWPGYYMIFVVNQDIPSEGVWVKLE 504



>gb:BFU557245_1632906 Botryotinia fuckeliana glyox1 gene for glyoxal
           oxidase, exons 1-2.
          Length = 656

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 55/169 (32%), Positives = 85/169 (50%), Gaps = 8/169 (4%)
 Frame = -1

Query: 746 LTPTKIARMYHSTSAVLPDAKILVAGSNT----HVSYDMKAKYPTDMRVEKFSPPYLAPA 579
           L  + I R+YHS S +L D  ++VAGSN      +  D    Y T+ RVE + PPYL+  
Sbjct: 490 LATSTIPRLYHSVSLLLLDGTLMVAGSNPVEMPKLQPDAADPYVTEFRVENYVPPYLSGD 549

Query: 578 LQKFRPQIVEKLSQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQRMLI 399
             K RP  V+  S +    G   ++ F  D  A   ++ VT+Y   F TH    G RML 
Sbjct: 550 NAKKRPTNVKLSSGSFKADGSTLDVTF--DCPAGAKAVTVTLYHGGFVTHSVHMGHRMLH 607

Query: 398 LGLTS----VAKDTISAVAPSSGKLAPPGYYLIFVVHRGVPSKGLWVHI 264
           L  T       +  ++   P +  +APPG Y+++++  G+P+ G +V +
Sbjct: 608 LDNTGFVAGATQQKLTVTRPPNNNVAPPGPYVVYILVDGIPAMGQFVTV 656



>gb:AX716727_1473711 Sequence 11 from Patent
           EP1293562.>gb:AX720117_1473816 Sequence 11 from Patent
           WO03023028.
          Length = 656

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 55/169 (32%), Positives = 85/169 (50%), Gaps = 8/169 (4%)
 Frame = -1

Query: 746 LTPTKIARMYHSTSAVLPDAKILVAGSNT----HVSYDMKAKYPTDMRVEKFSPPYLAPA 579
           L  + I R+YHS S +L D  ++VAGSN      +  D    Y T+ RVE + PPYL+  
Sbjct: 490 LATSTIPRLYHSVSLLLLDGTLMVAGSNPVEMPKLQPDAADPYVTEFRVENYVPPYLSGD 549

Query: 578 LQKFRPQIVEKLSQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQRMLI 399
             K RP  V+  S +    G   ++ F  D  A   ++ VT+Y   F TH    G RML 
Sbjct: 550 NAKKRPTNVKLSSGSFKADGSTLDVTF--DCPAGAKAVTVTLYHGGFVTHSVHMGHRMLH 607

Query: 398 LGLTS----VAKDTISAVAPSSGKLAPPGYYLIFVVHRGVPSKGLWVHI 264
           L  T       +  ++   P +  +APPG Y+++++  G+P+ G +V +
Sbjct: 608 LDNTGFGAGATQQKLTVTRPPNNNVAPPGPYVVYILVDGIPAMGQFVTV 656



>gb:AX716725_1473710 Sequence 9 from Patent
           EP1293562.>gb:AX720115_1473815 Sequence 9 from Patent
           WO03023028.
          Length = 656

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 55/169 (32%), Positives = 85/169 (50%), Gaps = 8/169 (4%)
 Frame = -1

Query: 746 LTPTKIARMYHSTSAVLPDAKILVAGSNT----HVSYDMKAKYPTDMRVEKFSPPYLAPA 579
           L  + I R+YHS S +L D  ++VAGSN      +  D    Y T+ RVE + PPYL+  
Sbjct: 490 LATSTIPRLYHSVSLLLLDGTLMVAGSNPVEMPKLQPDAADPYVTEFRVENYVPPYLSGD 549

Query: 578 LQKFRPQIVEKLSQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQRMLI 399
             K RP  V+  S +    G   ++ F  D  A   ++ VT+Y   F TH    G RML 
Sbjct: 550 NAKKRPTNVKLSSGSFKADGSTLDVTF--DCPAGAKAVTVTLYHGGFVTHSVHMGHRMLH 607

Query: 398 LGLTS----VAKDTISAVAPSSGKLAPPGYYLIFVVHRGVPSKGLWVHI 264
           L  T       +  ++   P +  +APPG Y+++++  G+P+ G +V +
Sbjct: 608 LDNTGFGAGATQQKLTVTRPPNNNVAPPGPYVVYILVDGIPAMGQFVTV 656



>gb:UMA550626_1726823 Ustilago maydis glo2 gene for Glyoxaloxidase
           2.
          Length = 625

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 57/158 (36%), Positives = 81/158 (51%)
 Frame = -1

Query: 737 TKIARMYHSTSAVLPDAKILVAGSNTHVSYDMKAKYPTDMRVEKFSPPYLAPALQKFRPQ 558
           T I R+YHS++ +LPD+ ILVAGSN +   +   K+ T+ R+E++ P +      + RP 
Sbjct: 410 TNIGRLYHSSATLLPDSSILVAGSNPNADVNHHVKWKTEYRIERWYPDF----YDQPRPS 465

Query: 557 IVEKLSQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQRMLILGLTSVA 378
             + L  +    G+ F I  +L  AA     KV +    F+THG   GQRM+ L  T   
Sbjct: 466 -NDGLPSSFSYGGQGFTI--RLSSAAQAQKAKVVLIRTGFSTHGMNMGQRMIELKSTHRG 522

Query: 377 KDTISAVAPSSGKLAPPGYYLIFVVHRGVPSKGLWVHI 264
                A  P +  L  PG  L FVV  GVPS+G  V +
Sbjct: 523 SKLYVAQLPPNPNLFAPGPALAFVVVDGVPSQGKMVMV 560



>gb:AX716721_1473708 Sequence 5 from Patent
           EP1293562.>gb:AX720111_1473813 Sequence 5 from Patent
           WO03023028.
          Length = 537

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 57/158 (36%), Positives = 81/158 (51%)
 Frame = -1

Query: 737 TKIARMYHSTSAVLPDAKILVAGSNTHVSYDMKAKYPTDMRVEKFSPPYLAPALQKFRPQ 558
           T I R+YHS++ +LPD+ ILVAGSN +   +   K+ T+ R+E++ P +      + RP 
Sbjct: 322 TNIGRLYHSSATLLPDSSILVAGSNPNADVNHHVKWKTEYRIERWYPDF----YDQPRPS 377

Query: 557 IVEKLSQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQRMLILGLTSVA 378
             + L  +    G+ F I  +L  AA     KV +    F+THG   GQRM+ L  T   
Sbjct: 378 -NDGLPSSFSYGGQGFTI--RLSSAAQAQKAKVVLIRTGFSTHGMNMGQRMIELKSTHRG 434

Query: 377 KDTISAVAPSSGKLAPPGYYLIFVVHRGVPSKGLWVHI 264
                A  P +  L  PG  L FVV  GVPS+G  V +
Sbjct: 435 SKLYVAQLPPNPNLFAPGPALAFVVVDGVPSQGKMVMV 472



>gb:BA000045_742246 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 749

 Score = 79.3 bits (194), Expect = 7e-14
 Identities = 53/168 (31%), Positives = 87/168 (51%), Gaps = 1/168 (0%)
 Frame = -1

Query: 731 IARMYHSTSAVLPDAKILVAGSNTHVSYDMKAKYPTDMRVEKFSPPYLAPALQKFRPQIV 552
           +AR+YHS + +LPD +++ AGSN     +       ++R+E FSPPYL    +  RP ++
Sbjct: 378 VARLYHSIALLLPDGRVITAGSNPEREVE-------ELRLEVFSPPYL---FRGPRP-VI 426

Query: 551 EKLSQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQRMLILGLTSVAKD 372
           E ++Q+   +     +  K   A D+  I  ++  P   TH +   QR++ +  T     
Sbjct: 427 ESVAQS---WNYGNAVEIKTPQATDIRWI--SLIRPGTPTHAFDMDQRLVDVPFTLNTSG 481

Query: 371 TISAVAPSSGKLAPPGYYLIFVVHRG-VPSKGLWVHIK*NRIEDTGSL 231
            ++A  PS   LAPPG+Y++F+     VPS   WV +K +    T SL
Sbjct: 482 GLTATIPSEPNLAPPGWYMLFITDNDKVPSVAAWVQLKPSTSPTTFSL 529



>gb:BX842628_1643901 Neurospora crassa DNA linkage group I BAC clone
            B23L4.
          Length = 1105

 Score = 76.3 bits (186), Expect = 6e-13
 Identities = 53/163 (32%), Positives = 82/163 (50%)
 Frame = -1

Query: 752  TELTPTKIARMYHSTSAVLPDAKILVAGSNTHVSYDMKAKYPTDMRVEKFSPPYLAPALQ 573
            T +  T IARMYHS +  L D +++++GS+        A  P + RVE F PPYL     
Sbjct: 933  TVMANTTIARMYHSEAITLLDGRVMISGSDPQ-----DAVNPEEYRVEVFVPPYLLNG-- 985

Query: 572  KFRPQIVEKLSQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQRMLILG 393
              +P+    L+  +  + +   I F L  AA   +I VT+     +THG   G R ++  
Sbjct: 986  --KPRPTFTLANRDWDWNQK-TIPFTLGAAARNGAITVTLLGSVSSTHGNSMGARTIMPN 1042

Query: 392  LTSVAKDTISAVAPSSGKLAPPGYYLIFVVHRGVPSKGLWVHI 264
            +      + +  AP +   APPG+Y  FV+  GVP+ G++V I
Sbjct: 1043 VQCTGT-SCTVDAPPNAHTAPPGWYQFFVLDGGVPAVGVYVRI 1084



>gb:BA000045_744326 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 761

 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 55/156 (35%), Positives = 84/156 (53%), Gaps = 2/156 (1%)
 Frame = -1

Query: 725 RMYHSTSAVLPDAKILVAGSNTHVSYDMKAKYPTDMRVEKFSPPYLAPALQKFR-PQIVE 549
           R+YHS +A+LPD ++L AG          A  P+    E +SPPYL      FR P+   
Sbjct: 369 RIYHSIAALLPDGRVLSAGGGQGGE---SAYRPS---AEIYSPPYL------FRGPRPTV 416

Query: 548 KLSQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQRMLILGLTSVAKDT 369
             +   + YG+ F +  +  +AAD+   +VT       TH + E QR   L  T  + +T
Sbjct: 417 SAAPISVGYGQAFTV--QSPEAADIR--RVTWVRLSSVTHAFNENQRFNELTFTR-SGNT 471

Query: 368 ISAVAPSSGKLAPPGYYLIFVVHR-GVPSKGLWVHI 264
           ++  AP++G LAPPG+YL++V++  GVPS G  V +
Sbjct: 472 LTVTAPANGNLAPPGHYLLYVLNADGVPSVGRVVRV 507



>gb:BX571965_790122 Burkholderia pseudomallei strain K96243,
            chromosome 1, complete sequence.
          Length = 909

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 51/165 (30%), Positives = 83/165 (50%), Gaps = 2/165 (1%)
 Frame = -1

Query: 752  TELTPTKIARMYHSTSAVLPDAKILVAGSNTHVSYDMKAKYPTDMRVEKFSPPYLAPALQ 573
            T L  T+IAR YH+T+ +LPD +I + G +    Y        + RVE FSPPYL     
Sbjct: 705  TLLASTRIARGYHATALLLPDGRIAITGKDG--DYQGSGLQYAETRVEIFSPPYLFKG-- 760

Query: 572  KFRPQIVEKLSQTELVYGKNFNIHFKLDDA-ADMSSIKVTMYPPPFTTHGYFEGQRMLIL 396
               P+   + +   + +G +F +      +  D+ SI +        TH      R++ L
Sbjct: 761  ---PRPAIQSAPASINHGGSFTLGLSSGTSPEDIGSIVIVACGS--ATHQINFSHRIVEL 815

Query: 395  GLTSVAKDTISAVAPSSGKLAPPGYYLIFVVHR-GVPSKGLWVHI 264
             + +V+   ++  AP +  +APPGYY++FV+ + GVPS    VH+
Sbjct: 816  -VFAVSGGALTVNAPPNANIAPPGYYMMFVLSKLGVPSVSSIVHV 859



>gb:BA000030_701178 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 757

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 51/157 (32%), Positives = 72/157 (45%), Gaps = 1/157 (0%)
 Frame = -1

Query: 728 ARMYHSTSAVLPDAKILVAGSNTHVSYDMKAKYPTDMRVEKFSPPYLAPALQKFRPQIVE 549
           AR YHS++ +LPD +++  G N             +  V  ++PPYL   L+  RP I  
Sbjct: 506 ARGYHSSAFLLPDGRVMATGDNP-------GNGTWNHNVSLYTPPYL---LKGTRPTITS 555

Query: 548 KLSQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQRMLILGLTSVAKDT 369
            +   E VYG    I        D    K  +  P   TH     QR + L L SV  + 
Sbjct: 556 VIDN-EWVYGDTQRI------TVDRPIAKAELIRPAAVTHSSDPNQRFVDLPL-SVGGNN 607

Query: 368 ISAVAPSSGKLAPPGYYLIFVVH-RGVPSKGLWVHIK 261
           +     S+  LAPPG+Y++F V   GVPS   WVH++
Sbjct: 608 VDLNVTSNPNLAPPGWYMLFAVDANGVPSVAKWVHLQ 644



>gb:AX716717_1473706 Sequence 1 from Patent
           EP1293562.>gb:AX716719_1473707 Sequence 3 from Patent
           EP1293562.>gb:AX720107_1473811 Sequence 1 from Patent
           WO03023028.>gb:AX720109_1473812 Sequence 3 from Patent
           WO03023028.>gb:UMA550625_1726822 Ustilago maydis glo1
           gene for Glyoxaloxidase 1.
          Length = 862

 Score = 66.2 bits (160), Expect = 6e-10
 Identities = 58/176 (32%), Positives = 79/176 (44%), Gaps = 20/176 (11%)
 Frame = -1

Query: 746 LTPTKIARMYHSTSAVLPDAKILVAGSNTH--VSYDMKA-----KYPTDMRVEKFSPPYL 588
           L P+ IAR+YHS++ +LPD  ++VAGSN H  V+ DM        + T   VEK+ PPY 
Sbjct: 443 LKPSTIARLYHSSAILLPDGSVMVAGSNPHQDVALDMPTGTTPQAFNTTYEVEKWYPPY- 501

Query: 587 APALQKFRPQIVEKLSQTELVYGKNFNI----HFKLDDA-ADMSSIKVTMYPPPFTTHGY 423
                  RP   + +  + L  G  FNI     F  D A A  ++ K  +    F+TH  
Sbjct: 502 ---WDSPRP-YPQGVPNSVLYGGSPFNITVNGTFMGDSANAKAANTKFAIIRTGFSTHAM 557

Query: 422 FEGQRMLILGLTSVAKDTISAV--------APSSGKLAPPGYYLIFVVHRGVPSKG 279
             GQR + L  T    D  S            +  +L  PG    +V   GVPS G
Sbjct: 558 NMGQRAVYLDYTYTVNDDASVTYMVNPLPNTKAMNRLFVPGPAFFYVTVGGVPSHG 613



>gb:AE017341_1754216 Cryptococcus neoformans var. neoformans JEC21
           chromosome 1, complete sequence.
          Length = 664

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 49/167 (29%), Positives = 82/167 (49%), Gaps = 7/167 (4%)
 Frame = -1

Query: 725 RMYHSTSAVLPDAKILVAGSNTHVSYDMKAKYPTDMRVEKFSPPYLAPALQKFRPQIVEK 546
           RMYHS++ +L D+ ILV+GSN +     + K+PT   VE++ P +      + RP+    
Sbjct: 428 RMYHSSAILLADSSILVSGSNPNKDATSE-KWPTSYSVEQWYPLW----YNEQRPEPSSS 482

Query: 545 LSQTELVYGKNFNIHFKLDDAADMS-SIKVTMYPPPFTTHGYFEGQRMLILGLTSVAKDT 369
              +    G+ FN+ +   +++  S + KV +    F+TH    GQR L L  T    + 
Sbjct: 483 WPSSLSYGGEYFNVSYTPSNSSSNSDNTKVVVIRTGFSTHAMNMGQRYLELNSTYTKDEA 542

Query: 368 ISAVA------PSSGKLAPPGYYLIFVVHRGVPSKGLWVHIK*NRIE 246
              V       P +  +  PG  +IF+V  G+PS+G  + +   +IE
Sbjct: 543 SGEVTLYVSQMPPNANIFQPGPAMIFLVVDGIPSQGKIIMVGSGKIE 589



>gb:PHAGLX2G_1700056 Phanerochaete chrysosporium glyoxal oxidase
           precursor (glx2) gene, complete cds.
          Length = 559

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 36/158 (22%), Positives = 75/158 (47%), Gaps = 5/158 (3%)
 Frame = -1

Query: 737 TKIARMYHSTSAVLPDAKILVAGSNTHVSYDMKA----KYPTDMRVEKFSPPYLAPALQK 570
           T I RMYHST  +       + G+N ++++        K+P+++R+E   PP++      
Sbjct: 393 TTIPRMYHSTVTLTQQGNFFIGGNNPNMNFTPPGTPGIKFPSELRIETLDPPFM------ 446

Query: 569 FRPQIVEKLSQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQRMLIL-G 393
           FR +        +L +G+   +   +      S ++V +    F++H +    R++ +  
Sbjct: 447 FRSRPALLTMPEKLKFGQKVTVPITIPSDLKASKVQVALMDLGFSSHAFHSSARLVFMES 506

Query: 392 LTSVAKDTISAVAPSSGKLAPPGYYLIFVVHRGVPSKG 279
             S  + +++  AP +G++ PPG  ++F+    V S G
Sbjct: 507 SISADRKSLTFTAPPNGRVFPPGPAVVFLTIDDVTSPG 544



>pir|A48296|A48296 glyoxal oxidase (EC 1.2.3.-) precursor -
           basidiomycete  (Phanerochaete
           chrysosporium)>gb:PHAGLX1G_1700055 Phanerochaete
           chrysosporium glyoxal oxidase precursor (glx1) gene,
           complete cds.
          Length = 559

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 36/158 (22%), Positives = 75/158 (47%), Gaps = 5/158 (3%)
 Frame = -1

Query: 737 TKIARMYHSTSAVLPDAKILVAGSNTHVSYDMKA----KYPTDMRVEKFSPPYLAPALQK 570
           T I RMYHST  +       + G+N ++++        K+P+++R+E   PP++      
Sbjct: 393 TTIPRMYHSTVTLTQQGNFFIGGNNPNMNFTPPGTPGIKFPSELRIETLDPPFM------ 446

Query: 569 FRPQIVEKLSQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQRMLIL-G 393
           FR +        +L +G+   +   +      S ++V +    F++H +    R++ +  
Sbjct: 447 FRSRPALLTMPEKLKFGQKVTVPITIPSDLKASKVQVALMDLGFSSHAFHSSARLVFMES 506

Query: 392 LTSVAKDTISAVAPSSGKLAPPGYYLIFVVHRGVPSKG 279
             S  + +++  AP +G++ PPG  ++F+    V S G
Sbjct: 507 SISADRKSLTFTAPPNGRVFPPGPAVVFLTIDDVTSPG 544



>gb:AE017346_1757395 Cryptococcus neoformans var. neoformans JEC21
           chromosome 6, complete sequence.
          Length = 631

 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 52/174 (29%), Positives = 82/174 (47%), Gaps = 16/174 (9%)
 Frame = -1

Query: 737 TKIARMYHSTSAVLPDAKILVAGSNTHVSY-----DMKAKYPTDMRVEKFSPPYLAPALQ 573
           + I RMYHS++++LPD  ++++GSN +  Y     +    Y T  +VE F P Y      
Sbjct: 399 SSIPRMYHSSASLLPDGTVIISGSNPNADYVDAVNNASYTYFTQYQVEIFYPDYADHV-- 456

Query: 572 KFRPQIVEKLSQTELVYGKN-FNIHFKLDD----AADMSSIKVTMYPPPFTTHGYFEGQR 408
           K  PQ +     + + YG + FNI     D      +++  +  +    F+TH    GQR
Sbjct: 457 KPTPQGM----PSNITYGGDYFNITLSASDLFNVPININKTRAVIMRTGFSTHTMNMGQR 512

Query: 407 MLILGLTSVAKDT------ISAVAPSSGKLAPPGYYLIFVVHRGVPSKGLWVHI 264
            + L  +    D       ++ + P+ G LA PG  L F+V  G+PS   WV I
Sbjct: 513 HIELETSFTTTDDGGGILHVAQLPPNPGILA-PGPALFFIVVDGIPSNASWVMI 565



>gb:UMA550627_1726824 Ustilago maydis glo3 gene for Glyoxaloxidase
           3.
          Length = 652

 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 56/185 (30%), Positives = 88/185 (47%), Gaps = 15/185 (8%)
 Frame = -1

Query: 752 TELTPTKIARMYHSTSAVLPDAKILVAGSNTH--VSYDMKAKYP-TDMRVEKFSPPYLAP 582
           T L   ++ RMYHST+ +L D  +L +GSN +  VS    A Y  T+ R+E++ P +   
Sbjct: 404 TGLAQMQVQRMYHSTAILLEDGSVLTSGSNPNADVSLSNAANYTNTEYRLEQWYPLW--- 460

Query: 581 ALQKFRPQIVEKLSQTELVY-GKNFNIHFKLDDAA----DMSSIKVTMYPPPFTTHGYFE 417
              + RP    + + T++ Y G +F++     D +    ++ + K+ +    F THG   
Sbjct: 461 -YNEPRP---TQPNVTQIAYGGGSFDVPLSESDLSNNITNIKTAKMVIIRSGFATHGVNF 516

Query: 416 GQRMLILGLT-------SVAKDTISAVAPSSGKLAPPGYYLIFVVHRGVPSKGLWVHIK* 258
           GQR L L  T       SV      +  P +  L  PG  + F+V  GVPS G  V I  
Sbjct: 517 GQRYLELNSTYTAFQNGSVGGTLHVSNMPPNANLFQPGPAMAFLVINGVPSHGQHVMIGT 576

Query: 257 NRIED 243
            ++ D
Sbjct: 577 GQLGD 581



>gb:AX716723_1473709 Sequence 7 from Patent
           EP1293562.>gb:AX720113_1473814 Sequence 7 from Patent
           WO03023028.
          Length = 633

 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 56/185 (30%), Positives = 88/185 (47%), Gaps = 15/185 (8%)
 Frame = -1

Query: 752 TELTPTKIARMYHSTSAVLPDAKILVAGSNTH--VSYDMKAKYP-TDMRVEKFSPPYLAP 582
           T L   ++ RMYHST+ +L D  +L +GSN +  VS    A Y  T+ R+E++ P +   
Sbjct: 385 TGLAQMQVQRMYHSTAILLEDGSVLTSGSNPNADVSLSNAANYTNTEYRLEQWYPLW--- 441

Query: 581 ALQKFRPQIVEKLSQTELVY-GKNFNIHFKLDDAA----DMSSIKVTMYPPPFTTHGYFE 417
              + RP    + + T++ Y G +F++     D +    ++ + K+ +    F THG   
Sbjct: 442 -YNEPRP---TQPNVTQIAYGGGSFDVPLSESDLSNNITNIKTAKMVIIRSGFATHGVNF 497

Query: 416 GQRMLILGLT-------SVAKDTISAVAPSSGKLAPPGYYLIFVVHRGVPSKGLWVHIK* 258
           GQR L L  T       SV      +  P +  L  PG  + F+V  GVPS G  V I  
Sbjct: 498 GQRYLELNSTYTAFQNGSVGGTLHVSNMPPNANLFQPGPAMAFLVINGVPSHGQHVMIGT 557

Query: 257 NRIED 243
            ++ D
Sbjct: 558 GQLGD 562



>gb:PHAPPEGO_1700086 Phanerochaete chrysosporium
           peroxidase-producing enzyme (glyoxal oxidase) mRNA,
           complete cds.
          Length = 529

 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 32/143 (22%), Positives = 68/143 (47%), Gaps = 5/143 (3%)
 Frame = -1

Query: 737 TKIARMYHSTSAVLPDAKILVAGSNTHVSYDMKA----KYPTDMRVEKFSPPYLAPALQK 570
           T I RMYHST  +       + G+N ++++        K+P+++R+E   PP++      
Sbjct: 393 TTIPRMYHSTVTLTQQGNFFIGGNNPNMNFTPPGTPGIKFPSELRIETLDPPFM------ 446

Query: 569 FRPQIVEKLSQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQRMLIL-G 393
           FR +        +L +G+   +   +      S ++V +    F++H +    R++ +  
Sbjct: 447 FRSRPALLTMPEKLKFGQKVTVPITIPSDLKASKVQVALMDLGFSSHAFHSSARLVFMES 506

Query: 392 LTSVAKDTISAVAPSSGKLAPPG 324
             S  + +++  AP +G++ PPG
Sbjct: 507 SISADRKSLTFTAPPNGRVFPPG 529



>gb:AE017345_1757111 Cryptococcus neoformans var. neoformans JEC21
           chromosome 5, complete sequence.
          Length = 676

 Score = 58.9 bits (141), Expect = 9e-08
 Identities = 54/179 (30%), Positives = 82/179 (45%), Gaps = 9/179 (5%)
 Frame = -1

Query: 752 TELTPTKIARMYHSTSAVLPDAKILVAGSNTHVSYDMKAKYPTDMRVEKFSPPYLAPALQ 573
           T L+ +   RMYHST+ +LPD+ +L+AGSN +  +    ++ +    EK+ P Y      
Sbjct: 429 TGLSASANERMYHSTAILLPDSSVLIAGSNPNADF-TNDQWRSRTDSEKWYPWY----YN 483

Query: 572 KFRPQIVEKLSQTELVY-GKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQRMLIL 396
           + RP        T L Y G +FN+     D       KV +    F TH    GQ+ML L
Sbjct: 484 EKRP--TYSGMPTNLYYGGDSFNLTMSGTDEDTAKDTKVVLIRGGFNTHAMGFGQKMLEL 541

Query: 395 ----GLTSVAKDTISAVAPSSGKLAP----PGYYLIFVVHRGVPSKGLWVHIK*NRIED 243
                +     +T   V+   G   P    PG  + FVV +GVPS G ++ +   ++ D
Sbjct: 542 ESSYTIDMNTGNTTIHVSQLPGNPGPTLFQPGPAMFFVVVKGVPSIGEFIMVGNGQLGD 600



>gb:AY055804_587237 Stigmatella aurantiaca putative copper-dependent
           oxidase (ox) gene, complete cds.
          Length = 779

 Score = 58.9 bits (141), Expect = 9e-08
 Identities = 48/164 (29%), Positives = 74/164 (45%), Gaps = 1/164 (0%)
 Frame = -1

Query: 749 ELTPTKIARMYHSTSAVLPDAKILVAGSNTHVSYDMKAKYPTDMRVEKFSPPYLAPALQK 570
           +L      R YHS+S +LPD ++L AG     +             E F PPYL      
Sbjct: 365 KLASNNAYRGYHSSSVLLPDGRVLSAGGRNVRT------------AEVFEPPYLFQG--- 409

Query: 569 FRPQIVEKLSQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQRMLILGL 390
             P+ V   +  E+  G  F++       A +   KVT+      TH +   QR L L  
Sbjct: 410 --PRPVISTAPDEIKPGTPFSVG--TPSGAQLK--KVTLISLASVTHAFDSSQRFLTLP- 462

Query: 389 TSVAKDTISAVAPSSGKLAPPGYYLIFVVHR-GVPSKGLWVHIK 261
            ++ ++ ++  AP S   APPG Y++F++ + GVPS    V +K
Sbjct: 463 HALTQEGLTVTAPESNVAAPPGPYMLFLISKEGVPSVAKMVMVK 506



>gb:BA000030_703105 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 645

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 48/159 (30%), Positives = 76/159 (47%), Gaps = 3/159 (1%)
 Frame = -1

Query: 731 IARMYHSTSAVLPDAKILVAGSNTHVSYDMKAKYPT-DMRVEKFSPPYLAPALQKFRPQI 555
           + R YHS S +LPD +++  GS++  +     K    + R+E ++PPY+    +  RP  
Sbjct: 497 VGRNYHSGSILLPDGRVMFFGSDSLYADKANTKPGVFEQRIEIYTPPYV---YRDSRP-- 551

Query: 554 VEKLSQTELVYGKNFNIHFKLDDAADMSSIKVT-MYPPPFTTHGYFEGQRMLILGLTSVA 378
              LS       +  +  FK   +A  SSIK   +  P  +TH     QR + L     +
Sbjct: 552 --SLSGGPGTLARGASGTFK---SAHASSIKTARLIRPSASTHVTDVDQRSIALDFKK-S 605

Query: 377 KDTISAVAPSSGKLAPPGYYLIFVV-HRGVPSKGLWVHI 264
           KD I+   P +  L   G+Y++FV   +G PSK  WV +
Sbjct: 606 KDGITVTVPKNRNLVESGWYMLFVTDDQGTPSKAQWVRV 644



>gb:BX571965_791493 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.
          Length = 771

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 45/159 (28%), Positives = 70/159 (44%), Gaps = 4/159 (2%)
 Frame = -1

Query: 728 ARMYHSTSAVLPDAKILVAGSNTHVSYDMKAKYPTDMRVEKFSPPYL--APALQKFRPQI 555
           +RMYH+ S +LPD  +L  G           ++P +   E + PPYL  A   +  RP I
Sbjct: 395 SRMYHAISLLLPDGTVLTGGGGASTPTYPGPEFPVNANAEVYYPPYLFNADGTRASRPVI 454

Query: 554 VEKLSQTELVYGKNFNIHFKLDDAADMSSI-KVTMYPPPFTTHGYFEGQRMLILGLTSVA 378
               +   +   + F +      + D  SI ++TM     TTH +   QR + L  T   
Sbjct: 455 --DSAPAAITANRIFTL-----TSPDAGSIGRMTMVKTGSTTHSFNMEQRFVELNFTRQG 507

Query: 377 KDTISAVAPSSGKLAPPGYYLIFVVH-RGVPSKGLWVHI 264
              +SA   +      PG Y++FV++  GVPS    V +
Sbjct: 508 AQ-LSATLTNDRHQFTPGMYMLFVINVNGVPSVASLVRV 545



>gb:SCO939114_176511 Streptomyces coelicolor A3(2) complete genome;
           segment 11/29.
          Length = 645

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 45/158 (28%), Positives = 73/158 (46%), Gaps = 2/158 (1%)
 Frame = -1

Query: 731 IARMYHSTSAVLPDAKILVAGSNTHVSYDMKAK-YPTDMRVEKFSPPYLAPALQKFRPQI 555
           + R YHS S +LPD +++  GS++  +     K    + R+E ++PPYL    +  RP  
Sbjct: 497 VGRNYHSGSILLPDGRLMFFGSDSLYADKANTKPGKFEQRIEIYTPPYL---YRDSRPD- 552

Query: 554 VEKLSQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQRMLILGLTSVAK 375
              LS       +  +  F    A+ +   KV +  P  +TH     QR + L  T+   
Sbjct: 553 ---LSGGPQTIARGGSGTFTSRAASTVK--KVRLIRPSASTHVTDVDQRSIALDFTADG- 606

Query: 374 DTISAVAPSSGKLAPPGYYLIFVVH-RGVPSKGLWVHI 264
           D ++   P+   L   G+Y++FV    G PSK  WV +
Sbjct: 607 DKLTVTVPTGKNLVQSGWYMMFVTDGEGTPSKAEWVRV 644



>pir|A38084|A38084 galactose oxidase (EC 1.1.3.9) precursor
            [validated] - fungus (Cladobotryum dendroides)
          Length = 728

 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 45/155 (29%), Positives = 72/155 (46%), Gaps = 3/155 (1%)
 Frame = -1

Query: 740  PTKIARMYHSTSAVLPDAKILVAGSNTHVSYDMKAKYPTDMRVEKFSPPYLAPALQKF-- 567
            P  I R+YHS S +LPD ++   G    +  D    +      + F+P YL  +      
Sbjct: 577  PNSIVRVYHSISLLLPDGRVFNGGGG--LCGDCTTNH---FDAQIFTPNYLYNSNGNLAT 631

Query: 566  RPQIVEKLSQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQRMLILGLT 387
            RP+I    +Q+  V G+       +  + D S  K ++      TH     QR + L LT
Sbjct: 632  RPKITRTSTQSVKVGGR-------ITISTDSSISKASLIRYGTATHTVNTDQRRIPLTLT 684

Query: 386  SVAKDTISAVAPSSGKLAPPGYYLIFVVH-RGVPS 285
            +   ++ S   PS   +A PGY+++FV++  GVPS
Sbjct: 685  NNGGNSYSFQVPSDSGVALPGYWMLFVMNSAGVPS 719



>sp|Q01745|GAOA_DACDE Galactose oxidase precursor (EC 1.1.3.9)
           (GAO).>gb:CDOGAOA_1646066 Dactylium dendroides (asexual
           stage of Cladobotryum dendroides) galactose oxidase
           monomer (gaoA) gene, complete cds.
          Length = 680

 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 45/155 (29%), Positives = 72/155 (46%), Gaps = 3/155 (1%)
 Frame = -1

Query: 740 PTKIARMYHSTSAVLPDAKILVAGSNTHVSYDMKAKYPTDMRVEKFSPPYLAPALQKF-- 567
           P  I R+YHS S +LPD ++   G    +  D    +      + F+P YL  +      
Sbjct: 529 PNSIVRVYHSISLLLPDGRVFNGGGG--LCGDCTTNH---FDAQIFTPNYLYNSNGNLAT 583

Query: 566 RPQIVEKLSQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQRMLILGLT 387
           RP+I    +Q+  V G+       +  + D S  K ++      TH     QR + L LT
Sbjct: 584 RPKITRTSTQSVKVGGR-------ITISTDSSISKASLIRYGTATHTVNTDQRRIPLTLT 636

Query: 386 SVAKDTISAVAPSSGKLAPPGYYLIFVVH-RGVPS 285
           +   ++ S   PS   +A PGY+++FV++  GVPS
Sbjct: 637 NNGGNSYSFQVPSDSGVALPGYWMLFVMNSAGVPS 671



>pir|AB2004|AB2004 hypothetical protein alr1584 [imported] - Nostoc
            sp. (strain PCC 7120)>gb:BA000019_682573 Nostoc sp. PCC
            7120 DNA, complete genome.
          Length = 650

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 56/210 (26%), Positives = 86/210 (40%), Gaps = 56/210 (26%)
 Frame = -1

Query: 746  LTPTKIARMYHSTSAVLPDAKILVAGSNTH-------------VSYDMKAKYP-TDMRV- 612
            + P K+ R+YH+ + +LPDA++L  G N +             +  D K  Y   D+R  
Sbjct: 440  MNPAKLPRLYHNGALLLPDARVLAIGGNANRALRDEDGTAHVDILQDAKTYYKFADLRDK 499

Query: 611  -------------------------------------EKFSPPYLAPALQKFRPQIVEKL 543
                                                 E FSPPYL       RP+I++  
Sbjct: 500  SGQNKKEFNLEEYYQNPQSYFAKDDKEPFVPAEIWQGEIFSPPYLFKPGS--RPKILK-- 555

Query: 542  SQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQRMLILGLTSVA---KD 372
            +  +L Y ++  I  K +   D S + V +      TH +  GQR+  L L  V    + 
Sbjct: 556  APNKLGYSQSNTISVK-NATKDGSLVLVKLGS---VTHSFDYGQRLAQLPLEDVVLGDES 611

Query: 371  TISAVAPSSGKLAPPGYYLIFVVHR-GVPS 285
            +IS  AP +  L PPGYY++F ++  G PS
Sbjct: 612  SISFKAPENKNLYPPGYYMMFYLNNLGKPS 641



>gb:NCB1D14_1689577 Neurospora crassa genomic DNA, BAC contig B1D14.
          Length = 716

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 46/171 (26%), Positives = 73/171 (42%), Gaps = 5/171 (2%)
 Frame = -1

Query: 752  TELTPTKIARMYHSTSAVLPDAKILVAGSNTHVSYDMKAKYPTDMRVEKFSPPYLAP--A 579
            TEL+   + R+YH+ S +LPD ++L AG    +  +  A +      + F+PPYL     
Sbjct: 531  TELSQNNVVRVYHTLSILLPDGRVLNAGGG--LCGNCSANHYDG---QIFTPPYLLTENG 585

Query: 578  LQKFRPQIVEKLSQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQRM-- 405
             ++ RP+I  +L  T +  G+    H       D      ++      TH     QR   
Sbjct: 586  EERSRPEIRTELPDT-IEVGEELRFH------TDRRIASASLVRLCSATHTVNTDQRRVP 638

Query: 404  LILGLTSVAKDTISAVAPSSGKLAPPGYYLIFVV-HRGVPSKGLWVHIK*N 255
            L LG             P+   +  PGY+++FV+   G PS    + IK N
Sbjct: 639  LPLGRRVPMFGRYHVQIPNDPGIVIPGYWMLFVMDEAGTPSIAKTIMIKSN 689



>gb:SAFBFA_169468 S.aurantiaca fbfA and fbfB genes.
          Length = 526

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 41/153 (26%), Positives = 61/153 (39%), Gaps = 2/153 (1%)
 Frame = -1

Query: 749 ELTPTKIARMYHSTSAVLPDAKILVAGSNTHVSYDMKAKYPTDMRVEKFSPPYLAPALQK 570
           +L      R YHS+S +LPD ++L AG                   E F PPYL      
Sbjct: 365 KLASNNAYRGYHSSSVLLPDGRVLSAGGR------------NVRTAEVFEPPYLFQG--- 409

Query: 569 FRPQIVEKLSQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQRMLIL-- 396
             P+ V   +  E+  G  F++       +     KVT+      TH +   QR L +  
Sbjct: 410 --PRPVISTAPDEIKPGTPFSV----GTPSGAQLKKVTLISLATETHAFDSSQRFLTVPH 463

Query: 395 GLTSVAKDTISAVAPSSGKLAPPGYYLIFVVHR 297
            LT   +D        S   APPG Y++F++ +
Sbjct: 464 ALTEGYRD-----RAESNVAAPPGPYMLFLISK 491



>gb:CP000010_865205 Burkholderia mallei ATCC 23344 chromosome 1,
            complete sequence.
          Length = 805

 Score = 40.0 bits (92), Expect = 0.045
 Identities = 42/168 (25%), Positives = 67/168 (39%), Gaps = 5/168 (2%)
 Frame = -1

Query: 752  TELTPTKIARMYHSTSAVLPDAKILVAGSNTHVSYDMKAKYPTDMRVEKFSPPYLAPALQ 573
            T L P  + R YHS + +LPD +++ +G     S      +P    V+  +PPYL  A  
Sbjct: 646  TRLAPMTVPRNYHSEALLLPDGRVMASGGGLCGS-GCNTNHP---NVQILTPPYLLNADG 701

Query: 572  KFRPQIVEKLSQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQRMLILG 393
                + V   +  +   G    +     DA   S   V M     +TH     QR + L 
Sbjct: 702  TAASRPVIAAAPEQAANGSTIAVS---TDAPIRSFALVRM---SSSTHSVNTDQRRIPLT 755

Query: 392  LTSVAKD----TISAVAPSSGKLAPPGYYLIFVVHR-GVPSKGLWVHI 264
                +        +   P+   +A PG Y++F ++  GVPS    + I
Sbjct: 756  FRQSSGGDGGYAYTVAIPADAGVAIPGQYMLFALNAGGVPSVAKTIRI 803



>gb:BX571965_791845 Burkholderia pseudomallei strain K96243,
            chromosome 1, complete sequence.
          Length = 855

 Score = 40.0 bits (92), Expect = 0.045
 Identities = 42/168 (25%), Positives = 67/168 (39%), Gaps = 5/168 (2%)
 Frame = -1

Query: 752  TELTPTKIARMYHSTSAVLPDAKILVAGSNTHVSYDMKAKYPTDMRVEKFSPPYLAPALQ 573
            T L P  + R YHS + +LPD +++ +G     S      +P    V+  +PPYL  A  
Sbjct: 696  TRLAPMTVPRNYHSEALLLPDGRVMASGGGLCGS-GCNTNHP---NVQILTPPYLLNADG 751

Query: 572  KFRPQIVEKLSQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQRMLILG 393
                + V   +  +   G    +     DA   S   V M     +TH     QR + L 
Sbjct: 752  TAASRPVIAAAPEQAANGSTIAVS---TDAPIRSFALVRM---SSSTHSVNTDQRRIPLT 805

Query: 392  LTSVAKD----TISAVAPSSGKLAPPGYYLIFVVHR-GVPSKGLWVHI 264
                +        +   P+   +A PG Y++F ++  GVPS    + I
Sbjct: 806  FRQSSGGDGGYAYTVAIPADAGVAIPGQYMLFALNAGGVPSVAKTIRI 853



>gb:CP000011_868848 Burkholderia mallei ATCC 23344 chromosome 2,
            complete sequence.
          Length = 806

 Score = 38.9 bits (89), Expect = 0.10
 Identities = 43/169 (25%), Positives = 66/169 (39%), Gaps = 8/169 (4%)
 Frame = -1

Query: 746  LTPTKIARMYHSTSAVLPDAKILVAGSNTHVSYDMKAKYPTDMRVEKFSPPYL--APALQ 573
            L P +  R YHST+ ++ D ++   G     +          +  E  +PPYL  A    
Sbjct: 654  LKPMQTPRTYHSTAILMADGRVFAGGGGQCGT----GCAMNHLNAEILTPPYLLNADGTP 709

Query: 572  KFRPQIVE-----KLSQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQR 408
              RP I       KL  T  V  +     F L     +SS+          TH     QR
Sbjct: 710  APRPVITNAPATAKLGATIAVSTQGPVASFVL---MRLSSV----------THTTNNDQR 756

Query: 407  MLILGLTSVAKDTISAVAPSSGKLAPPGYYLIFVVH-RGVPSKGLWVHI 264
             + L + S    +     P+   +  PGYY++F ++ +GVPS    + I
Sbjct: 757  RIPLAIASSGGTSYQLAIPADPGVVLPGYYMLFALNAQGVPSVSASIRI 805



>gb:BX571966_794911 Burkholderia pseudomallei strain K96243,
            chromosome 2, complete sequence.
          Length = 806

 Score = 38.9 bits (89), Expect = 0.10
 Identities = 43/169 (25%), Positives = 66/169 (39%), Gaps = 8/169 (4%)
 Frame = -1

Query: 746  LTPTKIARMYHSTSAVLPDAKILVAGSNTHVSYDMKAKYPTDMRVEKFSPPYL--APALQ 573
            L P +  R YHST+ ++ D ++   G     +          +  E  +PPYL  A    
Sbjct: 654  LKPMQTPRTYHSTAILMADGRVFAGGGGQCGT----GCAMNHLNAEILTPPYLLNADGTP 709

Query: 572  KFRPQIVE-----KLSQTELVYGKNFNIHFKLDDAADMSSIKVTMYPPPFTTHGYFEGQR 408
              RP I       KL  T  V  +     F L     +SS+          TH     QR
Sbjct: 710  APRPVITNAPATAKLGATIAVSTQGPVASFVL---MRLSSV----------THTTNNDQR 756

Query: 407  MLILGLTSVAKDTISAVAPSSGKLAPPGYYLIFVVH-RGVPSKGLWVHI 264
             + L + S    +     P+   +  PGYY++F ++ +GVPS    + I
Sbjct: 757  RIPLAIASSGGTSYQLAIPADPGVVLPGYYMLFALNAQGVPSVSASIRI 805



>gb:AE015821_318199 Shewanella oneidensis MR-1 section 370 of 457 of
           the complete genome.>gb:AE014299_953796 Shewanella
           oneidensis MR-1 complete genome.
          Length = 680

 Score = 33.1 bits (74), Expect = 5.5
 Identities = 25/97 (25%), Positives = 46/97 (47%), Gaps = 1/97 (1%)
 Frame = -1

Query: 746 LTPTKIARMYHSTSAVLPDAKILVAGSNTHVSYDMKAKYPTDMRVEKFSPPYLAPALQKF 567
           LTP K+++ YH   A  P+    + G+  HV+  +K K     + E      +   L+  
Sbjct: 371 LTPLKVSQDYHLLLAEKPNVTPAMVGNAAHVAMTLKFK---GAKAEVLIDEVIDATLEAC 427

Query: 566 RPQIVEKLSQTELVYGKNFNIHFKL-DDAADMSSIKV 459
             +      Q EL +  N  ++FK+ DDAA +++ ++
Sbjct: 428 GEEAPPPKYQGELAFDSNM-VNFKVSDDAASVTTAEM 463



>gb:AF067611_1238006 Caenorhabditis elegans cosmid C45G7, complete
            sequence.
          Length = 2302

 Score = 32.7 bits (73), Expect = 7.2
 Identities = 18/54 (33%), Positives = 26/54 (48%)
 Frame = -1

Query: 659  HVSYDMKAKYPTDMRVEKFSPPYLAPALQKFRPQIVEKLSQTELVYGKNFNIHF 498
            H+  D K +Y   M   +F        L+KFR QI+E + + +   GK   IHF
Sbjct: 2095 HIRNDRKLRYVLSMSRNEFGAN-----LEKFRRQILEAIGKDDQKAGKQLEIHF 2143



>pir|T33135|T33135 hypothetical protein C45G7.5 - Caenorhabditis
           elegans
          Length = 986

 Score = 32.7 bits (73), Expect = 7.2
 Identities = 18/54 (33%), Positives = 26/54 (48%)
 Frame = -1

Query: 659 HVSYDMKAKYPTDMRVEKFSPPYLAPALQKFRPQIVEKLSQTELVYGKNFNIHF 498
           H+  D K +Y   M   +F        L+KFR QI+E + + +   GK   IHF
Sbjct: 779 HIRNDRKLRYVLSMSRNEFGAN-----LEKFRRQILEAIGKDDQKAGKQLEIHF 827


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 891,550,550
Number of Sequences: 1806583
Number of extensions: 20123866
Number of successful extensions: 53558
Number of sequences better than 10.0: 45
Number of HSP's better than 10.0 without gapping: 52041
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 53480
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 46273900672
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)