BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig9327
         (1024 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|D96836|D96836 probable glycerol kinase, 69575-71670 [importe...   331   2e-89   Arabidopsis thaliana [mouse-ear cress]
gb:AY496707_1609123 Pandanus amaryllifolius glycerol kinase (GK)...   327   3e-88   
gb:AY492004_1608744 Glycine max glycerol kinase (GK) mRNA, compl...   319   5e-86   
gb:OST17804_1698365 Oryza sativa indica(GLA4) genomic DNA, chrom...   281   1e-74   
gb:AE017228_411058 Mycobacterium avium subsp. paratuberculosis s...   195   1e-48   
gb:AE016822_339662 Leifsonia xyli subsp. xyli str. CTCB07, compl...   195   1e-48   
gb:AP006618_557365 Nocardia farcinica IFM 10152 DNA, complete ge...   192   7e-48   
sp|Q828K5|GLK1_STRAW|GLK1_STRAW Glycerol kinase 1 (EC 2.7.1.30) (ATP:glycer...   191   3e-47   Streptomyces avermitilis
gb:AE017283_432042 Propionibacterium acnes KPA171202, complete g...   189   6e-47   
sp|Q826J2|GLK3_STRAW|GLK3_STRAW Glycerol kinase 3 (EC 2.7.1.30) (ATP:glycer...   189   6e-47   Streptomyces avermitilis
sp|O69664|GLPK_MYCTU|GLPK_MYCTU Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   188   1e-46   Mycobacterium tuberculosis
sp|Q827G1|GLK2_STRAW|GLK2_STRAW Glycerol kinase 2 (EC 2.7.1.30) (ATP:glycer...   187   2e-46   Streptomyces avermitilis
sp|Q9X1E4|GLK2_THEMA|GLK2_THEMA Glycerol kinase 2 (EC 2.7.1.30) (ATP:glycer...   186   6e-46   Thermotoga maritima
sp|Q9ADA7|GLK1_STRCO|GLK1_STRCO Glycerol kinase 1 (EC 2.7.1.30) (ATP:glycer...   186   8e-46   Streptomyces coelicolor
sp|Q9CB81|GLPK_MYCLE|GLPK_MYCLE Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   185   1e-45   Mycobacterium leprae
sp|Q8CSS0|GLPK_STAEP|GLPK_STAEP Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   184   2e-45   Staphylococcus epidermidis
sp|Q9RJM2|GLK2_STRCO|GLK2_STRCO Glycerol kinase 2 (EC 2.7.1.30) (ATP:glycer...   184   3e-45   Streptomyces coelicolor
sp|Q8R8J4|GLPK_THETN|GLPK_THETN Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   181   2e-44   
sp|Q97XW1|GLK1_SULSO|GLK1_SULSO Glycerol kinase 1 (EC 2.7.1.30) (ATP:glycer...   180   4e-44   Saccharolobus solfataricus
sp|Q9RT38|GLPK_DEIRA|GLPK_DEIRA Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   180   5e-44   Deinococcus radiodurans
gb:AK088373_1175363 Mus musculus 2 days neonate thymus thymic ce...   179   8e-44   
gb:AK044308_1166907 Mus musculus adult retina cDNA, RIKEN full-l...   179   8e-44   
pir|JE0391|JE0391 glycerol kinase (EC 2.7.1.30) - Flavobacterium...   179   8e-44   Elizabethkingia meningoseptica
sp|Q64516|GLPK_MOUSE|GLPK_MOUSE Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   179   8e-44   Mus musculus [mouse]
gb:AY335747_2144965 Synthetic construct Homo sapiens glycerol ki...   178   2e-43   
gb:HSGLYK_2013508 H.sapiens mRNA for glycerol kinase.                 178   2e-43   
gb:HSA252550_2001712 Homo sapiens partial GK gene for glycerol k...   178   2e-43   
gb:HSA252550_2001711 Homo sapiens partial GK gene for glycerol k...   178   2e-43   
gb:BC042421_1983240 Homo sapiens glycerol kinase, transcript var...   178   2e-43   
gb:CR859709_1183813 Pongo pygmaeus mRNA; cDNA DKFZp469P1225 (fro...   178   2e-43   
sp|P32189|GLPK_HUMAN|GLPK_HUMAN Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   178   2e-43   Homo sapiens [man]
gb:BX571874_789623 Photorhabdus luminescens subsp. laumondii TTO...   177   4e-43   
pir|C72254|C72254 glycerol kinase - Thermotoga maritima (strain ...   177   4e-43   Thermotoga maritima
sp|Q63060|GLPK_RAT|GLPK_RAT Glycerol kinase (EC 2.7.1.30) (ATP:glycerol 3...   177   4e-43   Rattus norvegicus [brown rat]
sp|Q8TZI8|GLPK_PYRFU|GLPK_PYRFU Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   177   4e-43   Pyrococcus furiosus
sp|Q7MYB6|GLPK_PHOLL|GLPK_PHOLL Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   177   4e-43   Photorhabdus laumondii subsp. laumondii
gb:BC066960_1987189 Homo sapiens glycerol kinase pseudogene 3, m...   176   5e-43   
sp|Q8NLP9|GLPK_CORGL|GLPK_CORGL Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   176   5e-43   Corynebacterium glutamicum
gb:AE017319_441376 Desulfovibrio vulgaris subsp. vulgaris str. H...   176   7e-43   
sp|Q7UTP4|GLPK_RHOBA|GLPK_RHOBA Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   175   1e-42   Rhodopirellula baltica
sp|Q14409|GKP3_HUMAN|GKP3_HUMAN Glycerol kinase, testis specific 1 (EC 2.7....   175   1e-42   Homo sapiens [man]
sp|P95907|GLK2_SULSO|GLK2_SULSO Glycerol kinase 2 (EC 2.7.1.30) (ATP:glycer...   174   2e-42   Saccharolobus solfataricus
gb:BX248360_763486 Corynebacterium diphtheriae gravis NCTC13129,...   174   3e-42   
sp|Q9V207|GLPK_PYRAB|GLPK_PYRAB Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   173   6e-42   Pyrococcus abyssi
gb:AP006878_576548 Thermococcus kodakaraensis strain KOD1 DNA, c...   172   7e-42   
gb:AE017252_416957 Treponema denticola ATCC 35405, section 7 of ...   172   7e-42   
sp|O93623|GLPK_PYRKO|GLPK_PYRKO Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   172   7e-42   
gb:BX571856_780722 Staphylococcus aureus subsp. aureus strain MR...   171   3e-41   
gb:BA000035_717502 Corynebacterium efficiens YS-314 DNA, complet...   171   3e-41   
gb:CP000046_91454 Staphylococcus aureus subsp. aureus COL, compl...   171   3e-41   
sp|Q99UH3|GLPK_STAAM|GLPK_STAAM Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   171   3e-41   Staphylococcus aureus
sp|Q8FLY8|GLPK_COREF|GLPK_COREF Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   171   3e-41   Corynebacterium efficiens
gb:AE013606_298384 Yersinia pestis KIM section 6 of 415 of the c...   170   4e-41   
gb:BX950851_843001 Erwinia carotovora subsp. atroseptica SCRI104...   170   5e-41   
sp|Q8RHZ9|GLPK_FUSNN|GLPK_FUSNN Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   169   6e-41   Fusobacterium nucleatum subsp. nucleatum
gb:AE017180_401053 Geobacter sulfurreducens PCA, complete genome.     169   8e-41   
sp|Q8NWX7|GLPK_STAAW|GLPK_STAAW Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   169   8e-41   Staphylococcus aureus
sp|Q8XHD3|GLPK_CLOPE|GLPK_CLOPE Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   169   8e-41   Clostridium perfringens
gb:BC048274_1984119 Homo sapiens glycerol kinase 2, mRNA (cDNA c...   169   1e-40   
gb:BC029820_1979638 Homo sapiens glycerol kinase 2, mRNA (cDNA c...   169   1e-40   
gb:CR382132_1664947 Yarrowia lipolytica chromosome F of strain C...   169   1e-40   
gb:AE016827_343617 Mannheimia succiniciproducens MBEL55E, comple...   169   1e-40   
sp|Q14410|GKP2_HUMAN|GKP2_HUMAN Glycerol kinase, testis specific 2 (EC 2.7....   169   1e-40   Homo sapiens [man]
gb:BX571857_783455 Staphylococcus aureus strain MSSA476, complet...   168   1e-40   
gb:BC056091_2551673 Xenopus laevis glycerol kinase, mRNA (cDNA c...   168   2e-40   
sp|Q87XL0|GLPK_PSESM|GLPK_PSESM Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   168   2e-40   Pseudomonas syringae pv. tomato
sp|Q81U58|GLPK_BACAN|GLPK_BACAN Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   168   2e-40   Bacillus anthracis [anthrax]
sp|Q8E9N7|GLPK_SHEON|GLPK_SHEON Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   167   2e-40   Shewanella oneidensis
gb:CP000001_851560 Bacillus cereus ZK, complete genome.               167   4e-40   
gb:BX842653_825538 Bdellovibrio bacteriovorus complete genome, s...   167   4e-40   
gb:AE017355_462262 Bacillus thuringiensis serovar konkukian str....   167   4e-40   
sp|Q97JG4|GLPK_CLOAB|GLPK_CLOAB Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   167   4e-40   Clostridium acetobutylicum
pir|G98250|G98250 probable carbohydrate kinase PA3579 [imported]...   166   5e-40   Agrobacterium fabrum str. C58
sp|Q9KLJ9|GLPK_VIBCH|GLPK_VIBCH Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   166   5e-40   
sp|Q8U940|GLPK_AGRT5|GLPK_AGRT5 Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   166   5e-40   Agrobacterium tumefaciens
gb:AP006840_568384 Symbiobacterium thermophilum DNA, complete ge...   166   7e-40   
sp|Q8Y6Z2|GLPK_LISMO|GLPK_LISMO Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   166   7e-40   
gb:AK076631_1171471 Mus musculus adult male testis cDNA, RIKEN f...   166   9e-40   
gb:AF543471_520701 Uncultured bacterium plasmid pAK115 GlpX (glp...   166   9e-40   
gb:AE008890_245699 Salmonella typhimurium LT2, section 194 of 22...   166   9e-40   
gb:CP000026_78577 Salmonella enterica subsp. enterica serovar Pa...   166   9e-40   
pir|AG0939|AG0939 glycerol kinase [imported] - Salmonella enteri...   166   9e-40   Salmonella enterica subsp. enterica serovar Typhi
sp|Q8ZKP3|GLPK_SALTY|GLPK_SALTY Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   166   9e-40   Salmonella enterica subsp. enterica serovar Typhimurium
sp|Q8Z2Y6|GLPK_SALTI|GLPK_SALTI Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   166   9e-40   Salmonella enterica subsp. enterica serovar Typhi
sp|O87924|GLPK_PSETO|GLPK_PSETO Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   166   9e-40   Pseudomonas tolaasii
gb:HSRNAGLK_2020048 H.sapiens mRNA for glycerol kinase.               165   1e-39   
gb:AE017344_1756236 Cryptococcus neoformans var. neoformans JEC2...   165   1e-39   
sp|Q81GZ2|GLPK_BACCR|GLPK_BACCR Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   165   1e-39   Bacillus cereus
gb:BC079449_2107553 Rattus norvegicus glucokinase activity, rela...   165   2e-39   
gb:AF117733_2055104 Mus musculus glycerol kinase-like protein 1 ...   165   2e-39   
gb:AE017327_443983 Listeria monocytogenes str. 4b F2365, section...   165   2e-39   
sp|O86033|GLPK_RHIME|GLPK_RHIME Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   165   2e-39   Sinorhizobium meliloti
gb:AF117734_2055105 Mus musculus glycerol kinase-like protein 2 ...   164   2e-39   
gb:AK075761_1170987 Mus musculus adult male testis cDNA, RIKEN f...   164   2e-39   
gb:AE016990_373210 Shigella flexneri 2a str. 2457T section 13 of...   164   2e-39   
gb:AE016770_328844 Escherichia coli CFT073 section 16 of 18 of t...   164   2e-39   
gb:AE005674_73588 Shigella flexneri 2a str. 301, complete genome.     164   2e-39   
pir|C86082|C86082 glycerol kinase [imported] - Escherichia coli ...   164   2e-39   Escherichia coli [E. coli]
pir|A27339|KIECGL glycerol kinase (EC 2.7.1.30) [validated] - Es...   164   2e-39   
sp|Q7UB84|GLPK_SHIFL|GLPK_SHIFL Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   164   2e-39   Shigella flexneri
sp|P08859|GLPK_ECOLI|GLPK_ECOLI Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   164   2e-39   Escherichia coli [E. coli]
sp|Q8FBC3|GLPK_ECOL6|GLPK_ECOL6 Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   164   2e-39   
sp|Q9KDW8|GLPK_BACHD|GLPK_BACHD Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   164   2e-39   Bacillus halodurans
gb:AF542057_520573 Bacillus subtilis var. natto glycerol kinase ...   164   3e-39   
gb:CR555306_107933 Azoarcus sp. EbN1 complete genome.                 164   3e-39   
gb:CR543861_102921 Acinetobacter sp. ADP1 complete genome.            164   3e-39   
sp|P18157|GLPK_BACSU|GLPK_BACSU Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   164   3e-39   Bacillus subtilis
sp|Q893Q3|GLK1_CLOTE|GLK1_CLOTE Glycerol kinase 1 (EC 2.7.1.30) (ATP:glycer...   164   3e-39   Clostridium tetani
gb:AE014296_1133959 Drosophila melanogaster chromosome 3L, compl...   164   3e-39   
gb:AE014296_1133958 Drosophila melanogaster chromosome 3L, compl...   164   3e-39   
gb:AY458643_619741 Uncultured bacterium 561 clone EBAC000-47H08 ...   164   3e-39   
sp|Q92BH6|GLPK_LISIN|GLPK_LISIN Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   164   3e-39   
gb:BT001661_1356434 Drosophila melanogaster RE46914 full insert ...   163   4e-39   
gb:CP000010_864686 Burkholderia mallei ATCC 23344 chromosome 1, ...   163   4e-39   
gb:BX571965_790468 Burkholderia pseudomallei strain K96243, chro...   163   4e-39   
gb:PAU49666_157122 Pseudomonas aeruginosa (orfX), glycerol dfiff...   163   4e-39   
pir|I64086|I64086 glycerol kinase (EC 2.7.1.30) - Haemophilus in...   163   4e-39   Haemophilus influenzae
sp|P44400|GLPK_HAEIN|GLPK_HAEIN Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   163   4e-39   Haemophilus influenzae
sp|Q51390|GLK1_PSEAE|GLK1_PSEAE Glycerol kinase 1 (EC 2.7.1.30) (ATP:glycer...   163   4e-39   Pseudomonas aeruginosa
sp|Q8ENK7|GLPK_OCEIH|GLPK_OCEIH Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   163   6e-39   Oceanobacillus iheyensis
gb:BA000043_737937 Geobacillus kaustophilus HTA426 DNA, complete...   162   8e-39   
gb:AP006627_563578 Bacillus clausii KSM-K16 DNA, complete genome.     162   8e-39   
sp|O66746|GLPK_AQUAE|GLPK_AQUAE Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   162   8e-39   Aquifex aeolicus
gb:CP000013_869478 Borrelia garinii PBi, complete genome.             162   1e-38   
gb:ECU41468_134136 Escherichia coli glycerol kinase (glpK22) gen...   162   1e-38   
sp|O51257|GLPK_BORBU|GLPK_BORBU Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   162   1e-38   Borreliella burgdorferi
sp|Q9WX53|GLPK_THEAQ|GLPK_THEAQ Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   162   1e-38   Thermus aquaticus
sp|O66131|GLPK_THETH|GLPK_THETH Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   161   2e-38   Thermus thermophilus
gb:AP006627_565701 Bacillus clausii KSM-K16 DNA, complete genome.     161   2e-38   
gb:CR378663_93664 Photobacterium profundum SS9; segment 1/12.         160   3e-38   
sp|Q88NX8|GLPK_PSEPK|GLPK_PSEPK Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   160   3e-38   Pseudomonas putida
gb:AF076290_476807 Brucella melitensis Bme18 (bme18) gene, parti...   160   4e-38   
gb:AE017333_446865 Bacillus licheniformis DSM 13, complete genom...   160   4e-38   
pir|AG3612|AG3612 glycerol kinase (EC 2.7.1.30) [imported] - Bru...   160   4e-38   Brucella melitensis
sp|Q8DBM6|GLPK_VIBVU|GLPK_VIBVU Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   160   4e-38   Vibrio vulnificus
sp|Q8YBR2|GLPK_BRUME|GLPK_BRUME Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   160   4e-38   
gb:AY588240_630450 Lactobacillus sakei glycerol metabolism opero...   160   5e-38   
gb:AE012798_285675 Chlorobium tepidum TLS section 19 of 194 of t...   160   5e-38   
sp|Q87M72|GLPK_VIBPA|GLPK_VIBPA Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   160   5e-38   
sp|Q8FWK8|GLPK_BRUSU|GLPK_BRUSU Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   159   1e-37   Brucella suis bv. 1
gb:AGA439353_1281916 Anopheles gambiae BAC clone 30E5.                158   1e-37   
gb:AF506980_517588 Borrelia hermsii glycerol kinase (glpK) gene,...   158   1e-37   
gb:CP000021_872987 Vibrio fischeri ES114 chromosome II, complete...   156   7e-37   
sp|Q8XUY1|GLPK_RALSO|GLPK_RALSO Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   156   7e-37   Ralstonia solanacearum
sp|Q8PDI0|GLPK_XANCP|GLPK_XANCP Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   155   9e-37   Xanthomonas campestris pv. campestris
sp|Q8E794|GLPK_STRA3|GLPK_STRA3 Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   155   9e-37   
gb:AF354273_504054 Lactobacillus rhamnosus glycerol kinase, alph...   154   2e-36   
pir|B82578|B82578 glycerol kinase XF2268 [imported] - Xylella fa...   154   2e-36   Xylella fastidiosa
sp|Q9PB76|GLPK_XYLFA|GLPK_XYLFA Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   154   2e-36   Xylella fastidiosa
sp|Q7WF38|GLPK_BORBR|GLPK_BORBR Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   154   2e-36   Bordetella bronchiseptica
gb:ECU94355_134959 Enterococcus casseliflavus glycerol kinase (g...   154   3e-36   
sp|O34153|GLPK_ENTCA|GLPK_ENTCA Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   154   3e-36   Enterococcus casseliflavus
sp|Q87BZ2|GLPK_XYLFT|GLPK_XYLFT Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   154   4e-36   Xylella fastidiosa
sp|P57944|GLPK_PASMU|GLPK_PASMU Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   154   4e-36   Pasteurella multocida
gb:CP000003_861354 Streptococcus pyogenes MGAS10394, complete ge...   153   5e-36   
sp|Q99YI7|GLPK_STRPY|GLPK_STRPY Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   153   5e-36   Streptococcus pyogenes
sp|Q8NZW9|GLPK_STRP8|GLPK_STRP8 Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   153   5e-36   Streptococcus pyogenes serotype M18
sp|Q8K665|GLPK_STRP3|GLPK_STRP3 Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   153   5e-36   Streptococcus pyogenes serotype M3
gb:AE017267_422355 Bacillus cereus ATCC 10987, section 4 of 18 o...   152   8e-36   
sp|Q9CG64|GLPK_LACLA|GLPK_LACLA Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   152   8e-36   Lactococcus lactis subsp. lactis
gb:AY596297_632032 Haloarcula marismortui ATCC 43049 chromosome ...   152   1e-35   
gb:AE011661_275321 Xanthomonas axonopodis pv. citri str. 306, se...   152   1e-35   
sp|Q8PQG7|GLPK_XANAC|GLPK_XANAC Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   152   1e-35   Xanthomonas citri
sp|Q7NJT1|GLPK_GLOVI|GLPK_GLOVI Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   152   1e-35   Gloeobacter violaceus
sp|Q7VSU7|GLPK_BORPE|GLPK_BORPE Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   152   1e-35   Bordetella pertussis
gb:CP000033_90093 Lactobacillus acidophilus NCFM, complete genome.    151   2e-35   
sp|Q7P1G2|GLPK_CHRVO|GLPK_CHRVO Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   151   2e-35   Chromobacterium violaceum
gb:AY871959_2150123 Synthetic construct hypothetical protein (FT...   151   2e-35   
gb:AE014296_1134253 Drosophila melanogaster chromosome 3L, compl...   151   2e-35   
gb:AJ749949_530587 Francisella tularensis subsp. tularensis comp...   151   2e-35   
sp|Q98M73|GLPK_RHILO|GLPK_RHILO Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   150   3e-35   Mesorhizobium loti
sp|Q9HNS5|GLPK_HALN1|GLPK_HALN1 Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   150   3e-35   Halobacterium sp.
sp|Q97N78|GLPK_STRPN|GLPK_STRPN Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   150   4e-35   
sp|Q7NC65|GLPK_MYCGA|GLPK_MYCGA Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   150   4e-35   
gb:AB127974_1201322 Trypanosoma congolense mRNA for glycerol kin...   150   5e-35   
gb:AY051535_1290129 Drosophila melanogaster GH18690 full length ...   149   7e-35   
gb:AP008227_579572 Thermus thermophilus HB8 plasmid pTT27 DNA, c...   149   7e-35   
gb:CP000009_864070 Gluconobacter oxydans 621H, complete genome.       149   9e-35   
sp|Q83D14|GLPK_COXBU|GLPK_COXBU Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   149   1e-34   Coxiella burnetii
gb:AB127973_1201321 Trypanosoma congolense mRNA for glycerol kin...   148   1e-34   
gb:TACID4_196853 Thermoplasma acidophilum complete genome; segme...   148   1e-34   
gb:EFU94356_135377 Enterococcus faecalis glycerol kinase (glpK) ...   148   1e-34   
sp|O34154|GLPK_ENTFA|GLPK_ENTFA Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   148   1e-34   Enterococcus faecalis
sp|Q8YW05|GLPK_ANASP|GLPK_ANASP Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   148   2e-34   Anabaena sp.
gb:AY391774_1604547 Pichia farinosa glycerol kinase GUT1 (GUT1) ...   147   4e-34   
gb:BX572604_803318 Rhodopseudomonas palustris CGA009 complete ge...   147   4e-34   
sp|Q891B8|GLK2_CLOTE|GLK2_CLOTE Glycerol kinase 2 (EC 2.7.1.30) (ATP:glycer...   145   1e-33   Clostridium tetani
gb:TBR319055_1399307 Trypanosoma brucei mRNA for glycerolkinase ...   145   2e-33   
sp|Q9NJP9|GLPK_TRYBB|GLPK_TRYBB Glycerol kinase, glycosomal (EC 2.7.1.30) (...   145   2e-33   Trypanosoma brucei brucei
sp|Q88YD9|GLK2_LACPL|GLK2_LACPL Glycerol kinase 2 (EC 2.7.1.30) (ATP:glycer...   144   2e-33   Lactobacillus plantarum
sp|Q88ZF1|GLK1_LACPL|GLK1_LACPL Glycerol kinase 1 (EC 2.7.1.30) (ATP:glycer...   144   3e-33   Lactobacillus plantarum
gb:AE017308_437916 Mycoplasma mobile 163K complete genome.            143   5e-33   
gb:CR382139_1673101 Debaryomyces hansenii chromosome G of strain...   143   6e-33   
gb:MMY512637_149260 Mycoplasma mycoides subsp. mycoides SC parti...   143   6e-33   
sp|Q89UK6|GLPK_BRAJA|GLPK_BRAJA Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   143   6e-33   Bradyrhizobium japonicum
gb:BX842642_822283 Mycoplasma mycoides subsp. mycoides SC genomi...   142   1e-32   
gb:AB039932_6417 Agrobacterium rhizogenes plasmid pRi1724 DNA, V...   142   1e-32   
sp|Q8EVD0|GLPK_MYCPE|GLPK_MYCPE Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   140   3e-32   Mycoplasma penetrans
sp|P32190|GLPK_YEAST|GLPK_YEAST Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   139   7e-32   Saccharomyces cerevisiae [brewer's yeast]
gb:AY372455_614087 Uncultured marine alpha proteobacterium HOT2C...   139   1e-31   
sp|P74260|GLPK_SYNY3|GLPK_SYNY3 Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   139   1e-31   Synechocystis sp.
sp|Q9X6C9|GLPK_THEBO|GLPK_THEBO Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   138   2e-31   Thermus brockianus
sp|Q98QY9|GLPK_MYCPU|GLPK_MYCPU Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   137   3e-31   Mycoplasma pulmonis
sp|Q9HY41|GLK2_PSEAE|GLK2_PSEAE Glycerol kinase 2 (EC 2.7.1.30) (ATP:glycer...   137   3e-31   Pseudomonas aeruginosa
gb:CR382125_1657236 Kluyveromyces lactis strain NRRL Y-1140 chro...   136   8e-31   
sp|P47284|GLPK_MYCGE|GLPK_MYCGE Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   135   1e-30   Mycoplasma genitalium
gb:AE016816_1746623 Ashbya gossypii (= Eremothecium gossypii) AT...   135   2e-30   
gb:AF274062_494560 Lactobacillus rhamnosus ATP-dependent glycero...   135   2e-30   
gb:AE011383_272356 Leptospira interrogans serovar lai str. 56601...   134   2e-30   
gb:CR380951_1650102 Candida glabrata strain CBS138 chromosome E ...   134   4e-30   
gb:CP000031_84176 Silicibacter pomeroyi DSS-3, complete genome.       133   5e-30   
gb:AE017354_459782 Legionella pneumophila subsp. pneumophila str...   132   1e-29   
gb:PFMAL13_1191565 Plasmodium falciparum 3D7 chromosome 13, *** ...   131   2e-29   
gb:CR628336_111484 Legionella pneumophila str. Paris complete ge...   131   2e-29   
gb:CR628337_114569 Legionella pneumophila str. Lens complete gen...   130   3e-29   
sp|P75064|GLPK_MYCPN|GLPK_MYCPN Glycerol kinase (EC 2.7.1.30) (ATP:glycerol...   130   3e-29   Mycoplasma pneumoniae
gb:BX569694_776855 Synechococcus sp. WH8102 complete genome; seg...   127   5e-28   
gb:AE017332_445628 Mycoplasma hyopneumoniae 232, complete genome.     126   8e-28   
sp|Q9X049|GLK1_THEMA|GLK1_THEMA Glycerol kinase 1 (EC 2.7.1.30) (ATP:glycer...   123   7e-27   Thermotoga maritima
sp|Q21944|GLPK_CAEEL|GLPK_CAEEL Probable glycerol kinase (EC 2.7.1.30) (ATP...   122   9e-27   Caenorhabditis elegans [roundworm]
gb:AE016864_351825 Pseudomonas syringae pv. tomato str. DC3000 s...   120   4e-26   
gb:AF543469_520693 Uncultured bacterium plasmid pAK102 GlpK (glp...   115   2e-24   
gb:AY570697_1337918 Dictyocaulus viviparus isolate L3i53 putativ...   112   2e-23   
gb:BX950851_840691 Erwinia carotovora subsp. atroseptica SCRI104...   107   3e-22   
gb:BX936398_835463 Yersinia pseudotuberculosis IP32953 genome, c...   107   4e-22   
pir|AD0402|AD0402 glycerol kinase (EC 2.7.1.30) [imported] - Yer...   107   4e-22   Yersinia pestis
pir|A87401|A87401 glycerol kinase [imported] - Caulobacter cresc...   106   9e-22   Caulobacter vibrioides
gb:BC050033_2100323 Mus musculus RIKEN cDNA C330018K18 gene, mRN...   105   2e-21   
gb:AK090901_1913358 Homo sapiens cDNA FLJ33582 fis, clone BRAMY2...   103   6e-21   
gb:AK127641_1916836 Homo sapiens cDNA FLJ45739 fis, clone KIDNE2...   103   7e-21   
gb:SCO939130_180670 Streptomyces coelicolor A3(2) complete genom...   101   3e-20   
gb:AE011512_273800 Leptospira interrogans serovar lai str. 56601...   100   8e-20   
gb:AK049275_1168699 Mus musculus ES cells cDNA, RIKEN full-lengt...    96   1e-18   
gb:BT010125_1357491 Drosophila melanogaster AT16378 full insert ...    89   2e-16   
pir|AE2810|AE2810 glycerol kinase 2 glpK [imported] - Agrobacter...    89   2e-16   Agrobacterium fabrum str. C58
gb:AE014296_1134449 Drosophila melanogaster chromosome 3L, compl...    88   2e-16   
gb:AE014296_1134448 Drosophila melanogaster chromosome 3L, compl...    88   2e-16   
gb:AE014296_1134447 Drosophila melanogaster chromosome 3L, compl...    88   2e-16   
gb:CP000033_89726 Lactobacillus acidophilus NCFM, complete genome.     87   7e-16   
gb:BC073246_2557098 Xenopus laevis MGC80591 protein, mRNA (cDNA ...    86   1e-15   
gb:AJ719390_2501577 Gallus gallus mRNA for hypothetical protein,...    84   3e-15   
gb:AF496515_516411 Lactobacillus delbrueckii subsp. lactis glyce...    84   6e-15   
gb:AE017203_404478 Lactobacillus johnsonii NCC 533, section 4 of...    81   3e-14   
gb:AE013599_1131352 Drosophila melanogaster chromosome 2R, compl...    80   5e-14   
gb:AE013599_1131351 Drosophila melanogaster chromosome 2R, compl...    80   5e-14   
pir|F72377|F72377 gluconate kinase - Thermotoga maritima (strain...    79   2e-13   Thermotoga maritima
gb:U88181_1406702 Caenorhabditis elegans cosmid C55B6, complete ...    77   6e-13   
gb:U88181_1406701 Caenorhabditis elegans cosmid C55B6, complete ...    77   6e-13   
pir|T25663|T25663 hypothetical protein C55B6.1 - Caenorhabditis ...    77   6e-13   Caenorhabditis elegans [roundworm]
pir|AB1204|AB1204 glycerol kinase homolog lmo1034 [imported] - L...    75   3e-12   Listeria monocytogenes
gb:AE017325_443483 Listeria monocytogenes str. 4b F2365, section...    74   5e-12   
pir|G69468|G69468 carbohydrate kinase, FGGY family homolog - Arc...    69   2e-10   Archaeoglobus fulgidus
gb:AP006627_564319 Bacillus clausii KSM-K16 DNA, complete genome.      64   6e-09   
gb:AL935255_551103 Lactobacillus plantarum strain WCFS1 complete...    63   8e-09   
gb:BA000011_665608 Thermoplasma volcanium GSS1 DNA, complete gen...    62   1e-08   
gb:MC140_143030 M.capricolum DNA for CONTIG MC140.                     62   1e-08   
pir|S77787|S77787 probable glycerol kinase (EC 2.7.1.30) - Mycop...    62   1e-08   Mycoplasma capricolum
gb:AE014296_1134450 Drosophila melanogaster chromosome 3L, compl...    62   2e-08   
gb:BA000043_738518 Geobacillus kaustophilus HTA426 DNA, complete...    62   2e-08   
gb:AF092042_478590 Lactococcus lactis subsp. lactis (Lactobacill...    60   7e-08   
gb:AF092041_478584 Lactococcus lactis subsp. lactis strain IO-1 ...    60   7e-08   
sp|Q9CFG8|XYLB_LACLA|XYLB_LACLA Xylulose kinase (EC 2.7.1.17) (Xylulokinase...    60   9e-08   Lactococcus lactis subsp. lactis
gb:BT001770_1356543 Drosophila melanogaster RH11619 full insert ...    59   2e-07   
gb:AY231676_1176969 Drosophila yakuba clone yak-em_CG8298 mRNA s...    59   2e-07   
gb:AE017261_420501 Picrophilus torridus DSM 9790, complete genome.     59   2e-07   
gb:CP000033_88661 Lactobacillus acidophilus NCFM, complete genome.     59   2e-07   
pir|H86897|H86897 gluconokinase (EC 2.7.1.12) [imported] - Lacto...    59   2e-07   Lactococcus lactis subsp. lactis
gb:AE017271_423520 Bacillus cereus ATCC 10987, section 8 of 18 o...    59   2e-07   
gb:CP000029_82642 Staphylococcus epidermidis RP62A, complete gen...    57   6e-07   
pir|H83460|H83460 probable carbohydrate kinase PA1487 [imported]...    57   6e-07   Pseudomonas aeruginosa
gb:AF001974_467156 Thermoanaerobacter ethanolicus putative TrkG ...    56   1e-06   
gb:CP000010_865489 Burkholderia mallei ATCC 23344 chromosome 1, ...    56   1e-06   
gb:BA000028_697576 Oceanobacillus iheyensis HTE831 DNA, complete...    56   1e-06   
gb:AE017005_377145 Bacillus cereus ATCC 14579 section 8 of 18 of...    56   1e-06   
gb:AE016750_323695 Staphylococcus epidermidis ATCC 12228, sectio...    56   1e-06   
gb:BX571856_782007 Staphylococcus aureus subsp. aureus strain MR...    55   2e-06   
gb:BA000028_697505 Oceanobacillus iheyensis HTE831 DNA, complete...    55   2e-06   
gb:CP000046_92588 Staphylococcus aureus subsp. aureus COL, compl...    55   2e-06   
gb:BA000033_712716 Staphylococcus aureus subsp. aureus MW2 DNA, ...    55   3e-06   
gb:CR378664_93875 Photobacterium profundum SS9; segment 2/12.          54   4e-06   
pir|C90054|C90054 gluconokinase [imported] - Staphylococcus aure...    54   4e-06   
gb:AE017201_403783 Lactobacillus johnsonii NCC 533, section 2 of...    54   5e-06   
gb:AE017331_445108 Listeria monocytogenes str. 4b F2365, section...    54   7e-06   
pir|AG1413|AG1413 gluconate kinase homolog lmo2712 [imported] - ...    54   7e-06   
gb:AE016957_367164 Enterococcus faecalis V583, section 11 of 11 ...    53   1e-05   
pir|AF1789|AF1789 gluconate kinase homolog lin2860 [imported] - ...    52   1e-05   
gb:AE016948_364659 Enterococcus faecalis V583, section 2 of 11 o...    52   2e-05   
pir|AG0157|AG0157 probable carbohydrate kinase YPO1291 [imported...    52   2e-05   
gb:BX294154_771617 Pirellula sp. strain 1 complete genome; segme...    51   3e-05   
gb:CP000001_853685 Bacillus cereus ZK, complete genome.                50   6e-05   
gb:AE017355_464460 Bacillus thuringiensis serovar konkukian str....    50   6e-05   
gb:AE017275_424614 Bacillus cereus ATCC 10987, section 12 of 18 ...    50   6e-05   
gb:AE017034_383440 Bacillus anthracis str. Ames section 11 of 18...    50   6e-05   
gb:AE017009_378265 Bacillus cereus ATCC 14579 section 12 of 18 o...    50   6e-05   
gb:AE013145_289546 Thermoanaerobacter tengcongensis MB4, section...    50   7e-05   
sp|P35850|XYLB_LACBR|XYLB_LACBR Xylulose kinase (EC 2.7.1.17) (Xylulokinase...    50   7e-05   
gb:BX936398_835968 Yersinia pseudotuberculosis IP32953 genome, c...    50   9e-05   
gb:AE017225_405576 Bacillus anthracis str. Sterne, complete genome.    50   9e-05   
pir|B72396|B72396 sugar kinase, FGGY family - Thermotoga maritim...    50   9e-05   
gb:AE017131_387120 Yersinia pestis biovar Medievalis str. 91001 ...    49   1e-04   
gb:CP000001_850791 Bacillus cereus ZK, complete genome.                49   2e-04   
gb:AE017355_461488 Bacillus thuringiensis serovar konkukian str....    49   2e-04   
pir|C72417|C72417 sugar kinase, FGGY family - Thermotoga maritim...    49   2e-04   
gb:AB052554_7613 Shewanella violacea DNA, dcw gene cluster, part...    49   2e-04   
gb:AE017333_450062 Bacillus licheniformis DSM 13, complete genom...    48   3e-04   
gb:AE017333_449822 Bacillus licheniformis DSM 13, complete genom...    48   3e-04   
gb:AE017283_432057 Propionibacterium acnes KPA171202, complete g...    47   5e-04   
gb:AE016751_323735 Staphylococcus epidermidis ATCC 12228, sectio...    47   5e-04   
gb:CP000029_82683 Staphylococcus epidermidis RP62A, complete gen...    47   5e-04   
gb:BA000040_729379 Bradyrhizobium japonicum USDA 110 DNA, comple...    47   6e-04   
gb:AE014292_309848 Brucella suis 1330 chromosome II, complete se...    47   6e-04   
pir|AB3632|AB3632 D-ribulokinase (EC 2.7.1.47) [imported] - Bruc...    47   6e-04   
sp|P12011|GNTK_BACSU|GNTK_BACSU Gluconokinase (EC 2.7.1.12) (Gluconate kina...    47   6e-04   
gb:BA000043_738451 Geobacillus kaustophilus HTA426 DNA, complete...    47   8e-04   
gb:BA000030_699012 Streptomyces avermitilis MA-4680 genomic DNA,...    47   8e-04   
sp|P29444|XYLB_KLEPN|XYLB_KLEPN Xylulose kinase (EC 2.7.1.17) (Xylulokinase...    47   8e-04   
gb:AB009593_1425 Tetragenococcus halophilus rbsC, rbsB, xylR, xy...    46   0.001   
pir|E83268|E83268 probable carbohydrate kinase PA3024 [imported]...    46   0.001   
pir|D72753|D72753 probable xylulose kinase APE0017 - Aeropyrum p...    45   0.002   
sp|P46834|GNTK_BACLI|GNTK_BACLI Gluconokinase (EC 2.7.1.12) (Gluconate kina...    45   0.002   
sp|P39211|XYLB_BACSU|XYLB_BACSU Xylulose kinase (EC 2.7.1.17) (Xylulokinase...    45   0.002   
gb:SME591792_186913 Sinorhizobium meliloti 1021 complete chromos...    44   0.005   
pir|D83984|D83984 gluconate kinase gntK [imported] - Bacillus ha...    44   0.005   
gb:AP006627_562897 Bacillus clausii KSM-K16 DNA, complete genome.      44   0.007   
gb:AE016765_327324 Escherichia coli CFT073 section 11 of 18 of t...    44   0.007   
pir|H91082|H91082 probable kinase [imported] - Escherichia coli ...    44   0.007   
gb:AF045245_472742 Klebsiella pneumoniae D-arabinitol transporte...    43   0.009   
gb:ECU29580_133873 Escherichia coli K-12 genome; approximately 6...    43   0.009   
sp|P55138|YGCE_ECOLI|YGCE_ECOLI Hypothetical sugar kinase ygcE.>pir|D65059|...    43   0.009   
sp|P27155|XYLB_STAXY|XYLB_STAXY Xylulose kinase (EC 2.7.1.17) (Xylulokinase...    43   0.009   
gb:BX950851_838853 Erwinia carotovora subsp. atroseptica SCRI104...    43   0.012   
gb:AE017271_423430 Bacillus cereus ATCC 10987, section 8 of 18 o...    43   0.012   
gb:PSP249910_1702293 Piromyces sp. E2 mRNA for D-xylulokinase (x...    42   0.015   
gb:BX294148_769887 Pirellula sp. strain 1 complete genome; segme...    42   0.026   
sp|P21939|XYLB_LACPE|XYLB_LACPE Xylulose kinase (EC 2.7.1.17) (Xylulokinase...    42   0.026   
gb:AP004838_1845767 Oryza sativa (japonica cultivar-group) genom...    41   0.034   
gb:BA000040_734045 Bradyrhizobium japonicum USDA 110 DNA, comple...    41   0.034   
gb:AY005817_584463 Escherichia coli ribitol dehydrogenase (rtlD)...    41   0.034   
gb:AE005674_73192 Shigella flexneri 2a str. 301, complete genome...    41   0.044   
gb:BX571966_795292 Burkholderia pseudomallei strain K96243, chro...    40   0.057   
gb:AE016768_328358 Escherichia coli CFT073 section 14 of 18 of t...    40   0.057   
pir|E86031|E86031 xylulokinase [imported] - Escherichia coli (st...    40   0.057   
sp|P09099|XYLB_ECOLI|XYLB_ECOLI Xylulose kinase (EC 2.7.1.17) (Xylulokinase...    40   0.057   
gb:AE016961_367591 Coxiella burnetii strain RSA 493, section 2 o...    40   0.075   
gb:BX571965_790597 Burkholderia pseudomallei strain K96243, chro...    40   0.098   
gb:AE016865_352116 Pseudomonas syringae pv. tomato str. DC3000 s...    40   0.098   
gb:SME591791_186587 Sinorhizobium meliloti 1021 complete chromos...    40   0.098   
gb:BX936398_838535 Yersinia pseudotuberculosis IP32953 genome, c...    39   0.13    
gb:AE016945_363789 Bacteroides thetaiotaomicron VPI-5482, sectio...    39   0.13    
gb:AE014007_302344 Yersinia pestis KIM section 407 of 415 of the...    39   0.13    
pir|AD0491|AD0491 xylulokinase (EC 2.7.1.17) [imported] - Yersin...    39   0.13    
pir|D83994|D83994 xylose kinase xylB [imported] - Bacillus halod...    39   0.13    
gb:AE016827_344001 Mannheimia succiniciproducens MBEL55E, comple...    39   0.17    
gb:AE017246_415192 Treponema denticola ATCC 35405, section 1 of ...    39   0.22    
gb:AE008869_245291 Salmonella typhimurium LT2, section 173 of 22...    39   0.22    
gb:CP000026_78200 Salmonella enterica subsp. enterica serovar Pa...    39   0.22    
pir|E83353|E83353 xylulose kinase PA2343 [imported] - Pseudomona...    39   0.22    
pir|AD0980|AD0980 xylulokinase (EC 2.7.1.17) - Salmonella enteri...    39   0.22    
gb:BX538352_1359019 Cryptosporidium parvum chromosome 6, complet...    38   0.28    
gb:BA000012_669838 Mesorhizobium loti MAFF303099 DNA, complete g...    38   0.28    
gb:CP000009_864193 Gluconobacter oxydans 621H, complete genome.        38   0.37    
pir|AF3107|AF3107 xylulokinase [imported] - Agrobacterium tumefa...    38   0.37    
pir|F98179|F98179 D-arabinitol kinase (AF045245) [imported] - Ag...    38   0.37    
gb:AE014291_307991 Brucella suis 1330 chromosome I, complete seq...    37   0.49    
gb:CP000031_84906 Silicibacter pomeroyi DSS-3, complete genome.        37   0.49    
pir|AD3425|AD3425 xylulokinase (EC 2.7.1.17) [imported] - Brucel...    37   0.49    
pir|D97221|D97221 xylulose kinase [imported] - Clostridium aceto...    37   0.49    
gb:AK176651_1818639 Arabidopsis thaliana mRNA, complete cds, clo...    37   0.63    
pir|D85354|D85354 hypothetical protein AT4g30310 [imported] - Ar...    37   0.63    
gb:AF378082_505719 Escherichia coli arabitol operon, complete se...    36   1.1     
gb:SAG766853_171372 Streptococcus agalactiae NEM316 complete gen...    36   1.1     
sp|P11553|FUCK_ECOLI|FUCK_ECOLI L-fuculokinase (EC 2.7.1.51) (L-fuculose ki...    36   1.1     
gb:BC068399_2555085 Danio rerio zgc:85818, mRNA (cDNA clone MGC:...    36   1.4     
pir|A95985|A95985 probable sugar kinase protein (EC 2.7.1.-) [im...    36   1.4     
gb:AK082737_1173644 Mus musculus 0 day neonate cerebellum cDNA, ...    35   1.8     
gb:AK009249_1155026 Mus musculus adult male tongue cDNA, RIKEN f...    35   1.8     
gb:BC090077_2111205 Rattus norvegicus cDNA clone MGC:94804 IMAGE...    35   2.4     
gb:AE016768_328377 Escherichia coli CFT073 section 14 of 18 of t...    35   2.4     
sp|Q8X6R3|FUCK_ECO57|FUCK_ECO57 L-fuculokinase (EC 2.7.1.51) (L-fuculose ki...    35   2.4     
gb:BC078117_2560753 Xenopus laevis MGC83632 protein, mRNA (cDNA ...    35   3.1     
gb:AP006840_568462 Symbiobacterium thermophilum DNA, complete ge...    35   3.1     
gb:AE016820_1750045 Ashbya gossypii (= Eremothecium gossypii) AT...    34   4.1     
gb:BA000037_723004 Vibrio vulnificus YJ016 DNA, chromosome I, co...    34   4.1     
gb:AE016827_341677 Mannheimia succiniciproducens MBEL55E, comple...    34   5.4     
gb:AB106334_13202 Gluconobacter oxydans gene for ribulokinase, c...    34   5.4     
gb:AX411894_1468096 Sequence 55 from Patent WO0222807.                 33   7.0     
gb:AY093656_1297627 Dermatophagoides farinae 60 kDa allergen Der...    33   7.0     
gb:CR380948_1649270 Candida glabrata strain CBS138 chromosome B ...    33   9.2     
gb:BA000030_705300 Streptomyces avermitilis MA-4680 genomic DNA,...    33   9.2     
gb:AE016942_363129 Bacteroides thetaiotaomicron VPI-5482, sectio...    33   9.2     
gb:AE012077_279150 Xanthomonas axonopodis pv. citri str. 306, se...    33   9.2     
gb:AX647805_1472530 Sequence 1997 from Patent EP1270724.               21   9.4     


>pir|D96836|D96836 probable glycerol kinase, 69575-71670 [imported] -
            Arabidopsis thaliana>gb:AE005173_895558 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC018849_1538431 Arabidopsis thaliana
            chromosome 1 BAC T21F11 genomic sequence, complete
            sequence.>gb:AY234854_1591782 Arabidopsis thaliana
            glycerol kinase (GLR1) mRNA, complete cds.
          Length = 522

 Score =  331 bits (848), Expect = 2e-89
 Identities = 161/210 (76%), Positives = 177/210 (84%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEGS AIAGAAVQWLRDSL +I SASEIE LA+ V+STGGVYFVPAFNGLFAPWWR+
Sbjct: 310  NYALEGSIAIAGAAVQWLRDSLGIIKSASEIEDLAAMVDSTGGVYFVPAFNGLFAPWWRE 369

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            DARGVCIGITRFTNK HIARAVLESMCFQV+DVLDSM+KDAG+KG + N +GEF+LRVDG
Sbjct: 370  DARGVCIGITRFTNKSHIARAVLESMCFQVKDVLDSMNKDAGEKGSLNNGKGEFLLRVDG 429

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            GAT NNLLMQIQADL+GSPVVRP DIETT          AVG W E +IF SGEK K   
Sbjct: 430  GATANNLLMQIQADLMGSPVVRPVDIETTALGAAYAAGLAVGFWKEADIFESGEKAKNSK 489

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD 393
            +F+P +EE +RKKKV SWCKAV RTFDLAD
Sbjct: 490  VFRPAMEEGIRKKKVASWCKAVERTFDLAD 519



>gb:AY496707_1609123 Pandanus amaryllifolius glycerol kinase (GK)
            mRNA, complete cds.
          Length = 531

 Score =  327 bits (837), Expect = 3e-88
 Identities = 159/210 (75%), Positives = 180/210 (85%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEGS AIAGAAVQWLRD L +I SA+EIE+LA  VE+TGGVYFVPAFNGLFAPWWR+
Sbjct: 320  NYALEGSTAIAGAAVQWLRDGLGIIRSAAEIEELAEGVENTGGVYFVPAFNGLFAPWWRE 379

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            DARGVC+GITRFTNK HIARAVLESMCFQV+DVL+SMHKD GD GE KN  GEF+LRVDG
Sbjct: 380  DARGVCLGITRFTNKGHIARAVLESMCFQVKDVLNSMHKDVGDVGEAKNKEGEFLLRVDG 439

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            GATVNNLLMQIQADLLGSPVVRPADIETT          A G+WT ++IF+SG  ++K T
Sbjct: 440  GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLATGVWTAEQIFASGH-IEKAT 498

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD 393
            +F+P ++EE RKK+ +SWCKAVSRTFDLAD
Sbjct: 499  VFRPKLDEEKRKKRTESWCKAVSRTFDLAD 528



>gb:AY492004_1608744 Glycine max glycerol kinase (GK) mRNA, complete
            cds.
          Length = 519

 Score =  319 bits (818), Expect = 5e-86
 Identities = 158/210 (75%), Positives = 180/210 (85%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEGS AIAGAAVQWLRD L +ISSA+EIE++A +VESTGGVYFVPAFNGLFAPWWR+
Sbjct: 310  NYALEGSVAIAGAAVQWLRDGLGIISSAAEIEEMALQVESTGGVYFVPAFNGLFAPWWRE 369

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            DARGVCIGITRFT+K HIARAVLESMCFQV+DVLDSMHKD+   GE ++ + EF+LRVDG
Sbjct: 370  DARGVCIGITRFTSKGHIARAVLESMCFQVKDVLDSMHKDS---GESESQKTEFLLRVDG 426

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            GATVNNLLMQIQADL+G PV+RPADIETT          A GIW ED IF++ EK+K   
Sbjct: 427  GATVNNLLMQIQADLVGCPVIRPADIETTALGAAYAAGLATGIWKEDFIFNTEEKLKNAR 486

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD 393
            +F+PV+ EEVRKKKVDSWCKAVS+TFDLAD
Sbjct: 487  VFRPVMTEEVRKKKVDSWCKAVSKTFDLAD 516



>gb:OST17804_1698365 Oryza sativa indica(GLA4) genomic DNA, chromosome
            4, BAC clone:t17804.
          Length = 772

 Score =  281 bits (720), Expect = 1e-74
 Identities = 137/188 (72%), Positives = 160/188 (85%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEGS AIAGAAVQWLRDSL +IS+A++IE+LA  V+ +GG+YFVPAFNGLFAPWWRD
Sbjct: 215  NYALEGSIAIAGAAVQWLRDSLGIISTAADIEKLADTVQDSGGIYFVPAFNGLFAPWWRD 274

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            DARG+CIGITRFTNK HIARAVLESMCFQV DVL SMHKDAG+ GEVK+  GEF+LRVDG
Sbjct: 275  DARGICIGITRFTNKGHIARAVLESMCFQVNDVLSSMHKDAGEAGEVKSAEGEFLLRVDG 334

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            GATVNNLLMQIQADLLGSPVVRPADIETT          AVG+W++++IF +G   +  T
Sbjct: 335  GATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVGVWSKEQIF-AGLHKENTT 393

Query: 482  IFKPVIEE 459
            +F+P ++E
Sbjct: 394  VFRPKLDE 401



>gb:AE017228_411058 Mycobacterium avium subsp. paratuberculosis str.
            k10, section 2 of 16 of the complete
            genome.>gb:AE016958_1054462 Mycobacterium avium subsp.
            paratuberculosis str. k10, complete genome.
          Length = 515

 Score =  195 bits (496), Expect = 1e-48
 Identities = 104/209 (49%), Positives = 132/209 (63%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS A+ GAAVQWLRD L +IS A++ E LA +V+  GGVYFVPAF+GLFAP+WR D
Sbjct: 315  YALEGSIAVTGAAVQWLRDQLGIISGAAQSESLARQVDDNGGVYFVPAFSGLFAPYWRSD 374

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +G++RF    H+ARA LE++C+Q RDV+D+M  D+G + E        VL+VDGG
Sbjct: 375  ARGAIVGLSRFNTNAHLARATLEAICYQSRDVVDAMAADSGVRLE--------VLKVDGG 426

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
             T N+L MQIQAD+LG  VVRP   ETT          AVG W +     +    ++D  
Sbjct: 427  ITGNDLCMQIQADVLGVDVVRPVVAETTALGAAYAAGLAVGFWADPGELRA--NWREDKR 484

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRTFDLAD 393
            + P   +E R      W KAV RT D AD
Sbjct: 485  WTPAWSDEQRTAGYAGWHKAVQRTLDWAD 513



>gb:AE016822_339662 Leifsonia xyli subsp. xyli str. CTCB07, complete
            genome.
          Length = 506

 Score =  195 bits (496), Expect = 1e-48
 Identities = 104/211 (49%), Positives = 136/211 (64%), Gaps = 1/211 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            +YALEGS A+ G+ VQWLRD+L +ISSA EIE+LA  VE  GG YFVPA +GLFAP+WR 
Sbjct: 301  HYALEGSIAVTGSLVQWLRDNLGVISSAPEIEELAQTVEDNGGAYFVPALSGLFAPYWRA 360

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAG-DKGEVKNDRGEFVLRVD 666
            DARG  +G+TR+ NK HIARA LE+  FQ R+VLD+++ D+G D  E         L+VD
Sbjct: 361  DARGALVGLTRYVNKGHIARAALEATAFQTREVLDAVNADSGVDLTE---------LKVD 411

Query: 665  GGATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKD 486
            GG   NN LMQ QAD+LG PVVRP   ETT          A G W  + +    +  K+D
Sbjct: 412  GGMIANNTLMQFQADILGVPVVRPVVAETTALGAAYAAGLATGFW--ENLDDLRKNWKED 469

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD 393
              ++P ++   R +++  W KAV++TFD  D
Sbjct: 470  RRWEPKMDAAERDRQLRLWKKAVTKTFDWVD 500



>gb:AP006618_557365 Nocardia farcinica IFM 10152 DNA, complete genome.
          Length = 499

 Score =  192 bits (489), Expect = 7e-48
 Identities = 105/207 (50%), Positives = 134/207 (64%), Gaps = 1/207 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS A+ G+ VQWLRD+L LISSA EIE LA  V+  GG Y VPAF+GLFAP WR D
Sbjct: 296  YALEGSIAVTGSLVQWLRDNLGLISSADEIEPLARSVDDNGGAYIVPAFSGLFAPRWRPD 355

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARGV  G+TRF  K H+ARAVLES  FQ R+V+D+M  DA  +   + D     L+VDGG
Sbjct: 356  ARGVIAGLTRFVTKAHLARAVLESTAFQTREVVDAMRADAESQ---QLDLELTTLKVDGG 412

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWT-EDEIFSSGEKMKKDT 483
             T N+LLMQ Q+D+L  PVVRP   ETT          AVG W+  D+I ++      DT
Sbjct: 413  MTANDLLMQFQSDILDVPVVRPVVAETTALGAAYAAGLAVGYWSGTDDIRAN---WAADT 469

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRTFD 402
             ++P + ++ R   + +W KAV RT++
Sbjct: 470  TWRPTMSDQDRATHLAAWNKAVERTYN 496



>sp|Q828K5|GLK1_STRAW Glycerol kinase 1 (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase 1) (Glycerokinase 1) (GK
            1).>gb:BA000030_704551 Streptomyces avermitilis MA-4680
            genomic DNA, complete genome.
          Length = 512

 Score =  191 bits (484), Expect = 3e-47
 Identities = 102/204 (50%), Positives = 128/204 (62%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS A+ G+ VQW+RD + LI SA+EIE LAS VE  GG YFVPAF+GLFAP+WR D
Sbjct: 311  YALEGSIAVTGSLVQWMRDQMGLIKSAAEIETLASSVEDNGGAYFVPAFSGLFAPYWRSD 370

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARGV  G+TR+  K HIARAVLE+  +Q R++ D+M KD+G +           L+VDGG
Sbjct: 371  ARGVIAGLTRYVTKAHIARAVLEATAWQTREITDAMTKDSGVE--------LAALKVDGG 422

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
             T NNLLMQ  +D L +PVVRP   ETT          AVG WT  E   +    ++   
Sbjct: 423  MTSNNLLMQTLSDFLDAPVVRPMVAETTCLGAAYAAGLAVGFWTNTEDLRA--NWRRAAE 480

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRT 408
            + P +  E R ++  SW KAV RT
Sbjct: 481  WTPNMAAETRDREYKSWLKAVERT 504



>gb:AE017283_432042 Propionibacterium acnes KPA171202, complete
            genome.
          Length = 515

 Score =  189 bits (481), Expect = 6e-47
 Identities = 100/209 (47%), Positives = 133/209 (63%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS A+AG+ VQWLRD+L +  +A +IE LA+ VE  GG YFVPAF+GLFAP+WR D
Sbjct: 312  YALEGSIAVAGSLVQWLRDNLKMFETAPQIEALANTVEDNGGAYFVPAFSGLFAPYWRPD 371

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +G+TR+ N+ HIARAVLES  FQ R+VL++M+ D+G             LRVDGG
Sbjct: 372  ARGALVGLTRYVNRGHIARAVLESTAFQTREVLEAMNADSGVP--------LTELRVDGG 423

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
             T N  LMQ QAD +  PVVRP   ETT          AVG W  +   +  +   +D  
Sbjct: 424  MTANETLMQFQADQVNVPVVRPVVAETTALGAAYAAGIAVGFWEGENDVT--DNWAEDKR 481

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRTFDLAD 393
            ++P +++  R++   +W KAV++TFD  D
Sbjct: 482  WEPKMDKNERERLFRNWKKAVTKTFDWVD 510



>sp|Q826J2|GLK3_STRAW Glycerol kinase 3 (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase 3) (Glycerokinase 3) (GK
            3).>gb:BA000030_705088 Streptomyces avermitilis MA-4680
            genomic DNA, complete genome.
          Length = 505

 Score =  189 bits (481), Expect = 6e-47
 Identities = 101/207 (48%), Positives = 135/207 (65%), Gaps = 1/207 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS A+ G+AVQWLRD + +I SA+E E LA  VE  GG+YFVPAF+GLFAP+WR D
Sbjct: 305  YALEGSIAVTGSAVQWLRDQMKIIKSAAESETLARTVEDNGGIYFVPAFSGLFAPYWRSD 364

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +G+ R+ +  H+ARA LE++C+Q RDV+++M +D+G    V  D    VL+VDGG
Sbjct: 365  ARGAIVGLARYHDNGHLARATLEAICYQSRDVVEAMEQDSG----VHLD----VLKVDGG 416

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKDT 483
             T N+L MQIQAD+LG PV RP   ETT          A G W + DE+ +  ++ K+  
Sbjct: 417  VTANDLCMQIQADILGVPVSRPVVAETTALGAAYAAGLATGFWQDTDELRTHWQESKR-- 474

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRTFD 402
             ++P   E+ R +    W KAV RT D
Sbjct: 475  -WEPQWSEDRRAEGYAGWKKAVERTLD 500



>sp|O69664|GLPK_MYCTU Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>pir|A70793|A70793 probable glycerol kinase -
            Mycobacterium tuberculosis  (strain
            H37RV)>gb:AE000516_23936 Mycobacterium tuberculosis
            CDC1551, complete genome.>gb:BX842583_821805
            Mycobacterium tuberculosis H37Rv complete genome; segment
            12/13.
          Length = 517

 Score =  188 bits (478), Expect = 1e-46
 Identities = 99/209 (47%), Positives = 130/209 (62%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS A+ G+AVQWLRD L +IS A++ E LA +V   GG+YFVPAF+GLFAP+WR D
Sbjct: 317  YALEGSIAVTGSAVQWLRDQLGIISGAAQSEALARQVPDNGGMYFVPAFSGLFAPYWRSD 376

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +G++RF    H+ARA LE++C+Q RDV+D+M  D+G + +        VL+VDGG
Sbjct: 377  ARGAIVGLSRFNTNAHLARATLEAICYQSRDVVDAMEADSGVRLQ--------VLKVDGG 428

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
             T N+L MQIQAD+LG  VVRP   ETT          AVG W       +    ++D  
Sbjct: 429  ITGNDLCMQIQADVLGVDVVRPVVAETTALGVAYAAGLAVGFWAAPSDLRA--NWREDKR 486

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRTFDLAD 393
            + P  +++ R      W KAV RT D  D
Sbjct: 487  WTPTWDDDERAAGYAGWRKAVQRTLDWVD 515



>sp|Q827G1|GLK2_STRAW Glycerol kinase 2 (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase 2) (Glycerokinase 2) (GK
            2).>gb:BA000030_704850 Streptomyces avermitilis MA-4680
            genomic DNA, complete genome.
          Length = 507

 Score =  187 bits (476), Expect = 2e-46
 Identities = 100/206 (48%), Positives = 132/206 (64%), Gaps = 1/206 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            Y LEGS AI GA VQW RD L +I +A EIE LA+ V+  GG Y VPAF+GLFAP+WR D
Sbjct: 304  YCLEGSIAITGALVQWFRDQLGIIRTADEIETLAASVDDNGGAYIVPAFSGLFAPYWRSD 363

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARGV  G+TR+  K H+ARAVLE+  +Q R+V+D+M++D+G +           L+VDGG
Sbjct: 364  ARGVVTGLTRYVTKAHLARAVLEATSWQTREVVDAMYQDSGVR--------ITTLKVDGG 415

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKDT 483
             T NNLLMQ QAD+LG PV+RP   ETT          A G+W + DE+ S     +KD 
Sbjct: 416  MTKNNLLMQHQADVLGVPVIRPRVSETTCLGAAYAAGLATGVWNDLDELKS---HWQKDV 472

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRTF 405
             + P +E   R ++  +W KAV ++F
Sbjct: 473  EWTPSMEASERDREYHNWRKAVEKSF 498



>sp|Q9X1E4|GLK2_THEMA Glycerol kinase 2 (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase 2) (Glycerokinase 2) (GK 2).
          Length = 496

 Score =  186 bits (472), Expect = 6e-46
 Identities = 106/204 (51%), Positives = 130/204 (63%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  I GAAVQWLRD L +IS+A+E E+LA+KV   GGV+FVPAF GL AP+W   
Sbjct: 297  YALEGSIFITGAAVQWLRDGLKIISNAAETEELATKVPDNGGVFFVPAFVGLGAPYWDMY 356

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+ IGITR T + HI RAVLES+ +Q RDV++ M KD+  K E         LRVDGG
Sbjct: 357  ARGLIIGITRGTTREHIVRAVLESIAYQTRDVVEVMEKDSDIKVE--------TLRVDGG 408

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A VNN LMQ QAD+LG PV RP   ETT          AVG W + E  +S    + D  
Sbjct: 409  AVVNNFLMQFQADILGVPVERPVVNETTALGAAYLAGLAVGYWKDQEEIAS--LWQLDRR 466

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRT 408
            F+P +  E R++    W +AVSR+
Sbjct: 467  FEPSMNSEERERLYSKWKEAVSRS 490



>sp|Q9ADA7|GLK1_STRCO Glycerol kinase 1 (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase 1) (Glycerokinase 1) (GK
            1).>gb:SCO939109_175335 Streptomyces coelicolor A3(2)
            complete genome; segment 6/29.
          Length = 512

 Score =  186 bits (471), Expect = 8e-46
 Identities = 97/204 (47%), Positives = 129/204 (63%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS A+ G+ VQW+RD + LIS+A+EIE LA  VE  GG YFVPAF+GLFAP+WR D
Sbjct: 311  YALEGSIAVTGSLVQWMRDQMGLISTAAEIETLALTVEDNGGAYFVPAFSGLFAPYWRSD 370

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARGV  G+TR+  K H+ARAVLE+  +Q R++ D+M KD+G +           L+VDGG
Sbjct: 371  ARGVIAGLTRYVTKAHLARAVLEATAWQTREIADAMTKDSGVE--------LTALKVDGG 422

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
             T NNLLMQ  AD + +PVVRP   ETT          AVG W   +   +    ++   
Sbjct: 423  MTSNNLLMQTLADFVDAPVVRPMVAETTCLGAAYAAGLAVGFWNSTDDLRA--NWRRAAE 480

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRT 408
            + P ++ ++R ++  SW KAV RT
Sbjct: 481  WTPRMDADIRDREYKSWLKAVERT 504



>sp|Q9CB81|GLPK_MYCLE Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>pir|F87198|F87198 glycerol kinase [imported] -
            Mycobacterium leprae>gb:MLEPRTN9_148119 Mycobacterium
            leprae strain TN complete genome; segment 9/10.
          Length = 508

 Score =  185 bits (469), Expect = 1e-45
 Identities = 101/209 (48%), Positives = 129/209 (61%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS A+ G+AVQWLRD L +IS A++ E LA +V   GGVYFVPAF+GLF+P+WR D
Sbjct: 308  YALEGSIAVTGSAVQWLRDQLGIISGAAQSESLARQVVDNGGVYFVPAFSGLFSPYWRSD 367

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +G++RF    H+ARA LE++C+Q RDV+D+M  D+G    V+ D    VL+VDGG
Sbjct: 368  ARGAIVGLSRFNTNAHLARATLEAICYQSRDVVDAMAADSG----VRLD----VLKVDGG 419

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
             T N+L MQIQAD+LG  VVR    ETT          AVG W       +    ++D  
Sbjct: 420  ITSNDLCMQIQADVLGVDVVRSVVAETTALGSAYAAGLAVGFWAGPSDLRA--NWQEDKR 477

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRTFDLAD 393
            + P   E+ R      W KAV RT D  D
Sbjct: 478  WTPTWGEDQRAAAYAGWRKAVQRTLDWVD 506



>sp|Q8CSS0|GLPK_STAEP Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:CP000029_81477 Staphylococcus epidermidis RP62A,
            complete genome.>gb:AE016747_322628 Staphylococcus
            epidermidis ATCC 12228, section 4 of 9 of the complete
            genome.>gb:AE015929_1147297 Staphylococcus epidermidis
            ATCC 12228, complete genome.
          Length = 499

 Score =  184 bits (467), Expect = 2e-45
 Identities = 104/212 (49%), Positives = 131/212 (61%), Gaps = 2/212 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEGS  ++G+A+QWLRD L +I+SA + E  AS+VEST GVY VPAF GL  P+W  
Sbjct: 298  NYALEGSIFVSGSAIQWLRDGLRMINSAPQTENYASRVESTEGVYMVPAFVGLGTPYWDS 357

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            +ARG   G++R T K H  RA LES+C+Q RDV+++M KD+G   EV+N      LRVDG
Sbjct: 358  EARGAIFGLSRGTEKEHFIRATLESLCYQTRDVMEAMSKDSGI--EVQN------LRVDG 409

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            GA  NN +MQ QAD++ S V RP   ETT          AVG W + E     E+ K  T
Sbjct: 410  GAVKNNFIMQFQADIVNSSVERPEIQETTALGAAYLAGLAVGFWDDKE--DIRERWKLQT 467

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRT--FDLAD 393
             FKP ++E+ R K    W KAV  T  F L D
Sbjct: 468  EFKPEMDEDQRHKLYSGWKKAVKATQVFKLED 499



>sp|Q9RJM2|GLK2_STRCO Glycerol kinase 2 (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase 2) (Glycerokinase 2) (GK
            2).>gb:SCO939105_174184 Streptomyces coelicolor A3(2)
            complete genome; segment 2/29.
          Length = 507

 Score =  184 bits (466), Expect = 3e-45
 Identities = 99/207 (47%), Positives = 131/207 (63%), Gaps = 1/207 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS A+ G+AVQWLRD + +I +A+E E+LA  VE  GG+YFVPAF+GLFAP+WR D
Sbjct: 305  YALEGSIAVTGSAVQWLRDQMKIIKTAAESEELARTVEDNGGMYFVPAFSGLFAPYWRSD 364

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +G+ R+ +  H+ARA LE++C+Q RDV+ +M +D+     V  D    VLRVDGG
Sbjct: 365  ARGAIVGLARYNDNAHLARATLEAICYQSRDVVVAMEQDS----SVHLD----VLRVDGG 416

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKDT 483
             T N+L MQIQAD+LG PV RP   ETT          A G W   DE+ +   + ++  
Sbjct: 417  VTANDLCMQIQADILGVPVSRPVVAETTALGAAYAAGLATGFWRHTDELRTHWSESRR-- 474

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRTFD 402
             ++P   EE R +    W  AV RT D
Sbjct: 475  -WEPQWSEERRAQGYAGWKMAVERTLD 500



>sp|Q8R8J4|GLPK_THETN Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:AE013151_289605 Thermoanaerobacter tengcongensis
            MB4, section 178 of 244 of the complete
            genome.>gb:AE008691_1111670 Thermoanaerobacter
            tengcongensis strain MB4, complete genome.
          Length = 497

 Score =  181 bits (459), Expect = 2e-44
 Identities = 102/209 (48%), Positives = 126/209 (60%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  I GAA+QWLRD L +I +A + E+ A KVE T GVY VPAF GL AP+W   
Sbjct: 298  YALEGSIFITGAAIQWLRDELRIIDNAPQSEEYALKVEDTNGVYVVPAFVGLGAPYWDMY 357

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARGV +G+TR   + HI RA LES+ +Q RDVL++M +D+G K +         L+VDGG
Sbjct: 358  ARGVIVGLTRGAKREHIIRATLESIAYQTRDVLEAMQEDSGIKLQ--------ALKVDGG 409

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A+ NN LMQ QAD+LG PV RP  IETT          AVG W   E       +  D  
Sbjct: 410  ASANNFLMQFQADILGVPVDRPQVIETTALGAAYLAGLAVGFWNSREEIEKNWNI--DRR 467

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRTFDLAD 393
            F+P +EEE R+K    W KAV R    A+
Sbjct: 468  FEPAMEEEKREKLYRGWKKAVERAMKWAE 496



>sp|Q97XW1|GLK1_SULSO Glycerol kinase 1 (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase 1) (Glycerokinase 1) (GK
            1).>pir|A99319|A99319 transporter/facilitator [imported]
            - Sulfolobus solfataricus>gb:AE006773_222420 Sulfolobus
            solfataricus P2 section 132 of 272 of the complete
            genome.>gb:AE006641_1108268 Sulfolobus solfataricus P2,
            complete genome.
          Length = 501

 Score =  180 bits (457), Expect = 4e-44
 Identities = 104/208 (50%), Positives = 124/208 (59%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  I GAAVQW RD L  I  + EIE LAS VE  GGVYFVPAF GL AP+W   
Sbjct: 297  YALEGSIFITGAAVQWFRDGLRAIDVSDEIEPLASNVEDNGGVYFVPAFVGLGAPYWDPY 356

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+ IGITR T K HIARA+LESM +Q RDV++ M K++G             L+VDGG
Sbjct: 357  ARGLIIGITRGTTKAHIARAILESMAYQTRDVIEVMQKESGISIN--------SLKVDGG 408

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  +NLLMQ QAD+LG  V+RP  +ETT           VG+W   E   S  K+ K+  
Sbjct: 409  AAKDNLLMQFQADILGIKVIRPKVMETTSMGVAMLAGLGVGLWNSLEELRSIWKVDKE-- 466

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRTFDLA 396
            F P + EE R+     W +AV R    A
Sbjct: 467  FIPSMSEEKRRALYSGWKEAVKRAMGWA 494



>sp|Q9RT38|GLPK_DEIRA Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>pir|G75337|G75337 glycerol kinase - Deinococcus
            radiodurans (strain R1)>gb:AE002031_42179 Deinococcus
            radiodurans R1 section 168 of 229 of the complete
            chromosome 1.>gb:AE000513_883074 Deinococcus radiodurans
            R1 complete chromosome 1.
          Length = 501

 Score =  180 bits (456), Expect = 5e-44
 Identities = 104/210 (49%), Positives = 134/210 (63%), Gaps = 1/210 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  I GA VQWLRD LN+I S++EIE LA  V+S+ GV  VPAF GL AP+W   
Sbjct: 299  YALEGSVFIGGAVVQWLRDGLNIIRSSTEIEALARTVDSSEGVMLVPAFVGLGAPYWDAY 358

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +GITR T K HIARA LE++ +Q  ++L++M KD+G   E+K       LRVDGG
Sbjct: 359  ARGTMVGITRGTTKAHIARAALEAVAYQSAELLEAMQKDSG--VELKE------LRVDGG 410

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIW-TEDEIFSSGEKMKKDT 483
            A+ N+L+MQ QAD+LG PV+RP   ETT          AVG W + D+I     + ++D 
Sbjct: 411  ASTNDLMMQFQADILGVPVIRPKVTETTALGAAYLAGLAVGYWKSTDDI---AHQWQEDK 467

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD 393
             F+P + EE R K +  W KAV+R  D  D
Sbjct: 468  RFEPQMSEEERSKLMRRWKKAVARARDWED 497



>gb:AK088373_1175363 Mus musculus 2 days neonate thymus thymic cells
            cDNA, RIKEN full-length enriched library,
            clone:E430014D11 product:glycerol kinase, full insert
            sequence.
          Length = 553

 Score =  179 bits (454), Expect = 8e-44
 Identities = 95/206 (46%), Positives = 134/206 (65%), Gaps = 2/206 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS AIAGA ++WLRD+L +I S+ EIE+LA +V ++ G YFVPAF+GL+AP+W   
Sbjct: 316  YALEGSVAIAGAVIRWLRDNLGIIKSSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPS 375

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+T+FTNKCHIA A LE++CFQ R++LD+M++D G             L+VDGG
Sbjct: 376  ARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS--------HLQVDGG 427

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTX--XXXXXXXXXAVGIWTEDEIFSSGEKMKKD 486
             T N +LMQ+QAD+L  PVV+P+  ETT             VG+W+ +    S   M++ 
Sbjct: 428  MTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMER- 486

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
              F+P I  E  + +  +W KAV ++
Sbjct: 487  --FEPQINAEESEIRYSTWKKAVMKS 510



>gb:AK044308_1166907 Mus musculus adult retina cDNA, RIKEN full-length
            enriched library, clone:A930006K13 product:glycerol
            kinase, full insert sequence.
          Length = 559

 Score =  179 bits (454), Expect = 8e-44
 Identities = 95/206 (46%), Positives = 134/206 (65%), Gaps = 2/206 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS AIAGA ++WLRD+L +I S+ EIE+LA +V ++ G YFVPAF+GL+AP+W   
Sbjct: 322  YALEGSVAIAGAVIRWLRDNLGIIKSSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPS 381

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+T+FTNKCHIA A LE++CFQ R++LD+M++D G             L+VDGG
Sbjct: 382  ARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS--------HLQVDGG 433

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTX--XXXXXXXXXAVGIWTEDEIFSSGEKMKKD 486
             T N +LMQ+QAD+L  PVV+P+  ETT             VG+W+ +    S   M++ 
Sbjct: 434  MTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMER- 492

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
              F+P I  E  + +  +W KAV ++
Sbjct: 493  --FEPQINAEESEIRYSTWKKAVMKS 516



>pir|JE0391|JE0391 glycerol kinase (EC 2.7.1.30) - Flavobacterium
            meningosepticum
          Length = 498

 Score =  179 bits (454), Expect = 8e-44
 Identities = 94/205 (45%), Positives = 126/205 (61%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            +YALEGS  + GAA+QWLRD L +I  A+E+  LA  V+  GGVYFVPA  GL AP+W  
Sbjct: 298  SYALEGSVFVGGAAIQWLRDGLKIIHDAAEVSTLAGSVKDNGGVYFVPALTGLGAPYWDQ 357

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG  +GITR T   H+ARA LE + FQV D++ +M  DAG +           LRVDG
Sbjct: 358  YARGTIVGITRGTTDAHVARATLEGIAFQVYDIVKAMEADAGTESS--------ELRVDG 409

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            GA+ +NLLMQIQ+DL G  ++RP  +ETT          AVG W   +   S   ++K+ 
Sbjct: 410  GASASNLLMQIQSDLFGFKIIRPQTLETTALGAAYLAGLAVGFWESIDEIQSQWIIEKE- 468

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRT 408
             F+P +E++   K ++SW KAV R+
Sbjct: 469  -FQPALEKDQVNKMINSWHKAVERS 492



>sp|Q64516|GLPK_MOUSE Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:BC003767_2089324 Mus musculus glycerol kinase,
            transcript variant 1, mRNA (cDNA clone MGC:5951
            IMAGE:3593896), complete cds.>gb:MMU48403_2121624 Mus
            musculus glycerol kinase (Gyk) mRNA, complete cds.
          Length = 524

 Score =  179 bits (454), Expect = 8e-44
 Identities = 95/206 (46%), Positives = 134/206 (65%), Gaps = 2/206 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS AIAGA ++WLRD+L +I S+ EIE+LA +V ++ G YFVPAF+GL+AP+W   
Sbjct: 316  YALEGSVAIAGAVIRWLRDNLGIIKSSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPS 375

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+T+FTNKCHIA A LE++CFQ R++LD+M++D G             L+VDGG
Sbjct: 376  ARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS--------HLQVDGG 427

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTX--XXXXXXXXXAVGIWTEDEIFSSGEKMKKD 486
             T N +LMQ+QAD+L  PVV+P+  ETT             VG+W+ +    S   M++ 
Sbjct: 428  MTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMER- 486

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
              F+P I  E  + +  +W KAV ++
Sbjct: 487  --FEPQINAEESEIRYSTWKKAVMKS 510



>gb:AY335747_2144965 Synthetic construct Homo sapiens glycerol kinase
            (GK) mRNA, partial cds.
          Length = 525

 Score =  178 bits (451), Expect = 2e-43
 Identities = 94/206 (45%), Positives = 134/206 (65%), Gaps = 2/206 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS AIAGA ++WLRD+L +I ++ EIE+LA +V ++ G YFVPAF+GL+AP+W   
Sbjct: 316  YALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPS 375

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+T+FTNKCHIA A LE++CFQ R++LD+M++D G             L+VDGG
Sbjct: 376  ARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS--------HLQVDGG 427

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTX--XXXXXXXXXAVGIWTEDEIFSSGEKMKKD 486
             T N +LMQ+QAD+L  PVV+P+  ETT             VG+W+ +    S   M++ 
Sbjct: 428  MTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMER- 486

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
              F+P I  E  + +  +W KAV ++
Sbjct: 487  --FEPQINAEESEIRYSTWKKAVMKS 510



>gb:HSGLYK_2013508 H.sapiens mRNA for glycerol kinase.
          Length = 395

 Score =  178 bits (451), Expect = 2e-43
 Identities = 94/206 (45%), Positives = 134/206 (65%), Gaps = 2/206 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS AIAGA ++WLRD+L +I ++ EIE+LA +V ++ G YFVPAF+GL+AP+W   
Sbjct: 187  YALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPS 246

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+T+FTNKCHIA A LE++CFQ R++LD+M++D G             L+VDGG
Sbjct: 247  ARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS--------HLQVDGG 298

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTX--XXXXXXXXXAVGIWTEDEIFSSGEKMKKD 486
             T N +LMQ+QAD+L  PVV+P+  ETT             VG+W+ +    S   M++ 
Sbjct: 299  MTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMER- 357

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
              F+P I  E  + +  +W KAV ++
Sbjct: 358  --FEPQINAEESEIRYSTWKKAVMKS 381



>gb:HSA252550_2001712 Homo sapiens partial GK gene for glycerol
            kinase, exon 1 (glycerol kinase deficiency case).
          Length = 559

 Score =  178 bits (451), Expect = 2e-43
 Identities = 94/206 (45%), Positives = 134/206 (65%), Gaps = 2/206 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS AIAGA ++WLRD+L +I ++ EIE+LA +V ++ G YFVPAF+GL+AP+W   
Sbjct: 322  YALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPS 381

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+T+FTNKCHIA A LE++CFQ R++LD+M++D G             L+VDGG
Sbjct: 382  ARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS--------HLQVDGG 433

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTX--XXXXXXXXXAVGIWTEDEIFSSGEKMKKD 486
             T N +LMQ+QAD+L  PVV+P+  ETT             VG+W+ +    S   M++ 
Sbjct: 434  MTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMER- 492

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
              F+P I  E  + +  +W KAV ++
Sbjct: 493  --FEPQINAEESEIRYSTWKKAVMKS 516



>gb:HSA252550_2001711 Homo sapiens partial GK gene for glycerol
            kinase, exon 1 (glycerol kinase deficiency case).
          Length = 553

 Score =  178 bits (451), Expect = 2e-43
 Identities = 94/206 (45%), Positives = 134/206 (65%), Gaps = 2/206 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS AIAGA ++WLRD+L +I ++ EIE+LA +V ++ G YFVPAF+GL+AP+W   
Sbjct: 316  YALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPS 375

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+T+FTNKCHIA A LE++CFQ R++LD+M++D G             L+VDGG
Sbjct: 376  ARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS--------HLQVDGG 427

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTX--XXXXXXXXXAVGIWTEDEIFSSGEKMKKD 486
             T N +LMQ+QAD+L  PVV+P+  ETT             VG+W+ +    S   M++ 
Sbjct: 428  MTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMER- 486

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
              F+P I  E  + +  +W KAV ++
Sbjct: 487  --FEPQINAEESEIRYSTWKKAVMKS 510



>gb:BC042421_1983240 Homo sapiens glycerol kinase, transcript variant
            1, mRNA (cDNA clone MGC:42376 IMAGE:4820945), complete
            cds.>gb:BC071595_1988676 Homo sapiens glycerol kinase,
            transcript variant 1, mRNA (cDNA clone MGC:87454
            IMAGE:5276056), complete cds.
          Length = 530

 Score =  178 bits (451), Expect = 2e-43
 Identities = 94/206 (45%), Positives = 134/206 (65%), Gaps = 2/206 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS AIAGA ++WLRD+L +I ++ EIE+LA +V ++ G YFVPAF+GL+AP+W   
Sbjct: 322  YALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPS 381

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+T+FTNKCHIA A LE++CFQ R++LD+M++D G             L+VDGG
Sbjct: 382  ARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS--------HLQVDGG 433

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTX--XXXXXXXXXAVGIWTEDEIFSSGEKMKKD 486
             T N +LMQ+QAD+L  PVV+P+  ETT             VG+W+ +    S   M++ 
Sbjct: 434  MTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMER- 492

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
              F+P I  E  + +  +W KAV ++
Sbjct: 493  --FEPQINAEESEIRYSTWKKAVMKS 516



>gb:CR859709_1183813 Pongo pygmaeus mRNA; cDNA DKFZp469P1225 (from
            clone DKFZp469P1225).
          Length = 530

 Score =  178 bits (451), Expect = 2e-43
 Identities = 94/206 (45%), Positives = 134/206 (65%), Gaps = 2/206 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS AIAGA ++WLRD+L +I ++ EIE+LA +V ++ G YFVPAF+GL+AP+W   
Sbjct: 322  YALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPS 381

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+T+FTNKCHIA A LE++CFQ R++LD+M++D G             L+VDGG
Sbjct: 382  ARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS--------HLQVDGG 433

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTX--XXXXXXXXXAVGIWTEDEIFSSGEKMKKD 486
             T N +LMQ+QAD+L  PVV+P+  ETT             VG+W+ +    S   M++ 
Sbjct: 434  MTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMER- 492

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
              F+P I  E  + +  +W KAV ++
Sbjct: 493  --FEPQINAEESEIRYSTWKKAVMKS 516



>sp|P32189|GLPK_HUMAN Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>pir|I37427|S36175 glycerol kinase (EC 2.7.1.30) -
            human>gb:BC037549_1982210 Homo sapiens glycerol kinase,
            transcript variant 2, mRNA (cDNA clone MGC:40353
            IMAGE:5213716), complete cds.>gb:HSA252550_2001710 Homo
            sapiens partial GK gene for glycerol kinase, exon 1
            (glycerol kinase deficiency case).>gb:HUMGLYKINB_2031563
            Human glycerol kinase (GK) mRNA exons 1-4, complete cds.
          Length = 524

 Score =  178 bits (451), Expect = 2e-43
 Identities = 94/206 (45%), Positives = 134/206 (65%), Gaps = 2/206 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS AIAGA ++WLRD+L +I ++ EIE+LA +V ++ G YFVPAF+GL+AP+W   
Sbjct: 316  YALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPS 375

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+T+FTNKCHIA A LE++CFQ R++LD+M++D G             L+VDGG
Sbjct: 376  ARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS--------HLQVDGG 427

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTX--XXXXXXXXXAVGIWTEDEIFSSGEKMKKD 486
             T N +LMQ+QAD+L  PVV+P+  ETT             VG+W+ +    S   M++ 
Sbjct: 428  MTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMER- 486

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
              F+P I  E  + +  +W KAV ++
Sbjct: 487  --FEPQINAEESEIRYSTWKKAVMKS 510



>gb:BX571874_789623 Photorhabdus luminescens subsp. laumondii TTO1
            complete genome; segment 16/17.
          Length = 507

 Score =  177 bits (448), Expect = 4e-43
 Identities = 98/210 (46%), Positives = 128/210 (60%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEG+  + GA++QWLRD L LI+ A++ E  A+KV+++ GVY VPAF GL AP+W  
Sbjct: 306  NYALEGAVFVGGASIQWLRDELKLIADAADSEYFATKVKNSNGVYVVPAFTGLGAPYWDP 365

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG   G+TR TN  HI RA LES+ +Q RDVLD+M  DAG + +         LRVDG
Sbjct: 366  YARGSIFGLTRGTNSNHIIRATLESIAYQTRDVLDAMQADAGTRLQ--------ALRVDG 417

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            GA  NN LMQ Q+D+LG+ V RP   E+T          AVG W + +   S   ++K+ 
Sbjct: 418  GAVANNFLMQFQSDILGTRVERPVVRESTALGAAFLAGLAVGYWKDLDEVKSKATIEKE- 476

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD 393
             F+P IE   R  K + W KAV+R  D  D
Sbjct: 477  -FRPGIETTERNYKYNGWKKAVARAQDWED 505



>pir|C72254|C72254 glycerol kinase - Thermotoga maritima (strain
            MSB8)>gb:AE001795_39328 Thermotoga maritima MSB8 section
            107 of 136 of the complete genome.>gb:AE000512_1113801
            Thermotoga maritima MSB8, complete genome.
          Length = 482

 Score =  177 bits (448), Expect = 4e-43
 Identities = 101/192 (52%), Positives = 123/192 (64%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  I GAAVQWLRD L +IS+A+E E+LA+KV   GGV+FVPAF GL AP+W   
Sbjct: 297  YALEGSIFITGAAVQWLRDGLKIISNAAETEELATKVPDNGGVFFVPAFVGLGAPYWDMY 356

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+ IGITR T + HI RAVLES+ +Q RDV++ M KD+  K E         LRVDGG
Sbjct: 357  ARGLIIGITRGTTREHIVRAVLESIAYQTRDVVEVMEKDSDIKVE--------TLRVDGG 408

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A VNN LMQ QAD+LG PV RP   ETT          AVG W + E  +S    + D  
Sbjct: 409  AVVNNFLMQFQADILGVPVERPVVNETTALGAAYLAGLAVGYWKDQEEIAS--LWQLDRR 466

Query: 479  FKPVIEEEVRKK 444
            F+P +  E R++
Sbjct: 467  FEPSMNSEERER 478



>sp|Q63060|GLPK_RAT Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase) (GK)
            (ATP-stimulated glucocorticoid-receptor translocation
            promoter) (ASTP).>pir|JN0606|JN0606 ATP-stimulated
            glucocorticoid-receptor translocation promoter protein -
            rat>gb:RATASTP_2131539 Rattus norvegicus mRNA for
            ATP-stimulated glucocorticoid-receptor translocaton
            promoter, complete cds.
          Length = 524

 Score =  177 bits (448), Expect = 4e-43
 Identities = 94/206 (45%), Positives = 133/206 (64%), Gaps = 2/206 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS AIAGA ++WLRD+L +I S+ EIE+LA +V ++ G YFVPAF+ L+AP+W   
Sbjct: 316  YALEGSVAIAGAVIRWLRDNLGIIKSSEEIEKLAKEVGTSYGCYFVPAFSALYAPYWEPS 375

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+T+FTNKCHIA A LE++CFQ R++LD+M++D G             L+VDGG
Sbjct: 376  ARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS--------HLQVDGG 427

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTX--XXXXXXXXXAVGIWTEDEIFSSGEKMKKD 486
             T N +LMQ+QAD+L  PVV+P+  ETT             VG+W+ +    S   M++ 
Sbjct: 428  MTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMER- 486

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
              F+P I  E  + +  +W KAV ++
Sbjct: 487  --FEPQINAEESEIRYSTWKKAVMKS 510



>sp|Q8TZI8|GLPK_PYRFU Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:AE010293_261571 Pyrococcus furiosus DSM 3638,
            section 168 of 173 of the complete
            genome.>gb:AE009950_902352 Pyrococcus furiosus DSM 3638,
            complete genome.
          Length = 490

 Score =  177 bits (448), Expect = 4e-43
 Identities = 100/209 (47%), Positives = 130/209 (62%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEGS  I GAAVQWLRD + +IS+A+E E+LA+K+ES  GVYFVPAF GL AP+W  
Sbjct: 290  NYALEGSIFITGAAVQWLRDGIKIISNAAETEELATKLESNEGVYFVPAFVGLGAPYWDQ 349

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG+ IGITR T + H+ARA LE++ +  RDV++ M K      ++K       LRVDG
Sbjct: 350  FARGLIIGITRGTGREHLARATLEAIAYLTRDVIEEMEKLI----QIKE------LRVDG 399

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            GATVNN LMQ QAD+L   V+RP   ETT          AV  W   E  S  +  + + 
Sbjct: 400  GATVNNFLMQFQADILNKKVIRPVVKETTALGAAYLAGLAVDYWESMEEIS--QLWRAER 457

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRTFDLA 396
            +F+P ++E+ R+K    W +AV R    A
Sbjct: 458  VFEPQMDEKTREKLYRGWKEAVKRALGWA 486



>sp|Q7MYB6|GLPK_PHOLL Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase) (GK).
          Length = 502

 Score =  177 bits (448), Expect = 4e-43
 Identities = 98/210 (46%), Positives = 128/210 (60%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEG+  + GA++QWLRD L LI+ A++ E  A+KV+++ GVY VPAF GL AP+W  
Sbjct: 301  NYALEGAVFVGGASIQWLRDELKLIADAADSEYFATKVKNSNGVYVVPAFTGLGAPYWDP 360

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG   G+TR TN  HI RA LES+ +Q RDVLD+M  DAG + +         LRVDG
Sbjct: 361  YARGSIFGLTRGTNSNHIIRATLESIAYQTRDVLDAMQADAGTRLQ--------ALRVDG 412

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            GA  NN LMQ Q+D+LG+ V RP   E+T          AVG W + +   S   ++K+ 
Sbjct: 413  GAVANNFLMQFQSDILGTRVERPVVRESTALGAAFLAGLAVGYWKDLDEVKSKATIEKE- 471

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD 393
             F+P IE   R  K + W KAV+R  D  D
Sbjct: 472  -FRPGIETTERNYKYNGWKKAVARAQDWED 500



>gb:BC066960_1987189 Homo sapiens glycerol kinase pseudogene 3, mRNA
            (cDNA clone MGC:87453 IMAGE:4821051), complete cds.
          Length = 553

 Score =  176 bits (447), Expect = 5e-43
 Identities = 95/206 (46%), Positives = 133/206 (64%), Gaps = 2/206 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS AIAGA ++WLRD+L +I ++ EIE+LA +V ++ G YFVPAF+GL+AP+W   
Sbjct: 316  YALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPS 375

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+T+FTNKCHIA A LE++CFQ R++LD+M++D G             L+VDGG
Sbjct: 376  ARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS--------HLQVDGG 427

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVG--IWTEDEIFSSGEKMKKD 486
             T N +LMQ+QAD+L  PVV+P   ETT          A G  +W+ +    S   MK+ 
Sbjct: 428  MTSNKILMQLQADILYIPVVKPLMPETTALGAAMAAGAAEGVDVWSLEPEDLSAVTMKR- 486

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
              F+P I  E  + +  +W KAV ++
Sbjct: 487  --FEPQINAEESEIRYSTWKKAVMKS 510



>sp|Q8NLP9|GLPK_CORGL Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:BA000036_720617 Corynebacterium glutamicum ATCC
            13032 DNA, complete genome.>gb:BX927156_834423
            Corynebacterium glutamicum ATCC 13032, IS fingerprint
            type 4-5, complete genome; segment
            9/10.>gb:AX065059_1459443 Sequence 185 from Patent
            WO0100844.
          Length = 509

 Score =  176 bits (447), Expect = 5e-43
 Identities = 103/210 (49%), Positives = 130/210 (61%), Gaps = 2/210 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS ++ G+ VQWLRD+L LI +A  IE LA +VE  GGV+ VPAF GLFAP WR D
Sbjct: 312  YALEGSVSMGGSLVQWLRDNLQLIPNAPAIENLAREVEDNGGVHVVPAFTGLFAPRWRPD 371

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARGV  G+TRF N+ HIARAVLE+  FQ R+V+D+M KDAG   E         LRVDG 
Sbjct: 372  ARGVITGLTRFANRKHIARAVLEANAFQTREVVDAMAKDAGKALE--------SLRVDGA 423

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIW-TEDEIFSSGEKM-KKD 486
               N+LLMQ+QAD LG  V R  D+ETT            G + T DEI    EK+    
Sbjct: 424  MVENDLLMQMQADFLGIDVQRLEDVETTAVGVAFAAGLGSGFFKTTDEI----EKLIAVK 479

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRTFDLA 396
             ++ P + EE R+++   W +AV  ++D A
Sbjct: 480  KVWNPDMSEEERERRYAEWNRAVEHSYDQA 509



>gb:AE017319_441376 Desulfovibrio vulgaris subsp. vulgaris str.
            Hildenborough, section 11 of 12 of the complete
            genome.>gb:AE017285_1074537 Desulfovibrio vulgaris subsp.
            vulgaris str. Hildenborough, complete genome.
          Length = 497

 Score =  176 bits (446), Expect = 7e-43
 Identities = 103/204 (50%), Positives = 120/204 (58%), Gaps = 1/204 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  IAGA VQWLRD L +I +A E+EQLA  V   GGVY VPAF GL AP W   
Sbjct: 298  YALEGSVFIAGAVVQWLRDGLGIIKAAPEVEQLALSVPDNGGVYLVPAFAGLGAPHWDQY 357

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +GITR   K HIARA LES+  Q  D++D M KD+G K           LR DGG
Sbjct: 358  ARGTMVGITRGATKAHIARAALESIALQTLDIMDCMQKDSGIK--------LAALRADGG 409

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIW-TEDEIFSSGEKMKKDT 483
            AT NNLLMQ QAD+LG PV RP   ETT          A G W +EDEI       + D 
Sbjct: 410  ATRNNLLMQFQADVLGVPVERPKVTETTALGAAYLAGLATGFWKSEDEI---ATMWQLDR 466

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSR 411
             F+P + ++ R+  V  W +AV R
Sbjct: 467  RFEPNMSDDKRQHLVYEWQRAVER 490



>sp|Q7UTP4|GLPK_RHOBA Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:BX294139_767050 Pirellula sp. strain 1 complete
            genome; segment 7/24.
          Length = 539

 Score =  175 bits (443), Expect = 1e-42
 Identities = 98/204 (48%), Positives = 122/204 (59%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YA EGS  IAGA VQWLRD L +I S+SE+E LA+ V+ T GVY VPAF GL AP W   
Sbjct: 335  YAYEGSIFIAGAIVQWLRDGLGIIQSSSEVESLAASVDDTDGVYLVPAFAGLGAPHWDAY 394

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+ +G+TR T K HIARA LE + FQV DVLD+M KD+G   E         LRVDGG
Sbjct: 395  ARGILVGLTRGTTKAHIARAALEGIAFQVADVLDAMRKDSGVAIE--------ELRVDGG 446

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  N+LLMQ QAD++G+ VVRP  IETT          A G W +          + D +
Sbjct: 447  AAANDLLMQFQADIIGARVVRPKVIETTAAGAAYVAGLATGFWKDSADIE--RIWETDRV 504

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRT 408
            F+P +  E   ++   W  A+ R+
Sbjct: 505  FEPQMPAEEVARRRRRWAAALERS 528



>sp|Q14409|GKP3_HUMAN Glycerol kinase, testis specific 1 (EC 2.7.1.30)
            (ATP:glycerol 3- phosphotransferase) (Glycerokinase)
            (GK).>gb:HSGKTS1_2013457 H.sapiens mRNA for glycerol
            kinase testis specific 1.
          Length = 553

 Score =  175 bits (443), Expect = 1e-42
 Identities = 94/206 (45%), Positives = 133/206 (64%), Gaps = 2/206 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS AIAGA ++WLRD+L +I ++ EIE+LA +V ++ G YFVPAF+GL+AP+W   
Sbjct: 316  YALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPS 375

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+T+FTNKCHIA A LE++CFQ R++LD+M++D G             L+VDGG
Sbjct: 376  ARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS--------HLQVDGG 427

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVG--IWTEDEIFSSGEKMKKD 486
             T N +LMQ+QAD+L  PVV+P   ETT          A G  +W+ +    S   M++ 
Sbjct: 428  MTSNKILMQLQADILYIPVVKPLMPETTALGAAMAAGAAEGVDVWSLEPEDLSAVTMER- 486

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
              F+P I  E  + +  +W KAV ++
Sbjct: 487  --FEPQINAEESEIRYSTWKKAVMKS 510



>sp|P95907|GLK2_SULSO Glycerol kinase 2 (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase 2) (Glycerokinase 2) (GK
            2).>pir|S74045|S74045 glycerol kinase (EC 2.7.1.30) -
            Sulfolobus solfataricus>gb:SS100KBFR_190312
            S.solfataricus 100 kbp DNA fragment.>gb:AE006820_222926
            Sulfolobus solfataricus P2 section 179 of 272 of the
            complete genome.>gb:AE006641_1108774 Sulfolobus
            solfataricus P2, complete genome.
          Length = 499

 Score =  174 bits (442), Expect = 2e-42
 Identities = 97/204 (47%), Positives = 127/204 (62%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  I GAAVQW RD L  I ++ +IE LA+ V  TGGVYFVPAF GL AP+W   
Sbjct: 296  YALEGSIFITGAAVQWFRDGLRAIDASDDIEPLAASVPDTGGVYFVPAFVGLGAPYWDPY 355

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+ IGITR T K HIARA+LES+ +Q RDV++ M K++G K          +L+VDGG
Sbjct: 356  ARGLIIGITRGTTKAHIARAILESIAYQNRDVIEIMEKESGTKIN--------ILKVDGG 407

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
               +NLLMQ QAD+LG  VVRP  +ET           A+  W  + +    +K   D  
Sbjct: 408  GAKDNLLMQFQADILGIRVVRPKVMETASMGVAMLAGLAINYW--NSLNELKQKWTVDKE 465

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRT 408
            F P I +E R+++ ++W +AV R+
Sbjct: 466  FIPSINKEERERRYNAWKEAVKRS 489



>gb:BX248360_763486 Corynebacterium diphtheriae gravis NCTC13129,
            complete genome; segment 7/8.
          Length = 506

 Score =  174 bits (440), Expect = 3e-42
 Identities = 93/206 (45%), Positives = 129/206 (62%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS A+ G+ VQWLRD+L +I ++  IE LA +V   GGVY VPAF+GLFAP WR D
Sbjct: 308  YALEGSVAMGGSLVQWLRDNLQIIPNSPAIENLAREVPDNGGVYIVPAFSGLFAPRWRPD 367

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARGV +G+TRF N+ H+ARAVLE+  +QVR+V+D+M  D+G +           +RVDGG
Sbjct: 368  ARGVIVGLTRFANRKHLARAVLEATAYQVREVIDAMVADSGVE--------LTEMRVDGG 419

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
              +N LLMQ QAD+L S V RP +IETT           VG W   ++  +  ++  D  
Sbjct: 420  MVMNELLMQFQADVLRSDVTRPKNIETTATGVAYAAGLGVGYWDSLDVLRNMNEV--DKT 477

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRTFD 402
            +   ++ +   + +  W KAV RT++
Sbjct: 478  WHAKMDADKIDELLAEWNKAVERTYN 503



>sp|Q9V207|GLPK_PYRAB Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>pir|H75217|H75217 glycerol kinase (EC 2.7.1.30)
            PAB2406 - Pyrococcus abyssi  (strain
            Orsay)>gb:CNSPAX01_849030 Pyrococcus abyssi complete
            genome; segment 1/6.
          Length = 494

 Score =  173 bits (438), Expect = 6e-42
 Identities = 102/208 (49%), Positives = 124/208 (59%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  I GAAVQWLRD + +I  ASE E LA K+ES  GVYFVPAF GL AP+W   
Sbjct: 294  YALEGSIFITGAAVQWLRDGIKIIKHASETEDLAEKLESNEGVYFVPAFVGLGAPYWDQF 353

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+ IGITR T + H+ARA LE++ +  RDV++ M K  G K           LRVDGG
Sbjct: 354  ARGLIIGITRGTGREHLARATLEAIAYLTRDVIEEMEKLVGIK----------ELRVDGG 403

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            AT N+ LMQ QAD+L   VVRP   ETT          AV  W   E   S  +++K  I
Sbjct: 404  ATANDFLMQFQADILNRRVVRPVVKETTALGAAYLAGLAVDYWESLEEIESLWRVEK--I 461

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRTFDLA 396
            F+P ++EE R+K    W +AV R    A
Sbjct: 462  FEPRMDEETREKLYRGWKEAVKRAMGWA 489



>gb:AP006878_576548 Thermococcus kodakaraensis strain KOD1 DNA,
            complete genome.
          Length = 497

 Score =  172 bits (437), Expect = 7e-42
 Identities = 97/209 (46%), Positives = 126/209 (60%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            +YALEGS  + GAAVQWLRD + +I  ASE E+LA+K+ES  GVYFVPAF GL AP+W  
Sbjct: 292  SYALEGSIFVTGAAVQWLRDGIKIIKHASETEELATKLESNEGVYFVPAFVGLGAPYWDQ 351

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG+ IGITR T + H+ARA LE++ +  RDV+D M K      ++K       LRVDG
Sbjct: 352  FARGIIIGITRGTGREHLARATLEAIAYLTRDVVDEMEKLV----QIKE------LRVDG 401

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            GAT N+ LMQ QAD+L   V+RP   ETT          AV  W +       E  K + 
Sbjct: 402  GATANDFLMQFQADILNRKVIRPVVKETTALGAAYLAGLAVDYWADTR--EIAELWKAER 459

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRTFDLA 396
            IF+P ++E+ R++    W +AV R    A
Sbjct: 460  IFEPKMDEKTRERLYKGWKEAVKRAMGWA 488



>gb:AE017252_416957 Treponema denticola ATCC 35405, section 7 of 10 of
            the complete genome.>gb:AE017226_1070553 Treponema
            denticola ATCC 35405, complete genome.
          Length = 496

 Score =  172 bits (437), Expect = 7e-42
 Identities = 100/208 (48%), Positives = 127/208 (61%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  IAGAAVQWLRD L LI +A E E  A  V  T GVYFVPAF+GL AP+W   
Sbjct: 299  YALEGSSFIAGAAVQWLRDELKLIYTAHETEYYAGLVNDTNGVYFVPAFSGLGAPYWDMY 358

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +G+TR   + HI RAVLE++ +Q +DVL +M KD+  K  +K+      L+VDGG
Sbjct: 359  ARGALLGLTRGAKREHIVRAVLEAIAYQTKDVLYAMEKDS--KINLKS------LKVDGG 410

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  NN LMQ Q+D+L  PV+RP + ETT          AVG W E       + ++++  
Sbjct: 411  ACANNFLMQFQSDILNVPVLRPYEKETTALGAAYLAGLAVGFWKEQGEIKRIQDIERE-- 468

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRTFDLA 396
            F+P +EEE RK     W KAV R+   A
Sbjct: 469  FRPDMEEEKRKTLYAGWKKAVERSMKWA 496



>sp|O93623|GLPK_PYRKO Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>pir|T43888|T43888 glycerol kinase (EC 2.7.1.30)
            [imported] - Pyrococcus kodakaraensis>gb:AB012099_2007
            Pyrococcus kodakaraensis Pk-glpK gene for Glycerol
            Kinase, complete cds.
          Length = 497

 Score =  172 bits (437), Expect = 7e-42
 Identities = 97/209 (46%), Positives = 126/209 (60%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            +YALEGS  + GAAVQWLRD + +I  ASE E+LA+K+ES  GVYFVPAF GL AP+W  
Sbjct: 292  SYALEGSIFVTGAAVQWLRDGIKIIKHASETEELATKLESNEGVYFVPAFVGLGAPYWDQ 351

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG+ IGITR T + H+ARA LE++ +  RDV+D M K      ++K       LRVDG
Sbjct: 352  FARGIIIGITRGTGREHLARATLEAIAYLTRDVVDEMEKLV----QIKE------LRVDG 401

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            GAT N+ LMQ QAD+L   V+RP   ETT          AV  W +       E  K + 
Sbjct: 402  GATANDFLMQFQADILNRKVIRPVVKETTALGAAYLAGLAVDYWADTR--EIAELWKAER 459

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRTFDLA 396
            IF+P ++E+ R++    W +AV R    A
Sbjct: 460  IFEPKMDEKTRERLYKGWKEAVKRAMGWA 488



>gb:BX571856_780722 Staphylococcus aureus subsp. aureus strain
            MRSA252, complete genome.
          Length = 498

 Score =  171 bits (432), Expect = 3e-41
 Identities = 93/205 (45%), Positives = 127/205 (61%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEGS  ++G+A+QWLRD L +I+SA + E  A++V+ST GVY VPAF GL  P+W  
Sbjct: 298  NYALEGSIFVSGSAIQWLRDGLRMINSAPQSESYATRVDSTEGVYVVPAFVGLGTPYWDS 357

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            +ARG   G+TR T K H  RA LES+C+Q RDV+++M KD+G   +V++      LRVDG
Sbjct: 358  EARGAIFGLTRGTEKEHFIRATLESLCYQTRDVMEAMSKDSGI--DVQS------LRVDG 409

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            GA  NN +MQ QAD++ + V RP   ETT          AVG W   +  +   K+++  
Sbjct: 410  GAVKNNFIMQFQADIVNTSVERPEIQETTALGAAYLAGLAVGFWESKDDIAKNWKLEEK- 468

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRT 408
             F P ++E  R+K    W KAV  T
Sbjct: 469  -FDPKMDEGEREKLYRGWKKAVEAT 492



>gb:BA000035_717502 Corynebacterium efficiens YS-314 DNA, complete
            genome.
          Length = 522

 Score =  171 bits (432), Expect = 3e-41
 Identities = 94/206 (45%), Positives = 127/206 (61%), Gaps = 1/206 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS ++ G+ VQWLRDSL +I +A  IE+ A +V   GGV+ VPAF+GLFAP W  +
Sbjct: 326  YALEGSVSMGGSLVQWLRDSLQMIPTAPAIEEFARQVPDNGGVHIVPAFSGLFAPRWHPE 385

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARGV  G+TRF N+ HI RAVLE+  FQ R+V+D+M +DAG + E         LRVDG 
Sbjct: 386  ARGVITGLTRFANRNHICRAVLEATAFQTREVVDAMARDAGKELE--------SLRVDGA 437

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKDT 483
               N LLMQ+QAD+LG  V+RP DIETT            G + + D+I    E +    
Sbjct: 438  MVQNELLMQMQADILGIDVIRPGDIETTALGTAFAAGLGSGFFKDFDQII---ELISIRQ 494

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRTF 405
             + P + E  R++  D+W +AV+  +
Sbjct: 495  TWTPEMTEAERERAYDAWNEAVTHAY 520



>gb:CP000046_91454 Staphylococcus aureus subsp. aureus COL, complete
            genome.
          Length = 498

 Score =  171 bits (432), Expect = 3e-41
 Identities = 93/205 (45%), Positives = 127/205 (61%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEGS  ++G+A+QWLRD L +I+SA + E  A++V+ST GVY VPAF GL  P+W  
Sbjct: 298  NYALEGSIFVSGSAIQWLRDGLRMINSAPQSESYATRVDSTEGVYVVPAFVGLGTPYWDS 357

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            +ARG   G+TR T K H  RA LES+C+Q RDV+++M KD+G   +V++      LRVDG
Sbjct: 358  EARGAIFGLTRGTEKEHFIRATLESLCYQTRDVMEAMSKDSGI--DVQS------LRVDG 409

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            GA  NN +MQ QAD++ + V RP   ETT          AVG W   +  +   K+++  
Sbjct: 410  GAVKNNFIMQFQADIVNTSVERPEIQETTALGAAFLAGLAVGFWESKDDIAKNWKLEEK- 468

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRT 408
             F P ++E  R+K    W KAV  T
Sbjct: 469  -FDPKMDEGEREKLYRGWKKAVEAT 492



>sp|Q99UH3|GLPK_STAAM Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>pir|G89904|G89904 glycerol kinase [imported] -
            Staphylococcus aureus (strain N315)>gb:BA000017_676991
            Staphylococcus aureus subsp. aureus Mu50 DNA, complete
            genome.>gb:BA000018_679577 Staphylococcus aureus subsp.
            aureus N315 genomic DNA, complete genome.
          Length = 498

 Score =  171 bits (432), Expect = 3e-41
 Identities = 93/205 (45%), Positives = 127/205 (61%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEGS  ++G+A+QWLRD L +I+SA + E  A++V+ST GVY VPAF GL  P+W  
Sbjct: 298  NYALEGSIFVSGSAIQWLRDGLRMINSAPQSESYATRVDSTEGVYVVPAFVGLGTPYWDS 357

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            +ARG   G+TR T K H  RA LES+C+Q RDV+++M KD+G   +V++      LRVDG
Sbjct: 358  EARGAIFGLTRGTEKEHFIRATLESLCYQTRDVMEAMSKDSGI--DVQS------LRVDG 409

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            GA  NN +MQ QAD++ + V RP   ETT          AVG W   +  +   K+++  
Sbjct: 410  GAVKNNFIMQFQADIVNTSVERPEIQETTALGAAFLAGLAVGFWESKDDIAKNWKLEEK- 468

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRT 408
             F P ++E  R+K    W KAV  T
Sbjct: 469  -FDPKMDEGEREKLYRGWKKAVEAT 492



>sp|Q8FLY8|GLPK_COREF Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase) (GK).
          Length = 508

 Score =  171 bits (432), Expect = 3e-41
 Identities = 94/206 (45%), Positives = 127/206 (61%), Gaps = 1/206 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS ++ G+ VQWLRDSL +I +A  IE+ A +V   GGV+ VPAF+GLFAP W  +
Sbjct: 312  YALEGSVSMGGSLVQWLRDSLQMIPTAPAIEEFARQVPDNGGVHIVPAFSGLFAPRWHPE 371

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARGV  G+TRF N+ HI RAVLE+  FQ R+V+D+M +DAG + E         LRVDG 
Sbjct: 372  ARGVITGLTRFANRNHICRAVLEATAFQTREVVDAMARDAGKELE--------SLRVDGA 423

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKDT 483
               N LLMQ+QAD+LG  V+RP DIETT            G + + D+I    E +    
Sbjct: 424  MVQNELLMQMQADILGIDVIRPGDIETTALGTAFAAGLGSGFFKDFDQII---ELISIRQ 480

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRTF 405
             + P + E  R++  D+W +AV+  +
Sbjct: 481  TWTPEMTEAERERAYDAWNEAVTHAY 506



>gb:AE013606_298384 Yersinia pestis KIM section 6 of 415 of the
            complete genome.>gb:AE017127_385950 Yersinia pestis
            biovar Medievalis str. 91001 section 1 of 16 of the
            complete genome.>gb:BX936398_834731 Yersinia
            pseudotuberculosis IP32953 genome, complete
            sequence.>gb:AE009952_928567 Yersinia pestis KIM complete
            genome.>gb:AE017042_1142516 Yersinia pestis biovar
            Medievalis str. 91001 complete genome.
          Length = 507

 Score =  170 bits (431), Expect = 4e-41
 Identities = 97/207 (46%), Positives = 123/207 (59%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEG+  I GA++QWLRD L LI  A++ E  A+KV+++ GVY VPAF GL AP+W  
Sbjct: 305  NYALEGAVFIGGASIQWLRDELKLIGDATDSEYFATKVKNSNGVYVVPAFTGLGAPYWDP 364

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG   G+TR  N  HI RA LES+ +Q RDVLD+M  D+G    +K+      LRVDG
Sbjct: 365  YARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLDAMQADSG--ARLKS------LRVDG 416

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            GA  NN LMQ QAD+LG+ V RPA  E+T          A G W  D++     K   + 
Sbjct: 417  GAVANNFLMQFQADILGTRVERPAIRESTALGAAFLAGLATGFW--DDLDEVKSKASIER 474

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRTFD 402
             F+P IE   R  +   W KAV+R  D
Sbjct: 475  EFRPGIETTERDIRYKGWKKAVARARD 501



>gb:BX950851_843001 Erwinia carotovora subsp. atroseptica SCRI1043,
            complete genome.
          Length = 503

 Score =  170 bits (430), Expect = 5e-41
 Identities = 99/211 (46%), Positives = 124/211 (58%), Gaps = 1/211 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEGS  + GA++QWLRD L LI  + + E  A+KV+ T GVY VPAF GL AP+W  
Sbjct: 301  NYALEGSVFVGGASIQWLRDELKLIGDSMDSEYFATKVKDTNGVYVVPAFTGLGAPYWDP 360

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG   G+TR  N  HI RA LES+ FQ RDVLD+M  DAG +  +K+      LRVDG
Sbjct: 361  YARGAIFGLTRGVNANHIIRATLESIAFQTRDVLDAMQADAGTR--LKS------LRVDG 412

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKD 486
            GA  NN LMQ Q+D+LG+ V RP   E+T          A G W + DE+ S   K   +
Sbjct: 413  GAVANNFLMQFQSDILGTRVERPEVRESTALGAAFLAGLATGFWNDLDEVKS---KATIE 469

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD 393
              F+P IE   R  +   W KAV+R  +  D
Sbjct: 470  REFRPSIETVERNVRYSGWQKAVARARNWED 500



>sp|Q8RHZ9|GLPK_FUSNN Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:AE010486_263639 Fusobacterium nucleatum subsp.
            nucleatum ATCC 25586, section 28 of 197 of the complete
            genome.>gb:AE009951_910807 Fusobacterium nucleatum subsp.
            nucleatum ATCC 25586, complete genome.
          Length = 497

 Score =  169 bits (429), Expect = 6e-41
 Identities = 98/205 (47%), Positives = 122/205 (59%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  + GA+VQWLRD L LIS + + E  A KV+ + GVY VPAF GL AP+W   
Sbjct: 299  YALEGSVFVGGASVQWLRDELKLISDSKDTEYFARKVKDSAGVYVVPAFVGLGAPYWDMY 358

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +G+TR  NK HI RA LES+ +Q +DVL +M +D+G K           L+VDGG
Sbjct: 359  ARGAILGLTRGANKNHIIRATLESIAYQTKDVLKAMEEDSGIKLN--------GLKVDGG 410

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIW-TEDEIFSSGEKMKKDT 483
            A  NN LM+ QAD+LG  V RP  +ETT          AVG W  ++EI    +K   D 
Sbjct: 411  AAANNFLMEFQADILGESVKRPTVLETTALGAAYLAGLAVGFWENKNEI---KQKWVLDK 467

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRT 408
             F P + +E R KK   W KAV RT
Sbjct: 468  EFTPNMPKEERDKKYAGWLKAVERT 492



>gb:AE017180_401053 Geobacter sulfurreducens PCA, complete genome.
          Length = 496

 Score =  169 bits (428), Expect = 8e-41
 Identities = 96/204 (47%), Positives = 121/204 (59%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AGAAVQWLRD L +I +++E+E LA+ V   GGVY VPAF GL AP W   
Sbjct: 297  YALEGSVFVAGAAVQWLRDGLGIIRTSAEVETLAASVPDNGGVYLVPAFAGLGAPHWDPY 356

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +GITR T   HIARA LES+ FQ  D+L++M  DA              LRVDGG
Sbjct: 357  ARGALLGITRGTTAGHIARATLESIAFQTADLLEAMEADAATP--------LAELRVDGG 408

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            AT NN+LMQ QADLLG PVVRP   ETT          AVG W +      G   + +  
Sbjct: 409  ATANNMLMQFQADLLGVPVVRPRVRETTALGAAYLAGLAVGYWRDRA--EIGRLWQAEHT 466

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRT 408
            F+P ++ +   +   +W +A+ R+
Sbjct: 467  FEPAMDRDRAAELRSTWSRALERS 490



>sp|Q8NWX7|GLPK_STAAW Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:BA000033_711475 Staphylococcus aureus subsp.
            aureus MW2 DNA, complete genome, strain:MW2.
          Length = 498

 Score =  169 bits (428), Expect = 8e-41
 Identities = 92/205 (44%), Positives = 127/205 (61%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEGS  ++G+A+QWLRD L +I+SA + E  A++V+ST GVY VPAF GL  P+W  
Sbjct: 298  NYALEGSIFVSGSAIQWLRDGLRMINSAPQSESYATRVDSTEGVYVVPAFVGLGTPYWDS 357

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            +ARG   G++R T K H  RA LES+C+Q RDV+++M KD+G   +V++      LRVDG
Sbjct: 358  EARGAIFGLSRGTEKEHFIRATLESLCYQTRDVMEAMSKDSGI--DVQS------LRVDG 409

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            GA  NN +MQ QAD++ + V RP   ETT          AVG W   +  +   K+++  
Sbjct: 410  GAVKNNFIMQFQADIVNTSVERPEIQETTALGAAFLAGLAVGFWESKDDIAKNWKLEEK- 468

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRT 408
             F P ++E  R+K    W KAV  T
Sbjct: 469  -FDPKMDEGEREKLYRGWKKAVEAT 492



>sp|Q8XHD3|GLPK_CLOPE Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:BA000016_675592 Clostridium perfringens str. 13
            DNA, complete genome.
          Length = 500

 Score =  169 bits (428), Expect = 8e-41
 Identities = 97/209 (46%), Positives = 123/209 (58%), Gaps = 5/209 (2%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  + GA +QWLRD L +IS +S+ E  A+KVE  GGVY VPAF GL AP+W   
Sbjct: 300  YALEGSVFVGGAVIQWLRDELRIISDSSDTEYFATKVEDNGGVYVVPAFVGLGAPYWDMY 359

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +G+TR TN+ HI RA LES+ +Q RDVL++M  D G             ++VDGG
Sbjct: 360  ARGTIVGLTRGTNRNHIIRAALESIAYQTRDVLEAMINDVGYDIN--------CIKVDGG 411

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDE-----IFSSGEKM 495
            A+ NN LMQ Q+DL+G  V++P   ETT          AVG W++ E      F+S E  
Sbjct: 412  ASRNNFLMQFQSDLVGKKVIKPIITETTALGAAYLAGLAVGYWSDKEEIAKLWFASEE-- 469

Query: 494  KKDTIFKPVIEEEVRKKKVDSWCKAVSRT 408
                 F+P I EE R K    W KAV R+
Sbjct: 470  -----FEPTISEERRNKYHKKWKKAVERS 493



>gb:BC048274_1984119 Homo sapiens glycerol kinase 2, mRNA (cDNA clone
            IMAGE:5166566), partial cds.
          Length = 558

 Score =  169 bits (427), Expect = 1e-40
 Identities = 89/206 (43%), Positives = 133/206 (64%), Gaps = 2/206 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS AIAGA ++WLRD+L +I ++ +IE+LA +V ++ G YFVPAF+GL+AP+W   
Sbjct: 321  YALEGSVAIAGAVIRWLRDNLGIIETSGDIERLAKEVGTSYGCYFVPAFSGLYAPYWEPS 380

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+T+FTNKCHIA A LE++CFQ R++L++M++D G             L+VDGG
Sbjct: 381  ARGILCGLTQFTNKCHIAFAALEAVCFQTREILEAMNRDCGIPLR--------HLQVDGG 432

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTX--XXXXXXXXXAVGIWTEDEIFSSGEKMKKD 486
             T N +LMQ+QAD+L  PV++P   ETT             V +W+ +    S  +M++ 
Sbjct: 433  MTNNKVLMQLQADILHIPVIKPFMPETTALGAAMAAGAAEGVSVWSLEPQALSVLRMER- 491

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
              F+P I+    + +  +W KAV ++
Sbjct: 492  --FEPQIQATESEIRYATWKKAVMKS 515



>gb:BC029820_1979638 Homo sapiens glycerol kinase 2, mRNA (cDNA clone
            MGC:35147 IMAGE:5169374), complete
            cds.>gb:BC058888_1985559 Homo sapiens glycerol kinase 2,
            mRNA (cDNA clone MGC:64903 IMAGE:5172337), complete cds.
          Length = 553

 Score =  169 bits (427), Expect = 1e-40
 Identities = 89/206 (43%), Positives = 133/206 (64%), Gaps = 2/206 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS AIAGA ++WLRD+L +I ++ +IE+LA +V ++ G YFVPAF+GL+AP+W   
Sbjct: 316  YALEGSVAIAGAVIRWLRDNLGIIETSGDIERLAKEVGTSYGCYFVPAFSGLYAPYWEPS 375

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+T+FTNKCHIA A LE++CFQ R++L++M++D G             L+VDGG
Sbjct: 376  ARGILCGLTQFTNKCHIAFAALEAVCFQTREILEAMNRDCGIPLR--------HLQVDGG 427

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTX--XXXXXXXXXAVGIWTEDEIFSSGEKMKKD 486
             T N +LMQ+QAD+L  PV++P   ETT             V +W+ +    S  +M++ 
Sbjct: 428  MTNNKVLMQLQADILHIPVIKPFMPETTALGAAMAAGAAEGVSVWSLEPQALSVLRMER- 486

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
              F+P I+    + +  +W KAV ++
Sbjct: 487  --FEPQIQATESEIRYATWKKAVMKS 510



>gb:CR382132_1664947 Yarrowia lipolytica chromosome F of strain CLIB99
            of Yarrowia lipolytica.
          Length = 503

 Score =  169 bits (427), Expect = 1e-40
 Identities = 96/205 (46%), Positives = 127/205 (61%), Gaps = 2/205 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS ++AG+ ++WLRD++ LI S+ +I +LAS+V+ + GV FV A +GLFAP+WR D
Sbjct: 304  YALEGSISVAGSCIKWLRDNIGLIESSEQIGELASQVDDSAGVVFVTALSGLFAPYWRTD 363

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +G+T+FT K HI RA LE+ CFQ R +LD+M KD+G K   K       LRVDGG
Sbjct: 364  ARGTILGLTQFTTKAHICRAALEATCFQTRAILDAMAKDSG-KPFTK-------LRVDGG 415

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIW--TEDEIFSSGEKMKKD 486
             T +++ MQIQAD+LG  V RPA  ETT          AVG+W   ED    + E M   
Sbjct: 416  MTNSDIAMQIQADILGIEVERPAMRETTALGAAIAAGFAVGVWKSIEDLKDINTEGM--- 472

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSR 411
            T F     EE R   +  W + + R
Sbjct: 473  TEFASKTNEEERAAMMKQWNRGIER 497



>gb:AE016827_343617 Mannheimia succiniciproducens MBEL55E, complete
            genome.
          Length = 517

 Score =  169 bits (427), Expect = 1e-40
 Identities = 93/208 (44%), Positives = 123/208 (59%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  IAGA++QWLRD L ++  + + E  A+KV ST GVY VPAF GL AP+W   
Sbjct: 315  YALEGSVFIAGASIQWLRDELKIVHDSYDSEYFATKVPSTNGVYVVPAFTGLGAPYWDPY 374

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +G++R  N+ HI RA LES+ +Q RDVL++M  D+G+K +         LRVDGG
Sbjct: 375  ARGAILGLSRGANRNHIVRATLESIAYQTRDVLEAMQSDSGEKLK--------YLRVDGG 426

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            AT NN LMQ QAD+L   V RP   E T          AVG W   ++    +K + +  
Sbjct: 427  ATANNFLMQFQADILDVNVERPVVKEVTALGAAYLAGLAVGFW--KDLSELQDKARVERT 484

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRTFDLA 396
            F P  + E R+++   W KAV R  + A
Sbjct: 485  FTPDNDNEKRERRYKGWKKAVRRALEWA 512



>sp|Q14410|GKP2_HUMAN Glycerol kinase, testis specific 2 (EC 2.7.1.30)
            (ATP:glycerol 3- phosphotransferase) (Glycerokinase)
            (GK).>pir|I37417|I37417 glycerol kinase -
            human>gb:HSGKTS2_2013458 H.sapiens mRNA for glycerol
            kinase testis specific 2.
          Length = 553

 Score =  169 bits (427), Expect = 1e-40
 Identities = 89/206 (43%), Positives = 133/206 (64%), Gaps = 2/206 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS AIAGA ++WLRD+L +I ++ +IE+LA +V ++ G YFVPAF+GL+AP+W   
Sbjct: 316  YALEGSVAIAGAVIRWLRDNLGIIETSGDIERLAKEVGTSYGCYFVPAFSGLYAPYWEPS 375

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+T+FTNKCHIA A LE++CFQ R++L++M++D G             L+VDGG
Sbjct: 376  ARGILCGLTQFTNKCHIAFAALEAVCFQTREILEAMNRDCGIPLR--------HLQVDGG 427

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTX--XXXXXXXXXAVGIWTEDEIFSSGEKMKKD 486
             T N +LMQ+QAD+L  PV++P   ETT             V +W+ +    S  +M++ 
Sbjct: 428  MTNNKVLMQLQADILHIPVIKPFMPETTALGAAMAAGAAEGVSVWSLEPQALSVLRMER- 486

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
              F+P I+    + +  +W KAV ++
Sbjct: 487  --FEPQIQATESEIRYATWKKAVMKS 510



>gb:BX571857_783455 Staphylococcus aureus strain MSSA476, complete
            genome.
          Length = 498

 Score =  168 bits (426), Expect = 1e-40
 Identities = 91/205 (44%), Positives = 127/205 (61%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEGS  ++G+A+QWLRD L +I+SA + E  A++V+ST GVY VPAF GL  P+W  
Sbjct: 298  NYALEGSIFVSGSAIQWLRDGLRMINSAPQSESYATRVDSTEGVYVVPAFVGLGTPYWDS 357

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            +ARG   G++R T K H  RA +ES+C+Q RDV+++M KD+G   +V++      LRVDG
Sbjct: 358  EARGAIFGLSRGTEKEHFIRATIESLCYQTRDVMEAMSKDSGI--DVQS------LRVDG 409

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            GA  NN +MQ QAD++ + V RP   ETT          AVG W   +  +   K+++  
Sbjct: 410  GAVKNNFIMQFQADIVNTSVERPEIQETTALGAAFLAGLAVGFWESKDDIAKNWKLEEK- 468

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRT 408
             F P ++E  R+K    W KAV  T
Sbjct: 469  -FDPKMDEGEREKLYRGWKKAVEAT 492



>gb:BC056091_2551673 Xenopus laevis glycerol kinase, mRNA (cDNA clone
            MGC:69102 IMAGE:5047388), complete cds.
          Length = 563

 Score =  168 bits (425), Expect = 2e-40
 Identities = 90/208 (43%), Positives = 132/208 (63%), Gaps = 2/208 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS AIAGA V+WLRD+L ++ +  E+E+LA++V ++ G YFVPAF+GL+AP+W   
Sbjct: 323  YALEGSVAIAGAVVRWLRDNLGIVKTTEEVEKLAAEVGTSYGCYFVPAFSGLYAPYWEPS 382

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+T+FTN+ HIA A LE++CFQ R++LD+M++D G             L+VDGG
Sbjct: 383  ARGIICGLTQFTNRNHIAFAALEAVCFQTREILDAMNQDCGIPLN--------QLQVDGG 434

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTX--XXXXXXXXXAVGIWTEDEIFSSGEKMKKD 486
             T N +LMQ+QAD+L  PVV+P+  ETT             VG+W+ +    +    ++ 
Sbjct: 435  MTSNKILMQLQADILCIPVVKPSMPETTALGAAMAAGAAEGVGVWSLNPGDLTAVTCER- 493

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRTFD 402
              F+P I  E  + +   W KAV ++ D
Sbjct: 494  --FEPQINPEESEFRYARWKKAVLKSMD 519



>sp|Q87XL0|GLPK_PSESM Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:AE016871_353536 Pseudomonas syringae pv. tomato
            str. DC3000 section 16 of 21 of the complete
            genome.>gb:AE016853_1038711 Pseudomonas syringae pv.
            tomato str. DC3000 complete genome.
          Length = 501

 Score =  168 bits (425), Expect = 2e-40
 Identities = 97/207 (46%), Positives = 124/207 (59%), Gaps = 1/207 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEG+    G+ VQWLRD L LI+ A + E  A KV+ + GVY VPAF GL AP+W   
Sbjct: 298  YALEGAVFNGGSTVQWLRDELKLINDALDTEYFAGKVKDSNGVYLVPAFTGLGAPYWDPY 357

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G+TR     HI RA LES+ +Q RDVLD+M +D+G++  +K+      LRVDGG
Sbjct: 358  ARGALFGLTRGVKVDHIIRAALESIAYQTRDVLDAMQQDSGER--LKS------LRVDGG 409

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKDT 483
            A  NN LMQ QAD+LG+ V RP   ETT          A+G W+  DE+     K   + 
Sbjct: 410  AVANNFLMQFQADILGTHVERPQMRETTALGAAFLAGLAIGFWSSLDEL---RNKAVIER 466

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRTFD 402
            +F+P  EE  R+K    W KAV+RT D
Sbjct: 467  VFEPACEEAHREKLYAGWQKAVARTRD 493



>sp|Q81U58|GLPK_BACAN Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:AE017027_381255 Bacillus anthracis str. Ames
            section 4 of 18 of the complete
            genome.>gb:AE017225_406361 Bacillus anthracis str.
            Sterne, complete genome.>gb:AE017334_451104 Bacillus
            anthracis str. 'Ames Ancestor', complete
            genome.>gb:AE016879_1010960 Bacillus anthracis str. Ames
            complete genome.
          Length = 496

 Score =  168 bits (425), Expect = 2e-40
 Identities = 96/206 (46%), Positives = 122/206 (59%), Gaps = 1/206 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEGS  +AG+A+QWLRD + +   ASE E  AS+VEST GVY VPAF GL  P+W  
Sbjct: 298  NYALEGSIFVAGSAIQWLRDGMRMFKDASESEVYASRVESTDGVYVVPAFVGLGTPYWDS 357

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            + RG   G+TR T K H  RA LES+ +Q++DVL +M  D+G   E+K       LRVDG
Sbjct: 358  EVRGAMFGVTRGTTKEHFIRATLESLAYQIKDVLCAMEADSGI--ELK------TLRVDG 409

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIW-TEDEIFSSGEKMKKD 486
            GA  NN LM+ Q+D+L  PV RP   ETT          AVG W  +DEI    E+   D
Sbjct: 410  GAVKNNFLMKFQSDILDVPVERPVINETTALGAAYLAGLAVGYWKNQDEI---KEQWHMD 466

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
              F+P +E E  ++    W KA+  T
Sbjct: 467  KRFEPTMEAETSEELYAGWKKAIEAT 492



>sp|Q8E9N7|GLPK_SHEON Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:AE015856_318541 Shewanella oneidensis MR-1
            section 405 of 457 of the complete
            genome.>gb:AE014299_954138 Shewanella oneidensis MR-1
            complete genome.
          Length = 494

 Score =  167 bits (424), Expect = 2e-40
 Identities = 97/205 (47%), Positives = 121/205 (59%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEGS  + GA +QWLRD L LI  AS+ E  ASKV  T GVY VPAF GL AP+W  
Sbjct: 298  NYALEGSVFMGGATIQWLRDELGLIRDASDTEYFASKVADTNGVYLVPAFVGLGAPYWDP 357

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            +ARG   G+TR  N+ HI RA LES+ +Q +D+LD+M KD+G    V   R    L+VDG
Sbjct: 358  NARGALFGLTRGANRNHIIRAALESIAYQSKDLLDAMIKDSG----VSLKR----LKVDG 409

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            GA  N+ LMQ QAD+    V+RP+  ETT          AVG W  + +     K   DT
Sbjct: 410  GAVANDFLMQFQADITDVEVLRPSVCETTALGAAFLAGLAVGFW--NSVTELEHKACIDT 467

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRT 408
             FKP I  + R++    W  AV+RT
Sbjct: 468  HFKPSINADYRQQLYAGWQDAVART 492



>gb:CP000001_851560 Bacillus cereus ZK, complete genome.
          Length = 496

 Score =  167 bits (422), Expect = 4e-40
 Identities = 96/206 (46%), Positives = 121/206 (58%), Gaps = 1/206 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEGS  +AG+A+QWLRD + +   ASE E  AS+VEST GVY VPAF GL  P+W  
Sbjct: 298  NYALEGSIFVAGSAIQWLRDGMRMFKDASESEVYASRVESTDGVYVVPAFVGLGTPYWDS 357

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            + RG   G+TR T K H  RA LES+ +Q +DVL +M  D+G   E+K       LRVDG
Sbjct: 358  EVRGAMFGVTRGTTKEHFIRATLESLAYQTKDVLCAMEADSGI--ELK------TLRVDG 409

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIW-TEDEIFSSGEKMKKD 486
            GA  NN LM+ Q+D+L  PV RP   ETT          AVG W  +DEI    E+   D
Sbjct: 410  GAVKNNFLMKFQSDILDVPVERPVINETTALGAAYLAGLAVGYWKNQDEI---KEQWHMD 466

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
              F+P +E E  ++    W KA+  T
Sbjct: 467  KRFEPTMEAETSEELYAGWKKAIEAT 492



>gb:BX842653_825538 Bdellovibrio bacteriovorus complete genome, strain
            HD100; segment 8/11.
          Length = 495

 Score =  167 bits (422), Expect = 4e-40
 Identities = 91/203 (44%), Positives = 124/203 (61%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEG   + GAAVQWLRD L LI  +S++E LA  V+ T GV FVPA  GL AP W+ +
Sbjct: 302  YALEGGAFVCGAAVQWLRDGLGLIQQSSDVEALAKTVDGTDGVEFVPALTGLGAPHWQPE 361

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+TR + K HIARA LE+M  Q  D+L++M +D G     K  RG   +RVDGG
Sbjct: 362  ARGLICGLTRGSTKAHIARATLEAMALQNVDILNTMQRDLG-----KKLRG---VRVDGG 413

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  N+LLMQ+QAD  G+ VVRP ++ETT            G+W + +      K+ K+  
Sbjct: 414  AAANDLLMQMQADYCGANVVRPQNLETTALGAAFMAGLGAGVWKDLKEIKRVWKVNKE-- 471

Query: 479  FKPVIEEEVRKKKVDSWCKAVSR 411
            FK  +  + RK+++  W +A+ R
Sbjct: 472  FKVKMTPKARKERLQRWAQALER 494



>gb:AE017355_462262 Bacillus thuringiensis serovar konkukian str.
            97-27, complete genome.
          Length = 496

 Score =  167 bits (422), Expect = 4e-40
 Identities = 96/206 (46%), Positives = 121/206 (58%), Gaps = 1/206 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEGS  +AG+A+QWLRD + +   ASE E  AS+VEST GVY VPAF GL  P+W  
Sbjct: 298  NYALEGSIFVAGSAIQWLRDGMRMFKDASESEVYASRVESTDGVYVVPAFVGLGTPYWDS 357

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            + RG   G+TR T K H  RA LES+ +Q +DVL +M  D+G   E+K       LRVDG
Sbjct: 358  EVRGAMFGVTRGTTKEHFIRATLESLAYQTKDVLCAMEADSGI--ELK------TLRVDG 409

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIW-TEDEIFSSGEKMKKD 486
            GA  NN LM+ Q+D+L  PV RP   ETT          AVG W  +DEI    E+   D
Sbjct: 410  GAVKNNFLMKFQSDILDVPVERPVINETTALGAAYLAGLAVGYWKNQDEI---KEQWHMD 466

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
              F+P +E E  ++    W KA+  T
Sbjct: 467  KRFEPTMEAETSEELYAGWKKAIEAT 492



>sp|Q97JG4|GLPK_CLOAB Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>pir|G97062|G97062 glycerol kinase, GLPK [imported]
            - Clostridium acetobutylicum>gb:AE007643_228651
            Clostridium acetobutylicum ATCC 824 section 131 of 356 of
            the complete genome.>gb:AE001437_1091606 Clostridium
            acetobutylicum ATCC 824, complete genome.
          Length = 498

 Score =  167 bits (422), Expect = 4e-40
 Identities = 90/203 (44%), Positives = 121/203 (59%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  + GA +QW+RD L L+S A++ E  A KV   GGVY VPAF GL AP+W   
Sbjct: 300  YALEGSVFVGGAVIQWIRDELKLVSDAADTEYFAKKVNDNGGVYVVPAFTGLGAPYWDMY 359

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G+TR  NK HI RA LE++ +Q RD++D+M +D+G   E+        ++VDGG
Sbjct: 360  ARGAIFGLTRGANKNHIIRAALEAIAYQSRDLIDAMKEDSG--CEITR------IKVDGG 411

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A+ NNLLMQ QAD+ G+ VVRP   ETT          AVG W   E     EK     +
Sbjct: 412  ASRNNLLMQFQADITGTEVVRPIITETTALGAAYLAGLAVGFWKSKE--EIAEKWSVSEV 469

Query: 479  FKPVIEEEVRKKKVDSWCKAVSR 411
            + P ++E+ + +  + W +AV R
Sbjct: 470  YTPNLDEDEKIRLYNGWKRAVER 492



>pir|G98250|G98250 probable carbohydrate kinase PA3579 [imported] -
            Agrobacterium tumefaciens (strain C58,
            Cereon)>gb:AE008295_235471 Agrobacterium tumefaciens str.
            C58 linear chromosome, section 99 of 187 of the complete
            sequence.>gb:AE007870_1080584 Agrobacterium tumefaciens
            str. C58 linear chromosome, complete sequence.
          Length = 507

 Score =  166 bits (421), Expect = 5e-40
 Identities = 95/210 (45%), Positives = 119/210 (56%), Gaps = 1/210 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  IAGAAVQWLRD L  IS ASE+  LA K +    VY VPAF GL AP+W  +
Sbjct: 306  YALEGSIFIAGAAVQWLRDELGFISVASEVSALAEKADPKQRVYLVPAFTGLGAPYWDAE 365

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKD-AGDKGEVKNDRGEFVLRVDG 663
            ARG   G+TR T     ARA LES+ +Q  D+LD+M KD AGD G+        VLRVDG
Sbjct: 366  ARGAIFGLTRGTGPAEFARAALESVAYQTFDLLDAMRKDWAGDNGKT-------VLRVDG 418

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            G   ++  MQ  AD+L +PV RP  +ETT            GIW + + F+  +  ++D 
Sbjct: 419  GMVASDWTMQRLADILAAPVDRPVFLETTILGAAWLAASRAGIWPDRKAFA--DHWRRDR 476

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD 393
             F P +EE  RK  +  W  +V R     D
Sbjct: 477  RFSPDMEESERKNAIAGWRDSVGRCLSKRD 506



>sp|Q9KLJ9|GLPK_VIBCH Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>pir|C82422|C82422 glycerol kinase VCA0744
            [imported] - Vibrio cholerae (strain N16961 serogroup
            O1)>gb:AE004403_53873 Vibrio cholerae O1 biovar eltor
            str. N16961 chromosome II, section 60 of 93 of the
            complete chromosome.>gb:AE003853_1050819 Vibrio cholerae
            O1 biovar eltor str. N16961 chromosome II, complete
            chromosome.
          Length = 505

 Score =  166 bits (421), Expect = 5e-40
 Identities = 94/201 (46%), Positives = 119/201 (59%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEG+  + GA++QWLRD L LIS A + E  A+KV+++ GVY VPAF GL AP+W   
Sbjct: 301  YALEGAVFMGGASIQWLRDELKLISDARDSEYFATKVDTSNGVYVVPAFTGLGAPYWDAY 360

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +G+TR  N  HI RA LES+ +Q RDVLD+M  D+G K           LRVDGG
Sbjct: 361  ARGTIVGLTRGVNSNHIIRATLESIAYQTRDVLDAMQADSGIKLS--------ALRVDGG 412

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  NN LMQ QAD+L + V RP   E T          AVG W  D +     K + D  
Sbjct: 413  AVANNFLMQFQADVLDTEVHRPKVTEVTALGAAYLAGLAVGFW--DGLEELQGKAEIDRS 470

Query: 479  FKPVIEEEVRKKKVDSWCKAV 417
            FKP  +EE R+++   W +AV
Sbjct: 471  FKPHHDEEKRQRRYKGWKRAV 491



>sp|Q8U940|GLPK_AGRT5 Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>pir|AD3035|AD3035 glycerol kinase glpK [imported] -
            Agrobacterium tumefaciens  (strain C58,
            Dupont)>gb:AE009319_250725 Agrobacterium tumefaciens str.
            C58 linear chromosome, section 89 of 187 of the complete
            sequence.>gb:AE008689_1088568 Agrobacterium tumefaciens
            str. C58 linear chromosome, complete sequence.
          Length = 499

 Score =  166 bits (421), Expect = 5e-40
 Identities = 95/210 (45%), Positives = 119/210 (56%), Gaps = 1/210 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  IAGAAVQWLRD L  IS ASE+  LA K +    VY VPAF GL AP+W  +
Sbjct: 298  YALEGSIFIAGAAVQWLRDELGFISVASEVSALAEKADPKQRVYLVPAFTGLGAPYWDAE 357

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKD-AGDKGEVKNDRGEFVLRVDG 663
            ARG   G+TR T     ARA LES+ +Q  D+LD+M KD AGD G+        VLRVDG
Sbjct: 358  ARGAIFGLTRGTGPAEFARAALESVAYQTFDLLDAMRKDWAGDNGKT-------VLRVDG 410

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            G   ++  MQ  AD+L +PV RP  +ETT            GIW + + F+  +  ++D 
Sbjct: 411  GMVASDWTMQRLADILAAPVDRPVFLETTILGAAWLAASRAGIWPDRKAFA--DHWRRDR 468

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD 393
             F P +EE  RK  +  W  +V R     D
Sbjct: 469  RFSPDMEESERKNAIAGWRDSVGRCLSKRD 498



>gb:AP006840_568384 Symbiobacterium thermophilum DNA, complete genome.
          Length = 498

 Score =  166 bits (420), Expect = 7e-40
 Identities = 94/203 (46%), Positives = 117/203 (57%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  I GAAVQWLRD L     A++ E LA  V  +GGVY VPAF GL AP+W   
Sbjct: 299  YALEGSIFIGGAAVQWLRDELRFFDRAADSEALALSVPDSGGVYVVPAFVGLGAPYWDMY 358

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+ +G+TR T + HI RA LES+ +Q RDVL +M KD+G    ++ +R    L+VDGG
Sbjct: 359  ARGIVVGLTRGTGRAHITRATLESIAYQTRDVLGAMEKDSG----IRLNR----LKVDGG 410

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  NN LMQ Q+D+LG PV RP   ETT          A G W         +K   D  
Sbjct: 411  AVANNFLMQFQSDILGVPVERPKIAETTALGAAYLAGLATGFWRSQA--ELADKWALDRG 468

Query: 479  FKPVIEEEVRKKKVDSWCKAVSR 411
            F P +  E R++    W +AV R
Sbjct: 469  FTPALPAEERERLYAGWRRAVER 491



>sp|Q8Y6Z2|GLPK_LISMO Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>pir|AB1267|AB1267 glycerol kinase homolog lmo1538
            [imported] - Listeria monocytogenes (strain
            EGD-e)>gb:AL591979_536029 Listeria monocytogenes strain
            EGD, complete genome, segment 7/12.
          Length = 497

 Score =  166 bits (420), Expect = 7e-40
 Identities = 91/201 (45%), Positives = 121/201 (60%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AG+A+QWLRD L ++  +S+ E  AS++ES+ GVY VPAF GL AP+W  D
Sbjct: 300  YALEGSIFVAGSAIQWLRDGLRMVRQSSDSENYASRIESSDGVYVVPAFVGLGAPYWDSD 359

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
             RG   G+TR T K    RA LES+ +Q RDVL +M +D+G   +         LRVDGG
Sbjct: 360  VRGAVFGLTRGTEKEQFIRATLESLAYQTRDVLYAMEQDSGISLK--------TLRVDGG 411

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A+ NN LMQ Q+D+LG PV RP + ETT          AVG+W +       +  K D  
Sbjct: 412  ASANNFLMQFQSDILGVPVERPENKETTVLGAAFLAGLAVGVWKDKNEIK--KHWKLDKR 469

Query: 479  FKPVIEEEVRKKKVDSWCKAV 417
            F+  ++EE R+   + W KAV
Sbjct: 470  FEVEMKEEQREDLYEGWHKAV 490



>gb:AK076631_1171471 Mus musculus adult male testis cDNA, RIKEN
            full-length enriched library, clone:4922501K24
            product:glucokinase activity, related sequence 1, full
            insert sequence.
          Length = 549

 Score =  166 bits (419), Expect = 9e-40
 Identities = 92/206 (44%), Positives = 129/206 (62%), Gaps = 2/206 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS AIAGA V W++++L +I S+SEIE+LA    ++ G YFVPAF+GL+AP+W   
Sbjct: 316  YALEGSVAIAGAVVSWIKNNLQIIQSSSEIEKLAEVAGTSYGCYFVPAFSGLYAPYWDPS 375

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+T+FTNK HIA A LE++CFQ R++LD+M+ D G             L+VDGG
Sbjct: 376  ARGIICGLTQFTNKFHIAFAALEAVCFQTREILDAMNSDCGIP--------LTHLQVDGG 427

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTX--XXXXXXXXXAVGIWTEDEIFSSGEKMKKD 486
             T N +LMQ+QAD+L  PV++P   ETT             V +W+ D    S  +M+K 
Sbjct: 428  MTANRVLMQLQADILCIPVMKPFMPETTALGVAMAAGAAEGVSVWSLDPKDLSSVQMEK- 486

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
              F+P I  E  + +  +W KAV ++
Sbjct: 487  --FEPQINVEESEGRYATWKKAVLKS 510



>gb:AF543471_520701 Uncultured bacterium plasmid pAK115 GlpX (glpX)
            gene, partial cds; and GlpK (glpK), GlpF (glpF), and
            putative short-chain alcohol dehydrogenase genes,
            complete cds.
          Length = 502

 Score =  166 bits (419), Expect = 9e-40
 Identities = 96/211 (45%), Positives = 119/211 (56%), Gaps = 1/211 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEG+  +AGA++QWLRD + LIS A + E  A+KV+ T GVY VPAF GL AP+W  
Sbjct: 300  NYALEGAVFMAGASIQWLRDEMKLISDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWDP 359

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG   G+TR  N  HI RA LES+ +Q RDVL++M  D+G +           LRVDG
Sbjct: 360  YARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLEAMQADSGIRWH--------ALRVDG 411

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKD 486
            GA  NN LMQ Q+D+LG+ V RP   E T          A G W   DE+    EK   +
Sbjct: 412  GAVANNFLMQFQSDILGTRVERPEVREVTALGAAYLAGLAAGFWQNLDEL---QEKAAIE 468

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD 393
              F+P IE   R  +   W KAV R     D
Sbjct: 469  REFRPGIETTERNFRYSGWKKAVKRALAWED 499



>gb:AE008890_245699 Salmonella typhimurium LT2, section 194 of 220 of
            the complete genome.>gb:AE006468_1002781 Salmonella
            typhimurium LT2, complete genome.
          Length = 502

 Score =  166 bits (419), Expect = 9e-40
 Identities = 96/205 (46%), Positives = 119/205 (58%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEG+  +AGA++QWLRD + LIS A + E  A+KV+ T GVY VPAF GL AP+W  
Sbjct: 300  NYALEGAVFMAGASIQWLRDEMKLISDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWDP 359

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG   G+TR  N  HI RA LES+ +Q RDVL++M  D+G +           LRVDG
Sbjct: 360  YARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLEAMQADSGIR--------LHALRVDG 411

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKD 486
            GA  NN LMQ Q+D+LG+ V RP   E T          AVG W   DE+    EK   +
Sbjct: 412  GAVANNFLMQFQSDILGTRVERPEVREVTALGAAYLAGLAVGYWQNLDEL---QEKAVIE 468

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSR 411
              F+P IE   R  +   W KAV R
Sbjct: 469  REFRPGIETTERNYRYSGWKKAVKR 493



>gb:CP000026_78577 Salmonella enterica subsp. enterica serovar
            Paratypi A str. ATCC 9150.
          Length = 502

 Score =  166 bits (419), Expect = 9e-40
 Identities = 96/205 (46%), Positives = 119/205 (58%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEG+  +AGA++QWLRD + LIS A + E  A+KV+ T GVY VPAF GL AP+W  
Sbjct: 300  NYALEGAVFMAGASIQWLRDEMKLISDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWDP 359

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG   G+TR  N  HI RA LES+ +Q RDVL++M  D+G +           LRVDG
Sbjct: 360  YARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLEAMQADSGIR--------LHALRVDG 411

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKD 486
            GA  NN LMQ Q+D+LG+ V RP   E T          AVG W   DE+    EK   +
Sbjct: 412  GAVANNFLMQFQSDILGTRVERPEVREVTALGAAYLAGLAVGYWQNLDEL---QEKAVIE 468

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSR 411
              F+P IE   R  +   W KAV R
Sbjct: 469  REFRPGIETTERNYRYSGWKKAVKR 493



>pir|AG0939|AG0939 glycerol kinase [imported] - Salmonella enterica
            subsp. enterica serovar Typhi (strain
            CT18)>gb:AE016846_347495 Salmonella enterica subsp.
            enterica serovar Typhi Ty2, section 13 of 16 of the
            complete genome.>gb:AL627279_543831 Salmonella enterica
            serovar Typhi (Salmonella typhi) strain CT18, complete
            chromosome; segment 15/20.>gb:AE014613_984827 Salmonella
            enterica subsp. enterica serovar Typhi Ty2, complete
            genome.
          Length = 501

 Score =  166 bits (419), Expect = 9e-40
 Identities = 96/205 (46%), Positives = 119/205 (58%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEG+  +AGA++QWLRD + LIS A + E  A+KV+ T GVY VPAF GL AP+W  
Sbjct: 299  NYALEGAVFMAGASIQWLRDEMKLISDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWDP 358

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG   G+TR  N  HI RA LES+ +Q RDVL++M  D+G +           LRVDG
Sbjct: 359  YARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLEAMQADSGIR--------LHALRVDG 410

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKD 486
            GA  NN LMQ Q+D+LG+ V RP   E T          AVG W   DE+    EK   +
Sbjct: 411  GAVANNFLMQFQSDILGTRVERPEVREVTALGAAYLAGLAVGYWQNLDEL---QEKAVIE 467

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSR 411
              F+P IE   R  +   W KAV R
Sbjct: 468  REFRPGIETTERNYRYSGWKKAVKR 492



>sp|Q8ZKP3|GLPK_SALTY Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase) (GK).
          Length = 501

 Score =  166 bits (419), Expect = 9e-40
 Identities = 96/205 (46%), Positives = 119/205 (58%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEG+  +AGA++QWLRD + LIS A + E  A+KV+ T GVY VPAF GL AP+W  
Sbjct: 299  NYALEGAVFMAGASIQWLRDEMKLISDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWDP 358

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG   G+TR  N  HI RA LES+ +Q RDVL++M  D+G +           LRVDG
Sbjct: 359  YARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLEAMQADSGIR--------LHALRVDG 410

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKD 486
            GA  NN LMQ Q+D+LG+ V RP   E T          AVG W   DE+    EK   +
Sbjct: 411  GAVANNFLMQFQSDILGTRVERPEVREVTALGAAYLAGLAVGYWQNLDEL---QEKAVIE 467

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSR 411
              F+P IE   R  +   W KAV R
Sbjct: 468  REFRPGIETTERNYRYSGWKKAVKR 492



>sp|Q8Z2Y6|GLPK_SALTI Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase) (GK).
          Length = 500

 Score =  166 bits (419), Expect = 9e-40
 Identities = 96/205 (46%), Positives = 119/205 (58%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEG+  +AGA++QWLRD + LIS A + E  A+KV+ T GVY VPAF GL AP+W  
Sbjct: 298  NYALEGAVFMAGASIQWLRDEMKLISDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWDP 357

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG   G+TR  N  HI RA LES+ +Q RDVL++M  D+G +           LRVDG
Sbjct: 358  YARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLEAMQADSGIR--------LHALRVDG 409

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKD 486
            GA  NN LMQ Q+D+LG+ V RP   E T          AVG W   DE+    EK   +
Sbjct: 410  GAVANNFLMQFQSDILGTRVERPEVREVTALGAAYLAGLAVGYWQNLDEL---QEKAVIE 466

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSR 411
              F+P IE   R  +   W KAV R
Sbjct: 467  REFRPGIETTERNYRYSGWKKAVKR 491



>sp|O87924|GLPK_PSETO Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:AB015974_2656 Pseudomonas tolaasii glpK gene for
            glycerol kinase, complete cds.
          Length = 503

 Score =  166 bits (419), Expect = 9e-40
 Identities = 92/206 (44%), Positives = 121/206 (58%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEG+    G+ VQWLRD L +I+ A++ E  A KV+ + GVY VPAF GL AP+W   
Sbjct: 300  YALEGAVFNGGSTVQWLRDELKIIADATDTEYFAGKVKDSNGVYLVPAFTGLGAPYWDPY 359

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G+TR     HI RA LES+ +Q RDVLD+M +D+G++ +         LRVDGG
Sbjct: 360  ARGALFGLTRGVRVDHIIRAALESIAYQTRDVLDAMQQDSGERLK--------ALRVDGG 411

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  NN LMQ QAD+LG+ V RP   ETT          A G W   E       ++++  
Sbjct: 412  AVANNFLMQFQADILGTQVERPQMRETTALGAAYLAGLACGFWGSLEELRGKAVIERE-- 469

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRTFD 402
            F+P ++E  ++K    W KAVSRT D
Sbjct: 470  FEPQLDEAAKEKLYAGWQKAVSRTRD 495



>gb:HSRNAGLK_2020048 H.sapiens mRNA for glycerol kinase.
          Length = 436

 Score =  165 bits (418), Expect = 1e-39
 Identities = 81/148 (54%), Positives = 110/148 (74%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS AIAGA ++WLRD+L +I ++ EIE+LA +V ++ G YFVPAF+GL+AP+W   
Sbjct: 246  YALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPS 305

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+T+FTNKCHIA A LE++CFQ R++LD+M++D G             L+VDGG
Sbjct: 306  ARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS--------HLQVDGG 357

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETT 576
             T N +LMQ+QAD+L  PVV+P+  ETT
Sbjct: 358  MTSNKILMQLQADILYIPVVKPSMPETT 385



>gb:AE017344_1756236 Cryptococcus neoformans var. neoformans JEC21
            chromosome 4, complete sequence.
          Length = 759

 Score =  165 bits (418), Expect = 1e-39
 Identities = 91/207 (43%), Positives = 127/207 (61%), Gaps = 4/207 (1%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS A+AG+A++WLRD + LI  ++E++ LA  V  TGGVYFV AF+GL AP+W  +
Sbjct: 532  YALEGSIAVAGSAIKWLRDQMTLIEESAEMDILAGSVSDTGGVYFVTAFSGLLAPYWDRE 591

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            A G  IG+T +T   HIARA LE++CFQ R VLD + K++G + +         L+VDGG
Sbjct: 592  ASGTIIGLTGYTTSAHIARATLEAVCFQTRAVLDVIEKESGSRLD--------TLKVDGG 643

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIW----TEDEIFSSGEKMK 492
             T ++L MQ+QA++ G  V RP+  E+T          A+G++    T  E  S      
Sbjct: 644  VTNSDLAMQLQANIGGFNVARPSMRESTALGSALLAAHALGLFGWDLTRPETLSEVNTAG 703

Query: 491  KDTIFKPVIEEEVRKKKVDSWCKAVSR 411
              T F+P +EE+ R KK+  W KAV R
Sbjct: 704  VHT-FEPELEEKARLKKIKGWNKAVDR 729



>sp|Q81GZ2|GLPK_BACCR Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:AE017001_375978 Bacillus cereus ATCC 14579
            section 4 of 18 of the complete
            genome.>gb:AE016877_1016228 Bacillus cereus ATCC 14579
            complete genome.
          Length = 496

 Score =  165 bits (418), Expect = 1e-39
 Identities = 95/206 (46%), Positives = 121/206 (58%), Gaps = 1/206 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEGS  +AG+A+QWLRD + +   ASE E  AS+VEST GVY VPAF GL  P+W  
Sbjct: 298  NYALEGSIFVAGSAIQWLRDGMRMFKDASESEVYASRVESTDGVYVVPAFVGLGTPYWDS 357

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            + RG   G+TR T K H  RA LES+ +Q +DVL +M  D+G   E+K       LRVDG
Sbjct: 358  EVRGAMFGVTRGTTKEHFIRATLESLAYQTKDVLCAMEADSGI--ELK------TLRVDG 409

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIW-TEDEIFSSGEKMKKD 486
            GA  NN LM+ Q+D+L  PV RP   ETT          AVG W  +DEI    E+   D
Sbjct: 410  GAVKNNFLMKFQSDILDVPVERPVINETTALGAAYLAGLAVGYWKNQDEI---KEQWHMD 466

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
              F+P +E +  ++    W KA+  T
Sbjct: 467  KRFEPTMEAKTSEELYAGWKKAIEAT 492



>gb:BC079449_2107553 Rattus norvegicus glucokinase activity, related
            sequence 2, mRNA (cDNA clone MGC:94998 IMAGE:7115796),
            complete cds.
          Length = 554

 Score =  165 bits (417), Expect = 2e-39
 Identities = 90/206 (43%), Positives = 129/206 (62%), Gaps = 2/206 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS AIAGA ++WLRD+  LI+S+ E+E LA +V +  G YFVPAF+GL+AP+W   
Sbjct: 316  YALEGSVAIAGAVIRWLRDNFELITSSGEVEDLAREVGTAYGCYFVPAFSGLYAPYWEPS 375

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+T+FTNKCHIA A LE++CFQ R+++D+M++D G             LRVDG 
Sbjct: 376  ARGIICGLTQFTNKCHIAFAALEAVCFQTREIVDAMNRDCGIPLS--------HLRVDGR 427

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGI--WTEDEIFSSGEKMKKD 486
             T N +LMQ+QAD+L  PVV+    ETT          A GI  W+ +    S   M++ 
Sbjct: 428  MTNNKILMQLQADILHIPVVKSVMPETTALGAAMAAGAAEGIDVWSIEPEDLSSMLMER- 486

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
              ++P I+    + +  +W +AV ++
Sbjct: 487  --YEPQIQATESEIRFSTWKRAVMKS 510



>gb:AF117733_2055104 Mus musculus glycerol kinase-like protein 1
            (Gkrs1) mRNA, complete cds.
          Length = 549

 Score =  165 bits (417), Expect = 2e-39
 Identities = 92/206 (44%), Positives = 129/206 (62%), Gaps = 2/206 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS AIAGA V W++++L +I S+SEIE+LA    ++ G YFVPAF+GL+AP+W   
Sbjct: 316  YALEGSVAIAGAVVSWIKNNLPIIKSSSEIEKLAEVAGTSYGCYFVPAFSGLYAPYWDPS 375

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+T+FTNK HIA A LE++CFQ R++LD+M+ D G             L+VDGG
Sbjct: 376  ARGIICGLTQFTNKFHIAFAALEAVCFQTREILDAMNSDCGIP--------LTHLQVDGG 427

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTX--XXXXXXXXXAVGIWTEDEIFSSGEKMKKD 486
             T N +LMQ+QAD+L  PV++P   ETT             V +W+ D    S  +M+K 
Sbjct: 428  MTANRVLMQLQADILCIPVMKPFMPETTALGVAMAAGAAEGVSVWSLDPKDLSSVQMEK- 486

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
              F+P I  E  + +  +W KAV ++
Sbjct: 487  --FEPQINVEESEGRYATWKKAVLKS 510



>gb:AE017327_443983 Listeria monocytogenes str. 4b F2365, section 6 of
            10 of the complete genome.>gb:AE017262_1076339 Listeria
            monocytogenes str. 4b F2365, complete genome.
          Length = 497

 Score =  165 bits (417), Expect = 2e-39
 Identities = 90/201 (44%), Positives = 121/201 (60%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AG+A+QWLRD L ++  +S+ E  AS++ES+ GVY VPAF GL AP+W  D
Sbjct: 300  YALEGSIFVAGSAIQWLRDGLRMVRQSSDSENYASRIESSDGVYVVPAFVGLGAPYWDSD 359

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
             RG   G+TR T K    RA LES+ +Q RDVL +M +D+G   +         LRVDGG
Sbjct: 360  VRGAVFGLTRGTEKEQFIRATLESLAYQTRDVLYAMEQDSGISLK--------TLRVDGG 411

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A+ NN LMQ Q+D+LG PV RP + ETT          AVG+W +       +  K D  
Sbjct: 412  ASANNFLMQFQSDILGVPVERPENKETTVLGAAFLAGLAVGVWKDKNEIK--KHWKLDKR 469

Query: 479  FKPVIEEEVRKKKVDSWCKAV 417
            F+  +++E R+   + W KAV
Sbjct: 470  FEVEMKDEQREDLYEGWHKAV 490



>sp|O86033|GLPK_RHIME Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>pir|G95983|G95983 probable glycerol kinase (EC
            2.7.1.30) [imported] - Sinorhizobium meliloti (strain
            1021) magaplasmid pSymB>gb:RME591985_165783 Sinorhizobium
            meliloti 1021 complete pSymB.
          Length = 497

 Score =  165 bits (417), Expect = 2e-39
 Identities = 90/204 (44%), Positives = 117/204 (57%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AGAAVQWLRD L +I +A +   LA   + +  VY VPAF GL AP W  D
Sbjct: 298  YALEGSIFVAGAAVQWLRDGLKVIKAAPDTGSLAESADPSQEVYLVPAFTGLGAPHWDPD 357

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G+TR T     ARA LE++C+Q RD+L++MHKD    G       + VLRVDGG
Sbjct: 358  ARGAIFGMTRNTGPAEFARAALEAVCYQTRDLLEAMHKDWRRNG------NDTVLRVDGG 411

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
               ++  MQ  +DLL +PV RP  +ETT            G+W   E F+  +   +D  
Sbjct: 412  MVASDWTMQRLSDLLDAPVDRPVILETTALGVAWLAGSRAGVWPNQEAFA--KSWARDRR 469

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRT 408
            F+P ++E  RK K+  W  AV RT
Sbjct: 470  FEPHMDEATRKVKLKGWRSAVKRT 493



>gb:AF117734_2055105 Mus musculus glycerol kinase-like protein 2
            (Gkrs2) mRNA, complete cds.>gb:BC050764_2100422 Mus
            musculus glycerol kinase 2, mRNA (cDNA clone MGC:58280
            IMAGE:6774427), complete cds.>gb:BC061147_2104362 Mus
            musculus glycerol kinase 2, mRNA (cDNA clone MGC:74279
            IMAGE:6770827), complete cds.
          Length = 554

 Score =  164 bits (416), Expect = 2e-39
 Identities = 87/206 (42%), Positives = 130/206 (63%), Gaps = 2/206 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS AIAGA ++WLRD+  +I+++ E+E LA +V ++ G YFVPAF+GL+AP+W   
Sbjct: 316  YALEGSVAIAGAVIRWLRDNFEIITTSGEVENLAREVGTSYGCYFVPAFSGLYAPYWEPS 375

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+T+FTNKCHIA A LE++CFQ R++LD+M++D G             L+VDGG
Sbjct: 376  ARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS--------HLQVDGG 427

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTX--XXXXXXXXXAVGIWTEDEIFSSGEKMKKD 486
             T N +LMQ+QAD+L  PVV+    ETT             V +W+ +    S   M++ 
Sbjct: 428  MTNNRILMQLQADILHIPVVKSVMPETTALGAAMAAGAAEGVNVWSLEPEDLSTILMER- 486

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
              ++P I+    + +  +W +AV ++
Sbjct: 487  --YEPQIQATESEIRFSTWKRAVMKS 510



>gb:AK075761_1170987 Mus musculus adult male testis cDNA, RIKEN
            full-length enriched library, clone:1700037H23
            product:GLYCEROL KINASE-LIKE PROTEIN 2 homolog [Mus
            musculus], full insert sequence.
          Length = 535

 Score =  164 bits (416), Expect = 2e-39
 Identities = 87/206 (42%), Positives = 130/206 (63%), Gaps = 2/206 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS AIAGA ++WLRD+  +I+++ E+E LA +V ++ G YFVPAF+GL+AP+W   
Sbjct: 297  YALEGSVAIAGAVIRWLRDNFEIITTSGEVENLAREVGTSYGCYFVPAFSGLYAPYWEPS 356

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+T+FTNKCHIA A LE++CFQ R++LD+M++D G             L+VDGG
Sbjct: 357  ARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS--------HLQVDGG 408

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTX--XXXXXXXXXAVGIWTEDEIFSSGEKMKKD 486
             T N +LMQ+QAD+L  PVV+    ETT             V +W+ +    S   M++ 
Sbjct: 409  MTNNRILMQLQADILHIPVVKSVMPETTALGAAMAAGAAEGVNVWSLEPEDLSTILMER- 467

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
              ++P I+    + +  +W +AV ++
Sbjct: 468  --YEPQIQATESEIRFSTWKRAVMKS 491



>gb:AE016990_373210 Shigella flexneri 2a str. 2457T section 13 of 16
            of the complete genome.>gb:AE014073_997960 Shigella
            flexneri 2a str. 2457T complete genome.
          Length = 502

 Score =  164 bits (416), Expect = 2e-39
 Identities = 95/205 (46%), Positives = 120/205 (58%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEG+  +AGA++QWLRD + LI+ A + E  A+KV++T GVY VPAF GL AP+W  
Sbjct: 300  NYALEGAVFMAGASIQWLRDEMKLINDAYDSEYFATKVQNTNGVYVVPAFTGLGAPYWDP 359

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG   G+TR  N  HI RA LES+ +Q RDVL++M  D+G +           LRVDG
Sbjct: 360  YARGAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQADSGIR--------LHALRVDG 411

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKD 486
            GA  NN LMQ Q+D+LG+ V RP   E T          AVG W   DE+    EK   +
Sbjct: 412  GAVANNFLMQFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDEL---QEKAVIE 468

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSR 411
              F+P IE   R  +   W KAV R
Sbjct: 469  REFRPGIETTERNYRYAGWKKAVKR 493



>gb:AE016770_328844 Escherichia coli CFT073 section 16 of 18 of the
            complete genome.>gb:AE014075_959428 Escherichia coli
            CFT073 complete genome.
          Length = 537

 Score =  164 bits (416), Expect = 2e-39
 Identities = 95/205 (46%), Positives = 120/205 (58%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEG+  +AGA++QWLRD + LI+ A + E  A+KV++T GVY VPAF GL AP+W  
Sbjct: 335  NYALEGAVFMAGASIQWLRDEMKLINDAYDSEYFATKVQNTNGVYVVPAFTGLGAPYWDP 394

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG   G+TR  N  HI RA LES+ +Q RDVL++M  D+G +           LRVDG
Sbjct: 395  YARGAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQADSGIR--------LHALRVDG 446

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKD 486
            GA  NN LMQ Q+D+LG+ V RP   E T          AVG W   DE+    EK   +
Sbjct: 447  GAVANNFLMQFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDEL---QEKAVIE 503

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSR 411
              F+P IE   R  +   W KAV R
Sbjct: 504  REFRPGIETTERNYRYAGWKKAVKR 528



>gb:AE005674_73588 Shigella flexneri 2a str. 301, complete genome.
          Length = 452

 Score =  164 bits (416), Expect = 2e-39
 Identities = 95/205 (46%), Positives = 120/205 (58%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEG+  +AGA++QWLRD + LI+ A + E  A+KV++T GVY VPAF GL AP+W  
Sbjct: 250  NYALEGAVFMAGASIQWLRDEMKLINDAYDSEYFATKVQNTNGVYVVPAFTGLGAPYWDP 309

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG   G+TR  N  HI RA LES+ +Q RDVL++M  D+G +           LRVDG
Sbjct: 310  YARGAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQADSGIR--------LHALRVDG 361

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKD 486
            GA  NN LMQ Q+D+LG+ V RP   E T          AVG W   DE+    EK   +
Sbjct: 362  GAVANNFLMQFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDEL---QEKAVIE 418

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSR 411
              F+P IE   R  +   W KAV R
Sbjct: 419  REFRPGIETTERNYRYAGWKKAVKR 443



>pir|C86082|C86082 glycerol kinase [imported] - Escherichia coli
            (strain O157:H7, substrain EDL933)>gb:AE005174_69118
            Escherichia coli O157:H7 EDL933, complete genome.
          Length = 509

 Score =  164 bits (416), Expect = 2e-39
 Identities = 95/205 (46%), Positives = 120/205 (58%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEG+  +AGA++QWLRD + LI+ A + E  A+KV++T GVY VPAF GL AP+W  
Sbjct: 307  NYALEGAVFMAGASIQWLRDEMKLINDAYDSEYFATKVQNTNGVYVVPAFTGLGAPYWDP 366

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG   G+TR  N  HI RA LES+ +Q RDVL++M  D+G +           LRVDG
Sbjct: 367  YARGAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQADSGIR--------LHALRVDG 418

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKD 486
            GA  NN LMQ Q+D+LG+ V RP   E T          AVG W   DE+    EK   +
Sbjct: 419  GAVANNFLMQFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDEL---QEKAVIE 475

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSR 411
              F+P IE   R  +   W KAV R
Sbjct: 476  REFRPGIETTERNYRYAGWKKAVKR 500



>pir|A27339|KIECGL glycerol kinase (EC 2.7.1.30) [validated] -
            Escherichia coli (strain K-12)>pir|C91235|C91235 glycerol
            kinase [imported] - Escherichia coli (strain O157:H7,
            substrain RIMD 0509952)>gb:ECOGLYK_128842 E.coli
            glp-kappa gene encoding glycerol kinase, complete
            cds.>gb:ECOUW87_131468 E. coli chromosomal region from
            87.2 to 89.2 minutes.>gb:U00096_202902 Escherichia coli
            K-12 MG1655 complete genome.>gb:BA000007_662863
            Escherichia coli O157:H7 DNA, complete genome.
          Length = 502

 Score =  164 bits (416), Expect = 2e-39
 Identities = 95/205 (46%), Positives = 120/205 (58%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEG+  +AGA++QWLRD + LI+ A + E  A+KV++T GVY VPAF GL AP+W  
Sbjct: 300  NYALEGAVFMAGASIQWLRDEMKLINDAYDSEYFATKVQNTNGVYVVPAFTGLGAPYWDP 359

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG   G+TR  N  HI RA LES+ +Q RDVL++M  D+G +           LRVDG
Sbjct: 360  YARGAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQADSGIR--------LHALRVDG 411

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKD 486
            GA  NN LMQ Q+D+LG+ V RP   E T          AVG W   DE+    EK   +
Sbjct: 412  GAVANNFLMQFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDEL---QEKAVIE 468

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSR 411
              F+P IE   R  +   W KAV R
Sbjct: 469  REFRPGIETTERNYRYAGWKKAVKR 493



>sp|Q7UB84|GLPK_SHIFL Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase) (GK).
          Length = 502

 Score =  164 bits (416), Expect = 2e-39
 Identities = 95/205 (46%), Positives = 120/205 (58%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEG+  +AGA++QWLRD + LI+ A + E  A+KV++T GVY VPAF GL AP+W  
Sbjct: 300  NYALEGAVFMAGASIQWLRDEMKLINDAYDSEYFATKVQNTNGVYVVPAFTGLGAPYWDP 359

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG   G+TR  N  HI RA LES+ +Q RDVL++M  D+G +           LRVDG
Sbjct: 360  YARGAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQADSGIR--------LHALRVDG 411

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKD 486
            GA  NN LMQ Q+D+LG+ V RP   E T          AVG W   DE+    EK   +
Sbjct: 412  GAVANNFLMQFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDEL---QEKAVIE 468

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSR 411
              F+P IE   R  +   W KAV R
Sbjct: 469  REFRPGIETTERNYRYAGWKKAVKR 493



>sp|P08859|GLPK_ECOLI Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase) (GK).
          Length = 501

 Score =  164 bits (416), Expect = 2e-39
 Identities = 95/205 (46%), Positives = 120/205 (58%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEG+  +AGA++QWLRD + LI+ A + E  A+KV++T GVY VPAF GL AP+W  
Sbjct: 299  NYALEGAVFMAGASIQWLRDEMKLINDAYDSEYFATKVQNTNGVYVVPAFTGLGAPYWDP 358

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG   G+TR  N  HI RA LES+ +Q RDVL++M  D+G +           LRVDG
Sbjct: 359  YARGAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQADSGIR--------LHALRVDG 410

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKD 486
            GA  NN LMQ Q+D+LG+ V RP   E T          AVG W   DE+    EK   +
Sbjct: 411  GAVANNFLMQFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDEL---QEKAVIE 467

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSR 411
              F+P IE   R  +   W KAV R
Sbjct: 468  REFRPGIETTERNYRYAGWKKAVKR 492



>sp|Q8FBC3|GLPK_ECOL6 Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase) (GK).
          Length = 501

 Score =  164 bits (416), Expect = 2e-39
 Identities = 95/205 (46%), Positives = 120/205 (58%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEG+  +AGA++QWLRD + LI+ A + E  A+KV++T GVY VPAF GL AP+W  
Sbjct: 299  NYALEGAVFMAGASIQWLRDEMKLINDAYDSEYFATKVQNTNGVYVVPAFTGLGAPYWDP 358

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG   G+TR  N  HI RA LES+ +Q RDVL++M  D+G +           LRVDG
Sbjct: 359  YARGAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQADSGIR--------LHALRVDG 410

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKD 486
            GA  NN LMQ Q+D+LG+ V RP   E T          AVG W   DE+    EK   +
Sbjct: 411  GAVANNFLMQFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDEL---QEKAVIE 467

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSR 411
              F+P IE   R  +   W KAV R
Sbjct: 468  REFRPGIETTERNYRYAGWKKAVKR 492



>sp|Q9KDW8|GLPK_BACHD Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>pir|E83786|E83786 glycerol kinase glpK [imported] -
            Bacillus halodurans  (strain C-125)>gb:BA000004_655039
            Bacillus halodurans C-125 DNA, complete genome.
          Length = 497

 Score =  164 bits (416), Expect = 2e-39
 Identities = 93/201 (46%), Positives = 116/201 (57%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AG+A+QWLRD L ++ SA E E  A+KV S  GVY VPAF GL  P+W  D
Sbjct: 300  YALEGSIFVAGSAIQWLRDGLRMMKSAKESEGYATKVTSADGVYVVPAFVGLGTPYWDSD 359

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
             RG   G+TR T+K H  RA LES+ +Q +DVL +M  D+G   +         LRVDGG
Sbjct: 360  VRGAVFGLTRGTSKEHFIRATLESLAYQTKDVLQAMEADSGISLK--------TLRVDGG 411

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  NN LMQ Q+DLLG  V RP   ETT          AVG WT  E  ++   +++   
Sbjct: 412  AVANNFLMQFQSDLLGVSVERPTVQETTALGAAYLAGLAVGFWTSKEEITNNWNLEQK-- 469

Query: 479  FKPVIEEEVRKKKVDSWCKAV 417
            F   +EE  R K  + W KAV
Sbjct: 470  FSAEMEETDRAKLYEGWQKAV 490



>gb:AF542057_520573 Bacillus subtilis var. natto glycerol kinase (glk)
            gene, complete cds.
          Length = 496

 Score =  164 bits (415), Expect = 3e-39
 Identities = 93/202 (46%), Positives = 114/202 (56%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEGS  +AG+A+QWLRD L +   +S  E  A KV+ST GVY VPAF GL  P+W  
Sbjct: 298  NYALEGSIFVAGSAIQWLRDGLRMFQDSSLSESYAEKVDSTDGVYVVPAFVGLGTPYWDS 357

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            D RG   G+TR T K H  RA LES+ +Q +DVLD+M  D+    +         LRVDG
Sbjct: 358  DVRGSVFGLTRGTTKEHFIRATLESLAYQAKDVLDAMEADSNISLK--------TLRVDG 409

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            GA  NN LMQ Q DLL  PV RP   ETT          AVG W +    ++  +   D 
Sbjct: 410  GAVKNNFLMQFQGDLLNVPVERPEINETTALGAAYLAGIAVGFWKDRSEIAN--QWNLDK 467

Query: 482  IFKPVIEEEVRKKKVDSWCKAV 417
             F+P +EEE R +    W KAV
Sbjct: 468  RFEPELEEEKRNELYKGWQKAV 489



>gb:CR555306_107933 Azoarcus sp. EbN1 complete genome.
          Length = 496

 Score =  164 bits (415), Expect = 3e-39
 Identities = 96/204 (47%), Positives = 121/204 (59%), Gaps = 1/204 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  I GA VQWLRD L LI  A ++E LA+ V  + GV  VPAF GL AP+W   
Sbjct: 297  YALEGSIFIGGALVQWLRDGLGLIRRAEDVEALAASVPDSEGVVLVPAFTGLGAPYWDAY 356

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKD-AGDKGEVKNDRGEFVLRVDG 663
            ARG   G+TR T   HIARA LE++  Q  D++ +M +D AG   E         LRVDG
Sbjct: 357  ARGTLFGLTRGTGAAHIARAALEAIALQTVDLVAAMDRDGAGPLAE---------LRVDG 407

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            GA  N+LLMQIQADLLG PVVRP  +ETT           VG+W+  E  +S    + + 
Sbjct: 408  GAAANDLLMQIQADLLGVPVVRPKMLETTALGAAYLAGLGVGMWSGIEELAS--HWRAER 465

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSR 411
             F+PV+ E+ R+  +  W +AV R
Sbjct: 466  RFEPVMAEDRREAAIARWRRAVER 489



>gb:CR543861_102921 Acinetobacter sp. ADP1 complete genome.
          Length = 495

 Score =  164 bits (415), Expect = 3e-39
 Identities = 93/204 (45%), Positives = 127/204 (62%), Gaps = 1/204 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AGA VQWLRD L LI  ++++EQLAS+V+ST GV  VPAF GL AP W  +
Sbjct: 297  YALEGSVFMAGAIVQWLRDGLGLIQHSAQVEQLASQVQSTEGVVLVPAFTGLGAPHWDSE 356

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            AR +  G++R T K HIARA LE++ FQV DVL +M  D          R    LRVDGG
Sbjct: 357  ARALLCGMSRGTTKAHIARAALEAIAFQVSDVLCAMQSDL--------SRPLKELRVDGG 408

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKDT 483
            A+ N++LMQ QAD+L  PV+RP  +E+T            G++T  DEI +S    + D 
Sbjct: 409  ASQNDMLMQFQADILNVPVLRPKMLESTAWGAAAMAGLKAGVFTNLDEIAAS---WQLDR 465

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSR 411
             F+P ++ + R+ ++  W +A+ R
Sbjct: 466  TFEPKMKNDERESRLCEWSQALKR 489



>sp|P18157|GLPK_BACSU Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>pir|B45868|B45868 glycerol kinase (EC 2.7.1.30)
            glpK - Bacillus subtilis>gb:BACGLPKD_745325 B.subtilis
            glycerol kinase (glpK) and glycerol-3-phosphate
            dehydrogenase (glpD) genes, complete
            cds.>gb:BSUB0005_752894 Bacillus subtilis complete genome
            (section 5 of 21): from 813670 to
            1011078.>gb:BSY14079_756233 Bacillus subtilis chromosomal
            DNA, region 75 degrees: glpPFKD operon and downstream.
          Length = 496

 Score =  164 bits (415), Expect = 3e-39
 Identities = 93/202 (46%), Positives = 114/202 (56%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEGS  +AG+A+QWLRD L +   +S  E  A KV+ST GVY VPAF GL  P+W  
Sbjct: 298  NYALEGSIFVAGSAIQWLRDGLRMFQDSSLSESYAEKVDSTDGVYVVPAFVGLGTPYWDS 357

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            D RG   G+TR T K H  RA LES+ +Q +DVLD+M  D+    +         LRVDG
Sbjct: 358  DVRGSVFGLTRGTTKEHFIRATLESLAYQTKDVLDAMEADSNISLK--------TLRVDG 409

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            GA  NN LMQ Q DLL  PV RP   ETT          AVG W +    ++  +   D 
Sbjct: 410  GAVKNNFLMQFQGDLLNVPVERPEINETTALGAAYLAGIAVGFWKDRSEIAN--QWNLDK 467

Query: 482  IFKPVIEEEVRKKKVDSWCKAV 417
             F+P +EEE R +    W KAV
Sbjct: 468  RFEPELEEEKRNELYKGWQKAV 489



>sp|Q893Q3|GLK1_CLOTE Glycerol kinase 1 (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase 1) (Glycerokinase 1) (GK
            1).>gb:AE015942_320851 Clostridium tetani E88, section 7
            of 10 of the complete genome.>gb:AE015927_963640
            Clostridium tetani E88, complete genome.
          Length = 498

 Score =  164 bits (415), Expect = 3e-39
 Identities = 92/206 (44%), Positives = 126/206 (61%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  I GAA+QWLRD L ++  + E E+ A+ VE T GVY VPAF GL AP+W   
Sbjct: 298  YALEGSIFIGGAAIQWLRDELRMLKDSPESERYATAVEDTNGVYMVPAFVGLGAPYWDPY 357

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +G+TR   K H  RA LES+ +Q  DVL++M +D+G   ++K       LRVDGG
Sbjct: 358  ARGAIVGLTRGATKEHFIRATLESLAYQTYDVLNAMREDSGI--DLK------ALRVDGG 409

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A+ N+ LMQ QAD+LG PV RP  IETT          AVG W + +  +    + K   
Sbjct: 410  ASANDFLMQFQADILGVPVQRPEVIETTALGAAYLAGLAVGYWKDKKDVAQNWAISK--T 467

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRTFD 402
            F+P + +E R++ ++ W +AV R+ +
Sbjct: 468  FEPDMIKERREELLEGWHEAVKRSMN 493



>gb:AE014296_1133959 Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE003467_1211258 Drosophila melanogaster
            chromosome 3L, section 1 of 83 of the complete sequence.
          Length = 474

 Score =  164 bits (414), Expect = 3e-39
 Identities = 95/208 (45%), Positives = 124/208 (59%), Gaps = 2/208 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS +IAGAA  WLRD++NLI ++ +IE +AS V+++  VYFVPAFNGL+AP+W  D
Sbjct: 262  YALEGSVSIAGAAFNWLRDNMNLIQNSGQIETMASTVDNSLDVYFVPAFNGLYAPYWNQD 321

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARGV  G++  T   HI RA LE++CFQVRD+LDSMHKD   K  +        L VDGG
Sbjct: 322  ARGVICGLSEETTSEHIVRATLEAVCFQVRDILDSMHKDC--KIPLAK------LMVDGG 373

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAV--GIWTEDEIFSSGEKMKKD 486
             TVNNL +Q+Q+DL+G  V+R    ETT          AV      E  +  SG +    
Sbjct: 374  MTVNNLFLQLQSDLVGIQVLRAKIAETTALGAAMAAYKAVENRYQMEAPLSKSGPR---- 429

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRTFD 402
               KP I    R  +   W  A+ R+ +
Sbjct: 430  EAIKPSISATDRNLRYQKWKMAIDRSLN 457



>gb:AE014296_1133958 Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE003467_1211257 Drosophila melanogaster
            chromosome 3L, section 1 of 83 of the complete
            sequence.>gb:AY051456_1290050 Drosophila melanogaster
            GH12641 full length cDNA.
          Length = 538

 Score =  164 bits (414), Expect = 3e-39
 Identities = 95/208 (45%), Positives = 124/208 (59%), Gaps = 2/208 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS +IAGAA  WLRD++NLI ++ +IE +AS V+++  VYFVPAFNGL+AP+W  D
Sbjct: 326  YALEGSVSIAGAAFNWLRDNMNLIQNSGQIETMASTVDNSLDVYFVPAFNGLYAPYWNQD 385

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARGV  G++  T   HI RA LE++CFQVRD+LDSMHKD   K  +        L VDGG
Sbjct: 386  ARGVICGLSEETTSEHIVRATLEAVCFQVRDILDSMHKDC--KIPLAK------LMVDGG 437

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAV--GIWTEDEIFSSGEKMKKD 486
             TVNNL +Q+Q+DL+G  V+R    ETT          AV      E  +  SG +    
Sbjct: 438  MTVNNLFLQLQSDLVGIQVLRAKIAETTALGAAMAAYKAVENRYQMEAPLSKSGPR---- 493

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRTFD 402
               KP I    R  +   W  A+ R+ +
Sbjct: 494  EAIKPSISATDRNLRYQKWKMAIDRSLN 521



>gb:AY458643_619741 Uncultured bacterium 561 clone EBAC000-47H08
            genomic sequence.
          Length = 498

 Score =  164 bits (414), Expect = 3e-39
 Identities = 92/204 (45%), Positives = 119/204 (58%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEG   I GAAVQWLRD L +I SA E+E LA  VES+GGV FVPA  GL AP W  +
Sbjct: 301  YALEGGAFICGAAVQWLRDELGIIKSAPEVEALAKTVESSGGVEFVPALAGLGAPHWDPE 360

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+TR + + HIARA L++M  Q  D+L+ M  + G K +        +LRVDGG
Sbjct: 361  ARGMISGLTRGSGRGHIARATLDAMALQNADILNLMESELGAKMK--------LLRVDGG 412

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  NNLLMQ+QAD LG  + RP  +ETT           VG+W         +  + D  
Sbjct: 413  AAANNLLMQLQADYLGKKITRPEVVETTVAGACFLAGLGVGLW--QSTAEIAKIWRVDRE 470

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRT 408
            FK  +  + R ++  SW  A++RT
Sbjct: 471  FKVALSSKKRLERRQSWQVAIART 494



>sp|Q92BH6|GLPK_LISIN Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>pir|AD1629|AD1629 glycerol kinase homolog lin1573
            [imported] - Listeria innocua (strain
            Clip11262)>gb:AL596169_538918 Listeria innocua Clip11262
            complete genome, segment 7/12.
          Length = 497

 Score =  164 bits (414), Expect = 3e-39
 Identities = 89/201 (44%), Positives = 121/201 (60%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AG+A+QWLRD L ++  +S+ E  AS++ES+ GVY VPAF GL AP+W  D
Sbjct: 300  YALEGSIFVAGSAIQWLRDGLRMVRQSSDSENYASRIESSDGVYVVPAFVGLGAPYWDSD 359

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
             RG   G+TR T K    RA LES+ +Q RDVL +M +D+G   +         LRVDGG
Sbjct: 360  VRGAVFGLTRGTEKEQFIRATLESLAYQTRDVLYAMEQDSGISLK--------TLRVDGG 411

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A+ NN LMQ Q+D+LG PV RP + ETT          AVG+W +       +  K D  
Sbjct: 412  ASANNFLMQFQSDILGVPVERPENKETTVLGAAFLAGLAVGVWKDKNEIK--KHWKLDKR 469

Query: 479  FKPVIEEEVRKKKVDSWCKAV 417
            F+  ++++ R+   + W KAV
Sbjct: 470  FEVEMKDDQREDLYEGWHKAV 490



>gb:BT001661_1356434 Drosophila melanogaster RE46914 full insert cDNA.
          Length = 474

 Score =  163 bits (413), Expect = 4e-39
 Identities = 94/208 (45%), Positives = 124/208 (59%), Gaps = 2/208 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS +IAGAA  WLRD++NLI ++ ++E +AS V+++  VYFVPAFNGL+AP+W  D
Sbjct: 262  YALEGSVSIAGAAFNWLRDNMNLIQNSGQVETMASTVDNSLDVYFVPAFNGLYAPYWNQD 321

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARGV  G++  T   HI RA LE++CFQVRD+LDSMHKD   K  +        L VDGG
Sbjct: 322  ARGVICGLSEETTSEHIVRATLEAVCFQVRDILDSMHKDC--KIPLAK------LMVDGG 373

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAV--GIWTEDEIFSSGEKMKKD 486
             TVNNL +Q+Q+DL+G  V+R    ETT          AV      E  +  SG +    
Sbjct: 374  MTVNNLFLQLQSDLVGIQVLRAKIAETTALGAAMAAYKAVENRYQMEAPLSKSGPR---- 429

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRTFD 402
               KP I    R  +   W  A+ R+ +
Sbjct: 430  EAIKPSISATDRNLRYQKWKMAIDRSLN 457



>gb:CP000010_864686 Burkholderia mallei ATCC 23344 chromosome 1,
            complete sequence.
          Length = 503

 Score =  163 bits (413), Expect = 4e-39
 Identities = 101/212 (47%), Positives = 122/212 (57%), Gaps = 2/212 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            +YALEGS  IAGA VQWLRD L +I SASEIE LA+ V  T GVY VPAF GL AP W  
Sbjct: 301  SYALEGSIFIAGAVVQWLRDGLGIIKSASEIEALAAGVPHTDGVYLVPAFAGLGAPHWNA 360

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDK-GEVKNDRGEFVLRVD 666
             ARG   G+TR T   H+ARA L+S+ +Q  DVL +M  D+G + GE         LRVD
Sbjct: 361  RARGSLFGVTRGTTSAHLARAALDSIAYQSLDVLKAMEADSGIRIGE---------LRVD 411

Query: 665  GGATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKK 489
            GGA+ NNLLMQ QADLLG   VRP   ETT          A+G W   DE+ S  +  ++
Sbjct: 412  GGASANNLLMQFQADLLGVDAVRPRITETTALGAAYLAGLAIGYWQNVDELHSQWQLERR 471

Query: 488  DTIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD 393
               F P ++ E     +  W +AV      AD
Sbjct: 472  ---FAPSMQAEQVGSCLAGWQRAVRAAKAWAD 500



>gb:BX571965_790468 Burkholderia pseudomallei strain K96243,
            chromosome 1, complete sequence.
          Length = 500

 Score =  163 bits (413), Expect = 4e-39
 Identities = 101/212 (47%), Positives = 122/212 (57%), Gaps = 2/212 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            +YALEGS  IAGA VQWLRD L +I SASEIE LA+ V  T GVY VPAF GL AP W  
Sbjct: 298  SYALEGSIFIAGAVVQWLRDGLGIIKSASEIEALAAGVPHTDGVYLVPAFAGLGAPHWNA 357

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDK-GEVKNDRGEFVLRVD 666
             ARG   G+TR T   H+ARA L+S+ +Q  DVL +M  D+G + GE         LRVD
Sbjct: 358  RARGSLFGVTRGTTSAHLARAALDSIAYQSLDVLKAMEADSGIRIGE---------LRVD 408

Query: 665  GGATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKK 489
            GGA+ NNLLMQ QADLLG   VRP   ETT          A+G W   DE+ S  +  ++
Sbjct: 409  GGASANNLLMQFQADLLGVDAVRPRITETTALGAAYLAGLAIGYWQNVDELHSQWQLERR 468

Query: 488  DTIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD 393
               F P ++ E     +  W +AV      AD
Sbjct: 469  ---FAPSMQAEQVGSCLAGWQRAVRAAKAWAD 497



>gb:PAU49666_157122 Pseudomonas aeruginosa (orfX), glycerol dfiffusion
            facilitator (glpF), glycerol kinase (glpK), and Glp
            repressor (glpR) genes, complete cds, and (orfK) gene,
            partial cds.
          Length = 505

 Score =  163 bits (413), Expect = 4e-39
 Identities = 93/205 (45%), Positives = 120/205 (58%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEG+    G+ VQWLRD L +I+ + + E  A+KV+ + GVY VPAF GL AP+W   
Sbjct: 304  YALEGAVFNGGSTVQWLRDELKVINDSFDSEYFATKVKDSNGVYLVPAFTGLGAPYWDPY 363

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G+TR     H+ RA LES+ +Q RDVLD+M +DAG++           LRVDGG
Sbjct: 364  ARGAVFGLTRGVKADHLIRATLESIAYQTRDVLDAMQRDAGERLR--------ALRVDGG 415

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKDT 483
            A  NN LMQ QAD+LG+ V RP   ETT          A G W+  DE+ S   K   + 
Sbjct: 416  AVANNFLMQFQADILGTRVERPVMRETTALGAAYLAGLACGFWSSLDELKS---KAVIER 472

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRT 408
            +F+P  +E  R+K    W KAV RT
Sbjct: 473  VFEPECDEPRREKLYAGWKKAVERT 497



>pir|I64086|I64086 glycerol kinase (EC 2.7.1.30) - Haemophilus
            influenzae  (strain Rd KW20)>gb:U32752_204364 Haemophilus
            influenzae Rd KW20 section 67 of 163 of the complete
            genome.>gb:L42023_1096913 Haemophilus influenzae Rd KW20
            complete genome.
          Length = 503

 Score =  163 bits (413), Expect = 4e-39
 Identities = 91/209 (43%), Positives = 122/209 (58%), Gaps = 1/209 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  IAGA++QWLRD L ++  + + E  A KV  + GVY VPAF GL AP+W   
Sbjct: 301  YALEGSVFIAGASIQWLRDELKIVHDSFDSEYFAQKVTDSNGVYVVPAFTGLGAPYWDPY 360

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G++R  N+ HI RA LES+ +Q RDVL++M  D+G++ +         LRVDGG
Sbjct: 361  ARGAIFGLSRGANRNHIVRATLESIAYQTRDVLEAMQSDSGERLQ--------YLRVDGG 412

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKDT 483
            AT NN LMQ QAD+L   V RP   E T          A G W + DE+    +K + + 
Sbjct: 413  ATNNNFLMQFQADILDVNVERPVVKEVTALGAAYLAGLATGFWKDLDEL---RDKARVER 469

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRTFDLA 396
             F P  + E R+++   W KAV R+ + A
Sbjct: 470  TFSPDSDNEKRERRYKGWKKAVKRSLEWA 498



>sp|P44400|GLPK_HAEIN Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase) (GK).
          Length = 502

 Score =  163 bits (413), Expect = 4e-39
 Identities = 91/209 (43%), Positives = 122/209 (58%), Gaps = 1/209 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  IAGA++QWLRD L ++  + + E  A KV  + GVY VPAF GL AP+W   
Sbjct: 300  YALEGSVFIAGASIQWLRDELKIVHDSFDSEYFAQKVTDSNGVYVVPAFTGLGAPYWDPY 359

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G++R  N+ HI RA LES+ +Q RDVL++M  D+G++ +         LRVDGG
Sbjct: 360  ARGAIFGLSRGANRNHIVRATLESIAYQTRDVLEAMQSDSGERLQ--------YLRVDGG 411

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKDT 483
            AT NN LMQ QAD+L   V RP   E T          A G W + DE+    +K + + 
Sbjct: 412  ATNNNFLMQFQADILDVNVERPVVKEVTALGAAYLAGLATGFWKDLDEL---RDKARVER 468

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRTFDLA 396
             F P  + E R+++   W KAV R+ + A
Sbjct: 469  TFSPDSDNEKRERRYKGWKKAVKRSLEWA 497



>sp|Q51390|GLK1_PSEAE Glycerol kinase 1 (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase 1) (Glycerokinase 1) (GK
            1).>pir|H83196|H83196 glycerol kinase PA3582 [imported] -
            Pseudomonas aeruginosa  (strain PAO1)>gb:AE004779_57818
            Pseudomonas aeruginosa PAO1, section 340 of 529 of the
            complete genome.>gb:AE004091_971918 Pseudomonas
            aeruginosa PAO1, complete genome.
          Length = 505

 Score =  163 bits (413), Expect = 4e-39
 Identities = 93/205 (45%), Positives = 120/205 (58%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEG+    G+ VQWLRD L +I+ + + E  A+KV+ + GVY VPAF GL AP+W   
Sbjct: 304  YALEGAVFNGGSTVQWLRDELKVINDSFDSEYFATKVKDSNGVYLVPAFTGLGAPYWDPY 363

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G+TR     H+ RA LES+ +Q RDVLD+M +DAG++           LRVDGG
Sbjct: 364  ARGAVFGLTRGVKADHLIRATLESIAYQTRDVLDAMQRDAGERLR--------ALRVDGG 415

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKDT 483
            A  NN LMQ QAD+LG+ V RP   ETT          A G W+  DE+ S   K   + 
Sbjct: 416  AVANNFLMQFQADILGTRVERPVMRETTALGAAYLAGLACGFWSSLDELKS---KAVIER 472

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRT 408
            +F+P  +E  R+K    W KAV RT
Sbjct: 473  VFEPECDEPRREKLYAGWKKAVERT 497



>sp|Q8ENK7|GLPK_OCEIH Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:BA000028_696862 Oceanobacillus iheyensis HTE831
            DNA, complete genome.
          Length = 500

 Score =  163 bits (412), Expect = 6e-39
 Identities = 94/204 (46%), Positives = 117/204 (57%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AG+A+QWLRD L LI S+ + E LAS+VE+T GVY VPAF GL  P+W  D
Sbjct: 300  YALEGSIFVAGSAIQWLRDGLRLIESSPQSEALASQVETTDGVYLVPAFVGLGTPYWDSD 359

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G+TR T K H  RA LES+ +Q +DV+D+M  D        +D     LRVDGG
Sbjct: 360  ARGAVFGLTRGTTKEHFVRATLESLAYQTKDVMDAMLAD--------SDIDLKKLRVDGG 411

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  NNLLMQ Q+D+LG  V RP   ETT          AVG W + E     ++   +  
Sbjct: 412  AVKNNLLMQFQSDILGVTVERPVVQETTALGSAYLAGLAVGFWKDKE--EIAKQWLNEKT 469

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRT 408
            F+  + EE        W KAV  T
Sbjct: 470  FENEMSEEESSYLYKGWQKAVEAT 493



>gb:BA000043_737937 Geobacillus kaustophilus HTA426 DNA, complete
            genome.
          Length = 496

 Score =  162 bits (411), Expect = 8e-39
 Identities = 92/202 (45%), Positives = 119/202 (58%), Gaps = 1/202 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AG+A+QWLRD L +I +A++ E  A KVEST GVY VPAF GL  P+W  +
Sbjct: 299  YALEGSIFVAGSAIQWLRDGLRMIKTAADSEAYAEKVESTDGVYVVPAFVGLGTPYWDSE 358

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
             RG   G+TR T K H  RA LES+ +Q +DVL +M  D+G             LRVDGG
Sbjct: 359  VRGAVFGLTRGTTKEHFIRATLESLAYQTKDVLAAMEADSG--------ISLTTLRVDGG 410

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIW-TEDEIFSSGEKMKKDT 483
            A  NN LMQ Q+DLL  PV RP   ETT          AVG W + D+I +  +  ++  
Sbjct: 411  AVKNNFLMQFQSDLLAVPVERPVVNETTALGAAYLAGLAVGYWNSRDDIAAQWQLERR-- 468

Query: 482  IFKPVIEEEVRKKKVDSWCKAV 417
             F+P ++++ R    D W KAV
Sbjct: 469  -FEPKMDDDKRTMLYDGWKKAV 489



>gb:AP006627_563578 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 500

 Score =  162 bits (411), Expect = 8e-39
 Identities = 86/204 (42%), Positives = 120/204 (58%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AG+A+QWLRD + L+ SA + E  A ++ES+ GVY VPAF GL  P+W  D
Sbjct: 300  YALEGSIFVAGSAIQWLRDGIKLLESAKDSEAYAKRIESSEGVYVVPAFVGLGTPYWDSD 359

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G+TR T + HI RA LE++ +Q +DV+++M  D+G + +         LR DGG
Sbjct: 360  ARGAMYGLTRGTTREHIVRATLEALAYQTKDVMEAMESDSGLESK--------KLRADGG 411

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
               N+ LMQ Q+DLL +PV RP   ETT          AVG+W + +     +K K D  
Sbjct: 412  VVKNDFLMQFQSDLLDAPVERPTINETTALGAAYLAGLAVGVWKDKQ--EIADKWKIDRS 469

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRT 408
            F+P +E+  R+     W  A+  T
Sbjct: 470  FEPEMEKTERETLYGGWKTAIEAT 493



>sp|O66746|GLPK_AQUAE Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>pir|F70339|F70339 glycerol kinase - Aquifex
            aeolicus>gb:AE000690_26097 Aquifex aeolicus VF5 section
            22 of 109 of the complete genome.>gb:AE000657_976628
            Aquifex aeolicus VF5 complete genome.
          Length = 492

 Score =  162 bits (411), Expect = 8e-39
 Identities = 88/204 (43%), Positives = 117/204 (57%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYA+EGS    GA ++WL D L LI  A++ E LA  + S  GVYFVPAF+GL AP+W  
Sbjct: 291  NYAIEGSVLTGGACIKWLMDRLKLIKQAADTEYLAKSISSNEGVYFVPAFSGLGAPYWDA 350

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG+ IGIT  T   HIARA LE++ +Q RDV++ M K+ G K +        +L+ DG
Sbjct: 351  SARGIIIGITGRTRIEHIARAALEAIAYQTRDVIEEMEKETGVKIK--------ILKADG 402

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            GA+ NN LMQ QAD+LG PV RP  +E T            G+W   E F   +  + + 
Sbjct: 403  GASQNNFLMQFQADILGIPVERPRHVELTALGAAGIAGIYSGMWKSKEEFIE-DTREVEL 461

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSR 411
             F P +++E R+     W  AV R
Sbjct: 462  TFSPEMKKEERELYYSKWKDAVKR 485



>gb:CP000013_869478 Borrelia garinii PBi, complete genome.
          Length = 501

 Score =  162 bits (410), Expect = 1e-38
 Identities = 96/205 (46%), Positives = 120/205 (58%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            Y LEGS  I GA +QWLRD L     +S+ E LAS     GGVYFVPAF GL AP W   
Sbjct: 297  YVLEGSVFIGGAVIQWLRDGLEFFRKSSDAESLASSASDNGGVYFVPAFVGLGAPHWDSY 356

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  IGITR + K HI RA LES+ FQ  D+L++M K      E+K       LRVDGG
Sbjct: 357  ARGTIIGITRGSTKAHITRAALESIAFQSFDILNTMKKSI-PNFEIKE------LRVDGG 409

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIW-TEDEIFSSGEKMKKDT 483
            A+ NNLLMQ QADLL   VVRP   ETT          A G W + +EI S     + D 
Sbjct: 410  ASQNNLLMQFQADLLECKVVRPKITETTALGAAYLAGLASGYWQSAEEIIS---LWQVDK 466

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRT 408
            IF+P + +  ++K +++W +A+ R+
Sbjct: 467  IFEPSMPKNQKEKLLENWNRAIERS 491



>gb:ECU41468_134136 Escherichia coli glycerol kinase (glpK22) gene,
            partial cds.
          Length = 501

 Score =  162 bits (410), Expect = 1e-38
 Identities = 94/205 (45%), Positives = 119/205 (58%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALE +  +AGA++QWLRD + LI+ A + E  A+KV++T GVY VPAF GL AP+W  
Sbjct: 299  NYALESAVFMAGASIQWLRDEMKLINDAYDSEYFATKVQNTNGVYVVPAFTGLGAPYWDP 358

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG   G+TR  N  HI RA LES+ +Q RDVL++M  D+G +           LRVDG
Sbjct: 359  YARGAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQADSGIR--------LHALRVDG 410

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKD 486
            GA  NN LMQ Q+D+LG+ V RP   E T          AVG W   DE+    EK   +
Sbjct: 411  GAVANNFLMQFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDEL---QEKAVIE 467

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSR 411
              F+P IE   R  +   W KAV R
Sbjct: 468  REFRPGIETTERNYRYAGWKKAVKR 492



>sp|O51257|GLPK_BORBU Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>pir|A70130|A70130 glycerol kinase (glpK) homolog -
            Lyme disease spirochete>gb:AE001134_32221 Borrelia
            burgdorferi B31 (section 20 of 70) of the complete
            genome.>gb:AE000783_1119872 Borrelia burgdorferi B31
            complete genome.
          Length = 501

 Score =  162 bits (410), Expect = 1e-38
 Identities = 97/204 (47%), Positives = 120/204 (58%), Gaps = 1/204 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            Y LEGS  I GA +QWLRD L     +S+ E LAS V   GGVYFVPAF GL AP W   
Sbjct: 297  YVLEGSVFIGGAVIQWLRDGLEFFRKSSDAEALASSVSDNGGVYFVPAFVGLGAPHWDSY 356

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  IGITR + K HI RA LES+ FQ  D+L++M K      E++       LRVDGG
Sbjct: 357  ARGTIIGITRGSTKAHITRAALESIAFQSFDILNTMKKSI-PNFEIQE------LRVDGG 409

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIW-TEDEIFSSGEKMKKDT 483
            A+ NNLLMQ QADLL   VVRP   ETT          A G W + +EI S     + D 
Sbjct: 410  ASQNNLLMQFQADLLECKVVRPKITETTALGAAYLAGLATGYWQSAEEIVS---LWQVDK 466

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSR 411
            IF+P + +  ++K +++W KAV +
Sbjct: 467  IFEPSMPKNQKEKLLENWNKAVGK 490



>sp|Q9WX53|GLPK_THEAQ Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>pir|JE0390|JE0390 glycerol kinase (EC 2.7.1.30)
            [validated] - Thermus aquaticus>gb:AB013715_2211 Thermus
            aquaticus gene for Glycerol Kinase, complete cds.
          Length = 496

 Score =  162 bits (409), Expect = 1e-38
 Identities = 92/202 (45%), Positives = 119/202 (58%), Gaps = 1/202 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AG+A+QWLRD L +I +A++ E  A KVEST GVY VPAF GL  P+W  +
Sbjct: 299  YALEGSIFVAGSAIQWLRDGLRMIKTAADSEAYAEKVESTDGVYVVPAFVGLGTPYWDSE 358

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
             RG   G+TR T K H  RA LES+ +Q +DVL +M  D+G             LRVDGG
Sbjct: 359  VRGAVFGLTRGTTKEHFIRATLESLAYQTKDVLAAMEADSG--------ISLTTLRVDGG 410

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIW-TEDEIFSSGEKMKKDT 483
            A  NN LMQ Q+DLL  PV RP   ETT          AVG W + D+I +  +  ++  
Sbjct: 411  AVKNNFLMQFQSDLLAVPVERPVINETTALGAPYLAGLAVGYWNSRDDIAAQWQLERR-- 468

Query: 482  IFKPVIEEEVRKKKVDSWCKAV 417
             F+P ++++ R    D W KAV
Sbjct: 469  -FEPKMDDDKRTMLYDGWKKAV 489



>sp|O66131|GLPK_THETH Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:AB004569_712 Thermus thermophilus gene for
            glycerol kinase, complete cds.
          Length = 496

 Score =  161 bits (408), Expect = 2e-38
 Identities = 92/202 (45%), Positives = 118/202 (58%), Gaps = 1/202 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AG+A+QWLRD L +I +A++ E  A KVEST GVY VPAF GL  P+W  +
Sbjct: 299  YALEGSIFVAGSAIQWLRDGLRMIKTAADSETYAEKVESTDGVYVVPAFIGLGTPYWDSE 358

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
             RG   G+TR T K H  RA LES+ +Q +DVL  M  D+G             LRVDGG
Sbjct: 359  VRGAVFGLTRGTTKEHFIRATLESLAYQTKDVLAVMEADSG--------ISLTTLRVDGG 410

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIW-TEDEIFSSGEKMKKDT 483
            A  NN LMQ Q+DLL  PV RP   ETT          AVG W + D+I +  +  ++  
Sbjct: 411  AVKNNFLMQFQSDLLAVPVERPVVNETTALGAAYLAGLAVGYWNSRDDIAAQWQLERR-- 468

Query: 482  IFKPVIEEEVRKKKVDSWCKAV 417
             F+P ++++ R    D W KAV
Sbjct: 469  -FEPKMDDDKRTMLYDGWKKAV 489



>gb:AP006627_565701 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 498

 Score =  161 bits (407), Expect = 2e-38
 Identities = 88/204 (43%), Positives = 116/204 (56%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AG+A+QWLRD L +I +A + E LA++V S  GVY VPAF GL  P+W  +
Sbjct: 300  YALEGSVFVAGSAIQWLRDGLKIIENAPQSEALATRVTSADGVYLVPAFVGLGTPYWDSE 359

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G+TR T   HI RA LES+ +Q +DV+ +M +DAG + +         LR DGG
Sbjct: 360  ARGAMFGLTRGTEHAHIVRATLESLAYQTKDVMAAMEQDAGMESK--------KLRADGG 411

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  N+ LMQ Q+DLL +PV  P+  ETT          AVG+W   E      K   D  
Sbjct: 412  AVANDFLMQFQSDLLDAPVEIPSVTETTALGAAYLAGLAVGVWKSKE--DIARKWNMDRS 469

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRT 408
            F+P +  + R      W  AV+ T
Sbjct: 470  FEPKMNADERDALYKGWKNAVNAT 493



>gb:CR378663_93664 Photobacterium profundum SS9; segment 1/12.
          Length = 508

 Score =  160 bits (406), Expect = 3e-38
 Identities = 89/201 (44%), Positives = 114/201 (56%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEG+  + GA++QWLRD + L+  A + E  A KV S+ GVY VPAF GL AP+W   
Sbjct: 302  YALEGAVFMGGASIQWLRDEVKLLGDAKDSEYFAEKVGSSNGVYVVPAFTGLGAPYWDPY 361

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +G+TR  N  HI RA LES+ +Q RDVLD+M  D+G K           LRVDGG
Sbjct: 362  ARGAIVGLTRGVNSNHIIRATLESVAYQTRDVLDAMQADSGIK--------LATLRVDGG 413

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  NN LMQ Q+D+L + V RP   E T          A+G W  D I    +K K D  
Sbjct: 414  AVANNFLMQFQSDVLDTQVFRPVVTEVTALGAAYLAGLAIGFW--DSIDELQDKAKLDRQ 471

Query: 479  FKPVIEEEVRKKKVDSWCKAV 417
            F P   ++ R ++   W +AV
Sbjct: 472  FIPCANDKKRDRRYRGWQRAV 492



>sp|Q88NX8|GLPK_PSEPK Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:AE016778_330514 Pseudomonas putida KT2440
            section 5 of 21 of the complete
            genome.>gb:AE015451_945591 Pseudomonas putida KT2440
            complete genome.
          Length = 499

 Score =  160 bits (406), Expect = 3e-38
 Identities = 94/210 (44%), Positives = 119/210 (56%), Gaps = 1/210 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEG+    G+ VQWLRD L +++ A + E  ASKV+ + GVY VPAF GL AP+W   
Sbjct: 298  YALEGAVFNGGSTVQWLRDELKIVNDALDTEYFASKVKDSNGVYLVPAFTGLGAPYWDPY 357

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G+TR     HI RA LES+ +Q RDVLD+M +D G +           LRVDGG
Sbjct: 358  ARGALFGLTRGVKVDHIIRAALESIAYQTRDVLDAMQQDCGQRLS--------ELRVDGG 409

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKDT 483
            A  NN LMQ QAD+LG+ V RP   ETT          A G W+  DE+    +K   + 
Sbjct: 410  AVANNFLMQFQADILGTCVERPQMRETTALGAAYLAGLACGFWSGLDEL---RDKAIIER 466

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD 393
             F P ++E  ++K    W KAV RT D  D
Sbjct: 467  EFSPQLDETQKEKLYAGWKKAVERTRDWED 496



>gb:AF076290_476807 Brucella melitensis Bme18 (bme18) gene, partial
            cds; Bme19 (bme19), Bme16 (bme16), Bme17 (bme17), Bme20
            (bme20), Bme21 (bme21), Bme22 (bme22), Bme23 (bme23),
            Bme24 (bme24), Bme25 (bme25), Bme26 (bme26), Bme27
            (bme27), Bme28 (bme28), Bme29 (bme29), Bme30 (bme30),
            Bme31 (bme31), Bme1 (bme1), Bme2 (bme2), Bme3 (bme3),
            Bme4 (bme4), outer membrane protein (omp31), Bme6 (bme6),
            Bme7 (bme7), Bme8 (bme8), Bme9 (bme9), Bme10 (bme10),
            Bme11 (bme11), Bme12 (bme12), Bme13 (bme13), and Bme14
            (bme14) genes, complete cds; and Bme15 (bme15) gene,
            partial cds.
          Length = 370

 Score =  160 bits (405), Expect = 4e-38
 Identities = 88/203 (43%), Positives = 119/203 (58%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  IAGAAVQWLRD +  IS ASE+  LA K +    +Y VPAF GL AP+W  +
Sbjct: 170  YALEGSIFIAGAAVQWLRDEMGFISVASEVSALAEKADPNQRIYLVPAFTGLGAPYWDAE 229

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G+TR T +   ARA LES+ +Q  D+L++M      +G+ K      VLRVDGG
Sbjct: 230  ARGAIFGLTRGTGRAEFARAALESVAYQTFDLLEAM------QGDWKGATNHTVLRVDGG 283

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
               ++  MQ  AD+L +PV RP  +ETT            GIW + + FS  E+ ++D  
Sbjct: 284  MVASDWTMQRLADILNAPVDRPVFLETTVLGAAWLAASRAGIWPDRKGFS--ERWQRDCR 341

Query: 479  FKPVIEEEVRKKKVDSWCKAVSR 411
            F+P + E+ R+  +  W  +VSR
Sbjct: 342  FEPAMPEKERESAIAGWRDSVSR 364



>gb:AE017333_446865 Bacillus licheniformis DSM 13, complete
            genome.>gb:CP000002_856687 Bacillus licheniformis ATCC
            14580, complete genome.
          Length = 496

 Score =  160 bits (405), Expect = 4e-38
 Identities = 88/202 (43%), Positives = 116/202 (57%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AG+A+QWLRD L +   A E E+ A + ES  GVY VPAF GL  P+W  D
Sbjct: 299  YALEGSVFVAGSAIQWLRDGLRMFKDAKESEKYAVRAESADGVYVVPAFVGLGTPYWDSD 358

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
             RG   G+TR T K H  RA LE++ +Q +DVLD+M +D+G   +         LRVDGG
Sbjct: 359  VRGAVFGLTRGTTKEHFIRATLEALAYQTKDVLDAMKEDSGIPVK--------TLRVDGG 410

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  NN LM  Q D+L  PV RP   ETT          AVG W++       ++ + D  
Sbjct: 411  AVKNNFLMDFQGDILDVPVERPEINETTALGSAYLAGLAVGFWSDRSEIK--DQWQLDKR 468

Query: 479  FKPVIEEEVRKKKVDSWCKAVS 414
            F+P +EE+ R+   + W KAV+
Sbjct: 469  FEPKMEEKERESLYNGWKKAVN 490



>pir|AG3612|AG3612 glycerol kinase (EC 2.7.1.30) [imported] - Brucella
            melitensis (strain 16M)>gb:AE009716_254803 Brucella
            melitensis 16M chromosome II, section 78 of 107 of the
            complete sequence.>gb:AE008918_980715 Brucella melitensis
            16M chromosome II, complete sequence.
          Length = 356

 Score =  160 bits (405), Expect = 4e-38
 Identities = 88/203 (43%), Positives = 119/203 (58%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  IAGAAVQWLRD +  IS ASE+  LA K +    +Y VPAF GL AP+W  +
Sbjct: 156  YALEGSIFIAGAAVQWLRDEMGFISVASEVSALAEKADPNQRIYLVPAFTGLGAPYWDAE 215

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G+TR T +   ARA LES+ +Q  D+L++M      +G+ K      VLRVDGG
Sbjct: 216  ARGAIFGLTRGTGRAEFARAALESVAYQTFDLLEAM------QGDWKGATNHTVLRVDGG 269

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
               ++  MQ  AD+L +PV RP  +ETT            GIW + + FS  E+ ++D  
Sbjct: 270  MVASDWTMQRLADILNAPVDRPVFLETTVLGAAWLAASRAGIWPDRKGFS--ERWQRDCR 327

Query: 479  FKPVIEEEVRKKKVDSWCKAVSR 411
            F+P + E+ R+  +  W  +VSR
Sbjct: 328  FEPAMPEKERESAIAGWRDSVSR 350



>sp|Q8DBM6|GLPK_VIBVU Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>sp|Q7MI93|GLPK_VIBVY Glycerol kinase (EC 2.7.1.30)
            (ATP:glycerol 3-phosphotransferase) (Glycerokinase)
            (GK).>gb:AE016802_336449 Vibrio vulnificus CMCP6
            chromosome I section 6 of 11 of the complete
            sequence.>gb:BA000037_723450 Vibrio vulnificus YJ016 DNA,
            chromosome I, complete sequence.>gb:AE016795_1046173
            Vibrio vulnificus CMCP6 chromosome I complete sequence.
          Length = 505

 Score =  160 bits (405), Expect = 4e-38
 Identities = 92/202 (45%), Positives = 117/202 (57%), Gaps = 1/202 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEG+  + GA++QWLRD L LIS A + E  A+KV+++ GVY VPAF GL AP+W   
Sbjct: 301  YALEGAVFMGGASIQWLRDELKLISDAHDSEYFATKVDTSNGVYVVPAFTGLGAPYWDAY 360

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +G+TR  N  HI RA LE + +Q RDVLD+M  D+G K           LRVDGG
Sbjct: 361  ARGTIVGLTRGVNSNHIIRATLEGIAYQTRDVLDAMQADSGIKLS--------ALRVDGG 412

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKDT 483
            A  NN LMQ Q+D+L + V RP   E T          AVG W   DE+     K + D 
Sbjct: 413  AVANNFLMQFQSDVLDTEVHRPKVTEVTALGAAYLAGLAVGYWNSIDELQG---KAEIDR 469

Query: 482  IFKPVIEEEVRKKKVDSWCKAV 417
             F P  +EE R ++   W +AV
Sbjct: 470  SFLPHQDEEKRSRRYKGWKRAV 491



>sp|Q8YBR2|GLPK_BRUME Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase) (GK).
          Length = 498

 Score =  160 bits (405), Expect = 4e-38
 Identities = 88/203 (43%), Positives = 119/203 (58%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  IAGAAVQWLRD +  IS ASE+  LA K +    +Y VPAF GL AP+W  +
Sbjct: 298  YALEGSIFIAGAAVQWLRDEMGFISVASEVSALAEKADPNQRIYLVPAFTGLGAPYWDAE 357

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G+TR T +   ARA LES+ +Q  D+L++M      +G+ K      VLRVDGG
Sbjct: 358  ARGAIFGLTRGTGRAEFARAALESVAYQTFDLLEAM------QGDWKGATNHTVLRVDGG 411

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
               ++  MQ  AD+L +PV RP  +ETT            GIW + + FS  E+ ++D  
Sbjct: 412  MVASDWTMQRLADILNAPVDRPVFLETTVLGAAWLAASRAGIWPDRKGFS--ERWQRDCR 469

Query: 479  FKPVIEEEVRKKKVDSWCKAVSR 411
            F+P + E+ R+  +  W  +VSR
Sbjct: 470  FEPAMPEKERESAIAGWRDSVSR 492



>gb:AY588240_630450 Lactobacillus sakei glycerol metabolism operon,
            complete sequence.
          Length = 505

 Score =  160 bits (404), Expect = 5e-38
 Identities = 91/209 (43%), Positives = 125/209 (59%), Gaps = 4/209 (1%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEGS  +AG+A+QWLRDS+ L+  +S+ E  A    S   VY VPAF GL AP+W  
Sbjct: 299  NYALEGSVFVAGSAIQWLRDSMQLVEKSSDSEAAAKASTSLNEVYVVPAFTGLGAPYWDA 358

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            +ARG  +GITR TN+  I +A L+S+ +Q RDV+ +M KD G   ++K      +LRVDG
Sbjct: 359  EARGSILGITRGTNRQDIIKATLQSLAYQTRDVVQTMQKDTGI--DIK------MLRVDG 410

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTED----EIFSSGEKM 495
            GA  NN LMQ QAD+L S + + A++ETT          AVG W +     +IFS G++ 
Sbjct: 411  GAANNNYLMQFQADILNSAIEKAANLETTAMGAAFLAGLAVGFWQDTDELAQIFSVGQR- 469

Query: 494  KKDTIFKPVIEEEVRKKKVDSWCKAVSRT 408
                 F+P + EE R+     W +A+  T
Sbjct: 470  -----FEPNMPEEEREDLYAGWQQAIEAT 493



>gb:AE012798_285675 Chlorobium tepidum TLS section 19 of 194 of the
            complete genome.>gb:AE006470_932843 Chlorobium tepidum
            TLS complete genome.
          Length = 483

 Score =  160 bits (404), Expect = 5e-38
 Identities = 93/207 (44%), Positives = 119/207 (57%), Gaps = 3/207 (1%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YA+EGS  I GA +QWLRD L LI SA+E E +A  VES GGVY VPAF GL AP W  +
Sbjct: 287  YAVEGSVFIGGAVMQWLRDGLQLIGSAAESETIARSVESNGGVYLVPAFVGLGAPHWNME 346

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G+TR +++ HI RA LES+ FQ  DV  +M  D G + +         L VDGG
Sbjct: 347  ARGTITGLTRGSSRAHIVRAALESIAFQSHDVFRAMVADIGIQPQ--------SLTVDGG 398

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIW---TEDEIFSSGEKMKK 489
            A  N  LMQ+QADLLG PV RP +IE+T            G+W    E  + +S E+   
Sbjct: 399  AVSNEFLMQLQADLLGVPVHRPRNIESTALGAACLAGLEAGVWGSAAELRVLNSVER--- 455

Query: 488  DTIFKPVIEEEVRKKKVDSWCKAVSRT 408
              +F P + E  R+  +  W KA+ +T
Sbjct: 456  --VFTPAMPEGEREALLAGWQKALRQT 480



>sp|Q87M72|GLPK_VIBPA Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:BA000031_707846 Vibrio parahaemolyticus RIMD
            2210633 DNA, chromosome 1, complete sequence.
          Length = 505

 Score =  160 bits (404), Expect = 5e-38
 Identities = 89/201 (44%), Positives = 119/201 (59%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEG+  + GA++QWLRD L +++ A + E  A+KV+++ GVY VPAF GL AP+W   
Sbjct: 301  YALEGAVFMGGASIQWLRDELKILNGAEDSEYFATKVDTSNGVYVVPAFTGLGAPYWDAY 360

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +G+TR  N  HI RA LE + +Q RDVLD+M  D+G K  + N      LRVDGG
Sbjct: 361  ARGTIVGLTRGVNSNHIIRATLEGIAYQTRDVLDAMQADSGIK--LAN------LRVDGG 412

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  NN LMQ Q+D+L + V RP   E T          AVG W  + I    +K   D  
Sbjct: 413  AVANNFLMQFQSDVLNTEVHRPQVTEVTALGAAYLAGLAVGYW--NSIDELQDKAVLDRT 470

Query: 479  FKPVIEEEVRKKKVDSWCKAV 417
            F+P  +EE R ++   W +AV
Sbjct: 471  FEPHDDEEKRNRRYKGWKRAV 491



>sp|Q8FWK8|GLPK_BRUSU Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:AE014292_310015 Brucella suis 1330 chromosome
            II, complete sequence.
          Length = 498

 Score =  159 bits (401), Expect = 1e-37
 Identities = 87/203 (42%), Positives = 118/203 (58%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  IAGAAVQWLRD +  IS  SE+  LA K +    +Y VPAF GL AP+W  +
Sbjct: 298  YALEGSIFIAGAAVQWLRDEMGFISVVSEVSALAEKADPNQRIYLVPAFTGLGAPYWDAE 357

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G+TR T +   ARA LES+ +Q  D+L++M      +G+ K      VLRVDGG
Sbjct: 358  ARGAIFGLTRGTGRAEFARAALESVAYQTFDLLEAM------QGDWKGATNHTVLRVDGG 411

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
               ++  MQ  AD+L +PV RP  +ETT            GIW + + FS  E+ ++D  
Sbjct: 412  MVASDWTMQRLADILNAPVDRPVFLETTVLGAAWLAASRAGIWPDRKGFS--ERWQRDCR 469

Query: 479  FKPVIEEEVRKKKVDSWCKAVSR 411
            F+P + E+ R+  +  W  +VSR
Sbjct: 470  FEPAMPEKERESAIAGWRDSVSR 492



>gb:AGA439353_1281916 Anopheles gambiae BAC clone 30E5.
          Length = 555

 Score =  158 bits (400), Expect = 1e-37
 Identities = 90/211 (42%), Positives = 116/211 (54%), Gaps = 3/211 (1%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS A+AG A+ WLRD+L +I    + E++A  V STG VYFVPAF GL+AP+WR D
Sbjct: 315  YALEGSVAVAGVAMNWLRDNLKIIKDIKDSEEIAGSVSSTGDVYFVPAFTGLYAPYWRKD 374

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+T FT K H  RA LE++CFQ RD++++M KD G    +  ++    L  DG 
Sbjct: 375  ARGIFCGLTSFTTKHHFVRAALEAVCFQTRDIIEAMKKDCG----INLNK----LHTDGI 426

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGI---WTEDEIFSSGEKMKK 489
               N+LLMQ+QADL G PV+R    E            A G+     E EI         
Sbjct: 427  MASNSLLMQLQADLSGIPVLRTEVHEPAALGTAMAAAQANGVDLYKLEAEIRGYAGVQSH 486

Query: 488  DTIFKPVIEEEVRKKKVDSWCKAVSRTFDLA 396
               F P   EE R  +   W  AV R+   A
Sbjct: 487  HETFLPTTTEEERNARYTKWKMAVQRSLGWA 517



>gb:AF506980_517588 Borrelia hermsii glycerol kinase (glpK) gene,
            complete cds.
          Length = 495

 Score =  158 bits (400), Expect = 1e-37
 Identities = 92/203 (45%), Positives = 120/203 (59%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            Y  EGS  I GA +QWLRD+L L   + + E +A+ V++ GG+YFVPAF GL  P W   
Sbjct: 297  YVFEGSVFIGGAVIQWLRDNLELFRKSGDAEAVAASVDNNGGIYFVPAFVGLGTPHWDPY 356

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+ IG+TR + K HI RA LES+  Q  DVL  M +++  + E+K       LRVDGG
Sbjct: 357  ARGMIIGLTRSSTKEHITRAALESIALQSFDVLTEM-QNSIQEFEIKE------LRVDGG 409

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A+ NNLLMQ QAD+L   VVRP   ETT          AVG W   E  +S    K D I
Sbjct: 410  ASKNNLLMQFQADILQCNVVRPKITETTALGSAYLAGLAVGYWESAEEITS--LWKSDKI 467

Query: 479  FKPVIEEEVRKKKVDSWCKAVSR 411
            F+P +E+  R+  + +W KA+ R
Sbjct: 468  FEPSMEKSKREDLIYNWNKAIKR 490



>gb:CP000021_872987 Vibrio fischeri ES114 chromosome II, complete
            sequence.
          Length = 504

 Score =  156 bits (394), Expect = 7e-37
 Identities = 88/203 (43%), Positives = 118/203 (58%), Gaps = 1/203 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            +YALEG+  + GA++QWLRD + L++ A + E  A+KV+++ GVY VPAF GL AP+W  
Sbjct: 300  SYALEGAVFMGGASIQWLRDEMKLLADAKDSEYFATKVDTSNGVYVVPAFTGLGAPYWDA 359

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG  +G+TR     HI RA LES+ +Q RDV+D+M  D+G K           LRVDG
Sbjct: 360  YARGTIVGLTRGCGSNHIIRATLESIAYQTRDVIDAMQADSGIKLS--------ALRVDG 411

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKD 486
            GA  NN LMQ Q+D+L   V RP   E T          AVG W   DE+    +K   D
Sbjct: 412  GAVANNFLMQFQSDVLDVAVHRPKVTEVTALGAAYLAGLAVGFWNGLDEL---ADKAVID 468

Query: 485  TIFKPVIEEEVRKKKVDSWCKAV 417
              F+P  +EE R ++   W +AV
Sbjct: 469  RSFEPHHDEEKRNQRYRGWKRAV 491



>sp|Q8XUY1|GLPK_RALSO Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:AL646073_547980 Ralstonia solanacearum GMI1000
            chromosome, complete sequence; segment 17/19.
          Length = 498

 Score =  156 bits (394), Expect = 7e-37
 Identities = 90/205 (43%), Positives = 121/205 (59%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            +YALEGS  + GA VQWLRD L  I  ++++E LA+ V  +GGV FVP+F GL AP+W  
Sbjct: 296  SYALEGSVFVGGAVVQWLRDGLRAIQRSADVEGLAASVPDSGGVVFVPSFTGLGAPYWDP 355

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             A+G  +G++R T   HIARA LES+ FQ   +L +M +DA              LRVDG
Sbjct: 356  TAQGAIVGLSRGTTIGHIARAALESIAFQSTALLQAMTRDAVS--------AITELRVDG 407

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIW-TEDEIFSSGEKMKKD 486
            GA+ NNLL+Q QADLLG PVVRP  IETT          A G + +EDE+     + +  
Sbjct: 408  GASANNLLLQFQADLLGIPVVRPEIIETTALGAAYLAGIATGFYRSEDEV---ARQWRAS 464

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSR 411
              F PVI  +  + ++  W  AV++
Sbjct: 465  RTFHPVISRDEAQHRMAQWEMAVAQ 489



>sp|Q8PDI0|GLPK_XANCP Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:AE012132_279633 Xanthomonas campestris pv.
            campestris str. ATCC 33913, section 40 of 460 of the
            complete genome.>gb:AE008922_912915 Xanthomonas
            campestris pv. campestris str. ATCC 33913, complete
            genome.
          Length = 499

 Score =  155 bits (393), Expect = 9e-37
 Identities = 87/204 (42%), Positives = 115/204 (56%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEG+  +AG+ VQWLRD L +   AS+ +  A +     GVYFVPAF GL AP+WR D
Sbjct: 300  YALEGAIFVAGSVVQWLRDGLRMFGKASDSQAYAERAGDNDGVYFVPAFVGLGAPYWRSD 359

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
             RG   G+TR T+K H  RA +ESM +Q RDVL +M  D+G   E+K       LR DGG
Sbjct: 360  IRGAVFGLTRGTSKEHFVRAAVESMAYQTRDVLTAMQSDSGI--ELKE------LRADGG 411

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  N+ + Q Q+D+L  PV+RP   ETT          A G W+  E     ++   D  
Sbjct: 412  AIANDFMAQFQSDILNVPVLRPEVAETTALGAAYLAGLATGFWSSRE--EIAKQWAVDRR 469

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRT 408
            F+P + EE R++    W +AV  T
Sbjct: 470  FEPNMPEERREQLYAGWQQAVEAT 493



>sp|Q8E794|GLPK_STRA3 Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>sp|Q8E1T0|GLPK_STRA5 Glycerol kinase (EC 2.7.1.30)
            (ATP:glycerol 3-phosphotransferase) (Glycerokinase)
            (GK).>gb:SAG766844_169791 Streptococcus agalactiae NEM316
            complete genome, segment 2.>gb:AE014203_305614
            Streptococcus agalactiae 2603V/R section 13 of 100 of the
            complete genome.>gb:AE009948_935727 Streptococcus
            agalactiae 2603V/R complete genome.
          Length = 502

 Score =  155 bits (393), Expect = 9e-37
 Identities = 90/206 (43%), Positives = 121/206 (58%), Gaps = 1/206 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            +YALEGS  IAG+A+QWLRD L +I ++SE E LA    S   VY VPAF GL AP+W  
Sbjct: 301  HYALEGSIFIAGSAIQWLRDGLRMIETSSESEGLAQSSTSDDEVYVVPAFTGLGAPYWDS 360

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            +ARG   G+TR T+K    +A L+S+ +QVRDV+D+M  D+G   +         LRVDG
Sbjct: 361  NARGSVFGLTRGTSKEDFVKATLQSIAYQVRDVIDTMQVDSGIDIQ--------QLRVDG 412

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIW-TEDEIFSSGEKMKKD 486
            GA +NNLLMQ QAD+LG  + R  ++ETT          +VG W + DE+    E     
Sbjct: 413  GAAMNNLLMQFQADILGIDIARAKNLETTALGAAFLAGLSVGYWESMDEL---KELNATG 469

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
             +F+  + E  ++K    W KAV  T
Sbjct: 470  QLFQATMNESRKEKLYKGWRKAVKAT 495



>gb:AF354273_504054 Lactobacillus rhamnosus glycerol kinase,
            alpha-glycerophosphate oxidase, and glycerol uptake
            facilitator genes, complete cds.
          Length = 505

 Score =  154 bits (390), Expect = 2e-36
 Identities = 87/204 (42%), Positives = 118/204 (57%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AG+A+QWLRD++ LI  +S+ E  A   +S   VY VPAF GL AP+W  D
Sbjct: 302  YALEGSVFVAGSAIQWLRDAMKLIERSSDSEAAARASKSQNEVYVVPAFTGLGAPYWDSD 361

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   GITR T +    +A L+S+ +Q RDV+D+M+KD G             LRVDGG
Sbjct: 362  ARGAIFGITRGTTREDFIKATLQSLAYQSRDVVDTMNKDTGMPIP--------ALRVDGG 413

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  N+ LMQ QAD+LG P+ R A++ETT          A G W   +   S  K+ K   
Sbjct: 414  AANNDYLMQFQADILGIPIERAANLETTAMGAAFFAGLATGFWNSTDELQSIVKVGKR-- 471

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRT 408
            F+P ++   R+   + W +AV+ T
Sbjct: 472  FEPTMDVSDRESLYEGWKQAVAAT 495



>pir|B82578|B82578 glycerol kinase XF2268 [imported] - Xylella
            fastidiosa  (strain 9a5c)>gb:AE004039_49896 Xylella
            fastidiosa 9a5c, section 185 of 229 of the complete
            genome.>gb:AE003849_1117106 Xylella fastidiosa 9a5c,
            complete genome.
          Length = 516

 Score =  154 bits (390), Expect = 2e-36
 Identities = 87/204 (42%), Positives = 114/204 (55%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AG+ VQWLRD L +   AS+ +  A +V   GGVY VPAF GL AP+WR D
Sbjct: 317  YALEGSIFVAGSVVQWLRDGLRMFGKASDSQAYADRVSDNGGVYVVPAFVGLGAPYWRSD 376

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
             RG   G+TR T K H  RA LESM +Q RDVL +M  DAG   E+K       LR DG 
Sbjct: 377  VRGAVFGLTRSTTKEHFIRAALESMAYQTRDVLSAMQADAG--MELKE------LRTDGA 428

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  N+ + Q Q+D+L  PV+R    ETT          A G W+  E  +  +    +  
Sbjct: 429  AITNDFMAQFQSDILAVPVLRSEIAETTALGAAYLAGLATGFWSSREEIT--QHWAINLC 486

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRT 408
            FKP ++++ R+     W +AV+ T
Sbjct: 487  FKPQMDKQQREHLYAGWKQAVAAT 510



>sp|Q9PB76|GLPK_XYLFA Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase) (GK).
          Length = 499

 Score =  154 bits (390), Expect = 2e-36
 Identities = 87/204 (42%), Positives = 114/204 (55%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AG+ VQWLRD L +   AS+ +  A +V   GGVY VPAF GL AP+WR D
Sbjct: 300  YALEGSIFVAGSVVQWLRDGLRMFGKASDSQAYADRVSDNGGVYVVPAFVGLGAPYWRSD 359

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
             RG   G+TR T K H  RA LESM +Q RDVL +M  DAG   E+K       LR DG 
Sbjct: 360  VRGAVFGLTRSTTKEHFIRAALESMAYQTRDVLSAMQADAG--MELKE------LRTDGA 411

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  N+ + Q Q+D+L  PV+R    ETT          A G W+  E  +  +    +  
Sbjct: 412  AITNDFMAQFQSDILAVPVLRSEIAETTALGAAYLAGLATGFWSSREEIT--QHWAINLC 469

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRT 408
            FKP ++++ R+     W +AV+ T
Sbjct: 470  FKPQMDKQQREHLYAGWKQAVAAT 493



>sp|Q7WF38|GLPK_BORBR Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>sp|Q7W3R1|GLPK_BORPA Glycerol kinase (EC 2.7.1.30)
            (ATP:glycerol 3-phosphotransferase) (Glycerokinase)
            (GK).>gb:BX640435_812204 Bordetella parapertussis strain
            12822, complete genome; segment 13/14.>gb:BX640450_817090
            Bordetella bronchiseptica strain RB50, complete genome;
            segment 14/16.
          Length = 508

 Score =  154 bits (390), Expect = 2e-36
 Identities = 89/201 (44%), Positives = 119/201 (59%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            Y +EG   +AGAAVQWLRD L +I  +++IE LA+ V  T  V+ VPAF GL AP W   
Sbjct: 304  YMVEGGVFMAGAAVQWLRDGLGIIQRSADIEALAASVADTDDVFMVPAFAGLGAPHWDPY 363

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +G+TR T + HIARA LES+  Q  ++L  M+ D+G             LRVDGG
Sbjct: 364  ARGTLVGMTRGTTRAHIARATLESIALQSAELLSCMNADSGIPLS--------ELRVDGG 415

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  N+LLMQ+QADLLG PVVRP   E+T          AVG W+  + F  G + + +  
Sbjct: 416  AARNDLLMQMQADLLGVPVVRPRVPESTALGAAGLAGLAVGFWSSLDEF--GAQWQAERT 473

Query: 479  FKPVIEEEVRKKKVDSWCKAV 417
            F+P    +VR+ ++  W +AV
Sbjct: 474  FEPAWPADVREARMQRWRQAV 494



>gb:ECU94355_134959 Enterococcus casseliflavus glycerol kinase (glpK)
            gene, complete cds.
          Length = 506

 Score =  154 bits (389), Expect = 3e-36
 Identities = 87/205 (42%), Positives = 122/205 (59%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AG+A+QWLRD L +I ++ + E+LA+K +    VY VPAF GL AP+W  +
Sbjct: 301  YALEGSIFVAGSAIQWLRDGLRMIETSPQSEELAAKAKGDNEVYVVPAFTGLGAPYWDSE 360

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G+TR T K    RA L+++ +Q +DV+D+M KD+G            +L+VDGG
Sbjct: 361  ARGAVFGLTRGTTKEDFVRATLQAVAYQSKDVIDTMKKDSGIDIP--------LLKVDGG 412

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKDT 483
            A  N+LLMQ QAD+L   V R A++ETT          AVG W + DE+ S  E   +  
Sbjct: 413  AAKNDLLMQFQADILDIDVQRAANLETTALGAAYLAGLAVGFWKDLDELKSMAE---EGQ 469

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRT 408
            +F P +  E R    + W +AV+ T
Sbjct: 470  MFTPEMPAEERDNLYEGWKQAVAAT 494



>sp|O34153|GLPK_ENTCA Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase) (GK).
          Length = 505

 Score =  154 bits (389), Expect = 3e-36
 Identities = 87/205 (42%), Positives = 122/205 (59%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AG+A+QWLRD L +I ++ + E+LA+K +    VY VPAF GL AP+W  +
Sbjct: 300  YALEGSIFVAGSAIQWLRDGLRMIETSPQSEELAAKAKGDNEVYVVPAFTGLGAPYWDSE 359

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G+TR T K    RA L+++ +Q +DV+D+M KD+G            +L+VDGG
Sbjct: 360  ARGAVFGLTRGTTKEDFVRATLQAVAYQSKDVIDTMKKDSGIDIP--------LLKVDGG 411

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKDT 483
            A  N+LLMQ QAD+L   V R A++ETT          AVG W + DE+ S  E   +  
Sbjct: 412  AAKNDLLMQFQADILDIDVQRAANLETTALGAAYLAGLAVGFWKDLDELKSMAE---EGQ 468

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRT 408
            +F P +  E R    + W +AV+ T
Sbjct: 469  MFTPEMPAEERDNLYEGWKQAVAAT 493



>sp|Q87BZ2|GLPK_XYLFT Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:AE012558_284701 Xylella fastidiosa Temecula1,
            section 6 of 9 of the complete genome.>gb:AE009442_961277
            Xylella fastidiosa Temecula1, complete genome.
          Length = 499

 Score =  154 bits (388), Expect = 4e-36
 Identities = 88/204 (43%), Positives = 112/204 (54%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  IAG+ VQWLRD L +   AS+ +  A +V   GGVY VPAF GL AP+WR D
Sbjct: 300  YALEGSIFIAGSVVQWLRDGLRMFGKASDSQAYADRVSDNGGVYVVPAFVGLGAPYWRSD 359

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
             RG   G+TR T K H  RA LESM +Q RDVL +M  DA    E+K       LR DG 
Sbjct: 360  VRGAVFGLTRSTTKEHFVRAALESMAYQTRDVLSAMQADADI--ELKE------LRTDGA 411

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  N+ + Q Q+D+L  PV+R    ETT          A G W+  E  +    + +   
Sbjct: 412  AITNDFMAQFQSDILAVPVLRSQIAETTALGAAYLAGLATGFWSSREEMTQHWAINR--C 469

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRT 408
            FKP +++E R+     W +AV  T
Sbjct: 470  FKPQMDKEQREHLYAGWKQAVEAT 493



>sp|P57944|GLPK_PASMU Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:AE006181_216334 Pasteurella multocida subsp.
            multocida str. Pm70 section 148 of 204 of the complete
            genome.>gb:AE004439_1119064 Pasteurella multocida subsp.
            multocida str. Pm70, complete genome.
          Length = 502

 Score =  154 bits (388), Expect = 4e-36
 Identities = 85/206 (41%), Positives = 114/206 (55%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  + GA++QWLRD L ++  + + E  A++V    GVY VPAF GL AP+W   
Sbjct: 301  YALEGSIFMGGASIQWLRDELKIVHDSYDSEYFATRVPDCNGVYVVPAFTGLGAPYWDPY 360

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G++R  N+ HI RA LES+ +Q RDVL++M  D+G   +         LRVDGG
Sbjct: 361  ARGAIFGLSRGANRNHIVRATLESIAYQTRDVLEAMQSDSGQTLQ--------ALRVDGG 412

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            AT NN LMQ QAD+L + V RP   E T          A G W   ++    +K   +  
Sbjct: 413  ATENNFLMQFQADILATKVERPKVKEVTALGAAYLAGLATGFW--KDLSELRDKASIEKT 470

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRTFD 402
            F P  +E  R ++   W KAV R  +
Sbjct: 471  FVPDGDEAKRTRRYKGWKKAVKRALE 496



>gb:CP000003_861354 Streptococcus pyogenes MGAS10394, complete genome.
          Length = 504

 Score =  153 bits (387), Expect = 5e-36
 Identities = 87/205 (42%), Positives = 120/205 (58%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            +YALEGS  IAG+A+QWLRD L +I ++ E EQ A    S   VY VPAF GL AP+W  
Sbjct: 300  HYALEGSIFIAGSAIQWLRDGLKMIETSPESEQFALASTSDDEVYVVPAFTGLGAPYWDS 359

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            +ARG   G+TR T+K    +A L+S+ +QVRDV+D+M  D+G   +         LRVDG
Sbjct: 360  NARGSVFGLTRGTSKEDFVKATLQSIAYQVRDVIDTMQVDSGIDIQ--------QLRVDG 411

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            GA +NN+LMQ QAD+LG  + R  ++ETT          AVG W  +++ +  E      
Sbjct: 412  GAAMNNMLMQFQADILGIDIARAKNLETTALGAAFLAGLAVGYW--EDMDALKELNATGQ 469

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRT 408
            +FK  + E  ++K    W +AV  T
Sbjct: 470  LFKASMNESRKEKLYKGWKRAVKAT 494



>sp|Q99YI7|GLPK_STRPY Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:AE006598_220565 Streptococcus pyogenes M1 GAS,
            section 127 of 167 of the complete
            genome.>gb:AE004092_1106411 Streptococcus pyogenes M1
            GAS, complete genome.
          Length = 508

 Score =  153 bits (387), Expect = 5e-36
 Identities = 87/205 (42%), Positives = 120/205 (58%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            +YALEGS  IAG+A+QWLRD L +I ++ E EQ A    S   VY VPAF GL AP+W  
Sbjct: 300  HYALEGSIFIAGSAIQWLRDGLKMIETSPESEQFALASTSDDEVYVVPAFTGLGAPYWDS 359

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            +ARG   G+TR T+K    +A L+S+ +QVRDV+D+M  D+G   +         LRVDG
Sbjct: 360  NARGSVFGLTRGTSKEDFVKATLQSIAYQVRDVIDTMQVDSGIDIQ--------QLRVDG 411

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            GA +NN+LMQ QAD+LG  + R  ++ETT          AVG W  +++ +  E      
Sbjct: 412  GAAMNNMLMQFQADILGIDIARAKNLETTALGAAFLAGLAVGYW--EDMDALKELNATGQ 469

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRT 408
            +FK  + E  ++K    W +AV  T
Sbjct: 470  LFKASMNESRKEKLYKGWKRAVKAT 494



>sp|Q8NZW9|GLPK_STRP8 Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:AE010080_259117 Streptococcus pyogenes strain
            MGAS8232, section 128 of 173 of the complete
            genome.>gb:AE009949_905499 Streptococcus pyogenes strain
            MGAS8232, complete genome.
          Length = 508

 Score =  153 bits (387), Expect = 5e-36
 Identities = 87/205 (42%), Positives = 120/205 (58%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            +YALEGS  IAG+A+QWLRD L +I ++ E EQ A    S   VY VPAF GL AP+W  
Sbjct: 300  HYALEGSIFIAGSAIQWLRDGLKMIETSPESEQFALASTSDDEVYVVPAFTGLGAPYWDS 359

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            +ARG   G+TR T+K    +A L+S+ +QVRDV+D+M  D+G   +         LRVDG
Sbjct: 360  NARGSVFGLTRGTSKEDFVKATLQSIAYQVRDVIDTMQVDSGIDIQ--------QLRVDG 411

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            GA +NN+LMQ QAD+LG  + R  ++ETT          AVG W  +++ +  E      
Sbjct: 412  GAAMNNMLMQFQADILGIDIARAKNLETTALGAAFLAGLAVGYW--EDMDALKELNATGQ 469

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRT 408
            +FK  + E  ++K    W +AV  T
Sbjct: 470  LFKASMNESRKEKLYKGWKRAVKAT 494



>sp|Q8K665|GLPK_STRP3 Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:AE014164_304945 Streptococcus pyogenes MGAS315,
            section 29 of 37 of the complete
            genome.>gb:BA000034_713322 Streptococcus pyogenes SSI-1
            DNA, complete genome.>gb:AE014074_928124 Streptococcus
            pyogenes MGAS315, complete genome.
          Length = 508

 Score =  153 bits (387), Expect = 5e-36
 Identities = 87/205 (42%), Positives = 120/205 (58%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            +YALEGS  IAG+A+QWLRD L +I ++ E EQ A    S   VY VPAF GL AP+W  
Sbjct: 300  HYALEGSIFIAGSAIQWLRDGLKMIETSPESEQFALASTSDDEVYVVPAFTGLGAPYWDS 359

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            +ARG   G+TR T+K    +A L+S+ +QVRDV+D+M  D+G   +         LRVDG
Sbjct: 360  NARGSVFGLTRGTSKEDFVKATLQSIAYQVRDVIDTMQVDSGIDIQ--------QLRVDG 411

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            GA +NN+LMQ QAD+LG  + R  ++ETT          AVG W  +++ +  E      
Sbjct: 412  GAAMNNMLMQFQADILGIDIARAKNLETTALGAAFLAGLAVGYW--EDMDALKELNATGQ 469

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRT 408
            +FK  + E  ++K    W +AV  T
Sbjct: 470  LFKASMNESRKEKLYKGWKRAVKAT 494



>gb:AE017267_422355 Bacillus cereus ATCC 10987, section 4 of 18 of the
            complete genome.>gb:AE017194_1060774 Bacillus cereus ATCC
            10987, complete genome.
          Length = 510

 Score =  152 bits (385), Expect = 8e-36
 Identities = 85/170 (50%), Positives = 105/170 (61%), Gaps = 1/170 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEGS  +AG+A+QWLRD + +   ASE E  A++VEST GVY VPAF GL  P+W  
Sbjct: 298  NYALEGSIFVAGSAIQWLRDGMRMFKDASESEVYANRVESTDGVYVVPAFVGLGTPYWDS 357

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            + RG   G+TR T K H  RA LES+ +Q +DVL +M  D+G   E+K       LRVDG
Sbjct: 358  EVRGAMFGVTRGTTKEHFIRATLESLAYQXKDVLCAMEADSGI--ELK------TLRVDG 409

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIW-TEDEI 516
            GA  NN LM+ Q+D+L  PV RP   ETT          AVG W  +DEI
Sbjct: 410  GAVKNNFLMKFQSDILDVPVERPVINETTALGAAYLAGLAVGYWKNQDEI 459



>sp|Q9CG64|GLPK_LACLA Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>pir|F86780|F86780 glycerol kinase (EC 2.7.1.30)
            [imported] - Lactococcus lactis subsp. lactis (strain
            IL1403)>gb:AE006356_218148 Lactococcus lactis subsp.
            lactis IL1403 section 118 of 218 of the complete
            genome.>gb:AE005176_1095221 Lactococcus lactis subsp.
            lactis IL1403, complete genome.
          Length = 498

 Score =  152 bits (385), Expect = 8e-36
 Identities = 86/204 (42%), Positives = 118/204 (57%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AG+++QWLRD L ++  AS+ E++A +  S   VY VPAF GL AP+W  +
Sbjct: 301  YALEGSIFVAGSSIQWLRDGLKMLERASDSEEVALQSRSQDEVYVVPAFVGLGAPYWDQE 360

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G+TR T K  I +A L+ + +QVRDV+ +M +D G            VL+VDGG
Sbjct: 361  ARGAMFGLTRGTTKEDIVKATLQGIAYQVRDVVSTMKEDTGIDMS--------VLKVDGG 412

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  N  LMQ QAD+L  P+ R  D+ETT          AVG W + E     E  +   I
Sbjct: 413  AANNEYLMQFQADILNIPIQRAGDLETTALGAAFLAGLAVGFWKDLEELK--ESYEPGKI 470

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRT 408
            F+  ++EE R++    W KAV+ T
Sbjct: 471  FQTQMQEERREELYAGWKKAVNAT 494



>gb:AY596297_632032 Haloarcula marismortui ATCC 43049 chromosome I,
            complete sequence.
          Length = 510

 Score =  152 bits (384), Expect = 1e-35
 Identities = 89/208 (42%), Positives = 120/208 (57%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  IAGAA++WL D ++LI++A++  +LA  VEST GVY VPAF GL AP W   
Sbjct: 311  YALEGSIFIAGAAIEWLED-VDLINNAAQTAELARSVESTDGVYMVPAFTGLGAPHWDGR 369

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +G+TR T K HI RA LES+ +Q RD+ ++M +D+G +           LRVDGG
Sbjct: 370  ARGTIVGMTRGTRKEHIVRATLESIAYQTRDLAEAMEEDSGVE--------MTTLRVDGG 421

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  NN L Q+Q+D++ + + RP   ETT          AVG W  D +    +  + D  
Sbjct: 422  AVKNNFLCQLQSDIIQTDIARPQVDETTALGSAYAAGLAVGYW--DTVDELRDNWQVDEE 479

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRTFDLA 396
            F P ++     K    W  AV R+ D A
Sbjct: 480  FSPEMDAGKADKMYARWDDAVDRSRDWA 507



>gb:AE011661_275321 Xanthomonas axonopodis pv. citri str. 306, section
            39 of 469 of the complete genome.>gb:AE008923_917096
            Xanthomonas axonopodis pv. citri str. 306, complete
            genome.
          Length = 505

 Score =  152 bits (384), Expect = 1e-35
 Identities = 84/204 (41%), Positives = 113/204 (55%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEG+  +AG+ VQWLRD L ++  AS+ +  A +     GVY VPAF GL AP+WR D
Sbjct: 306  YALEGAIFVAGSVVQWLRDGLRMLGKASDSQAYAERAGDNDGVYIVPAFVGLGAPYWRSD 365

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
             RG   G+TR T K H  RA +ESM +Q RDVL +M  D+G   E+K       LR DGG
Sbjct: 366  IRGAVFGLTRGTTKEHFVRAAVESMAYQTRDVLTAMQSDSGI--ELKE------LRADGG 417

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  N+ + Q Q+D+L  PV+RP   ETT          A G W+  E     ++   D  
Sbjct: 418  AIANDFMAQFQSDILNVPVLRPEVAETTALGAAYLAGLATGFWSSRE--EIAKQWAVDRR 475

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRT 408
            F+P + ++ R+     W +AV  T
Sbjct: 476  FEPAMADDKRQALYAGWQQAVEAT 499



>sp|Q8PQG7|GLPK_XANAC Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase) (GK).
          Length = 499

 Score =  152 bits (384), Expect = 1e-35
 Identities = 84/204 (41%), Positives = 113/204 (55%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEG+  +AG+ VQWLRD L ++  AS+ +  A +     GVY VPAF GL AP+WR D
Sbjct: 300  YALEGAIFVAGSVVQWLRDGLRMLGKASDSQAYAERAGDNDGVYIVPAFVGLGAPYWRSD 359

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
             RG   G+TR T K H  RA +ESM +Q RDVL +M  D+G   E+K       LR DGG
Sbjct: 360  IRGAVFGLTRGTTKEHFVRAAVESMAYQTRDVLTAMQSDSGI--ELKE------LRADGG 411

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  N+ + Q Q+D+L  PV+RP   ETT          A G W+  E     ++   D  
Sbjct: 412  AIANDFMAQFQSDILNVPVLRPEVAETTALGAAYLAGLATGFWSSRE--EIAKQWAVDRR 469

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRT 408
            F+P + ++ R+     W +AV  T
Sbjct: 470  FEPAMADDKRQALYAGWQQAVEAT 493



>sp|Q7NJT1|GLPK_GLOVI Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:BA000045_741826 Gloeobacter violaceus PCC 7421
            DNA, complete genome.
          Length = 497

 Score =  152 bits (384), Expect = 1e-35
 Identities = 86/184 (46%), Positives = 109/184 (59%), Gaps = 10/184 (5%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEG+    GA+VQWLRD L +I +A E E LA+ V  +GGVYFVPA +GL AP W   
Sbjct: 299  YALEGALFTTGASVQWLRDGLGIIETADESEALAASVPDSGGVYFVPALSGLGAPHWDMG 358

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+ IG+TR + +  IARAVLE++ FQ R+V D++  D G             L+VDGG
Sbjct: 359  ARGLLIGLTRGSGRGQIARAVLEAIAFQTREVTDALAADMGTP--------LTRLKVDGG 410

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE----------DEIFS 510
            A  NNLLMQ+QAD+LG PV RP  I+TT            G W +          D +F 
Sbjct: 411  AVRNNLLMQLQADVLGVPVERPQLIDTTAQGAAFAAGLGTGFWGDYAELVAARPIDRVFE 470

Query: 509  SGEK 498
            SGE+
Sbjct: 471  SGER 474



>sp|Q7VSU7|GLPK_BORPE Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:BX640422_808208 Bordetella pertussis strain
            Tohama I, complete genome; segment 12/12.
          Length = 508

 Score =  152 bits (384), Expect = 1e-35
 Identities = 88/201 (43%), Positives = 118/201 (58%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            Y +EG   +AGAAVQWLRD L +I  +++IE LA+ V  T  V+ VPAF GL AP W   
Sbjct: 304  YMVEGGVFMAGAAVQWLRDGLGIIQRSADIEALAASVADTDDVFMVPAFAGLGAPHWDPY 363

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +G+TR T + HIARA LES+  Q  ++L  M+ D+G             LRVDG 
Sbjct: 364  ARGTLVGMTRGTTRAHIARATLESIALQSAELLSCMNADSGIPLS--------ELRVDGS 415

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  N+LLMQ+QADLLG PVVRP   E+T          AVG W+  + F  G + + +  
Sbjct: 416  AARNDLLMQMQADLLGVPVVRPRVPESTALGAAGLAGLAVGFWSSLDEF--GAQWQAERT 473

Query: 479  FKPVIEEEVRKKKVDSWCKAV 417
            F+P    +VR+ ++  W +AV
Sbjct: 474  FEPAWPADVREARMQRWRQAV 494



>gb:CP000033_90093 Lactobacillus acidophilus NCFM, complete genome.
          Length = 500

 Score =  151 bits (382), Expect = 2e-35
 Identities = 89/208 (42%), Positives = 120/208 (57%), Gaps = 4/208 (1%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AG+A+QWLRDS+ LI +A + E+ A +  S   VY VPAF GL AP+W  +
Sbjct: 300  YALEGSIFVAGSAIQWLRDSMKLIKNAPDSEKAAYESTSENEVYVVPAFTGLGAPYWDAE 359

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G+TR T    + +A L+S+ +Q RDV+D+M KD+G             LRVDGG
Sbjct: 360  ARGAIFGVTRGTTDKDMIKATLQSLAYQTRDVVDTMQKDSGIDIP--------ALRVDGG 411

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DE---IFSSGEKMK 492
            A+ NN LMQ QAD+LG  + R   +ETT          AVG W   DE   +F+ G+   
Sbjct: 412  ASNNNYLMQFQADILGKKIERTKVLETTSMGAAFLAGLAVGYWKNIDELKHVFTIGQ--- 468

Query: 491  KDTIFKPVIEEEVRKKKVDSWCKAVSRT 408
                F+P + +  RKK  D W +A+  T
Sbjct: 469  ---AFEPKMGDLERKKLYDGWQRAIKAT 493



>sp|Q7P1G2|GLPK_CHRVO Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:AE016910_355212 Chromobacterium violaceum ATCC
            12472 section 1 of 16 of the complete
            genome.>gb:AE016825_1040366 Chromobacterium violaceum
            ATCC 12472 complete genome.
          Length = 500

 Score =  151 bits (382), Expect = 2e-35
 Identities = 92/210 (43%), Positives = 118/210 (56%), Gaps = 1/210 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  I GA V+WLRD L +I  ++++  LA +V+++ GVY VPAF GL AP W   
Sbjct: 299  YALEGSIFIGGAVVKWLRDGLGIIRHSADVGPLAQEVKNSDGVYLVPAFAGLGAPHWNAS 358

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +G T  T   HIARA L+S+ +Q RDVL +M  DAG             LRVDGG
Sbjct: 359  ARGTIVGATLGTKAAHIARAALDSIAYQTRDVLKAMEADAG--------MSIAELRVDGG 410

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIW-TEDEIFSSGEKMKKDT 483
            ATVN LLMQ Q+D+L   VVRP   ETT          AVG W + D+I     + + D 
Sbjct: 411  ATVNELLMQFQSDILAVDVVRPKITETTALGAAYLAGLAVGYWKSVDDIQG---QWQLDR 467

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRTFDLAD 393
             F+P +  +     V  W +AV+     AD
Sbjct: 468  RFQPAMAADEVLANVKGWQRAVNAAKVWAD 497



>gb:AY871959_2150123 Synthetic construct hypothetical protein
            (FTT0130) gene, complete cds.
          Length = 536

 Score =  151 bits (381), Expect = 2e-35
 Identities = 86/204 (42%), Positives = 115/204 (56%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  IAGA +QW+RD L L+ SA + E  A+K++ST GVY VPAF GL  P+W   
Sbjct: 327  YALEGSVFIAGAVIQWIRDGLGLVRSAEDSEYYATKIDSTNGVYLVPAFVGLGTPYWDMY 386

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +GITR T + HI RA LE++ +Q +DVL+ M +D G             LRVDGG
Sbjct: 387  ARGTIVGITRDTKREHIIRAALEAIAYQAKDVLECMKEDTG--------LDLAGLRVDGG 438

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  NN LMQ Q+D+L S + +P   E T          AVG W + +   S   +  + +
Sbjct: 439  AVQNNFLMQFQSDILQSEISKPKVNEITGLGAVFLAGLAVGFWKDKQELKS--ILTTEKV 496

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRT 408
            F+P  + +        W KAV R+
Sbjct: 497  FEPQKDSQAVAHDYRGWKKAVERS 520



>gb:AE014296_1134253 Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE014296_1134254 Drosophila melanogaster
            chromosome 3L, complete sequence.>gb:AE014296_1134255
            Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE014296_1134256 Drosophila melanogaster
            chromosome 3L, complete sequence.>gb:AE014296_1134257
            Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE003472_1211552 Drosophila melanogaster
            chromosome 3L, section 6 of 83 of the complete
            sequence.>gb:AE003472_1211553 Drosophila melanogaster
            chromosome 3L, section 6 of 83 of the complete
            sequence.>gb:AE003472_1211554 Drosophila melanogaster
            chromosome 3L, section 6 of 83 of the complete
            sequence.>gb:AE003472_1211555 Drosophila melanogaster
            chromosome 3L, section 6 of 83 of the complete
            sequence.>gb:AE003472_1211556 Drosophila melanogaster
            chromosome 3L, section 6 of 83 of the complete sequence.
          Length = 576

 Score =  151 bits (381), Expect = 2e-35
 Identities = 83/209 (39%), Positives = 123/209 (58%), Gaps = 5/209 (2%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YA+EG+ ++AG A+ WL++ + ++  + + E+ A  V ++G VYFVPAF GL+AP+WR +
Sbjct: 334  YAIEGAVSVAGHALSWLQNKVRILPDSRDAEKYAEMVPTSGDVYFVPAFTGLYAPYWRQN 393

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+ IG+T+FT K HI RA LES+CFQ RD+L+ MH++ G   E+        L  DG 
Sbjct: 394  ARGIIIGLTQFTRKNHIVRAALESICFQTRDILECMHQECG--YEINK------LHADGK 445

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGI-----WTEDEIFSSGEKM 495
             T NNLLMQ+QAD +G PV R   +++T          A G+       E   +   E +
Sbjct: 446  LTTNNLLMQLQADTIGMPVFRSQLMDSTAFGAAMCAAQADGVNLCQFEPEKRYY---ENV 502

Query: 494  KKDTIFKPVIEEEVRKKKVDSWCKAVSRT 408
              DT      + E RK++   W +AV R+
Sbjct: 503  HYDTFLATTTDVE-RKERYGKWKRAVERS 530



>gb:AJ749949_530587 Francisella tularensis subsp. tularensis complete
            genome.
          Length = 502

 Score =  151 bits (381), Expect = 2e-35
 Identities = 86/204 (42%), Positives = 115/204 (56%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  IAGA +QW+RD L L+ SA + E  A+K++ST GVY VPAF GL  P+W   
Sbjct: 301  YALEGSVFIAGAVIQWIRDGLGLVRSAEDSEYYATKIDSTNGVYLVPAFVGLGTPYWDMY 360

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +GITR T + HI RA LE++ +Q +DVL+ M +D G             LRVDGG
Sbjct: 361  ARGTIVGITRDTKREHIIRAALEAIAYQAKDVLECMKEDTG--------LDLAGLRVDGG 412

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  NN LMQ Q+D+L S + +P   E T          AVG W + +   S   +  + +
Sbjct: 413  AVQNNFLMQFQSDILQSEISKPKVNEITGLGAVFLAGLAVGFWKDKQELKS--ILTTEKV 470

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRT 408
            F+P  + +        W KAV R+
Sbjct: 471  FEPQKDSQAVAHDYRGWKKAVERS 494



>sp|Q98M73|GLPK_RHILO Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:BA000012_666527 Mesorhizobium loti MAFF303099
            DNA, complete genome.
          Length = 496

 Score =  150 bits (380), Expect = 3e-35
 Identities = 85/204 (41%), Positives = 115/204 (56%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  IAGAAVQWLRD + +I  A +  +LA + + T  VY VPAF GL AP W  +
Sbjct: 298  YALEGSIFIAGAAVQWLRDGIKVIGKAEQSGKLADEADPTQNVYLVPAFVGLGAPHWDAE 357

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G+TR +     ARA LE++ +Q RD+LD+M KD       K    + VLRVDGG
Sbjct: 358  ARGAIFGLTRNSGPAEFARAALEAVAYQTRDLLDAMRKD------WKGTSAKTVLRVDGG 411

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
               ++  MQ  AD+L +PV RP  +ETT            G+W + + F+    +++   
Sbjct: 412  MVASDWTMQRLADILDAPVDRPTILETTALGAAWLAGSKAGVWPKAKEFAKSWALERR-- 469

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRT 408
            FKP ++   R  K+  W  AV RT
Sbjct: 470  FKPEMDIATRSAKLAGWRDAVRRT 493



>sp|Q9HNS5|GLPK_HALN1 Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>pir|E84347|E84347 glycerol kinase [imported] -
            Halobacterium sp. NRC-1>gb:AE005092_63305 Halobacterium
            sp. NRC-1 section 123 of 170 of the complete
            genome.>gb:AE004437_888224 Halobacterium sp. NRC-1
            complete genome.
          Length = 510

 Score =  150 bits (380), Expect = 3e-35
 Identities = 85/204 (41%), Positives = 116/204 (56%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  + GAA++WL D ++LI++A++  +LAS V++T GVY VPAF GL AP W   
Sbjct: 311  YALEGSIFVTGAAIEWLED-VDLINNAAQTAELASSVDTTDGVYMVPAFTGLGAPHWDGR 369

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +G+TR T K HI RA LES+ +Q RD+  +M  D+G             LRVDGG
Sbjct: 370  ARGTLVGMTRGTRKAHIVRATLESIAYQTRDIAAAMEADSG--------VSTTTLRVDGG 421

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  NN L Q+Q+D++ + + RP   ETT          AVG W  D +    E  + D  
Sbjct: 422  AVKNNFLCQLQSDIIQTDLARPEVDETTALGAAYAAGLAVGYW--DSLDDLRENWRVDRS 479

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRT 408
            F+P ++      K   W  AV R+
Sbjct: 480  FEPEMDPSEADSKYGRWEDAVDRS 503



>sp|Q97N78|GLPK_STRPN Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>pir|D95255|D95255 glycerol kinase [imported] -
            Streptococcus pneumoniae  (strain
            TIGR4)>pir|D98120|D98120 glycerol kinase (EC 2.7.1.30)
            [imported] - Streptococcus pneumoniae (strain
            R6)>gb:AE007506_227298 Streptococcus pneumoniae TIGR4
            section 189 of 194 of the complete
            genome.>gb:AE008563_238309 Streptococcus pneumoniae R6
            section 179 of 184 of the complete
            genome.>gb:AE007317_944467 Streptococcus pneumoniae R6,
            complete genome.>gb:AE005672_1105066 Streptococcus
            pneumoniae TIGR4, complete genome.
          Length = 502

 Score =  150 bits (379), Expect = 4e-35
 Identities = 84/207 (40%), Positives = 121/207 (58%), Gaps = 3/207 (1%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  IAG+A+QWLRD L ++ ++ E E+ A    +   VY VPAF GL AP+W  +
Sbjct: 301  YALEGSIFIAGSAIQWLRDGLRMVENSPESEKYARDSHNNDEVYVVPAFTGLGAPYWNQN 360

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G+TR T+K    +A L+S+ +QVRD++D+M        +V       VL+VDGG
Sbjct: 361  ARGSVFGLTRGTSKEDFIKATLQSIAYQVRDIIDTM--------QVDTQTAIQVLKVDGG 412

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKDT 483
            A +NN LMQ QAD+LG  + R  ++ETT          +VG W + DE+     K+  +T
Sbjct: 413  AAMNNFLMQFQADILGIDIARAKNLETTALGAAFLAGLSVGYWKDLDEL-----KLLNET 467

Query: 482  --IFKPVIEEEVRKKKVDSWCKAVSRT 408
              +F+P + E  +++    W KAV  T
Sbjct: 468  GELFEPSMNESRKEQLYKGWKKAVKAT 494



>sp|Q7NC65|GLPK_MYCGA Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:AE016967_369284 Mycoplasma gallisepticum strain
            R section 1 of 4 of the complete
            genome.>gb:AE015450_1033933 Mycoplasma gallisepticum
            strain R complete genome.
          Length = 513

 Score =  150 bits (379), Expect = 4e-35
 Identities = 91/209 (43%), Positives = 122/209 (58%), Gaps = 3/209 (1%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIE---QLASKVESTGGVYFVPAFNGLFAPWW 849
            YALEGS  IAGAAVQW+RD L LI  A+E +    LASK + T  VY VP+F GL AP+W
Sbjct: 308  YALEGSVFIAGAAVQWIRDGLRLIYDAAESDFYANLASK-QDTHQVYLVPSFTGLGAPYW 366

Query: 848  RDDARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRV 669
               +RG   G+ R T K HI +A LES+ FQ  D++ +M  D G K E        V++V
Sbjct: 367  DSYSRGAIFGLERGTKKEHIIKATLESIVFQTNDLIKAMSSDVGKKIE--------VVKV 418

Query: 668  DGGATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKK 489
            DGGAT +  +MQ Q+ + G  V+RP +IE+T          AVG W   ++    + +K 
Sbjct: 419  DGGATRSEYIMQFQSSISGVNVIRPKNIESTALGATFLAGLAVGYW--KDLKELEKLVKV 476

Query: 488  DTIFKPVIEEEVRKKKVDSWCKAVSRTFD 402
            D  FKP +++E  +K V  W  AV RTF+
Sbjct: 477  DKEFKPKLDKEKVEKLVHGWNVAVKRTFN 505



>gb:AB127974_1201322 Trypanosoma congolense mRNA for glycerol kinase,
            complete cds, strain: IL3900.
          Length = 512

 Score =  150 bits (378), Expect = 5e-35
 Identities = 85/206 (41%), Positives = 117/206 (56%), Gaps = 1/206 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            +YALEGS A AGA V+W+R ++NL    SE E+LA  V  T GV FVPAF+GL AP+W  
Sbjct: 310  HYALEGSIACAGATVEWMRRNMNLFGHISECEKLARSVPGTQGVVFVPAFSGLLAPYWDP 369

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG  +G+T  T + HI RA L+++  Q+ DV+ SM +DAG             LRVDG
Sbjct: 370  SARGTIVGMTLKTTRAHIIRAALQAIALQLNDVVGSMKRDAG--------LSLTSLRVDG 421

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKD 486
            G T N LLM+IQ++LLG  ++ P+  ETT          A G+W+  DE+ +   +    
Sbjct: 422  GLTKNGLLMEIQSNLLGVDILVPSMHETTALGAALCAGLAAGVWSSLDEVKAVSLRENSW 481

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
                P    E R + +  W +A+ RT
Sbjct: 482  RTVSPTGSPEERTEMIAEWKEALKRT 507



>gb:AY051535_1290129 Drosophila melanogaster GH18690 full length cDNA.
          Length = 576

 Score =  149 bits (377), Expect = 7e-35
 Identities = 83/209 (39%), Positives = 122/209 (58%), Gaps = 5/209 (2%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YA+EG+ ++AG A+ WL++ + ++  + + E+ A  V ++G VYFVPAF GL+AP+WR +
Sbjct: 334  YAIEGAVSVAGHALSWLQNKVRILPDSRDAEKYAEMVPTSGDVYFVPAFTGLYAPYWRQN 393

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+ IG+T+FT K HI RA LES+CFQ RD+L+ MH++ G   E+        L  DG 
Sbjct: 394  ARGIIIGLTQFTRKNHIVRAALESICFQTRDILECMHQECG--YEINK------LHADGK 445

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGI-----WTEDEIFSSGEKM 495
             T NNLLMQ+QAD +G PV R   +++T          A G+       E   +   E +
Sbjct: 446  LTTNNLLMQLQADTIGMPVFRSQLMDSTAFGAAMCAAQADGVNLCQFEPEKRYY---ENV 502

Query: 494  KKDTIFKPVIEEEVRKKKVDSWCKAVSRT 408
              DT        E RK++   W +AV R+
Sbjct: 503  HYDTFLATTTYVE-RKERYGKWKRAVERS 530



>gb:AP008227_579572 Thermus thermophilus HB8 plasmid pTT27 DNA,
            complete sequence.
          Length = 495

 Score =  149 bits (377), Expect = 7e-35
 Identities = 86/203 (42%), Positives = 120/203 (59%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AGAAV WL++ + LI  ++E+E LA+ VE TG VYFVPAF GL AP+W   
Sbjct: 297  YALEGSLFVAGAAVGWLKE-VGLIRESAEVEALAASVEDTGDVYFVPAFTGLGAPYWDPY 355

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +G+TR T++ H+ARA LE + FQVRDV+ +M ++AG + +        VL+ DGG
Sbjct: 356  ARGTLLGLTRGTSRAHLARAALEGVAFQVRDVVLAMEEEAGVRLK--------VLKADGG 407

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
               N L ++IQADLLG PV  P   ETT            G  + +++     + ++   
Sbjct: 408  MAQNRLFLKIQADLLGVPVAVPEVTETTALGAALMAGVGAGALSPEDV---AGRFREAER 464

Query: 479  FKPVIEEEVRKKKVDSWCKAVSR 411
            F P + E  R+     W +AV R
Sbjct: 465  FLPTMPEGRREALYRRWREAVER 487



>gb:CP000009_864070 Gluconobacter oxydans 621H, complete genome.
          Length = 512

 Score =  149 bits (376), Expect = 9e-35
 Identities = 79/205 (38%), Positives = 121/205 (59%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AGA ++WLRD L LI+ AS+ + +A+++  + GVY VPAF GL AP W  D
Sbjct: 299  YALEGSIFVAGAGIKWLRDGLKLITHASQTDDMATRIPDSHGVYMVPAFVGLGAPHWDPD 358

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            +RG+  G+T  + + HIARA+LES+ +Q  D++ +M +D   +          +LR+DGG
Sbjct: 359  SRGLICGLTLGSTQAHIARAMLESVAYQTYDLIRAMREDGAMRTS--------ILRIDGG 410

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKDT 483
              VN+   Q  + +L + V RP +IETT           VG+W   DE+ ++    K++ 
Sbjct: 411  MAVNDWFAQFLSSMLKAEVERPVNIETTALGAAFLAGLQVGLWKSLDEVTAT---WKQER 467

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRT 408
            +F P ++   R+  +D W  AV RT
Sbjct: 468  VFAPKMDPAQRRIMIDGWHDAVRRT 492



>sp|Q83D14|GLPK_COXBU Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:AE016962_368149 Coxiella burnetii strain RSA
            493, section 3 of 7 of the complete
            genome.>gb:AE016828_1008885 Coxiella burnetii strain RSA
            493, complete genome.
          Length = 501

 Score =  149 bits (375), Expect = 1e-34
 Identities = 84/204 (41%), Positives = 117/204 (57%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            Y LEGS  IAGAAV+WLRD L+LI  A++ E +AS VE TGGVY VPAF GL AP+W  +
Sbjct: 299  YGLEGSIFIAGAAVKWLRDPLHLIEKANDSESMASSVEDTGGVYLVPAFTGLGAPYWDPN 358

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G+TR T + HI RA LE++C+Q +D++ ++  D  +            LRVDGG
Sbjct: 359  ARGALFGLTRNTQREHIVRAALEAVCYQSKDLVRAILNDGANL---------TTLRVDGG 409

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
               NN L+Q  +D+LG  V R   IE++            G++  D +       + D  
Sbjct: 410  MAANNWLLQFLSDILGVNVDRSRCIESSALGTAFLAGLGAGLF--DSLEEMTGLWQADRH 467

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRT 408
            F P ++ + R++  D W KAV +T
Sbjct: 468  FIPQMDPKKREELYDGWQKAVEKT 491



>gb:AB127973_1201321 Trypanosoma congolense mRNA for glycerol kinase,
            complete cds, strain: IL1180.
          Length = 512

 Score =  148 bits (374), Expect = 1e-34
 Identities = 84/206 (40%), Positives = 117/206 (56%), Gaps = 1/206 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            +YALEGS A AGA V+W+R ++NL    SE E+LA  V  T GV FVPAF+GL AP+W  
Sbjct: 310  HYALEGSIACAGATVEWMRRNMNLFGRISECEKLARSVPGTQGVVFVPAFSGLLAPYWDP 369

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG  +G+T  T + HI RA L+++  Q+ DV+ SM +DAG             LRVDG
Sbjct: 370  SARGTIVGMTLKTTRAHIIRAALQAIALQLNDVVGSMKRDAG--------LSLTSLRVDG 421

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKD 486
            G T N LLM+IQ++LLG  ++ P+  ETT          A G+W+  DE+ +   +    
Sbjct: 422  GLTKNGLLMEIQSNLLGVDILVPSMHETTALGAALCAGLAAGVWSSLDEVKAVSLRENSW 481

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRT 408
                P    + R + +  W +A+ RT
Sbjct: 482  RTVSPTGSPKERAEMIAEWKEALKRT 507



>gb:TACID4_196853 Thermoplasma acidophilum complete genome; segment
            4/5.
          Length = 488

 Score =  148 bits (374), Expect = 1e-34
 Identities = 80/204 (39%), Positives = 118/204 (57%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            +YALEGS   +G+ ++WL++SL+L  SA +IE  A K++S  GVYFVPAF+GL +P+W  
Sbjct: 287  SYALEGSILASGSVLRWLQNSLHLFRSAKDIEDAAEKLKSNDGVYFVPAFSGLGSPYWDQ 346

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            DARG+ IG+T  T   H+AR+VLES  +   DV+  + K+ G        R    +R DG
Sbjct: 347  DARGLFIGLTESTTADHLARSVLESEVYMATDVIMEIEKEIG--------RNIAKIRCDG 398

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            G + ++ LMQ QAD+  + V+ P   ETT            G+W   +      ++KK  
Sbjct: 399  GGSRSDFLMQFQADIANAEVLVPESSETTALGSAYLSGLVSGLWKSKDEIRELWRLKK-- 456

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSR 411
            +++PV+ EE RK+    W  AV R
Sbjct: 457  VYRPVMSEEERKRNYVGWKDAVKR 480



>gb:EFU94356_135377 Enterococcus faecalis glycerol kinase (glpK) gene,
            complete cds.>gb:AE016953_365941 Enterococcus faecalis
            V583, section 7 of 11 of the complete
            genome.>gb:AE016830_992429 Enterococcus faecalis V583,
            complete genome.
          Length = 501

 Score =  148 bits (374), Expect = 1e-34
 Identities = 83/205 (40%), Positives = 122/205 (59%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AG+A+QWLRD L ++ +A+E E +A        VY VPAF GL AP+W   
Sbjct: 300  YALEGSIFVAGSAIQWLRDGLKMLQTAAESEAVAKASTGHNEVYVVPAFTGLGAPYWDSQ 359

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G+TR T +    +A L+++ +QVRD++D+M +D G            VL+VDGG
Sbjct: 360  ARGAVFGLTRGTTREDFVKATLQAVAYQVRDIIDTMKEDTGIDIP--------VLKVDGG 411

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKDT 483
            A  N+ LMQ QAD+L + V R  ++ETT          AVG W + +EI +  E+ ++  
Sbjct: 412  AANNDFLMQFQADILNTAVQRAHNLETTALGAAFLAGLAVGFWKDLEEIKAFQEEGQQ-- 469

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRT 408
             F+P++ EE R+   + W +AV+ T
Sbjct: 470  -FEPIMAEEEREDLYEGWQQAVAAT 493



>sp|O34154|GLPK_ENTFA Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase) (GK).
          Length = 500

 Score =  148 bits (374), Expect = 1e-34
 Identities = 83/205 (40%), Positives = 122/205 (59%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AG+A+QWLRD L ++ +A+E E +A        VY VPAF GL AP+W   
Sbjct: 299  YALEGSIFVAGSAIQWLRDGLKMLQTAAESEAVAKASTGHNEVYVVPAFTGLGAPYWDSQ 358

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G+TR T +    +A L+++ +QVRD++D+M +D G            VL+VDGG
Sbjct: 359  ARGAVFGLTRGTTREDFVKATLQAVAYQVRDIIDTMKEDTGIDIP--------VLKVDGG 410

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKDT 483
            A  N+ LMQ QAD+L + V R  ++ETT          AVG W + +EI +  E+ ++  
Sbjct: 411  AANNDFLMQFQADILNTAVQRAHNLETTALGAAFLAGLAVGFWKDLEEIKAFQEEGQQ-- 468

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRT 408
             F+P++ EE R+   + W +AV+ T
Sbjct: 469  -FEPIMAEEEREDLYEGWQQAVAAT 492



>sp|Q8YW05|GLPK_ANASP Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>pir|AE2032|AE2032 glycerol kinase [imported] -
            Nostoc sp. (strain PCC 7120)>gb:BA000019_682800 Nostoc
            sp. PCC 7120 DNA, complete genome.
          Length = 500

 Score =  148 bits (373), Expect = 2e-34
 Identities = 86/206 (41%), Positives = 115/206 (55%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS   +GA +QWLRD + LI +A+E E +A++V   GGVYFVPAF+GL AP+W  +
Sbjct: 303  YALEGSMFTSGACIQWLRDGIKLIKTAAETETMANQVADNGGVYFVPAFSGLGAPYWDMN 362

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   GIT      H+ RAVLE++ +QV +V+ +++       +         L VDGG
Sbjct: 363  ARGAFFGITASVQPQHLVRAVLEAIAYQVLEVVQAINASCSSPMQ--------RLIVDGG 414

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  NN LMQ QAD+LG PV RP   +TT          AVG W  D   +   + + D I
Sbjct: 415  ACENNFLMQFQADVLGIPVERPTMRDTTVQGAAFAAGLAVGFW--DSYTALVNQRQIDRI 472

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRTFD 402
            F+P    +        W KAV R+ D
Sbjct: 473  FEPGEGSQNATANFAIWQKAVKRSLD 498



>gb:AY391774_1604547 Pichia farinosa glycerol kinase GUT1 (GUT1) gene,
            complete cds.
          Length = 630

 Score =  147 bits (370), Expect = 4e-34
 Identities = 87/225 (38%), Positives = 127/225 (56%), Gaps = 16/225 (7%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS A+AG+ +QWLRD+L LI  + ++  LAS V  +GGV F+PAF+GL+AP+W   
Sbjct: 402  YALEGSIAVAGSIIQWLRDNLKLIEQSKDVGPLASLVHDSGGVVFIPAFSGLYAPYWNSG 461

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKG----EVKNDRGE---- 684
            ARG   G+T++T+  HIARA LE +CFQVR +L +M  DAG       E  N + E    
Sbjct: 462  ARGTIFGMTQYTSASHIARAALEGVCFQVRSILKAMADDAGTSADFLEEALNTQNESTPL 521

Query: 683  FVLRVDGGATVNNLLMQIQADLLGSPV-VRPADI-ETTXXXXXXXXXXAV-----GIWTE 525
              L VDGG +  + ++QIQAD+LG  V V+ A I E T          +       +W +
Sbjct: 522  ATLAVDGGMSKADEVLQIQADILGPCVTVKRAQISECTALGAAIAAGLSFKDENERVWKD 581

Query: 524  -DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD 393
             +++F   +    +  FK  + +  R++    W +A+ R  D  D
Sbjct: 582  FNDVFEKIDAANGNNSFKAKLPDAERRRNWRRWERAIDRAKDWLD 626



>gb:BX572604_803318 Rhodopseudomonas palustris CGA009 complete genome;
            segment 12/16.
          Length = 500

 Score =  147 bits (370), Expect = 4e-34
 Identities = 84/201 (41%), Positives = 112/201 (55%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AG+AVQWLRD L +I  ASE   LA K +S   VY VPAF G+ AP+W   
Sbjct: 297  YALEGSIFVAGSAVQWLRDGLGVIKHASETGPLADKSDSAQSVYLVPAFVGMGAPYWNPR 356

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
             RG   G+TR T    +A A LES+C+Q  D+  +M  D  D      D    VLRVDGG
Sbjct: 357  VRGALFGLTRNTGPAELAHAALESVCYQTFDLWAAMRADWPDA-----DAATTVLRVDGG 411

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
             T ++  MQ  ADLL +PV RP   ETT          + G++ E + F+  +  + D  
Sbjct: 412  MTASDWTMQRLADLLDAPVDRPVIQETTALGAAYLAGLSAGVFPEPQKFA--DNWRLDHR 469

Query: 479  FKPVIEEEVRKKKVDSWCKAV 417
            F+P +    R++K+  W +AV
Sbjct: 470  FRPAMSAATRERKLAGWGRAV 490



>sp|Q891B8|GLK2_CLOTE Glycerol kinase 2 (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase 2) (Glycerokinase 2) (GK
            2).>gb:AE015944_321489 Clostridium tetani E88, section 9
            of 10 of the complete genome.>gb:AE015927_964278
            Clostridium tetani E88, complete genome.
          Length = 493

 Score =  145 bits (367), Expect = 1e-33
 Identities = 84/205 (40%), Positives = 117/205 (57%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AG  + W++D+L +I S  + E+ A  VE T  VY VPAF GL AP+W  +
Sbjct: 298  YALEGSVFMAGEGINWIKDNLRMIDSLEDAEEYALSVEDTNNVYMVPAFGGLGAPYWNPE 357

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            A+GV IG+TR + K H  RAV+ES+ +Q  DVL +M +D+G    +KN      LRVDG 
Sbjct: 358  AKGVVIGLTRGSKKEHFIRAVIESLAYQSYDVLKAMEEDSGI--VLKN------LRVDGQ 409

Query: 659  ATVNNLLMQIQADLLGSPVVRPADI-ETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
             +VNN LMQ Q+D+L   V +P +I              AVG W   E       ++K+ 
Sbjct: 410  YSVNNFLMQFQSDILNCKVEKPKNILNIAGLGAAYFAGLAVGFWKNKEDILKNNGIEKE- 468

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRT 408
             F   I++  RK  V+ W +A+ RT
Sbjct: 469  -FNSSIDDRRRKVLVEGWKEAIKRT 492



>gb:TBR319055_1399307 Trypanosoma brucei mRNA for glycerolkinase (GLK1
            gene).
          Length = 512

 Score =  145 bits (365), Expect = 2e-33
 Identities = 81/205 (39%), Positives = 115/205 (56%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEG+ A AGA V+W+R ++NL S  +E E+LA  V  T G+ FVPAF+GL AP+W   
Sbjct: 311  YALEGAIACAGATVEWMRRNMNLFSHITECEKLARSVPGTQGIVFVPAFSGLLAPYWDPS 370

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +G+T  T + H+ RA L+++  Q+ DV+ SM +DAG             LRVDGG
Sbjct: 371  ARGTIVGMTLKTTRAHVIRAALQAIALQLNDVVGSMKRDAG--------LNLSSLRVDGG 422

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKDT 483
             + N LLM+IQA LLG  ++ P+  ETT          A G+WT  +E+ +   +     
Sbjct: 423  LSKNGLLMEIQASLLGVDILVPSMHETTALGAALCAGLAAGVWTSLEEVKAVSRRENSWK 482

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRT 408
               P      R+  +  W +A+ RT
Sbjct: 483  TVSPSGSAMEREAMIAEWREALKRT 507



>sp|Q9NJP9|GLPK_TRYBB Glycerol kinase, glycosomal (EC 2.7.1.30)
            (ATP:glycerol 3- phosphotransferase) (Glycerokinase)
            (GK).>gb:AF132295_1243615 Trypanosoma brucei brucei
            glycerol kinase (GK) gene, complete cds.
          Length = 512

 Score =  145 bits (365), Expect = 2e-33
 Identities = 81/205 (39%), Positives = 115/205 (56%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEG+ A AGA V+W+R ++NL S  +E E+LA  V  T G+ FVPAF+GL AP+W   
Sbjct: 311  YALEGAIACAGATVEWMRRNMNLFSHITECEKLARSVPGTQGIVFVPAFSGLLAPYWDPS 370

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +G+T  T + H+ RA L+++  Q+ DV+ SM +DAG             LRVDGG
Sbjct: 371  ARGTIVGMTLKTTRAHVIRAALQAIALQLNDVVGSMKRDAG--------LNLSSLRVDGG 422

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKDT 483
             + N LLM+IQA LLG  ++ P+  ETT          A G+WT  +E+ +   +     
Sbjct: 423  LSKNGLLMEIQASLLGVDILVPSMHETTALGAALCAGLAAGVWTSLEEVKAVSRRENSWK 482

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRT 408
               P      R+  +  W +A+ RT
Sbjct: 483  TVSPSGSAMEREAMIAEWREALKRT 507



>sp|Q88YD9|GLK2_LACPL Glycerol kinase 2 (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase 2) (Glycerokinase 2) (GK
            2).>gb:AL935254_550762 Lactobacillus plantarum strain
            WCFS1 complete genome; segment 3/11.
          Length = 508

 Score =  144 bits (364), Expect = 2e-33
 Identities = 84/203 (41%), Positives = 110/203 (54%), Gaps = 1/203 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEGS  +AG+A+QWLRD + LI SA E E LA +  +   VY VPAF GL AP+W  
Sbjct: 299  NYALEGSIFVAGSALQWLRDGMQLIESAPESESLAQQSHNHNEVYVVPAFTGLGAPYWDS 358

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            + RG   G+TR T +    +A L+S+ +Q RDV+D+M  DA              L VDG
Sbjct: 359  ETRGAVFGLTRGTTRADFVKATLQSLAYQSRDVIDTMKNDANITMP--------TLMVDG 410

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKD 486
            GA  NN LMQ QAD+    ++R AD+ETT          AVG W + DE+ S  +     
Sbjct: 411  GAARNNWLMQFQADISNVKIIRAADLETTALGAAFLAGLAVGYWQDLDELKSIHQ---TG 467

Query: 485  TIFKPVIEEEVRKKKVDSWCKAV 417
             +F+P +    R      W  AV
Sbjct: 468  NVFQPRMAAPQRANLYQGWQAAV 490



>sp|Q88ZF1|GLK1_LACPL Glycerol kinase 1 (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase 1) (Glycerokinase 1) (GK
            1).>gb:AL935252_550362 Lactobacillus plantarum strain
            WCFS1 complete genome; segment 1/11.
          Length = 505

 Score =  144 bits (363), Expect = 3e-33
 Identities = 80/204 (39%), Positives = 116/204 (56%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AG+A+QWLRD + L+ SA + E+ A +  +   VY VPAF GL AP+W  +
Sbjct: 300  YALEGSIFVAGSAIQWLRDGIRLVESAPDSERAARESHNENEVYVVPAFTGLGAPYWDSE 359

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G+TR T +    +A L+++ +Q RDV+++M KD+G +          VL+VDGG
Sbjct: 360  ARGSVFGLTRGTTREDFIKATLQALAYQTRDVVETMKKDSGIEIP--------VLKVDGG 411

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  N+ LMQ QAD+L + ++R A++ETT          +VG W + E   +    K  T 
Sbjct: 412  AARNDWLMQFQADILDTQIMRAANLETTALGAAFLAGLSVGYWQDLEELKA--SYKPGTS 469

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRT 408
            F P +    R    + W  AV  T
Sbjct: 470  FDPEMGPAERTNLYEGWQAAVKAT 493



>gb:AE017308_437916 Mycoplasma mobile 163K complete genome.
          Length = 510

 Score =  143 bits (361), Expect = 5e-33
 Identities = 84/208 (40%), Positives = 121/208 (58%), Gaps = 2/208 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGG-VYFVPAFNGLFAPWWRD 843
            YALEGS  +AGA+++WLRDSL LI ++ E +  A++V+  G  VY VPAF GL AP+W  
Sbjct: 303  YALEGSVFVAGASLKWLRDSLRLIYASDESDYYANRVQDDGQRVYVVPAFTGLGAPYWDS 362

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             A+G   G+ R TN+ H+ +A LES+ +Q  D+L +M  D  +K +        V++VDG
Sbjct: 363  SAKGAIFGLERSTNREHLVKATLESIAYQSNDLLKAMESDLKEKIK--------VMKVDG 414

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKK-D 486
            G + +  L+Q QAD+    V++P +IETT          AV  WT     +  EK+ K D
Sbjct: 415  GVSNSKFLLQFQADISNLEVIKPKNIETTAMGAAYLAGLAVKFWTN---LAEIEKISKID 471

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSRTFD 402
            T  K  I E+ RK  +  W +AV RT +
Sbjct: 472  TNSKSKITEDKRKFLLKGWNEAVKRTLN 499



>gb:CR382139_1673101 Debaryomyces hansenii chromosome G of strain
            CBS767 of Debaryomyces hansenii.
          Length = 630

 Score =  143 bits (360), Expect = 6e-33
 Identities = 90/222 (40%), Positives = 132/222 (59%), Gaps = 18/222 (8%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            +YALEGS A+AG+ +QWLRD+L LI  A ++  LAS+V++ GGV F+PAF+GL+AP+W  
Sbjct: 401  HYALEGSIAVAGSIIQWLRDNLKLIEHARDVGPLASQVDNAGGVVFIPAFSGLYAPYWDG 460

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDK----GEVKNDRGE--- 684
             ARG   G+T++T+  HIARA LE +C+QVR +L +M  DAG       E  N + E   
Sbjct: 461  GARGTIFGMTQYTSSSHIARAALEGVCYQVRAILRAMANDAGASEDFLEEALNRQNEKKP 520

Query: 683  -FVLRVDGGATVNNLLMQIQADLLGSPV-VRPADI-ETTXXXXXXXXXXAV-----GIWT 528
               L VDGG +  + ++QIQAD+LG  V V+ A+I E T          +       +W 
Sbjct: 521  LSALSVDGGMSKADEVLQIQADILGPCVTVKRANISECTALGAAIAAGLSFKDEEERVWK 580

Query: 527  E-DEIFS--SGEKMKKDTIFKPVIEEEVRKKKVDSWCKAVSR 411
            + D+I+   +G   +K+  FK  + +  R+K    W KA+ R
Sbjct: 581  DFDDIYEKINGTDDEKNN-FKAKLPDSDRRKYWKRWEKAIDR 621



>gb:MMY512637_149260 Mycoplasma mycoides subsp. mycoides SC partial
            glpK gene for glycerol kinase and glpF gene for glycerol
            facilitator factor.
          Length = 377

 Score =  143 bits (360), Expect = 6e-33
 Identities = 84/209 (40%), Positives = 116/209 (55%), Gaps = 4/209 (1%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  IAGAAVQWLRD+L ++ +A E E  A +V+    VY VP+F GL +P+W   
Sbjct: 176  YALEGSVMIAGAAVQWLRDNLRIVYNAIETEWYAGQVKDDRRVYVVPSFTGLGSPYWDSF 235

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            +RG   G+ R T + HI RA LE++ +Q  DV+D+M KD     E        + +VDGG
Sbjct: 236  SRGAIFGLDRGTRREHIVRATLEAIAYQANDVVDAMRKDMKKPIE--------IFKVDGG 287

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  N  LMQ Q+++  S V++P ++ETT          AVG W       + E++KK   
Sbjct: 288  AANNKFLMQFQSNISQSKVIKPTNVETTAMGAAFMAGLAVGYW------ENAEELKKTYK 341

Query: 479  FKPVIEEEVRKKKVD----SWCKAVSRTF 405
                +  E+ K +VD     W  AV RTF
Sbjct: 342  VHFELTPELSKPEVDKLIKGWKVAVQRTF 370



>sp|Q89UK6|GLPK_BRAJA Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:BA000040_729670 Bradyrhizobium japonicum USDA
            110 DNA, complete genome.
          Length = 500

 Score =  143 bits (360), Expect = 6e-33
 Identities = 81/201 (40%), Positives = 111/201 (55%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AG+AVQWLRD L +I  A+E   LA + +S   VY VPAF G+ AP+W   
Sbjct: 297  YALEGSIFVAGSAVQWLRDGLGIIKHAAETGPLADQSDSMQSVYLVPAFVGMGAPYWNPR 356

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
             RG   G+TR T    +A A LES+C+Q  D+  +M  D        ++    VLRVDGG
Sbjct: 357  VRGALFGLTRNTGPAELAHAALESVCYQTFDLWAAMRAD-----WPSSETASVVLRVDGG 411

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
             T ++  MQ  ADLL +PV RP   ETT            G++ E   F+   +++    
Sbjct: 412  MTASDWTMQRLADLLDAPVDRPVIQETTALGAAYLAGLNAGVYPEPTKFADNWRLEHR-- 469

Query: 479  FKPVIEEEVRKKKVDSWCKAV 417
            FKP + E  R++K+  W +AV
Sbjct: 470  FKPNMSEATRERKLAGWARAV 490



>gb:BX842642_822283 Mycoplasma mycoides subsp. mycoides SC genomic
            DNA, complete sequence; segment 1/4.
          Length = 505

 Score =  142 bits (358), Expect = 1e-32
 Identities = 84/209 (40%), Positives = 116/209 (55%), Gaps = 4/209 (1%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  IAGAAVQWLRD+L ++ +A E E  A +V+    VY VP+F GL +P+W   
Sbjct: 304  YALEGSVMIAGAAVQWLRDNLRIVYNAIETEWYADQVKDDRRVYVVPSFTGLGSPYWDSF 363

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            +RG   G+ R T + HI RA LE++ +Q  DV+D+M KD     E        + +VDGG
Sbjct: 364  SRGAIFGLDRGTRREHIVRATLEAIVYQANDVVDAMRKDMKKPIE--------IFKVDGG 415

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  N  LMQ Q+++  S V++P ++ETT          AVG W       + E++KK   
Sbjct: 416  AANNKFLMQFQSNISQSKVIKPTNVETTAMGAAFMVGLAVGYW------ENAEELKKTYK 469

Query: 479  FKPVIEEEVRKKKVD----SWCKAVSRTF 405
                +  E+ K +VD     W  AV RTF
Sbjct: 470  VHFELTPELSKPEVDKLIKGWKVAVQRTF 498



>gb:AB039932_6417 Agrobacterium rhizogenes plasmid pRi1724 DNA, VAR
            region, complete cds.>gb:AP002086_554317 Agrobacterium
            rhizogenes plasmid pRi1724 DNA, complete sequence.
          Length = 500

 Score =  142 bits (357), Expect = 1e-32
 Identities = 85/208 (40%), Positives = 112/208 (53%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AGAAVQWLRDSL LI  A E  +LA   +    VY VPAF GL AP W   
Sbjct: 298  YALEGSIFMAGAAVQWLRDSLKLIKEADETGRLAHLADEQEDVYLVPAFTGLGAPHWNSQ 357

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG   G+TR T    ++RA LES+C+Q RD+L++M  D     EV+       LRVDGG
Sbjct: 358  ARGAIFGLTRGTGIAELSRATLESVCYQTRDLLEAMACDY--PMEVRG----ATLRVDGG 411

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
             + ++  MQ  AD LGS + R    E T            G+W + + F++  K K+   
Sbjct: 412  LSGSDWAMQALADCLGSVIERSQSQEATAYGVAALAGAESGVWPDLQTFAANWKAKRS-- 469

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRTFDLA 396
            F P +  + R ++   W  AV+ T   A
Sbjct: 470  FTPNLNTDERARRYRKWRAAVASTLSYA 497



>sp|Q8EVD0|GLPK_MYCPE Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:BA000026_693986 Mycoplasma penetrans HF-2 DNA,
            complete genome.
          Length = 507

 Score =  140 bits (354), Expect = 3e-32
 Identities = 80/211 (37%), Positives = 118/211 (55%), Gaps = 5/211 (2%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTG-GVYFVPAFNGLFAPWWRD 843
            YALEGS  IAG+ ++WLRDS+ +I +A E +      +     VY VP+F GL AP+W  
Sbjct: 306  YALEGSVFIAGSGIKWLRDSIKVIYNAQECDFYCGLADQEPQNVYMVPSFTGLGAPYWDS 365

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             +RG   G+ R T + HI +A +E++ FQ  D+L +M KD G K          +++VDG
Sbjct: 366  SSRGAIFGLERGTKREHIVKATIEAIAFQSNDLLSAMQKDIGKKIN--------IMKVDG 417

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKK-- 489
            GA+ +N LMQ Q+ +    ++RP +IETT          A G W       S +++KK  
Sbjct: 418  GASNSNYLMQFQSSISDVTIMRPTNIETTALGAAYLAGSASGFW------KSIDELKKLN 471

Query: 488  --DTIFKPVIEEEVRKKKVDSWCKAVSRTFD 402
              D  F+P + +EV  KK+  W +AV RTF+
Sbjct: 472  PIDKSFRPGLSKEVVNKKLKGWQEAVKRTFN 502



>sp|P32190|GLPK_YEAST Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>pir|S33907|S33907 glycerol kinase (EC 2.7.1.30) -
            yeast (Saccharomyces cerevisiae)>gb:SCGUT1_1708413
            S.cerevisiae GUT1 gene for glycerol
            kinase.>gb:YSCH9196_1729144 Saccharomyces cerevisiae
            chromosome VIII cosmid 9196.
          Length = 709

 Score =  139 bits (351), Expect = 7e-32
 Identities = 73/149 (48%), Positives = 97/149 (65%), Gaps = 12/149 (8%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            ++ALEGS A+AGA VQWLRD+L LI  + ++  +AS V  +GGV FVPAF+GLFAP+W  
Sbjct: 452  HFALEGSVAVAGAVVQWLRDNLRLIDKSEDVGPIASTVPDSGGVVFVPAFSGLFAPYWDP 511

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGE------- 684
            DAR   +G+++FT   HIARA +E +CFQ R +L +M  DA  +G    D  E       
Sbjct: 512  DARATIMGMSQFTTASHIARAAVEGVCFQARAILKAMSSDAFGEGSKDRDFLEEISDVTY 571

Query: 683  -----FVLRVDGGATVNNLLMQIQADLLG 612
                  VL VDGG + +N +MQIQAD+LG
Sbjct: 572  EKSPLSVLAVDGGMSRSNEVMQIQADILG 600



>gb:AY372455_614087 Uncultured marine alpha proteobacterium HOT2C01
            fosmid clone.
          Length = 497

 Score =  139 bits (349), Expect = 1e-31
 Identities = 79/203 (38%), Positives = 120/203 (59%), Gaps = 1/203 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            ++ALEGS   AG  VQW+RD +N I+ AS++E+LA   ++T  + F+PAF GL AP+W  
Sbjct: 299  DFALEGSIFNAGTVVQWMRDEMNFINDASKVEELAKNSKNT--IQFIPAFTGLGAPYWNS 356

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            D RG   GITR T+K  IA A L+S+C+Q RD+L+ +  D     E+K  R +F +RVDG
Sbjct: 357  DVRGQITGITRDTSKADIAMAALKSICYQTRDLLECLLDDT----ELK--RSDFTIRVDG 410

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKM-KKD 486
            G + NNL+MQ+ +D+    + RP + E+T            G++ +    +  EK+ K D
Sbjct: 411  GMSKNNLMMQLLSDITQVRIERPLNQESTAMGAAYLAGMKSGVYKD---VAEVEKLWKTD 467

Query: 485  TIFKPVIEEEVRKKKVDSWCKAV 417
              F+P I  +   ++ + W K V
Sbjct: 468  CKFEPSITLDEADQQYNRWLKMV 490



>sp|P74260|GLPK_SYNY3 Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>pir|S75895|S75895 probable L-xylulokinase (EC
            2.7.1.53) - Synechocystis sp.  (strain PCC
            6803)>gb:BA000022_689133 Synechocystis sp. PCC 6803 DNA,
            complete genome.
          Length = 495

 Score =  139 bits (349), Expect = 1e-31
 Identities = 76/169 (44%), Positives = 105/169 (62%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            +YALEGS   AG+ VQWLRD L LI SA+  E LA  V+S GGVYFVPA +GL AP W  
Sbjct: 305  DYALEGSMFTAGSCVQWLRDKLGLIESAAASESLARSVDSNGGVYFVPALSGLGAPHWDM 364

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            +A G  +G+T    K H+ R+VLE++ FQ R+V++++++D+    +         L+VDG
Sbjct: 365  NACGAFLGLTAGVTKAHLVRSVLEAIAFQAREVVEAINQDSPAPIQ--------QLKVDG 416

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEI 516
            GA  N+ LMQ QAD+LG PV RPA ++ T           +G W + +I
Sbjct: 417  GACNNDFLMQCQADVLGIPVERPAVLDATAQGAAFGAGLKIG-WNQLQI 464



>sp|Q9X6C9|GLPK_THEBO Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>gb:AF135398_482222 Thermus brockianus strain ITI360
            putative galactoside binding protein (bdtE) gene, partial
            cds; and putative integral membrane protein (bdtF),
            putative integral membrane protein (bdtG),
            beta-galactosidase (bgaT), alpha-galactosidase (agaT),
            galactose-1-phosphate uridylyltransferase homolog (galT),
            glycerol kinase homolog (glpK), and glycerol
            dehydrogenase homolog (glpD) genes, complete cds.
          Length = 495

 Score =  138 bits (348), Expect = 2e-31
 Identities = 84/203 (41%), Positives = 112/203 (55%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AGAAV WLR+ + L+  + E+E LA +VE  GGVYFVPAF GL AP W   
Sbjct: 297  YALEGSVFVAGAAVGWLRE-VGLLGESHEVESLARQVEDAGGVYFVPAFTGLGAPHWDPY 355

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +G+TR T + H+ARA LE + F V +V  +M   AG         G   L+ DGG
Sbjct: 356  ARGAILGLTRGTTRAHLARAALEGVAFSVGEVAWAMAGAAG--------LGLKALKADGG 407

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
               N+L ++IQADLLG PV+RP   ETT            G  +  ++       +++  
Sbjct: 408  MAQNDLFLEIQADLLGVPVLRPRVTETTALGAAWARGIGAGALSLGDL---PALWREEAR 464

Query: 479  FKPVIEEEVRKKKVDSWCKAVSR 411
            F P + E  R+     W +AV R
Sbjct: 465  FLPRMPEARREALYRGWRRAVER 487



>sp|Q98QY9|GLPK_MYCPU Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>pir|E90539|E90539 hypothetical protein MYPU_2210
            [imported] - Mycoplasma pulmonis (strain UAB
            CTIP)>gb:MPULM01_149734 Mycoplasma pulmonis (strain UAB
            CTIP) complete genome; segment 1/3.
          Length = 507

 Score =  137 bits (346), Expect = 3e-31
 Identities = 80/206 (38%), Positives = 116/206 (56%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AGAA+QWLRDSL ++ +A+  +  +S V+    VY VPAF GL AP+W   
Sbjct: 306  YALEGSVFVAGAAIQWLRDSLRILYNAALSDFYSSLVKDNQRVYVVPAFTGLGAPYWDSY 365

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            A+G   G+ R T   HI +A LES+ +Q  D++ +M KD G K          +L+VDGG
Sbjct: 366  AKGAIFGLERGTKNEHIIKATLESIAYQSNDLIKAMEKDLGQK--------ITLLKVDGG 417

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A+ ++ LM  QA +    V RPA++ETT          AVG W   +I    + +K D  
Sbjct: 418  ASKSDYLMNFQASISNLDVHRPANVETTALGAAYLAGLAVGFW--KDIKEIQKMIKIDHQ 475

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRTFD 402
            FKP ++++     +  W +AV R  +
Sbjct: 476  FKPSVDQKEVDVLLKGWNEAVKRVLN 501



>sp|Q9HY41|GLK2_PSEAE Glycerol kinase 2 (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase 2) (Glycerokinase 2) (GK
            2).>pir|F83199|F83199 probable carbohydrate kinase PA3579
            [imported] - Pseudomonas aeruginosa (strain
            PAO1)>gb:AE004778_57815 Pseudomonas aeruginosa PAO1,
            section 339 of 529 of the complete
            genome.>gb:AE004091_971915 Pseudomonas aeruginosa PAO1,
            complete genome.
          Length = 494

 Score =  137 bits (346), Expect = 3e-31
 Identities = 84/205 (40%), Positives = 108/205 (52%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            +YA+EGS  +AGAAVQWLRD + LI  A E E LA +   + GVY VPAF GL AP+W  
Sbjct: 297  SYAVEGSIFVAGAAVQWLRDGIKLIDHAHESEALAIQAGDSNGVYLVPAFTGLGAPYWDP 356

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG   G+TR T    I  A L+S+C+Q RD+L++M +D               LRVDG
Sbjct: 357  KARGAIFGLTRDTGIKEIVTAGLQSVCYQTRDLLEAMRQDGTPPS---------ALRVDG 407

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE-DEIFSSGEKMKKD 486
            G  VNN +MQ   D+LG  V RP   ETT            G + + D+I S     ++ 
Sbjct: 408  GMVVNNWMMQFLTDILGVTVERPEVTETTALGVAYMAGLKAGFYRDLDDIASHWHLQRR- 466

Query: 485  TIFKPVIEEEVRKKKVDSWCKAVSR 411
              F   + EE R +    W  AV R
Sbjct: 467  --FAAHMAEERRGELYAGWQNAVRR 489



>gb:CR382125_1657236 Kluyveromyces lactis strain NRRL Y-1140
            chromosome E of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 661

 Score =  136 bits (342), Expect = 8e-31
 Identities = 75/147 (51%), Positives = 100/147 (68%), Gaps = 10/147 (6%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            +YALEGS A+AGA VQWLRD+L LI  A ++  LAS V ++GGV FVPAF+GLFAP+W  
Sbjct: 413  HYALEGSVAVAGAVVQWLRDNLRLIPRAEDVGPLASAVPNSGGVVFVPAFSGLFAPYWDP 472

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDA---GDKG---EVKNDRGE- 684
            DAR   +G++++T   HIARA +E +CFQ R +L +M  DA    DK    EV ++  E 
Sbjct: 473  DARATIMGMSQYTTASHIARAAVEGVCFQARAILKAMSSDAFGSEDKDFLEEVVDETYEK 532

Query: 683  ---FVLRVDGGATVNNLLMQIQADLLG 612
                 L VDGG + ++ +MQIQAD+LG
Sbjct: 533  TLLSTLAVDGGMSRSDEVMQIQADILG 559



>sp|P47284|GLPK_MYCGE Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>pir|B64204|B64204 glycerol kinase (EC 2.7.1.30) -
            Mycoplasma genitalium>gb:U39683_205446 Mycoplasma
            genitalium G-37 section 5 of 51 of the complete
            genome.>gb:L43967_1100598 Mycoplasma genitalium G-37,
            complete genome.
          Length = 508

 Score =  135 bits (341), Expect = 1e-30
 Identities = 82/204 (40%), Positives = 111/204 (54%), Gaps = 1/204 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKV-ESTGGVYFVPAFNGLFAPWWRD 843
            YALEGS  +AGAA++WLRD+L +I S  E +  A    E+   + FVPAF+GL APWW  
Sbjct: 307  YALEGSVFVAGAAIKWLRDALKIIYSEKESDFYAELAKENEQNLVFVPAFSGLGAPWWDA 366

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             ARG+ +GI   T + HI +A LES+ FQ  D+L++M  D G K           ++ DG
Sbjct: 367  SARGIILGIEASTKREHIVKASLESIAFQTNDLLNAMASDLGYK--------ITSIKADG 418

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            G   +N LMQ QAD+    V  P + ETT          A G W   +I    +    D 
Sbjct: 419  GIVKSNYLMQFQADIADVIVSIPKNKETTAVGVCFLAGLACGFW--KDIHQLEKLTTLDK 476

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSR 411
             FK  ++  +RK K++SW KAV R
Sbjct: 477  KFKSTMDPNIRKTKINSWHKAVER 500



>gb:AE016816_1746623 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome III, complete sequence.
          Length = 644

 Score =  135 bits (339), Expect = 2e-30
 Identities = 88/241 (36%), Positives = 121/241 (50%), Gaps = 36/241 (14%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            ++ LEGS A+AG+ VQWLRD+L L   A ++  LAS+V   GGV FVPAF+GLFAP+W  
Sbjct: 394  HFVLEGSVAVAGSVVQWLRDNLRLFPRAEDVGPLASRVPDCGGVVFVPAFSGLFAPYWDA 453

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGE------- 684
             ARG  +G+++FT   HIARA +E +CFQ R +L +M  DA  +G   +D  E       
Sbjct: 454  AARGTILGMSQFTTASHIARAAIEGVCFQARAILKAMSSDAFGEGAKDHDFLEEIVDTGT 513

Query: 683  ------FVLRVDGGATVNNLLMQIQADLLGS--PVVRPADIETTXXXXXXXXXXAV---- 540
                   VL VDGG + ++ +MQIQAD+LG    V R    E+T          A     
Sbjct: 514  YEHSPLSVLAVDGGMSKSDEVMQIQADILGPCVKVRRSPTAESTALGAAIAACMAYKDPN 573

Query: 539  -----------------GIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWCKAVSR 411
                             G+  E+ + +      K  IF     + VR+K    W  A+ R
Sbjct: 574  ERVWKDLNDAKKWIFYGGLEKEEALRTPDNVSSKLKIFASQSVDTVRRKNWKRWEAAIER 633

Query: 410  T 408
            T
Sbjct: 634  T 634



>gb:AF274062_494560 Lactobacillus rhamnosus ATP-dependent glycerol
            kinase (glpK) gene, complete cds.
          Length = 484

 Score =  135 bits (339), Expect = 2e-30
 Identities = 69/149 (46%), Positives = 94/149 (63%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEGS  +AG+A+QWLRD + L++ + + +Q A    S   VY VPAF GL AP+W  
Sbjct: 299  NYALEGSVFVAGSAIQWLRDQMGLVAQSPDTQQAAEAATSDDEVYVVPAFTGLGAPYWDA 358

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            +ARG   G+TR T K    +A L+++ +Q RDV+D+M+KD               LRVDG
Sbjct: 359  EARGAVFGLTRGTTKDDFIKATLQALAYQTRDVVDTMYKD--------TQIAVPALRVDG 410

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETT 576
            GA  N+ LMQ QAD+L  P+ R A++ETT
Sbjct: 411  GAARNDYLMQFQADILNKPLERAANLETT 439



>gb:AE011383_272356 Leptospira interrogans serovar lai str. 56601
            chromosome I, section 192 of 397 of the complete
            sequence.>gb:AE017294_433997 Leptospira interrogans
            serovar Copenhageni str. Fiocruz L1-130, chromosome I,
            section 8 of 14 of the complete
            sequence.>gb:AE010300_1005755 Leptospira interrogans
            serovar lai str. 56601 chromosome I, complete
            sequence.>gb:AE016823_1067008 Leptospira interrogans
            serovar Copenhageni str. Fiocruz L1-130, chromosome I,
            complete sequence.
          Length = 496

 Score =  134 bits (338), Expect = 2e-30
 Identities = 77/203 (37%), Positives = 114/203 (56%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            Y LEGS  I GA VQ+LRD+L     +   E+ AS V+    V F+PAF GL AP+W  +
Sbjct: 299  YCLEGSVFIGGAVVQFLRDNLKFFKESKISEKYASSVKKEDDVVFIPAFAGLGAPYWDMN 358

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +G+TR T    I RA L+S+  Q  +++++M  D G K +        VL+VDGG
Sbjct: 359  ARGAILGLTRDTTAEQITRAALKSIALQSYELVEAMENDTGSKLK--------VLKVDGG 410

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            AT N+ LMQ Q+D+LG  VVRP++++TT            G +    +    +K+K    
Sbjct: 411  ATGNSWLMQYQSDILGKRVVRPSNVDTTVLGAAFLAGLERGFF--PSVVDLKKKLKTSKE 468

Query: 479  FKPVIEEEVRKKKVDSWCKAVSR 411
            F P +++  R+K++  W  +V R
Sbjct: 469  FSPQMKQPQREKEIQIWKDSVHR 491



>gb:CR380951_1650102 Candida glabrata strain CBS138 chromosome E
            complete sequence.
          Length = 672

 Score =  134 bits (336), Expect = 4e-30
 Identities = 69/150 (46%), Positives = 100/150 (66%), Gaps = 13/150 (8%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            ++ALEGS A+AGA VQWLRD+L LI  A ++  +A+ V  +GGV FVPAF+GLFAP+W  
Sbjct: 418  HFALEGSVAVAGAVVQWLRDNLRLIPKAEDVGPIANSVPDSGGVVFVPAFSGLFAPYWDP 477

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVK-------NDRGE 684
            +ARG  +G++++T   HIARA +E++CFQ R +L +M  DA  + E         ++ G 
Sbjct: 478  EARGTIMGMSQYTTASHIARAAVEAVCFQARAILLAMSNDAMGEAEKDSTFKTEISEEGS 537

Query: 683  F------VLRVDGGATVNNLLMQIQADLLG 612
            +       L VDGG + ++ +MQIQAD+LG
Sbjct: 538  YQKSLLSTLAVDGGMSRSDEVMQIQADILG 567



>gb:CP000031_84176 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 492

 Score =  133 bits (335), Expect = 5e-30
 Identities = 78/202 (38%), Positives = 110/202 (54%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  IAGAAVQWLRD L +I +A++   LA++ +    V  VPAF GL AP+W+ D
Sbjct: 295  YALEGSIFIAGAAVQWLRDGLGIIENAAQSGALAARADPAQNVILVPAFTGLGAPYWKPD 354

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
             RG   G+TR +      +A LES+ +Q RD+ ++M  D G   +V       +LRVDGG
Sbjct: 355  CRGAMFGLTRNSGPAEFCKAALESVAYQTRDLWEAMQGDWGADADV-------ILRVDGG 407

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
             + ++  MQ  AD LG+PV RP   ETT            G++ +   F++   +  D  
Sbjct: 408  MSASDWAMQGLADRLGAPVDRPVMQETTALGAAWLAGMRAGVYPDQAGFAATWAL--DAR 465

Query: 479  FKPVIEEEVRKKKVDSWCKAVS 414
            F P + E  R+     W  AV+
Sbjct: 466  FTPKMVEGDREAAYRRWKAAVA 487



>gb:AE017354_459782 Legionella pneumophila subsp. pneumophila str.
            Philadelphia 1, complete genome.
          Length = 491

 Score =  132 bits (331), Expect = 1e-29
 Identities = 77/202 (38%), Positives = 103/202 (50%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            Y LEGS   AG  V+WLRD + LIS ++E E LA  ++S  GVY V +F GL AP W   
Sbjct: 293  YGLEGSIYHAGTTVKWLRDEMKLISHSAETEVLARSLDSNNGVYLVSSFTGLGAPHWLSI 352

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
                 IG++R TN+ H ARA LE +C+Q RDVL  M  D        +     +LR DGG
Sbjct: 353  TGTAIIGVSRSTNRAHFARAALEGVCYQTRDVLTCMRDD--------SQLDLTLLRADGG 404

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
              VN   +Q  AD     + +P DIETT            G++  D + S  +    +  
Sbjct: 405  MAVNQWFLQFMADQCQLTIQKPKDIETTAKGAAVLAAIGSGLF--DSVSSVNKIWDVENE 462

Query: 479  FKPVIEEEVRKKKVDSWCKAVS 414
            F+P  E EV +K    W +A+S
Sbjct: 463  FQPFREREVVEKDFRGWLEALS 484



>gb:PFMAL13_1191565 Plasmodium falciparum 3D7 chromosome 13, ***
            SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 501

 Score =  131 bits (330), Expect = 2e-29
 Identities = 79/205 (38%), Positives = 109/205 (53%), Gaps = 1/205 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS   AG+ V WL  +  LI   SE   +  K E+T GV FVPAF+GL+AP WR D
Sbjct: 303  YALEGSIGTAGSGVSWLLKN-KLIDDPSEASDIMEKCENTTGVIFVPAFSGLYAPRWRSD 361

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            AR    G+T  T + HI RA+LE + FQ+ +++DS+  D G +          VLR DGG
Sbjct: 362  ARASIYGMTFNTERSHIVRALLEGIAFQLNEIVDSLTSDMGIE-------MLHVLRCDGG 414

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKK-DT 483
             T N   MQ  +D++ + +      E T           V IW  D + S    +++ D 
Sbjct: 415  MTKNKPFMQFNSDIINTKIEVSKYKEVTSLGAAVLAGLEVKIW--DSLDSVKSLLRRSDA 472

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRT 408
            +F   ++++ RKKK   W KAV RT
Sbjct: 473  VFHSKMDDKKRKKKTSEWNKAVERT 497



>gb:CR628336_111484 Legionella pneumophila str. Paris complete genome.
          Length = 491

 Score =  131 bits (329), Expect = 2e-29
 Identities = 76/202 (37%), Positives = 103/202 (50%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            Y LEGS   AG  V+WLRD + LIS ++E E LA  ++S  GVY V +F GL AP W   
Sbjct: 293  YGLEGSIYHAGTTVKWLRDEMKLISHSAETEVLAQSLDSNNGVYLVSSFTGLGAPHWLSI 352

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
                 IG++R TN+ H ARA LE +C+Q RDVL  M  D        +     +LR DGG
Sbjct: 353  TGTAIIGVSRSTNRAHFARAALEGVCYQTRDVLTCMRDD--------SQLDLTLLRADGG 404

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
              VN   +Q  AD     + +P DIETT            G++  D + S  +    +  
Sbjct: 405  MAVNQWFLQFMADQCQLTIQKPKDIETTAKGAAVLAAIGSGLF--DSVSSVNKVWDVENE 462

Query: 479  FKPVIEEEVRKKKVDSWCKAVS 414
            F+P  E EV +K    W +A++
Sbjct: 463  FQPSREREVVEKDFRGWLEALA 484



>gb:CR628337_114569 Legionella pneumophila str. Lens complete genome.
          Length = 491

 Score =  130 bits (328), Expect = 3e-29
 Identities = 76/202 (37%), Positives = 103/202 (50%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            Y LEGS   AG  V+WLRD + LIS ++E E LA  ++S  GVY V +F GL AP W   
Sbjct: 293  YGLEGSIYHAGTTVKWLRDEMKLISHSAETEVLARSLDSNNGVYLVSSFTGLGAPHWLSI 352

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
                 IG++R TN+ H ARA LE +C+Q RDVL  M  D        +     +LR DGG
Sbjct: 353  TGTAIIGVSRSTNRAHFARAALEGVCYQTRDVLTCMRDD--------SQLDLTLLRADGG 404

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
              VN   +Q  AD     + +P DIETT            G++  D + S  +    +  
Sbjct: 405  MAVNQWFLQFMADQCQLTIQKPKDIETTAKGAAVLAAIGSGLF--DSVSSVNKVWDIENE 462

Query: 479  FKPVIEEEVRKKKVDSWCKAVS 414
            F+P  E EV +K    W +A++
Sbjct: 463  FQPFREREVVEKDFRGWLEALA 484



>sp|P75064|GLPK_MYCPN Glycerol kinase (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase) (Glycerokinase)
            (GK).>pir|S73430|S73430 glycerol kinase glpK - Mycoplasma
            pneumoniae (strain ATCC 29342)>gb:AE000012_18989
            Mycoplasma pneumoniae M129 section 5 of 63 of the
            complete genome.>gb:U00089_1101090 Mycoplasma pneumoniae
            M129, complete genome.
          Length = 508

 Score =  130 bits (328), Expect = 3e-29
 Identities = 82/211 (38%), Positives = 114/211 (54%), Gaps = 3/211 (1%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIE---QLASKVESTGGVYFVPAFNGLFAPWW 849
            YALEGS  +AGAA++WLRDSL ++ SA+E +   +LA K E    V FVPAF GL AP+W
Sbjct: 307  YALEGSVFVAGAALKWLRDSLKVMYSAAESDFYAKLAQKEEQE--VVFVPAFTGLGAPYW 364

Query: 848  RDDARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRV 669
               ARG   GI   T + H+ +A LE++ FQ  D++ +M  D      +K       ++ 
Sbjct: 365  DASARGAIFGIEANTKREHLVKATLEAIAFQANDLIKAMASDL--NSSIKK------IKA 416

Query: 668  DGGATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKK 489
            DGGA  +N LMQ QAD+    V+ P ++ETT          AV  W + +       + K
Sbjct: 417  DGGACNSNYLMQFQADIANLEVIIPKNVETTTMGAAFLAGLAVNYWKDTKQLEKLTGIAK 476

Query: 488  DTIFKPVIEEEVRKKKVDSWCKAVSRTFDLA 396
               FK  + + VR+KK   W +AV RT   A
Sbjct: 477  Q--FKSQMNQTVREKKSKRWNEAVKRTLKWA 505



>gb:BX569694_776855 Synechococcus sp. WH8102 complete genome; segment
            6/7.
          Length = 501

 Score =  127 bits (318), Expect = 5e-28
 Identities = 79/206 (38%), Positives = 108/206 (52%), Gaps = 2/206 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            Y LEGS   AG  VQWLRD L +I  A E+  LA  V  +GGV  VPAF G   P W   
Sbjct: 302  YCLEGSLFNAGTVVQWLRDGLQIIEQADEVNALAQSVPDSGGVMLVPAFTGWGTPHWDPQ 361

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARGV +G+TR +N+ HIARA LE +   V  +++   +  G        RG   L VDGG
Sbjct: 362  ARGVLVGLTRDSNRGHIARAALEGIALSVATLVELAGEALG--------RGLGELAVDGG 413

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            A  ++ L+Q QAD  G  V RP ++E+T            G+  +    S+    ++D +
Sbjct: 414  AAASDPLLQAQADSTGLTVRRPRNLESTARGIALFAGVQCGLIPD---LSAIAAHRQDDV 470

Query: 479  --FKPVIEEEVRKKKVDSWCKAVSRT 408
              F+P I  E R+ + D W  AV+R+
Sbjct: 471  QRFEPQINTERRRLQRDRWNDAVNRS 496



>gb:AE017332_445628 Mycoplasma hyopneumoniae 232, complete genome.
          Length = 510

 Score =  126 bits (316), Expect = 8e-28
 Identities = 71/207 (34%), Positives = 112/207 (54%), Gaps = 1/207 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTG-GVYFVPAFNGLFAPWWRD 843
            YALEGS  IAGAA+QWLRD L+LI ++S+ + L SK +     +  VP+F GL AP+W  
Sbjct: 308  YALEGSVFIAGAAIQWLRDGLSLIENSSDCDSLVSKAKKNDYHIILVPSFTGLGAPYWDS 367

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             +RG   G+ R T K H+ +A LES+ FQ  D++ ++  D G K          +++VDG
Sbjct: 368  YSRGAIFGLERGTKKEHLIKASLESIAFQANDLIKAIESDLGTKIS--------LMKVDG 419

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            G + ++ LMQ Q+ +    + RP +IETT              W  + +    + +  + 
Sbjct: 420  GVSKSDYLMQFQSSISQVEIQRPKNIETTAMGAAFLAGLYAKFW--NSLAELKQILVPEK 477

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSRTFD 402
            +F P  ++ + KK   +W  AV +T +
Sbjct: 478  VFVPEFDQFMVKKLTSNWDLAVRKTLN 504



>sp|Q9X049|GLK1_THEMA Glycerol kinase 1 (EC 2.7.1.30) (ATP:glycerol
            3-phosphotransferase 1) (Glycerokinase 1) (GK
            1).>pir|C72314|C72314 glycerol kinase - Thermotoga
            maritima (strain MSB8)>gb:AE001758_38861 Thermotoga
            maritima MSB8 section 70 of 136 of the complete
            genome.>gb:AE000512_1113334 Thermotoga maritima MSB8,
            complete genome.
          Length = 492

 Score =  123 bits (308), Expect = 7e-27
 Identities = 69/204 (33%), Positives = 110/204 (53%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            +Y LEG+   AG  + WL++ L +IS  SE E++A  +E+ GGVY VPAF GL AP+WR 
Sbjct: 295  SYVLEGNIHSAGDTIVWLKEKLGIISDPSETEKIALSLENNGGVYLVPAFVGLGAPYWRS 354

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            D +   +G+ R   K H+ RA LES+ +QVRD+ + M +         + +    +R DG
Sbjct: 355  DVKAAILGLQRNHGKEHVVRAALESIAYQVRDIFEEMVR--------ISSKEPTEVRADG 406

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            G T N  LMQ QAD+L  PV+     E +           +G +++ E     +K+    
Sbjct: 407  GITRNRFLMQFQADILNIPVLVSNIEEVSARGVAFVALLHLGAFSDLE--EIRQKITYRE 464

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSR 411
             ++P + +E+R+   + W  A+ +
Sbjct: 465  KYEPRMGDELREMYYEGWKTAIRK 488



>sp|Q21944|GLPK_CAEEL Probable glycerol kinase (EC 2.7.1.30)
            (ATP:glycerol 3- phosphotransferase) (Glycerokinase)
            (GK).>pir|T16716|T16716 hypothetical protein R11F4.1 -
            Caenorhabditis elegans>gb:U38378_1402927 Caenorhabditis
            elegans cosmid R11F4, complete sequence.
          Length = 502

 Score =  122 bits (307), Expect = 9e-27
 Identities = 69/204 (33%), Positives = 107/204 (52%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS +I G  V++LRD+   IS A E+E L   VE T G YFVP+F GL+ P+W   
Sbjct: 303  YALEGSGSIGGNVVRFLRDNFKFISDAKEMEGLCRSVEDTSGAYFVPSFTGLYTPYWDST 362

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG  +G+T+ T + HI  A L ++ FQ  +++ ++ +D     +V        L+VDGG
Sbjct: 363  ARGTILGLTQVTQREHICLAALRAVAFQSAEMIAAVEQDLEGGTKVT------TLKVDGG 416

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
               N L  +IQAD++G  +V P   E +               + DE     ++  +D  
Sbjct: 417  MIANKLFNEIQADIMGRDIVTPKITEISGWGAAVAGGIGAQQISLDEFL---QQSSEDNR 473

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRT 408
            + P  ++  R  ++  W +AV R+
Sbjct: 474  YTPQKDDNWRSAELARWKEAVKRS 497



>gb:AE016864_351825 Pseudomonas syringae pv. tomato str. DC3000
            section 9 of 21 of the complete
            genome.>gb:AE016853_1037000 Pseudomonas syringae pv.
            tomato str. DC3000 complete genome.
          Length = 491

 Score =  120 bits (301), Expect = 4e-26
 Identities = 77/203 (37%), Positives = 107/203 (52%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YA+EG+    GAAVQW    L    S   + + A+++   GGVYFVPA +GL AP W+ D
Sbjct: 298  YAMEGNIVHTGAAVQWAA-RLVAGESIDALSEQAAQLADNGGVYFVPALSGLGAPHWQAD 356

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+T  ++  HI RA LES+ +Q+RDV D+M  D G   +         L VDGG
Sbjct: 357  ARGLICGLTEGSSGAHIMRAALESIGYQIRDVFDAMQADIGSPLK--------ELWVDGG 408

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            AT N  LMQ  ADLL  PV+R    E +          A+G+W +       E+ ++   
Sbjct: 409  ATRNRWLMQFLADLLQRPVIRSLSPEVSALGAAHLAGKALGLWNDAADLQVLERQRER-- 466

Query: 479  FKPVIEEEVRKKKVDSWCKAVSR 411
            F PV   ++ +     W KA+ R
Sbjct: 467  FDPVPGRDL-EGVYQEWQKALGR 488



>gb:AF543469_520693 Uncultured bacterium plasmid pAK102 GlpK (glpK)
            and putative acetyltransferase genes, complete cds; and
            unknown genes.
          Length = 502

 Score =  115 bits (287), Expect = 2e-24
 Identities = 65/146 (44%), Positives = 85/146 (58%), Gaps = 5/146 (3%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASE-----IEQLASKVESTGGVYFVPAFNGLFAP 855
            Y LEG+    G AV W+ DS  L     E     +  L + V+ST GVYFVPA  GL AP
Sbjct: 299  YGLEGNIPHTGDAVAWMADSTGLSELPEEQLLHELNTLPATVDSTLGVYFVPALTGLGAP 358

Query: 854  WWRDDARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVL 675
            WW +DARG+  G++R   + H+ RA LES+ +Q+ DV+ +M +  G +           L
Sbjct: 359  WWDEDARGLIHGLSRGVKRAHLVRAALESITYQIADVVLAMRQHNGFRLS--------AL 410

Query: 674  RVDGGATVNNLLMQIQADLLGSPVVR 597
             VDGG T N+ LMQ QADLLG PV+R
Sbjct: 411  MVDGGPTKNDWLMQYQADLLGCPVMR 436



>gb:AY570697_1337918 Dictyocaulus viviparus isolate L3i53 putative
            glycerol kinase mRNA, complete cds.
          Length = 517

 Score =  112 bits (279), Expect = 2e-23
 Identities = 72/219 (32%), Positives = 110/219 (50%), Gaps = 16/219 (7%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISS-------------ASEIEQLASKVESTGGVYFVP 879
            +A EGS +I G  V++LRD+ N I               ASE+E++   V+ST GV FVP
Sbjct: 303  FAFEGSGSIGGNVVRFLRDNFNFIKETRQKASNSYCFKDASEMEEICRSVDSTEGVVFVP 362

Query: 878  AFNGLFAPWWRDDARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVK 699
             F GL+ P+W   A+G  +G+T+ T K HI  A L+++ FQ  ++L+ + ++        
Sbjct: 363  CFTGLYTPYWDPTAKGTILGLTQVTTKAHICLAALQAVAFQSAEMLEEIQQEL------- 415

Query: 698  NDRGEFVLRVDGGATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTED- 522
             D        DGG T N L  +IQ+D++G P+      E T          A GI ++  
Sbjct: 416  EDTPIHHFSTDGGMTANVLFNEIQSDIIGKPIKTLKITEIT----GWGAAVAAGIGSQQI 471

Query: 521  --EIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWCKAVSR 411
              + FSS  K    TI++P  +E  R+ ++  W K V R
Sbjct: 472  CLDAFSS--KQPPATIYEPQTDERQREFEMSRWKKGVRR 508



>gb:BX950851_840691 Erwinia carotovora subsp. atroseptica SCRI1043,
            complete genome.
          Length = 496

 Score =  107 bits (268), Expect = 3e-22
 Identities = 69/203 (33%), Positives = 101/203 (49%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEG+    G+   W+   L  + S +++ +LA   ES  GV+FVPA +GL AP+W   
Sbjct: 298  YALEGNITHTGSGFAWIGQMLG-VPSVTQLTELALSAESNQGVFFVPALSGLGAPYWDVQ 356

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+   T    IARA LE++ +QV DV  +M        E  +      LRVDGG
Sbjct: 357  ARGLLCGLCDATTPAIIARAGLEAIAYQVADVFFAM--------EQVSQAALPALRVDGG 408

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            AT N  LMQ QADLL  P++R  + E +           +G W  +E  ++    ++  +
Sbjct: 409  ATQNRWLMQFQADLLQRPLIRNHNAEVSALGAAYLGGKMLGWWEHNEQIAA--LPREVEV 466

Query: 479  FKPVIEEEVRKKKVDSWCKAVSR 411
             +P        +    W  AV+R
Sbjct: 467  IEPSATNHAILESYQQWRTAVAR 489



>gb:BX936398_835463 Yersinia pseudotuberculosis IP32953 genome,
            complete sequence.
          Length = 495

 Score =  107 bits (267), Expect = 4e-22
 Identities = 69/203 (33%), Positives = 98/203 (48%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEG+    G+ V W+   L  IS  S +  +A       GVYFVPA +GL AP+W   
Sbjct: 298  YALEGNITHTGSGVAWVSRMLG-ISDLSRLTDMAESQSGNQGVYFVPALSGLGAPYWDSQ 356

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+T  T    +ARA LES+ +Q+ DV  +M   A  + E         LRVDGG
Sbjct: 357  ARGLFCGLTDATTPAVLARAALESVAYQIADVFFAMENAAHHRLE--------RLRVDGG 408

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            AT N  LMQ QADLL   ++R    E +           +G W + +  ++    ++   
Sbjct: 409  ATSNRWLMQFQADLLQRTLIRNHTAEVSALGAAYLGGKTLGWWQDSQQLAA--LPREVEY 466

Query: 479  FKPVIEEEVRKKKVDSWCKAVSR 411
             +P I     +     W  A++R
Sbjct: 467  IEPRIHSAEMQDNYSLWQTAIAR 489



>pir|AD0402|AD0402 glycerol kinase (EC 2.7.1.30) [imported] - Yersinia
            pestis  (strain CO92)>gb:AE013690_299202 Yersinia pestis
            KIM section 90 of 415 of the complete
            genome.>gb:AE017128_386224 Yersinia pestis biovar
            Medievalis str. 91001 section 2 of 16 of the complete
            genome.>gb:AJ414156_525073 Yersinia pestis strain CO92
            complete genome; segment 16/20.>gb:AE009952_929385
            Yersinia pestis KIM complete genome.>gb:AE017042_1142790
            Yersinia pestis biovar Medievalis str. 91001 complete
            genome.
          Length = 495

 Score =  107 bits (267), Expect = 4e-22
 Identities = 69/203 (33%), Positives = 98/203 (48%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEG+    G+ V W+   L  IS  S +  +A       GVYFVPA +GL AP+W   
Sbjct: 298  YALEGNITHTGSGVAWVSRMLG-ISDLSRLTDMAESQSGNQGVYFVPALSGLGAPYWDSQ 356

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            ARG+  G+T  T    +ARA LES+ +Q+ DV  +M   A  + E         LRVDGG
Sbjct: 357  ARGLFCGLTDATTPAVLARAALESVAYQIADVFFAMENAAHHRLE--------RLRVDGG 408

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
            AT N  LMQ QADLL   ++R    E +           +G W + +  ++    ++   
Sbjct: 409  ATSNRWLMQFQADLLQRTLIRNHTAEVSALGAAYLGGKTLGWWQDSQQLAA--LPREVEY 466

Query: 479  FKPVIEEEVRKKKVDSWCKAVSR 411
             +P I     +     W  A++R
Sbjct: 467  IEPRIHSAEMQDNYSLWQTAIAR 489



>pir|A87401|A87401 glycerol kinase [imported] - Caulobacter
            crescentus>gb:AE005798_212368 Caulobacter crescentus CB15
            section 124 of 359 of the complete
            genome.>gb:AE005673_922267 Caulobacter crescentus CB15
            complete genome.
          Length = 496

 Score =  106 bits (264), Expect = 9e-22
 Identities = 70/204 (34%), Positives = 93/204 (45%), Gaps = 1/204 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            YALEGS  +AGAA+QWL + L +       E LA   +    V  VPAF GL APWW  +
Sbjct: 298  YALEGSIFVAGAAIQWLGEGLGITGGPRAAEALARAAKPDHAVVVVPAFTGLGAPWWDAE 357

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDK-GEVKNDRGEFVLRVDG 663
            ARG   G+TR      IA A  ++   Q RD++++M  DA    GE         LR+DG
Sbjct: 358  ARGGIFGLTRDAGLPEIAAATFDACALQSRDLIEAMRADAPTAFGEAAQ------LRIDG 411

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDT 483
            G   +    Q  ADL G  V R +  ETT            G++    I  + E      
Sbjct: 412  GMAKSAWFSQRLADLTGLSVRRASYQETTALGAALFAAVGAGLY--GSIEEAAEASPAAE 469

Query: 482  IFKPVIEEEVRKKKVDSWCKAVSR 411
               P +++ VR+     W  AV R
Sbjct: 470  TLAPAMDDHVREAAYARWLDAVPR 493



>gb:BC050033_2100323 Mus musculus RIKEN cDNA C330018K18 gene, mRNA
            (cDNA clone IMAGE:5328207), partial cds.
          Length = 230

 Score =  105 bits (261), Expect = 2e-21
 Identities = 63/203 (31%), Positives = 108/203 (53%)
 Frame = -3

Query: 1010 EGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDDARG 831
            EG+    G A+ W +  L+L + A+E E++A  +E + GVYFVP+F+GL AP     A  
Sbjct: 34   EGNAGDTGTAIMWAQ-KLDLFTDAAETEKMALSLEDSEGVYFVPSFSGLQAPLNDPCACA 92

Query: 830  VCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATV 651
              +G+   TNK H+ RA+LES+ F+ + + D + ++   +  V N      +R DGG   
Sbjct: 93   SFMGLKHSTNKYHLVRAILESIAFRNKQLYDMLQREI--QIPVTN------IRADGGVCN 144

Query: 650  NNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTIFKP 471
            N  +MQ+ +DL+   + RPA  + +          AVG W + E     +  + + +FKP
Sbjct: 145  NAFVMQMTSDLINEKIDRPAHFDMSCLGAASLAGLAVGFWADKEELQ--KLRQSEMVFKP 202

Query: 470  VIEEEVRKKKVDSWCKAVSRTFD 402
              + +  +  +++W KAV R+ +
Sbjct: 203  QKKWQEYEVNMENWVKAVKRSMN 225



>gb:AK090901_1913358 Homo sapiens cDNA FLJ33582 fis, clone
            BRAMY2011849, weakly similar to GLYCEROL KINASE 2 (EC
            2.7.1.30).
          Length = 250

 Score =  103 bits (257), Expect = 6e-21
 Identities = 62/203 (30%), Positives = 107/203 (52%)
 Frame = -3

Query: 1010 EGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDDARG 831
            E +    G A++W +  L+L + A+E E++A  +E + GV FVP+F+GL AP     A  
Sbjct: 54   ESNAGDTGTAIKWAQQ-LDLFTDAAETEKMAKSLEDSEGVCFVPSFSGLQAPLNDPWACA 112

Query: 830  VCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATV 651
              +G+   T+K H+ RA+LES+ F+ + + + M K+               +R DGG   
Sbjct: 113  SFMGLKPSTSKYHLVRAILESIAFRNKQLYEMMKKEIHIPVRK--------IRADGGVCK 164

Query: 650  NNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTIFKP 471
            N  +MQ+ +DL+   + RPADI+ +          AVG WT+ E     +  + + +FKP
Sbjct: 165  NGFVMQMTSDLINENIDRPADIDMSCLGAASLAGLAVGFWTDKEELK--KLRQSEVVFKP 222

Query: 470  VIEEEVRKKKVDSWCKAVSRTFD 402
              + +  +  +++W KAV R+ +
Sbjct: 223  QKKCQEYEMSLENWAKAVKRSMN 245



>gb:AK127641_1916836 Homo sapiens cDNA FLJ45739 fis, clone
            KIDNE2010049, weakly similar to Glycerol kinase 2 (EC
            2.7.1.30).
          Length = 529

 Score =  103 bits (256), Expect = 7e-21
 Identities = 62/203 (30%), Positives = 107/203 (52%)
 Frame = -3

Query: 1010 EGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDDARG 831
            E +    G A++W +  L+L + A+E E++A  +E + GV FVP+F+GL AP     A  
Sbjct: 333  ESNAGDIGTAIKWAQQ-LDLFTDAAETEKMAKSLEDSEGVCFVPSFSGLQAPLNDPWACA 391

Query: 830  VCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATV 651
              +G+   T+K H+ RA+LES+ F+ + + + M K+               +R DGG   
Sbjct: 392  SFMGLKPSTSKYHLVRAILESIAFRNKQLYEMMKKEIHIPVRK--------IRADGGVCK 443

Query: 650  NNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTIFKP 471
            N  +MQ+ +DL+   + RPADI+ +          AVG WT+ E     +  + + +FKP
Sbjct: 444  NGFVMQMTSDLINENIDRPADIDMSCLGAASLAGLAVGFWTDKEELK--KLRQSEVVFKP 501

Query: 470  VIEEEVRKKKVDSWCKAVSRTFD 402
              + +  +  +++W KAV R+ +
Sbjct: 502  QKKCQEYEMSLENWAKAVKRSMN 524



>gb:SCO939130_180670 Streptomyces coelicolor A3(2) complete genome;
            segment 27/29.
          Length = 479

 Score =  101 bits (251), Expect = 3e-20
 Identities = 59/140 (42%), Positives = 80/140 (57%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            ++ L+G    A +AV+WL   L +I+ A++++ + + V  TGGV FVPA  GL APWWR 
Sbjct: 280  DHCLDGQVYTAASAVRWLT-GLGVITGAADLDPVGATVPDTGGVTFVPALAGLAAPWWRG 338

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            D RG   G+   T   H+ RA+ E +  QV ++ D+   D G            VLRVDG
Sbjct: 339  DLRGSLTGLGLDTAPGHLVRALCEGLAAQVAELADAAAADLGTP--------LTVLRVDG 390

Query: 662  GATVNNLLMQIQADLLGSPV 603
            G T + LLMQ QADLL  PV
Sbjct: 391  GLTRSALLMQTQADLLQRPV 410



>gb:AE011512_273800 Leptospira interrogans serovar lai str. 56601
            chromosome I, section 321 of 397 of the complete
            sequence.>gb:AE017289_432859 Leptospira interrogans
            serovar Copenhageni str. Fiocruz L1-130, chromosome I,
            section 3 of 14 of the complete
            sequence.>gb:AE010300_1007199 Leptospira interrogans
            serovar lai str. 56601 chromosome I, complete
            sequence.>gb:AE016823_1065870 Leptospira interrogans
            serovar Copenhageni str. Fiocruz L1-130, chromosome I,
            complete sequence.
          Length = 515

 Score = 99.8 bits (247), Expect = 8e-20
 Identities = 60/207 (28%), Positives = 105/207 (50%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            Y LEG  A AG  + WL   + L  +   + +LA++ E T GV F+P   G   P++   
Sbjct: 318  YMLEGYVATAGTLIDWLGQGIGLSDTPKVLNELAAQSEDTEGVVFIPTPTGARFPYFNPR 377

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            A+   IG++  +++ H+ARAVLE +   + ++L+ + +D   K E+K+      ++VDGG
Sbjct: 378  AKASVIGLSLASHRRHVARAVLEGISLSLYEILEGIQRDT--KVEIKD------IKVDGG 429

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
             + +++L+Q  +D     V R  + + T          AVG W   +   + +K  K   
Sbjct: 430  VSQSDILLQCLSDFSNVRVNRSPEPDMTATGTAYLAGLAVGFWKNLDELKNLQKGYKS-- 487

Query: 479  FKPVIEEEVRKKKVDSWCKAVSRTFDL 399
            F+P +    R +K+  W KAV+ T  +
Sbjct: 488  FEPKMNPTKRVQKIQRWKKAVTATLSI 514



>gb:AK049275_1168699 Mus musculus ES cells cDNA, RIKEN full-length
            enriched library, clone:C330018K18 product:hypothetical
            Carbohydrate kinase, FGGY family containing protein, full
            insert sequence.
          Length = 516

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 58/180 (32%), Positives = 95/180 (52%)
 Frame = -3

Query: 1010 EGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDDARG 831
            EG+    G A+ W +  L+L + A+E E++A  +E + GVYFVP+F+GL AP     A  
Sbjct: 338  EGNAGDTGTAIMWAQ-KLDLFTDAAETEKMALSLEDSEGVYFVPSFSGLQAPLNDPCACA 396

Query: 830  VCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATV 651
              +G+   TNK H+ RA+LES+ F+ + + D + ++   +  V N      +R DGG   
Sbjct: 397  SFMGLKHSTNKYHLVRAILESIAFRNKQLYDMLQREI--QIPVTN------IRADGGVCN 448

Query: 650  NNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTIFKP 471
            N  +MQ+ +DL+   + RPA  + +          AVG W + E     +  + + +FKP
Sbjct: 449  NAFVMQMTSDLINEKIDRPAHFDMSCLGAASLAGLAVGFWADKEELQ--KLRQSEMVFKP 506



>gb:BT010125_1357491 Drosophila melanogaster AT16378 full insert cDNA.
          Length = 539

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 59/207 (28%), Positives = 100/207 (48%), Gaps = 1/207 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            Y +EG+    G  V W + S  L  S +    +A  V  T  V+F+PAF+GL  P     
Sbjct: 342  YCIEGASHDFGTVVTWAQ-SCELFDSPANTSDIAQSVPDTNDVFFMPAFSGLGPPVNDYR 400

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            +    IG+T  T K H+ RA+LES+ F++  ++++  K+   K          ++RVDGG
Sbjct: 401  SASGFIGLTPSTTKAHMVRALLESIVFRLVQLIEAAEKETSQK--------LHMIRVDGG 452

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
             + N+ + Q  ADL    V R  + E++            GIW + +      K+++  +
Sbjct: 453  VSRNDFVCQFLADLSRLRVERAENAESSIMGATFMAGINHGIWRDVDDLKRFRKVER--V 510

Query: 479  FKPVIEE-EVRKKKVDSWCKAVSRTFD 402
            F+P  +E E    ++D W + ++R  D
Sbjct: 511  FEPRPKEYETIANRMDKWSRTIARFSD 537



>pir|AE2810|AE2810 glycerol kinase 2 glpK [imported] - Agrobacterium
            tumefaciens (strain C58, Dupont)>pir|H97588|H97588
            glycerol kinase 2 (ATP glycerol 3-phosphotransferase 2)
            (glycerokinase 2) (gk 2) [imported] - Agrobacterium
            tumefaciens (strain C58, Cereon)>gb:AE008109_233605
            Agrobacterium tumefaciens str. C58 circular chromosome,
            section 167 of 254 of the complete
            sequence.>gb:AE009144_248926 Agrobacterium tumefaciens
            str. C58 circular chromosome, section 170 of 256 of the
            complete sequence.>gb:AE007869_1083274 Agrobacterium
            tumefaciens str. C58 circular chromosome, complete
            sequence.>gb:AE008688_1086769 Agrobacterium tumefaciens
            str. C58 circular chromosome, complete sequence.
          Length = 489

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 58/165 (35%), Positives = 87/165 (52%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            +A EG+  ++ A++ W+ D L L   A+ +E LA+  E  G   FVPAF GL AP+W  +
Sbjct: 290  FAFEGNILVSAASLPWMTDILGLPDVAALVE-LAATAEPEGPG-FVPAFVGLGAPYWDTN 347

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            AR +   I   T +  +ARAV +S+ FQV DV  +M          ++  G   L VDGG
Sbjct: 348  ARALFSQINFSTTRAQMARAVTDSIAFQVHDVFAAM--------RAQSPSGFGRLFVDGG 399

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTE 525
             + N  LMQ  AD+L  PV++    E +          A+G+W++
Sbjct: 400  PSQNRFLMQCVADMLEHPVIQRDAPEASALGAAYLAGLALGVWSD 444



>gb:AE014296_1134449 Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE003476_1211748 Drosophila melanogaster
            chromosome 3L, section 10 of 83 of the complete sequence.
          Length = 406

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 59/207 (28%), Positives = 99/207 (47%), Gaps = 1/207 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            Y +EG+    G  V W + S  L  S +    +A  V  T  V+F+PAF+GL  P     
Sbjct: 209  YCIEGASHDFGTVVTWAQ-SCELFDSPANTSDIAQSVPDTNDVFFMPAFSGLGPPVNDYR 267

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            +    IG+T  T K H+ RA+LES+ F++  ++++  K+   K          ++RVDGG
Sbjct: 268  SASGFIGLTPSTTKAHMVRALLESIVFRLVQLIEAAEKETSQK--------LHMIRVDGG 319

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
             + N+ + Q  ADL    V R  + E++           +GIW +        K+ +  +
Sbjct: 320  VSRNDFVCQFLADLSRLRVERADNAESSIMGATFMAGINLGIWRDVNDLKRFRKVAR--V 377

Query: 479  FKPVIEE-EVRKKKVDSWCKAVSRTFD 402
            F+P  +E E    ++D W + ++R  D
Sbjct: 378  FEPRPKEYETIANRMDKWSRTIARFSD 404



>gb:AE014296_1134448 Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE003476_1211747 Drosophila melanogaster
            chromosome 3L, section 10 of 83 of the complete sequence.
          Length = 539

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 59/207 (28%), Positives = 99/207 (47%), Gaps = 1/207 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            Y +EG+    G  V W + S  L  S +    +A  V  T  V+F+PAF+GL  P     
Sbjct: 342  YCIEGASHDFGTVVTWAQ-SCELFDSPANTSDIAQSVPDTNDVFFMPAFSGLGPPVNDYR 400

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            +    IG+T  T K H+ RA+LES+ F++  ++++  K+   K          ++RVDGG
Sbjct: 401  SASGFIGLTPSTTKAHMVRALLESIVFRLVQLIEAAEKETSQK--------LHMIRVDGG 452

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
             + N+ + Q  ADL    V R  + E++           +GIW +        K+ +  +
Sbjct: 453  VSRNDFVCQFLADLSRLRVERADNAESSIMGATFMAGINLGIWRDVNDLKRFRKVAR--V 510

Query: 479  FKPVIEE-EVRKKKVDSWCKAVSRTFD 402
            F+P  +E E    ++D W + ++R  D
Sbjct: 511  FEPRPKEYETIANRMDKWSRTIARFSD 537



>gb:AE014296_1134447 Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE003476_1211746 Drosophila melanogaster
            chromosome 3L, section 10 of 83 of the complete
            sequence.>gb:AY060998_1292801 Drosophila melanogaster
            HL01494 full length cDNA.
          Length = 556

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 59/207 (28%), Positives = 99/207 (47%), Gaps = 1/207 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            Y +EG+    G  V W + S  L  S +    +A  V  T  V+F+PAF+GL  P     
Sbjct: 359  YCIEGASHDFGTVVTWAQ-SCELFDSPANTSDIAQSVPDTNDVFFMPAFSGLGPPVNDYR 417

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
            +    IG+T  T K H+ RA+LES+ F++  ++++  K+   K          ++RVDGG
Sbjct: 418  SASGFIGLTPSTTKAHMVRALLESIVFRLVQLIEAAEKETSQK--------LHMIRVDGG 469

Query: 659  ATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKDTI 480
             + N+ + Q  ADL    V R  + E++           +GIW +        K+ +  +
Sbjct: 470  VSRNDFVCQFLADLSRLRVERADNAESSIMGATFMAGINLGIWRDVNDLKRFRKVAR--V 527

Query: 479  FKPVIEE-EVRKKKVDSWCKAVSRTFD 402
            F+P  +E E    ++D W + ++R  D
Sbjct: 528  FEPRPKEYETIANRMDKWSRTIARFSD 554



>gb:CP000033_89726 Lactobacillus acidophilus NCFM, complete genome.
          Length = 483

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 52/146 (35%), Positives = 80/146 (54%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            +Y LEG+   AGA + WL+D+L+LI++ +E   LA           +PAF GL AP+W+ 
Sbjct: 298  SYVLEGNINYAGACITWLKDNLHLINTPNETADLALTANPEDHTILIPAFAGLGAPYWKP 357

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            D +   +G+T  T+K  + RA L S+ +Q+ D+L S  K    K  V N+     +  DG
Sbjct: 358  DMKAAFVGMTSTTSKKELVRATLNSLVYQIADIL-SEFKQLYPK--VNNE-----IHTDG 409

Query: 662  GATVNNLLMQIQADLLGSPVVRPADI 585
            G   N  LMQ  +++    +V+ ADI
Sbjct: 410  GMIHNKYLMQYLSNIT-QRIVKVADI 434



>gb:BC073246_2557098 Xenopus laevis MGC80591 protein, mRNA (cDNA clone
            MGC:80591 IMAGE:5505754), complete cds.
          Length = 479

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 47/139 (33%), Positives = 80/139 (57%)
 Frame = -3

Query: 1010 EGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDDARG 831
            EG+ +  G A++W  + LNL +S ++ E +A  V   GG+Y VP+F+GL AP     A  
Sbjct: 325  EGNASDTGTAIKWAEE-LNLFTSVADTEAMARSVPDCGGIYLVPSFSGLQAPINDPYACA 383

Query: 830  VCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATV 651
              +G+   T+K H+ RA+LES+ ++ + + D++ ++              ++R DGG + 
Sbjct: 384  SFMGLKPSTSKSHLVRAILESVAYRNKQLYDTVLRE--------TTIPITLIRADGGVSN 435

Query: 650  NNLLMQIQADLLGSPVVRP 594
            NN +MQ+ ADLLG  + +P
Sbjct: 436  NNFIMQMTADLLGQTIDKP 454



>gb:AJ719390_2501577 Gallus gallus mRNA for hypothetical protein,
            clone 1n17.
          Length = 517

 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 54/205 (26%), Positives = 103/205 (50%), Gaps = 4/205 (1%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFN-GLFAPWWRD 843
            Y  EGS +  G  ++W +D +NL ++  E  ++A  +  + GV FVP F      P+   
Sbjct: 325  YLTEGSMSNIGTTIKWAQD-INLFTNVDETAKMARSIVDSQGVCFVPGFQVSANDPY--- 380

Query: 842  DARGVC---IGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLR 672
                +C   +G+   T + H+ RA+LES+ F+ + + D + K      +         +R
Sbjct: 381  ----LCASFMGLKPTTTRNHLVRAILESVAFRNKQLFDIIVKKVRIPLQT--------VR 428

Query: 671  VDGGATVNNLLMQIQADLLGSPVVRPADIETTXXXXXXXXXXAVGIWTEDEIFSSGEKMK 492
             DGG + N+ +MQ+ +DL+   + +P++ + +          A G+WT+ E      ++ 
Sbjct: 429  ADGGVSNNSFVMQMTSDLINKKIEKPSNTDMSSLGAAFLAGLASGLWTDKEQLKKLRQI- 487

Query: 491  KDTIFKPVIEEEVRKKKVDSWCKAV 417
             +T+F+P  +E+  K  +D+W +AV
Sbjct: 488  -ETVFEPQKDEKEYKPAMDTWMRAV 511



>gb:AF496515_516411 Lactobacillus delbrueckii subsp. lactis glycerol
            kinase gene, partial cds.
          Length = 146

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 40/71 (56%), Positives = 50/71 (70%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NYALEGS  +AG+A+QWLRDS+ L++SA E EQ A + +    VY VPAF GL AP W  
Sbjct: 70   NYALEGSVFVAGSAIQWLRDSVKLLNSAPESEQAALESKDDNEVYVVPAFTGLGAPXWDS 129

Query: 842  DARGVCIGITR 810
            +ARG   G+TR
Sbjct: 130  EARGAIFGLTR 140



>gb:AE017203_404478 Lactobacillus johnsonii NCC 533, section 4 of 7 of
            the complete genome.>gb:AE017198_1122965 Lactobacillus
            johnsonii NCC 533, complete genome.
          Length = 483

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 44/135 (32%), Positives = 69/135 (51%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            +Y LEG+   AGA V WL+D L+LI   S+   LA           +PAF GL AP+W  
Sbjct: 298  SYVLEGNINYAGACVTWLKDKLHLIHDPSDTTMLALTANPNDHTILIPAFAGLGAPYWLP 357

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
            + +   + +T  T K  + RA L S+ +Q+ D+L + H  +    +V ++     +  DG
Sbjct: 358  NMKAAFVNMTATTGKKELVRATLNSLVYQINDILQAFHHFS---SQVNSE-----IHADG 409

Query: 662  GATVNNLLMQIQADL 618
            G   N  LMQ  +++
Sbjct: 410  GMIQNKYLMQYLSNI 424



>gb:AE013599_1131352 Drosophila melanogaster chromosome 2R, complete
            sequence.>gb:AE003824_1226382 Drosophila melanogaster
            chromosome 2R, section 26 of 74 of the complete sequence.
          Length = 544

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 66/234 (28%), Positives = 101/234 (43%), Gaps = 30/234 (12%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSL----------NLISSAS----EIEQLASKVEST----- 900
            NY LEG+ + AG+ V WLRD L          N++ S +    E   ++S   S+     
Sbjct: 263  NYTLEGAISNAGSTVTWLRDKLQINTEINSNDNVVESLNTFIGENSMISSSCSSSMLNAE 322

Query: 899  -------GGVYFVPAFNGLFAPWWRDDARGVCIGITRFTNKCHIARAVLESMCFQVRDVL 741
                     + FVPAF+G++AP+WR DARG+ +G+T  T   +I +A  E+  FQ+ +VL
Sbjct: 323  CGLAAKRSEITFVPAFHGMYAPYWRHDARGIILGLTSQTTAENITQAAYEATGFQIFEVL 382

Query: 740  DSMHKDAGDKGEVKNDRGEF--VLRVDGGATVNNLLMQIQADLLGSPVVRPADIETTXXX 567
             +  +D  +      DR     VL   G    N  L+Q  AD++G  + RP     T   
Sbjct: 383  QAFKRDTPNW-----DRSSMQPVLTFGGDYAENLHLVQFIADIIGYMLERP----QTTSP 433

Query: 566  XXXXXXXAVGIWTEDEIFSSGEKM--KKDTIFKPVIEEEVRKKKVDSWCKAVSR 411
                     G+  +        KM      +F P   +  R+     W  AV +
Sbjct: 434  AGLGVMITAGVTMKVVSLEHAVKMYTPPTDVFSPTTTKNRRELLYKRWAYAVKK 487



>gb:AE013599_1131351 Drosophila melanogaster chromosome 2R, complete
            sequence.>gb:AE003824_1226381 Drosophila melanogaster
            chromosome 2R, section 26 of 74 of the complete
            sequence.>gb:AY084124_1296780 Drosophila melanogaster
            RE20574 full insert cDNA.
          Length = 596

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 66/234 (28%), Positives = 101/234 (43%), Gaps = 30/234 (12%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSL----------NLISSAS----EIEQLASKVEST----- 900
            NY LEG+ + AG+ V WLRD L          N++ S +    E   ++S   S+     
Sbjct: 315  NYTLEGAISNAGSTVTWLRDKLQINTEINSNDNVVESLNTFIGENSMISSSCSSSMLNAE 374

Query: 899  -------GGVYFVPAFNGLFAPWWRDDARGVCIGITRFTNKCHIARAVLESMCFQVRDVL 741
                     + FVPAF+G++AP+WR DARG+ +G+T  T   +I +A  E+  FQ+ +VL
Sbjct: 375  CGLAAKRSEITFVPAFHGMYAPYWRHDARGIILGLTSQTTAENITQAAYEATGFQIFEVL 434

Query: 740  DSMHKDAGDKGEVKNDRGEF--VLRVDGGATVNNLLMQIQADLLGSPVVRPADIETTXXX 567
             +  +D  +      DR     VL   G    N  L+Q  AD++G  + RP     T   
Sbjct: 435  QAFKRDTPNW-----DRSSMQPVLTFGGDYAENLHLVQFIADIIGYMLERP----QTTSP 485

Query: 566  XXXXXXXAVGIWTEDEIFSSGEKM--KKDTIFKPVIEEEVRKKKVDSWCKAVSR 411
                     G+  +        KM      +F P   +  R+     W  AV +
Sbjct: 486  AGLGVMITAGVTMKVVSLEHAVKMYTPPTDVFSPTTTKNRRELLYKRWAYAVKK 539



>pir|F72377|F72377 gluconate kinase - Thermotoga maritima (strain
            MSB8)>gb:AE001722_38356 Thermotoga maritima MSB8 section
            34 of 136 of the complete genome.>gb:AE000512_1112829
            Thermotoga maritima MSB8, complete genome.
          Length = 476

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 45/141 (31%), Positives = 69/141 (48%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            NY L G+    G  + WLRD +        IE+         G+ F+P  NG  AP WR+
Sbjct: 275  NYVLGGAINNGGIVLMWLRDIMKFKDYNDIIEEAKESPAGANGLVFLPFLNGERAPHWRE 334

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
              RGV +G+T    +  IARA LE +CF+++D+    H      G V  +R    +   G
Sbjct: 335  RYRGVLVGLTSSHRRSDIARAALEGICFRIKDI----HNAVKRVGSVDPNR----IVATG 386

Query: 662  GATVNNLLMQIQADLLGSPVV 600
            G T +   +Q+ +D+LG  ++
Sbjct: 387  GFTSSPYWVQLLSDVLGKDII 407



>gb:U88181_1406702 Caenorhabditis elegans cosmid C55B6, complete
            sequence.
          Length = 299

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 63/208 (30%), Positives = 97/208 (46%), Gaps = 4/208 (1%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            ++  EG+       + W + S+ L +  +E   +A  V  + GV F+PAF G+  P   +
Sbjct: 99   DFIAEGNAHDTAVILHWAQ-SIGLFNDVTETSDIALSVNDSNGVVFIPAFCGIQTPINDE 157

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             A    + I   T K H+ RA+LES+ F+V  +       A  + EV  ++   V R+ G
Sbjct: 158  TACSGFMCIRPDTTKVHMVRAILESIAFRVYQIY------AAAESEVNINKNSPV-RICG 210

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIE-TTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKD 486
            G + NN + Q  ADLLG  V R  D +             + GIWT++++    E +  +
Sbjct: 211  GVSNNNFICQCIADLLGRKVERMTDSDHVAARGVALLTGFSSGIWTKEKL---RELVTVE 267

Query: 485  TIFKPVIEEEVRK---KKVDSWCKAVSR 411
             IF P    E RK   K   +W KAV R
Sbjct: 268  DIFTP--NYESRKGLLKTFQTWKKAVDR 293



>gb:U88181_1406701 Caenorhabditis elegans cosmid C55B6, complete
            sequence.
          Length = 523

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 63/208 (30%), Positives = 97/208 (46%), Gaps = 4/208 (1%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            ++  EG+       + W + S+ L +  +E   +A  V  + GV F+PAF G+  P   +
Sbjct: 323  DFIAEGNAHDTAVILHWAQ-SIGLFNDVTETSDIALSVNDSNGVVFIPAFCGIQTPINDE 381

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             A    + I   T K H+ RA+LES+ F+V  +       A  + EV  ++   V R+ G
Sbjct: 382  TACSGFMCIRPDTTKVHMVRAILESIAFRVYQIY------AAAESEVNINKNSPV-RICG 434

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIE-TTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKD 486
            G + NN + Q  ADLLG  V R  D +             + GIWT++++    E +  +
Sbjct: 435  GVSNNNFICQCIADLLGRKVERMTDSDHVAARGVALLTGFSSGIWTKEKL---RELVTVE 491

Query: 485  TIFKPVIEEEVRK---KKVDSWCKAVSR 411
             IF P    E RK   K   +W KAV R
Sbjct: 492  DIFTP--NYESRKGLLKTFQTWKKAVDR 517



>pir|T25663|T25663 hypothetical protein C55B6.1 - Caenorhabditis
            elegans
          Length = 504

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 63/208 (30%), Positives = 97/208 (46%), Gaps = 4/208 (1%)
 Frame = -3

Query: 1022 NYALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRD 843
            ++  EG+       + W + S+ L +  +E   +A  V  + GV F+PAF G+  P   +
Sbjct: 304  DFIAEGNAHDTAVILHWAQ-SIGLFNDVTETSDIALSVNDSNGVVFIPAFCGIQTPINDE 362

Query: 842  DARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDG 663
             A    + I   T K H+ RA+LES+ F+V  +       A  + EV  ++   V R+ G
Sbjct: 363  TACSGFMCIRPDTTKVHMVRAILESIAFRVYQIY------AAAESEVNINKNSPV-RICG 415

Query: 662  GATVNNLLMQIQADLLGSPVVRPADIE-TTXXXXXXXXXXAVGIWTEDEIFSSGEKMKKD 486
            G + NN + Q  ADLLG  V R  D +             + GIWT++++    E +  +
Sbjct: 416  GVSNNNFICQCIADLLGRKVERMTDSDHVAARGVALLTGFSSGIWTKEKL---RELVTVE 472

Query: 485  TIFKPVIEEEVRK---KKVDSWCKAVSR 411
             IF P    E RK   K   +W KAV R
Sbjct: 473  DIFTP--NYESRKGLLKTFQTWKKAVDR 498



>pir|AB1204|AB1204 glycerol kinase homolog lmo1034 [imported] -
            Listeria monocytogenes (strain EGD-e)>gb:AL591977_535525
            Listeria monocytogenes strain EGD, complete genome,
            segment 5/12.
          Length = 487

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 51/145 (35%), Positives = 73/145 (50%), Gaps = 1/145 (0%)
 Frame = -3

Query: 1019 YALEGSXAIAGAAVQWLRDSLNLISSASEIEQLASKVESTGGVYFVPAFNGLFAPWWRDD 840
            +ALEG     G  + +L + L L +      + A ++    GV  +P   GL AP+W  D
Sbjct: 292  FALEGIIRSCGDTLVFLSEQLELFNDYDTACKRAFQLPCNEGVVLIPGQLGLGAPYWNTD 351

Query: 839  ARGVCIGITRFTNKCHIARAVLESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGG 660
             R   +G+TR   K HI RA   S+ FQ++ V+D M    G    +K       L+VDGG
Sbjct: 352  IRAEILGLTREHTKWHIIRAGFTSIAFQIKAVIDQMELMIGQ--NIKR------LQVDGG 403

Query: 659  ATVNNLLMQIQADLLGSPV-VRPAD 588
             T  + LMQ  AD+L + V V PA+
Sbjct: 404  LTKQHELMQYLADVLKAEVAVSPAE 428


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,033,422,266
Number of Sequences: 1806583
Number of extensions: 21277377
Number of successful extensions: 56568
Number of sequences better than 10.0: 392
Number of HSP's better than 10.0 without gapping: 53933
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 56125
length of database: 581,917,975
effective HSP length: 125
effective length of database: 356,095,100
effective search space used: 76560446500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)