BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig9195
         (1143 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:MSA319713_1687033 Medicago sativa subsp. falcata mRNA for Mob...   374   e-102   
gb:AC146468_1744543 Oryza sativa (japonica cultivar-group) chrom...   359   7e-98   
gb:AY303170_1597389 Solanum bulbocastanum chromosome 8 clone CB3...   358   1e-97   
gb:AB018113_1513804 Arabidopsis thaliana genomic DNA, chromosome...   356   6e-97   
gb:BT006214_1639106 Arabidopsis thaliana At4g19050 gene, complet...   352   6e-96   
gb:AY303171_1597417 Solanum bulbocastanum chromosome 8 clone 177...   352   6e-96   
gb:AE016959_1022420 Oryza sativa (japonica cultivar-group) chrom...   349   7e-95   
pir|T04426|T04426 hypothetical protein T18B16.20 - Arabidopsis t...   346   4e-94   Arabidopsis thaliana [mouse-ear cress]
gb:AC113433_1739060 Oryza sativa chromosome 3 BAC OSJNBb0108E08 ...   343   3e-93   
gb:AC147962_1744806 Oryza sativa chromosome 3 BAC OSJNBa0083K01 ...   327   2e-88   
gb:CAR299394_1645241 Cicer arietinum partial mRNA for hypothetic...   327   4e-88   
gb:AX880375_1478252 Sequence 15280 from Patent EP1074617.>gb:AK0...   308   2e-82   
gb:CR859077_1183215 Pongo pygmaeus mRNA; cDNA DKFZp469J052 (from...   306   5e-82   
gb:BC045952_2549466 Danio rerio zgc:56156, mRNA (cDNA clone MGC:...   305   9e-82   
gb:AK077320_1171799 Mus musculus adult male pituitary gland cDNA...   304   2e-81   
gb:AX877202_1476885 Sequence 12107 from Patent EP1074617.>gb:AK0...   303   3e-81   
gb:AY647429_2541528 Xenopus laevis kinase regulatory subunit MOB...   303   6e-81   
gb:AY319763_2526694 Xenopus laevis MOB1 (MOB1) mRNA, complete cd...   303   6e-81   
gb:AK028416_1160981 Mus musculus 15 days embryo head cDNA, RIKEN...   301   2e-80   
gb:AY398317_2531847 Danio rerio clone RK143A1D09 chromosome 2 op...   300   4e-80   
gb:BC066567_2554442 Danio rerio zgc:56189, mRNA (cDNA clone MGC:...   297   2e-79   
gb:BC045979_2549491 Danio rerio zgc:56189, mRNA (cDNA clone MGC:...   295   2e-78   
gb:AE014297_1140804 Drosophila melanogaster chromosome 3R, compl...   295   2e-78   
gb:AJ635581_1813354 Medicago sativa subsp. falcata mRNA for Mob1...   246   8e-64   
sp|O94360|MOB1_SCHPO|MOB1_SCHPO Maintenance of ploidy protein mob1.>pir|T40...   234   2e-60   Schizosaccharomyces pombe
gb:CR382130_1662659 Yarrowia lipolytica chromosome D of strain C...   230   5e-59   
gb:AY046920_1289412 Trypanosoma brucei cell cycle associated pro...   229   6e-59   
gb:AE017348_1758309 Cryptococcus neoformans var. neoformans JEC2...   224   3e-57   
gb:BC084470_2563844 Xenopus tropicalis hypothetical LOC496492, m...   222   1e-56   
gb:AY046919_1289411 Trypanosoma brucei cell cycle associated pro...   221   2e-56   
gb:BC072711_2556641 Danio rerio zgc:92408, mRNA (cDNA clone MGC:...   219   6e-56   
gb:BC015049_1974928 Homo sapiens MOB1, Mps One Binder kinase act...   219   1e-55   
gb:AK030481_1162026 Mus musculus adult male pituitary gland cDNA...   219   1e-55   
gb:AX880331_1478231 Sequence 15236 from Patent EP1074617.>gb:AK0...   218   1e-55   
gb:AK039841_1165511 Mus musculus 0 day neonate thymus cDNA, RIKE...   218   1e-55   
gb:AC005328_1874922 Homo sapiens chromosome 19, cosmid R26660, c...   217   3e-55   
gb:CR860711_1184765 Pongo pygmaeus mRNA; cDNA DKFZp459M1427 (fro...   217   3e-55   
gb:HSM803881_2017726 Homo sapiens mRNA; cDNA DKFZp451A0116 (from...   216   7e-55   
gb:BC033027_1980759 Homo sapiens MOB1, Mps One Binder kinase act...   216   7e-55   
gb:AK084014_1174148 Mus musculus 12 days embryo spinal ganglion ...   216   9e-55   
gb:AE014134_1128530 Drosophila melanogaster chromosome 2L, compl...   215   2e-54   
gb:BT020665_1436023 Bos taurus MOB1, Mps One Binder kinase activ...   214   2e-54   
gb:HSA580637_2009766 Homo sapiens mRNA for Mob3C protein (MOB3C ...   214   3e-54   
gb:AL136373_1919153 Human DNA sequence from clone RP11-49P4 on c...   214   3e-54   
gb:AL136373_1919152 Human DNA sequence from clone RP11-49P4 on c...   214   3e-54   
gb:AK090453_1913250 Homo sapiens mRNA for FLJ00374 protein.           214   3e-54   
gb:BC073205_2557059 Xenopus laevis MGC80478 protein, mRNA (cDNA ...   213   4e-54   
gb:BC067183_2554655 Danio rerio zgc:77552, mRNA (cDNA clone MGC:...   213   8e-54   
gb:BC049527_2550323 Danio rerio zgc:77552, mRNA (cDNA clone MGC:...   211   2e-53   
gb:AX878562_1477481 Sequence 13467 from Patent EP1074617.>gb:AK0...   206   7e-52   
pir|T49581|T49581 probable MOB1 protein [imported] - Neurospora ...   205   2e-51   Neurospora crassa
sp|Q9P601|MOB1_NEUCR|MOB1_NEUCR Probable maintenance of ploidy protein mob1...   204   2e-51   
pir|T33987|T33987 hypothetical protein T12B3.4 - Caenorhabditis ...   202   8e-51   Caenorhabditis elegans [roundworm]
gb:CR382126_1658516 Kluyveromyces lactis strain NRRL Y-1140 chro...   199   1e-49   
gb:CR382133_1666556 Debaryomyces hansenii chromosome A of strain...   196   1e-48   
gb:AE016817_1747148 Ashbya gossypii (= Eremothecium gossypii) AT...   192   1e-47   
pir|S48466|S48466 MOB1 protein [validated] - yeast (Saccharomyce...   187   4e-46   Saccharomyces cerevisiae [brewer's yeast]
sp|P40484|MOB1_YEAST|MOB1_YEAST Maintenance of ploidy protein MOB1 (MPS1 bi...   187   4e-46   Saccharomyces cerevisiae [brewer's yeast]
gb:CR380953_1650738 Candida glabrata strain CBS138 chromosome G ...   182   1e-44   
gb:CEF38H4_1363651 Caenorhabditis elegans cosmid F38H4, complete...   169   1e-40   
sp|O74558|MOB2_SCHPO|MOB2_SCHPO Probable maintenance of ploidy protein mob2...   166   6e-40   Schizosaccharomyces pombe
gb:CR382127_1660165 Yarrowia lipolytica chromosome A of strain C...   163   5e-39   
gb:AE017346_1757335 Cryptococcus neoformans var. neoformans JEC2...   162   9e-39   
pir|S58648|S58648 hypothetical protein YFL034c-b - yeast (Saccha...   159   8e-38   Saccharomyces cerevisiae [brewer's yeast]
sp|P43563|MOB2_YEAST|MOB2_YEAST Maintenance of ploidy protein MOB2 (MPS1 bi...   159   8e-38   Saccharomyces cerevisiae [brewer's yeast]
gb:BC076047_2558929 Danio rerio zgc:92512, mRNA (cDNA clone MGC:...   158   2e-37   
gb:CR382124_1656556 Kluyveromyces lactis strain NRRL Y-1140 chro...   158   2e-37   
gb:CR382136_1668991 Debaryomyces hansenii chromosome D of strain...   157   5e-37   
gb:CR380957_1653053 Candida glabrata strain CBS138 chromosome K ...   154   2e-36   
gb:BC047291_1983818 Homo sapiens HCCA2 protein, mRNA (cDNA clone...   154   3e-36   
gb:AF228503_2059956 Mus musculus ovary-specific MOB-like protein...   152   1e-35   
gb:AK091808_1913568 Homo sapiens cDNA FLJ34489 fis, clone HLUNG2...   150   5e-35   
gb:AE016816_1746913 Ashbya gossypii (= Eremothecium gossypii) AT...   149   8e-35   
gb:BC061432_2553206 Xenopus tropicalis hypothetical protein MGC7...   145   2e-33   
gb:AK087285_1174889 Mus musculus 0 day neonate lung cDNA, RIKEN ...   145   2e-33   
gb:BC070585_2555564 Xenopus laevis cDNA clone MGC:81135 IMAGE:63...   144   3e-33   
gb:AX400015_1467328 Sequence 186 from Patent WO0218424.               144   3e-33   
gb:BC081182_2562084 Xenopus laevis MGC84379 protein, mRNA (cDNA ...   144   3e-33   
gb:AB061793_1868793 Homo sapiens moblak mRNA for MOB-LAK, comple...   144   3e-33   
gb:AE014296_1135842 Drosophila melanogaster chromosome 3L, compl...   140   5e-32   
gb:BT001864_1356637 Drosophila melanogaster RH70633 full insert ...   139   8e-32   
gb:AE014296_1135841 Drosophila melanogaster chromosome 3L, compl...   139   8e-32   
gb:AE014296_1135840 Drosophila melanogaster chromosome 3L, compl...   139   8e-32   
gb:AE014296_1135839 Drosophila melanogaster chromosome 3L, compl...   139   8e-32   
gb:AP005847_1859010 Oryza sativa (japonica cultivar-group) genom...   138   2e-31   
gb:BC082348_2562585 Xenopus tropicalis MGC79814 protein, mRNA (c...   127   3e-28   
pir|T21979|T21979 hypothetical protein F38H4.10 - Caenorhabditis...   125   2e-27   Caenorhabditis elegans [roundworm]
gb:AK028695_1161113 Mus musculus 10 days neonate skin cDNA, RIKE...   104   3e-21   
gb:AK012535_1157014 Mus musculus 11 days embryo whole body cDNA,...   104   4e-21   
gb:AK057350_1911994 Homo sapiens cDNA FLJ32788 fis, clone TESTI2...    90   1e-16   
gb:CEF09A5_1362109 Caenorhabditis elegans cosmid F09A5, complete...    87   5e-16   
gb:CEF09A5_1362107 Caenorhabditis elegans cosmid F09A5, complete...    87   5e-16   
gb:CEF09A5_1362105 Caenorhabditis elegans cosmid F09A5, complete...    87   5e-16   
pir|T20626|T20626 hypothetical protein F09A5.4b - Caenorhabditis...    87   5e-16   Caenorhabditis elegans [roundworm]
pir|T20627|T20627 hypothetical protein F09A5.4a - Caenorhabditis...    87   5e-16   Caenorhabditis elegans [roundworm]
gb:CR859744_1183847 Pongo pygmaeus mRNA; cDNA DKFZp468D176 (from...    59   2e-07   
gb:BC076155_2559029 Danio rerio zgc:92671, mRNA (cDNA clone MGC:...    52   2e-05   
gb:AE013599_1130268 Drosophila melanogaster chromosome 2R, compl...    52   3e-05   
gb:AF250319_1892957 Homo sapiens CGI95-iso mRNA, complete cds.         50   9e-05   
gb:AF093825_1882719 Homo sapiens 2C4D mRNA, complete cds.              50   9e-05   
gb:AB015441_1864722 Homo sapiens mRNA for Mob3, complete cds.>gb...    50   9e-05   
gb:CR858003_1182194 Pongo pygmaeus mRNA; cDNA DKFZp468L107 (from...    50   9e-05   
gb:AK027043_1910789 Homo sapiens cDNA: FLJ23390 fis, clone HEP17...    49   1e-04   
gb:BC088913_2565965 Xenopus laevis hypothetical LOC496323, mRNA ...    49   2e-04   
pir|S44776|S44776 C30A5 protein - Caenorhabditis elegans               47   6e-04   Caenorhabditis elegans [roundworm]
sp|P34349|YK83_CAEEL|YK83_CAEEL Hypothetical protein C30A5.3 in chromosome ...    47   6e-04   Caenorhabditis elegans [roundworm]
gb:AK020446_1160430 Mus musculus 12 days embryo embryonic body b...    47   7e-04   
gb:CR627409_1180780 Homo sapiens mRNA; cDNA DKFZp686N2312 (from ...    41   0.040   
gb:AE017350_1759002 Cryptococcus neoformans var. neoformans JEC2...    39   0.26    
pir|T12466|T12466 hypothetical protein DKFZp564M112.1 - human>gb...    35   2.2     Homo sapiens [man]
sp|Q03214|YM42_YEAST|YM42_YEAST Hypothetical 162.7 kDa protein in SIP18-SPT...    35   3.7     Saccharomyces cerevisiae [brewer's yeast]
gb:AX886153_1481606 Sequence 2016 from Patent EP1033401.               33   8.2     
gb:AY231687_1176980 Drosophila yakuba clone yak-em_CG8707 mRNA s...    33   8.2     
gb:AK034840_1163894 Mus musculus 12 days embryo embryonic body b...    33   8.2     


>gb:MSA319713_1687033 Medicago sativa subsp. falcata mRNA for
           Mob1-like protein (mob1 gene), allele
           wild-type.>gb:AJ635582_1813355 Medicago sativa subsp.
           falcata mob1 gene for Mob1-like protein, exons 1-3,
           allele wild-type.
          Length = 215

 Score =  374 bits (959), Expect = e-102
 Identities = 174/215 (80%), Positives = 193/215 (89%)
 Frame = -3

Query: 796 MSLLGLASRNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAV 617
           MSL GL SRNQKTF PKKS P G+KG  LQKHIDATLGSGNLREAV LP GED+NEWLAV
Sbjct: 1   MSLFGLGSRNQKTFRPKKSAPTGSKGAQLQKHIDATLGSGNLREAVKLPPGEDINEWLAV 60

Query: 616 NTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLM 437
           NTVDFFNQVN ++GTLTEFCTPS+CP MTAGPKYE  WADGVTIKKPI+VSAPKYV+YLM
Sbjct: 61  NTVDFFNQVNTMFGTLTEFCTPSNCPTMTAGPKYEYRWADGVTIKKPIEVSAPKYVEYLM 120

Query: 436 DWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHL 257
           DWIE QLDDE+IFPQ+ GAPFPPNF DVVKTI KRLFRVYAH+YHSHFQKI+ LKEEAHL
Sbjct: 121 DWIESQLDDETIFPQRLGAPFPPNFRDVVKTIFKRLFRVYAHVYHSHFQKIVSLKEEAHL 180

Query: 256 NTCFKHFVMFSWEFHLIDKNGVAPLYEIVESILQL 152
           NTCFKHFV+F+WEF LI+K  +APL ++V+SI+QL
Sbjct: 181 NTCFKHFVLFTWEFRLIEKAELAPLEDLVDSIIQL 215



>gb:AC146468_1744543 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBa0008D12 map MAP_LOC, complete
           sequence.
          Length = 214

 Score =  359 bits (921), Expect = 7e-98
 Identities = 171/213 (80%), Positives = 187/213 (87%)
 Frame = -3

Query: 796 MSLLGLASRNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAV 617
           MSL GL  RNQKTF PKKS P G+KG  L+KHIDATLGSGNLREAV LP GED+NEWLAV
Sbjct: 1   MSLFGLG-RNQKTFRPKKSAPSGSKGAQLRKHIDATLGSGNLREAVRLPPGEDINEWLAV 59

Query: 616 NTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLM 437
           NTVDFFNQVN+LYGTL EFCTP SCP MTAGPKYE  WADGV IKKPI+VSAPKYV+YLM
Sbjct: 60  NTVDFFNQVNLLYGTLAEFCTPESCPTMTAGPKYEYRWADGVQIKKPIEVSAPKYVEYLM 119

Query: 436 DWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHL 257
           DWIE QLDDESIFPQK G PFPPNF++VVKTI KRLFRVYAHIYHSHFQKI+ LKEEAHL
Sbjct: 120 DWIEGQLDDESIFPQKLGTPFPPNFKEVVKTIFKRLFRVYAHIYHSHFQKIVSLKEEAHL 179

Query: 256 NTCFKHFVMFSWEFHLIDKNGVAPLYEIVESIL 158
           NTCFKHF++F+ EF LIDK  +APL E++ESI+
Sbjct: 180 NTCFKHFILFTTEFGLIDKKELAPLQELIESII 212



>gb:AY303170_1597389 Solanum bulbocastanum chromosome 8 clone
           CB3A14, complete sequence.
          Length = 215

 Score =  358 bits (918), Expect = 1e-97
 Identities = 170/213 (79%), Positives = 188/213 (88%)
 Frame = -3

Query: 796 MSLLGLASRNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAV 617
           MSL GL  RNQ+TF PKKS P G+KG  L+KHIDATLGSGNLREAV LP GED+NEWLAV
Sbjct: 1   MSLFGLG-RNQRTFRPKKSAPSGSKGAQLRKHIDATLGSGNLREAVRLPPGEDINEWLAV 59

Query: 616 NTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLM 437
           NTVDFFNQVN+LYGTLTEFCTP +CP MTAGPKYE  WADGV IKKPI+VSAPKYV+YLM
Sbjct: 60  NTVDFFNQVNLLYGTLTEFCTPENCPTMTAGPKYEYRWADGVQIKKPIEVSAPKYVEYLM 119

Query: 436 DWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHL 257
           DWIE QLDDES+FPQ+ GAPFP NF+DVVKTI KRLFRVYAHIYHSHFQKI+ LKEEAHL
Sbjct: 120 DWIETQLDDESLFPQRLGAPFPSNFKDVVKTIFKRLFRVYAHIYHSHFQKIVSLKEEAHL 179

Query: 256 NTCFKHFVMFSWEFHLIDKNGVAPLYEIVESIL 158
           NTCFKHF++F+ EF LIDK  +APL EI+ESI+
Sbjct: 180 NTCFKHFILFTHEFGLIDKKELAPLQEIIESII 212



>gb:AB018113_1513804 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MFC19.>gb:AY045864_1561373 Arabidopsis thaliana
           unknown protein (At5g45550) mRNA, complete
           cds.>gb:AY086730_1571773 Arabidopsis thaliana clone
           27099 mRNA, complete sequence.>gb:AY117158_1579199
           Arabidopsis thaliana unknown protein (At5g45550) mRNA,
           complete cds.
          Length = 215

 Score =  356 bits (913), Expect = 6e-97
 Identities = 169/213 (79%), Positives = 187/213 (87%)
 Frame = -3

Query: 796 MSLLGLASRNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAV 617
           MSL GL  RNQKTF PKKS P G+KG  L+KHIDATLGSGNLREAV LP GED NEWLAV
Sbjct: 1   MSLFGLG-RNQKTFRPKKSAPSGSKGAQLRKHIDATLGSGNLREAVRLPPGEDANEWLAV 59

Query: 616 NTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLM 437
           NTVDFFNQVN+LYGTLTEFCTP +CP MTAGPKYE  WADGV IKKPI+VSAPKYV+YLM
Sbjct: 60  NTVDFFNQVNLLYGTLTEFCTPDNCPTMTAGPKYEYRWADGVQIKKPIEVSAPKYVEYLM 119

Query: 436 DWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHL 257
           DWIE QLDDE++FPQ+ GAPFP NF+DVVKTI KRLFRVYAHIYHSHFQKI+ LKEEAHL
Sbjct: 120 DWIETQLDDETLFPQRLGAPFPQNFKDVVKTIFKRLFRVYAHIYHSHFQKIVSLKEEAHL 179

Query: 256 NTCFKHFVMFSWEFHLIDKNGVAPLYEIVESIL 158
           NTCFKHF++F+ EF LIDK  +APL E++ESI+
Sbjct: 180 NTCFKHFILFTHEFGLIDKKELAPLQELIESII 212



>gb:BT006214_1639106 Arabidopsis thaliana At4g19050 gene, complete
           cds.>gb:AK117341_1815380 Arabidopsis thaliana At4g19050
           mRNA for unknown protein, complete cds, clone:
           RAFL16-90-M13.
          Length = 215

 Score =  352 bits (904), Expect = 6e-96
 Identities = 169/213 (79%), Positives = 186/213 (87%)
 Frame = -3

Query: 796 MSLLGLASRNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAV 617
           MSL GL  RNQKTF PKKS P G KG  L+KHIDATLGSGNLREAV LP GEDLNEWLAV
Sbjct: 1   MSLFGLG-RNQKTFRPKKSAPSGTKGAELRKHIDATLGSGNLREAVKLPPGEDLNEWLAV 59

Query: 616 NTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLM 437
           NTVDFFNQVN+L+GTLTEFCTP +C  MTAGPKYE  WADGV IKKPI+VSAPKYV+YLM
Sbjct: 60  NTVDFFNQVNLLFGTLTEFCTPENCSTMTAGPKYEYRWADGVQIKKPIEVSAPKYVEYLM 119

Query: 436 DWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHL 257
           DWIE QLDDE+IFPQK GA FPPNF++VVKTI KRLFRVYAHIYHSHFQKI+ LKEEAHL
Sbjct: 120 DWIETQLDDETIFPQKLGAAFPPNFKEVVKTIFKRLFRVYAHIYHSHFQKIVSLKEEAHL 179

Query: 256 NTCFKHFVMFSWEFHLIDKNGVAPLYEIVESIL 158
           NTCFKHF++F+ EF LIDK  +APL E++ESI+
Sbjct: 180 NTCFKHFILFTHEFVLIDKKELAPLQELIESII 212



>gb:AY303171_1597417 Solanum bulbocastanum chromosome 8 clone
           177O13, complete sequence.
          Length = 218

 Score =  352 bits (904), Expect = 6e-96
 Identities = 170/216 (78%), Positives = 188/216 (87%), Gaps = 3/216 (1%)
 Frame = -3

Query: 796 MSLLGLASRNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAV 617
           MSL GL  RNQ+TF PKKS P G+KG  L+KHIDATLGSGNLREAV LP GED+NEWLAV
Sbjct: 1   MSLFGLG-RNQRTFRPKKSAPSGSKGAQLRKHIDATLGSGNLREAVRLPPGEDINEWLAV 59

Query: 616 NTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKY---ECLWADGVTIKKPIKVSAPKYVD 446
           NTVDFFNQVN+LYGTLTEFCTP +CP MTAGPKY   E  WADGV IKKPI+VSAPKYV+
Sbjct: 60  NTVDFFNQVNLLYGTLTEFCTPENCPTMTAGPKYVQYEYRWADGVQIKKPIEVSAPKYVE 119

Query: 445 YLMDWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEE 266
           YLMDWIE QLDDES+FPQ+ GAPFP NF+DVVKTI KRLFRVYAHIYHSHFQKI+ LKEE
Sbjct: 120 YLMDWIETQLDDESLFPQRLGAPFPSNFKDVVKTIFKRLFRVYAHIYHSHFQKIVSLKEE 179

Query: 265 AHLNTCFKHFVMFSWEFHLIDKNGVAPLYEIVESIL 158
           AHLNTCFKHF++F+ EF LIDK  +APL EI+ESI+
Sbjct: 180 AHLNTCFKHFILFTHEFGLIDKKELAPLQEIIESII 215



>gb:AE016959_1022420 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC108884_1738679 Oryza sativa
            (japonica cultivar-group) cultivar Nipponbare clone
            OSJNBb0058B20 from chromosome 10, complete
            sequence.>gb:AC122144_1740254 Oryza sativa (japonica
            cultivar-group) chromosome 10 clone OSJNAa0011L09,
            complete sequence.>gb:AE017090_1752239 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 44 of 77
            of the complete sequence.
          Length = 1152

 Score =  349 bits (895), Expect = 7e-95
 Identities = 161/208 (77%), Positives = 183/208 (87%)
 Frame = -3

Query: 775  SRNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFN 596
            +RNQKTF PKK+ P GNKG  L+KHIDATLGSGNLR+AV LP GEDLNEWLAVNTVDFFN
Sbjct: 944  TRNQKTFRPKKNAPSGNKGVQLKKHIDATLGSGNLRDAVRLPPGEDLNEWLAVNTVDFFN 1003

Query: 595  QVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQL 416
            QVNILYGTL EFCTP++CP M+AGPK+E  WADG+ IKKPI+VSAPKYV+YLMDWIE QL
Sbjct: 1004 QVNILYGTLMEFCTPTTCPTMSAGPKFEYRWADGIQIKKPIEVSAPKYVEYLMDWIEVQL 1063

Query: 415  DDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHF 236
            DDESIFPQK G PFP NF +VVKTI KRLFRVYAHIYH+HFQKI+ LKEEAHLNTCFKHF
Sbjct: 1064 DDESIFPQKLGTPFPQNFREVVKTIFKRLFRVYAHIYHTHFQKIVSLKEEAHLNTCFKHF 1123

Query: 235  VMFSWEFHLIDKNGVAPLYEIVESILQL 152
             +F+WEF LIDK  +APL +++ESI+ +
Sbjct: 1124 TLFTWEFKLIDKAELAPLIDLIESIVSV 1151



>pir|T04426|T04426 hypothetical protein T18B16.20 - Arabidopsis
            thaliana>gb:ATCHRIV50_1545745 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 50.>gb:ATF13C5_1548426
            Arabidopsis thaliana DNA chromosome 4, BAC clone F13C5
            (ESSA project).
          Length = 1405

 Score =  346 bits (888), Expect = 4e-94
 Identities = 163/204 (79%), Positives = 180/204 (88%)
 Frame = -3

Query: 769  NQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQV 590
            NQKTF PKKS P G KG  L+KHIDATLGSGNLREAV LP GEDLNEWLAVNTVDFFNQV
Sbjct: 1199 NQKTFRPKKSAPSGTKGAELRKHIDATLGSGNLREAVKLPPGEDLNEWLAVNTVDFFNQV 1258

Query: 589  NILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDD 410
            N+L+GTLTEFCTP +C  MTAGPKYE  WADGV IKKPI+VSAPKYV+YLMDWIE QLDD
Sbjct: 1259 NLLFGTLTEFCTPENCSTMTAGPKYEYRWADGVQIKKPIEVSAPKYVEYLMDWIETQLDD 1318

Query: 409  ESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVM 230
            E+IFPQK GA FPPNF++VVKTI KRLFRVYAHIYHSHFQKI+ LKEEAHLNTCFKHF++
Sbjct: 1319 ETIFPQKLGAAFPPNFKEVVKTIFKRLFRVYAHIYHSHFQKIVSLKEEAHLNTCFKHFIL 1378

Query: 229  FSWEFHLIDKNGVAPLYEIVESIL 158
            F+ EF LIDK  +APL E++ESI+
Sbjct: 1379 FTHEFVLIDKKELAPLQELIESII 1402



>gb:AC113433_1739060 Oryza sativa chromosome 3 BAC OSJNBb0108E08
           genomic sequence, complete sequence.
          Length = 217

 Score =  343 bits (881), Expect = 3e-93
 Identities = 158/213 (74%), Positives = 186/213 (87%)
 Frame = -3

Query: 796 MSLLGLASRNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAV 617
           MSL G +SR+Q TF PKKS P G+KG  L+KHIDATLGSGNLREAV LP GEDLNEWLAV
Sbjct: 1   MSLFGRSSRSQLTFRPKKSSPSGSKGLPLKKHIDATLGSGNLREAVRLPIGEDLNEWLAV 60

Query: 616 NTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLM 437
           NTVDFFNQVN LYGTL EFCT S+CP+M+AGPKYE  WADG+ +KKP++VSAPKYV+YLM
Sbjct: 61  NTVDFFNQVNFLYGTLMEFCTSSTCPIMSAGPKYEYRWADGMKVKKPVQVSAPKYVEYLM 120

Query: 436 DWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHL 257
           DW+E QLDDE+IFPQK GAPFP NF +V++TI KRLFRVY+H+YHSHFQ I+ LKEEAHL
Sbjct: 121 DWVESQLDDEAIFPQKIGAPFPQNFREVIRTIFKRLFRVYSHMYHSHFQMILKLKEEAHL 180

Query: 256 NTCFKHFVMFSWEFHLIDKNGVAPLYEIVESIL 158
           +TCFKHFV+F+WEFHLID+  +APL E++E I+
Sbjct: 181 STCFKHFVLFTWEFHLIDRAELAPLNELIEPIV 213



>gb:AC147962_1744806 Oryza sativa chromosome 3 BAC OSJNBa0083K01
           genomic sequence, complete sequence.
          Length = 190

 Score =  327 bits (839), Expect = 2e-88
 Identities = 153/188 (81%), Positives = 168/188 (89%)
 Frame = -3

Query: 721 GELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSC 542
           G  L+KHIDATLGSGNLREAV LP GED+NEWLAVNTVDFFNQVN+LYGTL EFCTP SC
Sbjct: 1   GAQLRKHIDATLGSGNLREAVRLPPGEDINEWLAVNTVDFFNQVNLLYGTLAEFCTPESC 60

Query: 541 PMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNF 362
           P MTAGPKYE  WADGV IKKPI+VSAPKYV+YLMDWIE QLDDESIFPQK G PFPPNF
Sbjct: 61  PTMTAGPKYEYRWADGVQIKKPIEVSAPKYVEYLMDWIEGQLDDESIFPQKLGTPFPPNF 120

Query: 361 EDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDKNGVAPL 182
           ++VVKTI KRLFRVYAHIYHSHFQKI+ LKEEAHLNTCFKHF++F+ EF LIDK  +APL
Sbjct: 121 KEVVKTIFKRLFRVYAHIYHSHFQKIVSLKEEAHLNTCFKHFILFTTEFGLIDKKELAPL 180

Query: 181 YEIVESIL 158
            E++ESI+
Sbjct: 181 QELIESII 188



>gb:CAR299394_1645241 Cicer arietinum partial mRNA for hypothetical
           protein (ORF), clone Can173-1.
          Length = 191

 Score =  327 bits (837), Expect = 4e-88
 Identities = 152/190 (80%), Positives = 171/190 (90%)
 Frame = -3

Query: 727 NKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPS 548
           +KG  L+KHIDATLGSGNLREAV LP GEDLNEWLAVNTVDFFNQVN+LYGTLTEFCTP 
Sbjct: 1   SKGAQLRKHIDATLGSGNLREAVKLPPGEDLNEWLAVNTVDFFNQVNLLYGTLTEFCTPE 60

Query: 547 SCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPP 368
           +C  M+AGPKYE  WADGV IKKPI+VSAPKYV+YLMDWIE QLDDESIFPQ+ G+PFPP
Sbjct: 61  NCRTMSAGPKYEYRWADGVQIKKPIEVSAPKYVEYLMDWIESQLDDESIFPQRLGSPFPP 120

Query: 367 NFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDKNGVA 188
           NF+DVVKTI KRLFRVYAHIYHSHFQKI+ LKEEAHLNTCFKHF++F+ EF LIDK  +A
Sbjct: 121 NFKDVVKTIFKRLFRVYAHIYHSHFQKIVSLKEEAHLNTCFKHFILFTCEFGLIDKKELA 180

Query: 187 PLYEIVESIL 158
           PL E++E+I+
Sbjct: 181 PLQELIETII 190



>gb:AX880375_1478252 Sequence 15280 from Patent
           EP1074617.>gb:AK023321_1909592 Homo sapiens cDNA
           FLJ13259 fis, clone OVARC1000876, moderately similar to
           MOB1 PROTEIN.
          Length = 216

 Score =  308 bits (788), Expect = 2e-82
 Identities = 141/212 (66%), Positives = 173/212 (81%)
 Frame = -3

Query: 796 MSLLGLASRNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAV 617
           MS L L+SR+ KTF PKK++P G+    L KH +ATLGSGNLR+AV+LP GEDLNEW+AV
Sbjct: 1   MSFL-LSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAV 59

Query: 616 NTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLM 437
           NTVDFFNQ+N+LYGT+TEFCT +SCP+M+AGP+YE  WADG  IKKPIK SAPKY+DYLM
Sbjct: 60  NTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLM 119

Query: 436 DWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHL 257
            W++ QLDDE++FP K G PFP NF  V KTI+KRLFRVYAHIYH HF  ++ L+EEAHL
Sbjct: 120 TWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHL 179

Query: 256 NTCFKHFVMFSWEFHLIDKNGVAPLYEIVESI 161
           NT FKHF+ F  EF+LID+  +APL E++E +
Sbjct: 180 NTSFKHFIFFVQEFNLIDRRELAPLQELIEKL 211



>gb:CR859077_1183215 Pongo pygmaeus mRNA; cDNA DKFZp469J052 (from
           clone DKFZp469J052).>gb:CR859538_1183649 Pongo pygmaeus
           mRNA; cDNA DKFZp459P0524 (from clone
           DKFZp459P0524).>gb:CQ826793_1453668 Sequence 5 from
           Patent WO2004048576.>gb:AB016839_1864813 Homo sapiens
           mob1 mRNA, complete cds.>gb:BC003398_1968810 Homo
           sapiens MOB1, Mps One Binder kinase activator-like 1B
           (yeast), mRNA (cDNA clone MGC:4929 IMAGE:3448503),
           complete cds.>gb:HSA577474_2009286 Homo sapiens mRNA for
           Mob4B protein.>gb:BC009149_2090828 Mus musculus MOB1,
           Mps One Binder kinase activator-like 1B (yeast), mRNA
           (cDNA clone MGC:6884 IMAGE:2651599), complete
           cds.>gb:BC033463_2097479 Mus musculus MOB1, Mps One
           Binder kinase activator-like 1B (yeast), mRNA (cDNA
           clone MGC:19450 IMAGE:3500664), complete cds.
          Length = 216

 Score =  306 bits (784), Expect = 5e-82
 Identities = 140/212 (66%), Positives = 172/212 (81%)
 Frame = -3

Query: 796 MSLLGLASRNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAV 617
           MS L  +SR+ KTF PKK++P G+    L KH +ATLGSGNLR+AV+LP GEDLNEW+AV
Sbjct: 1   MSFL-FSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAV 59

Query: 616 NTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLM 437
           NTVDFFNQ+N+LYGT+TEFCT +SCP+M+AGP+YE  WADG  IKKPIK SAPKY+DYLM
Sbjct: 60  NTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLM 119

Query: 436 DWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHL 257
            W++ QLDDE++FP K G PFP NF  V KTI+KRLFRVYAHIYH HF  ++ L+EEAHL
Sbjct: 120 TWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHL 179

Query: 256 NTCFKHFVMFSWEFHLIDKNGVAPLYEIVESI 161
           NT FKHF+ F  EF+LID+  +APL E++E +
Sbjct: 180 NTSFKHFIFFVQEFNLIDRRELAPLQELIEKL 211



>gb:BC045952_2549466 Danio rerio zgc:56156, mRNA (cDNA clone
           MGC:56156 IMAGE:5412480), complete
           cds.>gb:BC063989_2553689 Danio rerio zgc:56156, mRNA
           (cDNA clone MGC:77872 IMAGE:7002550), complete cds.
          Length = 216

 Score =  305 bits (782), Expect = 9e-82
 Identities = 141/212 (66%), Positives = 170/212 (80%)
 Frame = -3

Query: 796 MSLLGLASRNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAV 617
           MS L   SR+ KTF PKK++P G+    L KH +ATLGSGNLR AV+LP GEDLNEW+AV
Sbjct: 1   MSFL-FGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPDGEDLNEWVAV 59

Query: 616 NTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLM 437
           NTVDFFNQ+N+LYGT+T+FCT  SCP+M+AGPKYE  WADG  IKKPIK SAPKY+DYLM
Sbjct: 60  NTVDFFNQINMLYGTITDFCTEESCPLMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLM 119

Query: 436 DWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHL 257
            W++ QLDDE++FP K G PFP NF  V KTI+KRLFRVYAHIYH HF+ +I L+EEAHL
Sbjct: 120 TWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFESVIQLQEEAHL 179

Query: 256 NTCFKHFVMFSWEFHLIDKNGVAPLYEIVESI 161
           NT FKHF+ F  EF+LID+  +APL E++E +
Sbjct: 180 NTSFKHFIFFVQEFNLIDRKELAPLQELIEKL 211



>gb:AK077320_1171799 Mus musculus adult male pituitary gland cDNA,
           RIKEN full-length enriched library, clone:5330416A12
           product:unknown EST, full insert
           sequence.>gb:BC038112_1982289 Homo sapiens MOB1, Mps One
           Binder kinase activator-like 1A (yeast), mRNA (cDNA
           clone MGC:33910 IMAGE:5264730), complete
           cds.>gb:HSA577473_2009285 Homo sapiens mRNA for Mob4A
           protein.
          Length = 216

 Score =  304 bits (779), Expect = 2e-81
 Identities = 141/212 (66%), Positives = 169/212 (79%)
 Frame = -3

Query: 796 MSLLGLASRNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAV 617
           MS L   SR+ KTF PKK++P G+    L KH +ATLGSGNLR AV+LP GEDLNEW+AV
Sbjct: 1   MSFL-FGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAV 59

Query: 616 NTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLM 437
           NTVDFFNQ+N+LYGT+T+FCT  SCP+M+AGPKYE  WADG  IKKPIK SAPKY+DYLM
Sbjct: 60  NTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLM 119

Query: 436 DWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHL 257
            W++ QLDDE++FP K G PFP NF  V KTI+KRLFRVYAHIYH HF  +I L+EEAHL
Sbjct: 120 TWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHL 179

Query: 256 NTCFKHFVMFSWEFHLIDKNGVAPLYEIVESI 161
           NT FKHF+ F  EF+LID+  +APL E++E +
Sbjct: 180 NTSFKHFIFFVQEFNLIDRRELAPLQELIEKL 211



>gb:AX877202_1476885 Sequence 12107 from Patent
           EP1074617.>gb:AK001650_1908556 Homo sapiens cDNA
           FLJ10788 fis, clone NT2RP4000498, moderately similar to
           MOB1 PROTEIN.
          Length = 216

 Score =  303 bits (777), Expect = 3e-81
 Identities = 139/212 (65%), Positives = 171/212 (80%)
 Frame = -3

Query: 796 MSLLGLASRNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAV 617
           MS L  +SR+ KTF PKK++P G+    L KH +ATLGSGNLR+AV+LP GEDLNEW+AV
Sbjct: 1   MSFL-FSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAV 59

Query: 616 NTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLM 437
           NTVDFFNQ+N+LYGT+TEFCT +SCP+M+AGP+YE  WADG  IKKPIK SAPKY+DYLM
Sbjct: 60  NTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLM 119

Query: 436 DWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHL 257
            W++ QLDDE++FP K G PFP NF  V KTI+KRLFRVYAHIYH HF  ++ L+E AHL
Sbjct: 120 TWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEGAHL 179

Query: 256 NTCFKHFVMFSWEFHLIDKNGVAPLYEIVESI 161
           NT FKHF+ F  EF+LID+  +APL E++E +
Sbjct: 180 NTSFKHFIFFVQEFNLIDRRELAPLQELIEKL 211



>gb:AY647429_2541528 Xenopus laevis kinase regulatory subunit MOB1B
           mRNA, complete cds.>gb:BC082414_2562651 Xenopus laevis
           cDNA clone MGC:82164 IMAGE:3396911, complete cds.
          Length = 216

 Score =  303 bits (775), Expect = 6e-81
 Identities = 141/212 (66%), Positives = 168/212 (79%)
 Frame = -3

Query: 796 MSLLGLASRNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAV 617
           MS L   +R+ KTF PKKS+P G+    L KH +ATLGSGNLR AV+LP GEDLNEW+AV
Sbjct: 1   MSFL-FGNRSSKTFKPKKSLPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAV 59

Query: 616 NTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLM 437
           NTVDFFNQ+N+LYGT+T+FCT  SCP+M+AGPKYE  WADG  IKKPIK SAPKY+DYLM
Sbjct: 60  NTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLM 119

Query: 436 DWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHL 257
            W++ QLDDE++FP K G PFP NF  V KTI+KRLFRVYAHIYH HF  +I L+EEAHL
Sbjct: 120 TWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVIQLQEEAHL 179

Query: 256 NTCFKHFVMFSWEFHLIDKNGVAPLYEIVESI 161
           NT FKHF+ F  EF+LID+   APL E++E +
Sbjct: 180 NTSFKHFIFFVQEFNLIDRREQAPLQELIEKL 211



>gb:AY319763_2526694 Xenopus laevis MOB1 (MOB1) mRNA, complete
           cds.>gb:BC074352_2557862 Xenopus laevis cDNA clone
           MGC:84216 IMAGE:6954988, complete cds.
          Length = 215

 Score =  303 bits (775), Expect = 6e-81
 Identities = 137/207 (66%), Positives = 168/207 (81%)
 Frame = -3

Query: 781 LASRNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDF 602
           L SR+ KTF PKK++P G+    L KH +ATLGSGNLR+AV+LP GEDLNEW+AVNTVDF
Sbjct: 4   LFSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDF 63

Query: 601 FNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEK 422
           FNQ+N+LYGT+TEFCT S+C +M+AGP+YE  WADG  IKKPIK SAPKY+DYLM W++ 
Sbjct: 64  FNQINMLYGTITEFCTESTCSVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQD 123

Query: 421 QLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFK 242
           QLDDE++FP K G PFP NF  V KTI+KRLFRVYAHIYH HF  ++ L+EEAHLNT FK
Sbjct: 124 QLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDAVMQLQEEAHLNTSFK 183

Query: 241 HFVMFSWEFHLIDKNGVAPLYEIVESI 161
           HF+ F  EF+LID+  +APL E++E +
Sbjct: 184 HFIFFVQEFNLIDRRELAPLQELIEKL 210



>gb:AK028416_1160981 Mus musculus 15 days embryo head cDNA, RIKEN
           full-length enriched library, clone:4022402H07
           product:MOB1 PROTEIN (HYPOTHETICAL 25.1 KDA PROTEIN)
           homolog [Homo sapiens], full insert sequence.
          Length = 216

 Score =  301 bits (771), Expect = 2e-80
 Identities = 138/212 (65%), Positives = 170/212 (80%)
 Frame = -3

Query: 796 MSLLGLASRNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAV 617
           MS L  +SR+ KTF PKK++P G+    L KH +ATLGSGNLR+AV+LP GEDLNEW+AV
Sbjct: 1   MSFL-FSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAV 59

Query: 616 NTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLM 437
           NTVDFFNQ+N+LYGT+TEFCT +SCP+M+AGP+YE  WADG  IK  IK SAPKY+DYLM
Sbjct: 60  NTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKNAIKCSAPKYIDYLM 119

Query: 436 DWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHL 257
            W++ QLDDE++FP K G PFP NF  V KTI+KRLFRVYAHIYH HF  ++ L+EEAHL
Sbjct: 120 TWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHL 179

Query: 256 NTCFKHFVMFSWEFHLIDKNGVAPLYEIVESI 161
           NT FKHF+ F  EF+LID+  +APL E++E +
Sbjct: 180 NTSFKHFIFFVQEFNLIDRRELAPLQELIEKL 211



>gb:AY398317_2531847 Danio rerio clone RK143A1D09 chromosome 2 open
           reading frame 6 (C2orf6) mRNA, complete cds.
          Length = 216

 Score =  300 bits (768), Expect = 4e-80
 Identities = 138/212 (65%), Positives = 169/212 (79%)
 Frame = -3

Query: 796 MSLLGLASRNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAV 617
           MS L   +R+ KTF PKK++P G+    L KH +ATLGSGNLR AV+LP GEDLNEW+AV
Sbjct: 1   MSFL-FGNRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAV 59

Query: 616 NTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLM 437
           NTVDFFNQ+N+LYGT+T+FC+  SCP+M+AGPKYE  WADG  IKKPIK SAPKY+DYLM
Sbjct: 60  NTVDFFNQINMLYGTITDFCSEDSCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLM 119

Query: 436 DWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHL 257
            W++ QLDDE++FP K G PFP NF  V KTI+KRLFRVYAHIYH HF  ++ L+EEAHL
Sbjct: 120 TWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDAVMQLQEEAHL 179

Query: 256 NTCFKHFVMFSWEFHLIDKNGVAPLYEIVESI 161
           NT FKHF+ F  EF+LID+  +APL E++E +
Sbjct: 180 NTSFKHFIFFVQEFNLIDRKELAPLQELIERL 211



>gb:BC066567_2554442 Danio rerio zgc:56189, mRNA (cDNA clone
           MGC:76936 IMAGE:6524831), complete cds.
          Length = 216

 Score =  297 bits (761), Expect = 2e-79
 Identities = 137/212 (64%), Positives = 167/212 (78%)
 Frame = -3

Query: 796 MSLLGLASRNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAV 617
           MS L   +R+ KTF PKK++P G+    L KH +ATLGSGNLR AV+LP GEDLNEW+AV
Sbjct: 1   MSFL-FGNRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRAAVMLPEGEDLNEWIAV 59

Query: 616 NTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLM 437
           NTVDFFNQ+N+LYGT+TEFCT   C +M+AGP+YE  WADG  IKKPIK SAPKY+DYLM
Sbjct: 60  NTVDFFNQINMLYGTITEFCTEVKCSVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLM 119

Query: 436 DWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHL 257
            W++ QLDDE++FP K G PFP NF  V KTI+KRLFRVYAHIYH HF  +I L+EEAHL
Sbjct: 120 TWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDAVIQLQEEAHL 179

Query: 256 NTCFKHFVMFSWEFHLIDKNGVAPLYEIVESI 161
           NT FKHF+ F  EF+LID+  +APL +++E +
Sbjct: 180 NTSFKHFIFFVQEFNLIDRRELAPLQDLIEKL 211



>gb:BC045979_2549491 Danio rerio zgc:56189, mRNA (cDNA clone
           MGC:56189 IMAGE:5413687), complete cds.
          Length = 216

 Score =  295 bits (754), Expect = 2e-78
 Identities = 136/212 (64%), Positives = 166/212 (78%)
 Frame = -3

Query: 796 MSLLGLASRNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAV 617
           MS L   +R+ KTF PKK++P G+    L KH +ATLGSGNLR AV+LP GEDLN W+AV
Sbjct: 1   MSFL-FGNRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRAAVMLPEGEDLNGWIAV 59

Query: 616 NTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLM 437
           NTVDFFNQ+N+LYGT+TEFCT   C +M+AGP+YE  WADG  IKKPIK SAPKY+DYLM
Sbjct: 60  NTVDFFNQINMLYGTITEFCTEVKCSVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLM 119

Query: 436 DWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHL 257
            W++ QLDDE++FP K G PFP NF  V KTI+KRLFRVYAHIYH HF  +I L+EEAHL
Sbjct: 120 TWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDAVIQLQEEAHL 179

Query: 256 NTCFKHFVMFSWEFHLIDKNGVAPLYEIVESI 161
           NT FKHF+ F  EF+LID+  +APL +++E +
Sbjct: 180 NTSFKHFIFFVQEFNLIDRRELAPLQDLIEKL 211



>gb:AE014297_1140804 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003739_1222797 Drosophila melanogaster
           chromosome 3R, section 77 of 118 of the complete
           sequence.>gb:AY061520_1293323 Drosophila melanogaster
           LD47553 full length cDNA.
          Length = 219

 Score =  295 bits (754), Expect = 2e-78
 Identities = 133/205 (64%), Positives = 163/205 (79%)
 Frame = -3

Query: 775 SRNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFN 596
           SR+ KTF PKK++P G     L KH  ATLGSGNLR AV LP GEDLNEW+AVNTVDFFN
Sbjct: 7   SRSSKTFKPKKNIPEGTHQYDLMKHAAATLGSGNLRNAVALPDGEDLNEWVAVNTVDFFN 66

Query: 595 QVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQL 416
           Q+N+LYGT+TEFCT  +C +M+AGPKYE  WADG+T+KKPIK SAPKY+DYLM W++ QL
Sbjct: 67  QINMLYGTITEFCTEETCGIMSAGPKYEYHWADGLTVKKPIKCSAPKYIDYLMTWVQDQL 126

Query: 415 DDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHF 236
           DDE++FP K G PFP NF    KTI+KRLFRVYAHIYH HF +++ L EEAHLNT FKHF
Sbjct: 127 DDETLFPSKIGVPFPKNFHSSAKTILKRLFRVYAHIYHQHFTEVVTLGEEAHLNTSFKHF 186

Query: 235 VMFSWEFHLIDKNGVAPLYEIVESI 161
           + F  EF+LI++  +APL E+++ +
Sbjct: 187 IFFVQEFNLIERRELAPLQELIDKL 211



>gb:AJ635581_1813354 Medicago sativa subsp. falcata mRNA for
           Mob1-like protein (mob1 gene), allele
           mutant.>gb:AJ635583_1813356 Medicago sativa subsp.
           falcata mob1 gene for Mob1-like protein, exons 1-3,
           allele mutant.
          Length = 147

 Score =  246 bits (627), Expect = 8e-64
 Identities = 115/140 (82%), Positives = 125/140 (89%)
 Frame = -3

Query: 796 MSLLGLASRNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAV 617
           MSL GL SRNQKTF PKKS P G+KG  LQKHIDATLGSGNLREAV LP GED+NEWLAV
Sbjct: 1   MSLFGLGSRNQKTFRPKKSAPTGSKGAQLQKHIDATLGSGNLREAVKLPPGEDINEWLAV 60

Query: 616 NTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLM 437
           NTVDFFNQVN ++GTLTEFCTPS+CP MTAGPKYE  WADGVTIKKPI+VSAPKYV+YLM
Sbjct: 61  NTVDFFNQVNTMFGTLTEFCTPSNCPTMTAGPKYEYRWADGVTIKKPIEVSAPKYVEYLM 120

Query: 436 DWIEKQLDDESIFPQKFGAP 377
           DW+E QLDDE+IFPQ+ GAP
Sbjct: 121 DWMESQLDDETIFPQRLGAP 140



>sp|O94360|MOB1_SCHPO Maintenance of ploidy protein
           mob1.>pir|T40465|T40465 probable mitosis and maintenance
           of ploidy protein - fission yeast (Schizosaccharomyces
           pombe)>gb:SPBC428_1720162 S.pombe chromosome II cosmid
           c428.
          Length = 210

 Score =  234 bits (597), Expect = 2e-60
 Identities = 105/211 (49%), Positives = 152/211 (72%)
 Frame = -3

Query: 790 LLGLASRNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNT 611
           + G +++  KTF  +K+   G K   L+++ +ATLGSG+L EAV LP GEDLNEW+A+NT
Sbjct: 1   MFGFSNKTAKTFRVRKT-EAGTKHYQLRQYAEATLGSGSLMEAVKLPKGEDLNEWIAMNT 59

Query: 610 VDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDW 431
           +DF+ Q+N+LYGT+TEFCT +SCP M AGP YE  W D     KP ++SAP Y++ L+DW
Sbjct: 60  MDFYTQINMLYGTITEFCTAASCPQMNAGPSYEYYWQDDKIYTKPTRMSAPDYINNLLDW 119

Query: 430 IEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNT 251
            +++LDD+ +FP + G  FP NF  V++ I +RLFR+YAHIY SHF  ++ ++ E++LNT
Sbjct: 120 TQEKLDDKKLFPTEIGVEFPKNFRKVIQQIFRRLFRIYAHIYCSHFHVMVAMELESYLNT 179

Query: 250 CFKHFVMFSWEFHLIDKNGVAPLYEIVESIL 158
            FKHFV F  EF L+D    AP+ ++V+S++
Sbjct: 180 SFKHFVFFCREFGLMDNKEYAPMQDLVDSMV 210



>gb:CR382130_1662659 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 224

 Score =  230 bits (586), Expect = 5e-59
 Identities = 111/209 (53%), Positives = 151/209 (72%), Gaps = 3/209 (1%)
 Frame = -3

Query: 775 SRNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFN 596
           SR  +TF P  +  P     LL+++ D TLG+G+L +AV LP GEDL EWLAV+TVDF+N
Sbjct: 14  SRTTRTFKPSTASSP--PAHLLRQYADTTLGAGSLAQAVKLPEGEDLAEWLAVHTVDFYN 71

Query: 595 QVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVT--IKKPIKVSAPKYVDYLMDWIEK 422
           QVN+LY T+T FC+P+SCP MTA  +YE LW +  +   +KP +VSAP+Y+++L+ W++ 
Sbjct: 72  QVNMLYSTITSFCSPASCPRMTATDEYEYLWQNAASEKFRKPTRVSAPEYIEHLVSWVQA 131

Query: 421 QLDDESIFPQKFGAPFPPNF-EDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCF 245
           QLDDE++FP + GAPFP NF   VV  I+KRLFRVYAHIY  HF +I  L  + HLNT  
Sbjct: 132 QLDDEAVFPHRLGAPFPKNFVSSVVPQILKRLFRVYAHIYCHHFDQISELGLQPHLNTSL 191

Query: 244 KHFVMFSWEFHLIDKNGVAPLYEIVESIL 158
           KHFV+FS EF ++D+   APL E+++ +L
Sbjct: 192 KHFVLFSKEFGVVDQKEFAPLDELIQILL 220



>gb:AY046920_1289412 Trypanosoma brucei cell cycle associated
           protein Mob1-2 gene, complete cds.
          Length = 225

 Score =  229 bits (585), Expect = 6e-59
 Identities = 107/204 (52%), Positives = 145/204 (71%)
 Frame = -3

Query: 769 NQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQV 590
           + +T+ PKK    G +   L K   + + SG+L  AV LP G DLN WL+V+TVDF+N  
Sbjct: 11  SDRTYKPKKKHKEGTERYNLHKFAKSLVRSGDLSAAVKLPQGADLNHWLSVHTVDFYNIT 70

Query: 589 NILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDD 410
           N+LYG+LTEFCT SSCP+M++GP+YE LW D     K  KVSAP+YV  LM+WIE+Q++D
Sbjct: 71  NVLYGSLTEFCTNSSCPVMSSGPRYEYLWRDPPEYPKATKVSAPEYVRLLMEWIERQIND 130

Query: 409 ESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVM 230
           E +FP +   P+PP+F D VK   KRLFRVYAH+Y+SHF KI  L+EE+H+NT  KHF+ 
Sbjct: 131 ERVFPSEDRNPYPPDFADRVKACFKRLFRVYAHVYYSHFAKIRELQEESHINTALKHFMY 190

Query: 229 FSWEFHLIDKNGVAPLYEIVESIL 158
           F WEF LI +  V+PL E++ +++
Sbjct: 191 FVWEFDLIPREEVSPLRELLVNLM 214



>gb:AE017348_1758309 Cryptococcus neoformans var. neoformans JEC21
           chromosome 8, complete sequence.
          Length = 192

 Score =  224 bits (570), Expect = 3e-57
 Identities = 104/181 (57%), Positives = 130/181 (71%)
 Frame = -3

Query: 685 GSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECL 506
           GSGNLR AV LP GEDL EW+AV+ VDFFN VN+LYGT++EFCTP+ CP+M AGPKYE  
Sbjct: 12  GSGNLRTAVKLPEGEDLQEWIAVHVVDFFNHVNMLYGTVSEFCTPTECPVMNAGPKYEYF 71

Query: 505 WADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLF 326
           W DG   KKP ++SAP YV+ LM W +  LDDE  FPQ  G  FPP F    KTI++RLF
Sbjct: 72  WEDGTNYKKPTQLSAPAYVEALMSWTQSILDDEKHFPQTIGKRFPPTFMTTAKTILRRLF 131

Query: 325 RVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDKNGVAPLYEIVESILQL*G 146
           RVYAHIYH+HF +I  L  EAHLNT ++HF++F  EF L+ +  + PL +  ++IL   G
Sbjct: 132 RVYAHIYHAHFDQICALGIEAHLNTNYRHFLLFVDEFALLSEKDLVPLEDFNKTILNETG 191

Query: 145 R 143
           +
Sbjct: 192 K 192



>gb:BC084470_2563844 Xenopus tropicalis hypothetical LOC496492, mRNA
           (cDNA clone MGC:89339 IMAGE:6987768), complete cds.
          Length = 216

 Score =  222 bits (565), Expect = 1e-56
 Identities = 103/198 (52%), Positives = 140/198 (70%), Gaps = 1/198 (0%)
 Frame = -3

Query: 763 KTFHPKKSVPPGNKGELLQKHIDATLGSG-NLREAVLLPAGEDLNEWLAVNTVDFFNQVN 587
           +TF PK+   PG +   L K   A+L +G +L+ AV LP GEDLN+W+AV+ VDFFN++N
Sbjct: 13  RTFRPKRKFEPGTQRFELHKKAQASLNAGLDLKLAVQLPHGEDLNDWVAVHVVDFFNRIN 72

Query: 586 ILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDE 407
           ++YGT+++ CT  SCP+M+ GPKYE  W D    +KP  +SAPKY++ LMDWIE Q+++E
Sbjct: 73  LIYGTVSDSCTEQSCPVMSGGPKYEYRWQDDNRYRKPTALSAPKYMNLLMDWIEVQINNE 132

Query: 406 SIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMF 227
            IFP   G PFP NF  VVK I+ RLFRV+ H+Y  HF++II +  EAH+NTC+KHF  F
Sbjct: 133 GIFPTNVGTPFPKNFLQVVKKILSRLFRVFVHVYIHHFERIIQMGAEAHVNTCYKHFYYF 192

Query: 226 SWEFHLIDKNGVAPLYEI 173
             EF+LID   + PL E+
Sbjct: 193 VTEFNLIDTKELEPLKEM 210



>gb:AY046919_1289411 Trypanosoma brucei cell cycle associated
           protein Mob1-1 gene, complete cds.
          Length = 208

 Score =  221 bits (563), Expect = 2e-56
 Identities = 102/185 (55%), Positives = 136/185 (73%)
 Frame = -3

Query: 712 LQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPMM 533
           L K   + + SG+L  AV LP G DLN WL+V+TVDF+N  N+LYG+LTEFCT SSCP+M
Sbjct: 13  LHKFAKSLVRSGDLSAAVKLPQGTDLNHWLSVHTVDFYNITNVLYGSLTEFCTNSSCPVM 72

Query: 532 TAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFEDV 353
           ++GP+YE LW D     K  KVSAP+YV  LM+WIE+Q++DE +FP +   P+PP+F D 
Sbjct: 73  SSGPRYEYLWRDPPEYPKATKVSAPEYVRLLMEWIERQINDERVFPSEDRNPYPPDFADR 132

Query: 352 VKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDKNGVAPLYEI 173
           VK   KRLFRVYAH+Y+SHF KI  L+EE+H+NT  KHF+ F WEF LI +  V+PL E+
Sbjct: 133 VKACFKRLFRVYAHVYYSHFAKIRELQEESHINTALKHFMYFVWEFDLIPREEVSPLREL 192

Query: 172 VESIL 158
           + +++
Sbjct: 193 LVNLM 197



>gb:BC072711_2556641 Danio rerio zgc:92408, mRNA (cDNA clone
           MGC:92408 IMAGE:7038341), complete cds.
          Length = 216

 Score =  219 bits (559), Expect = 6e-56
 Identities = 102/210 (48%), Positives = 140/210 (66%), Gaps = 1/210 (0%)
 Frame = -3

Query: 787 LGLASRNQKTFHPKKSVPPGNKGELLQKHIDATLGSG-NLREAVLLPAGEDLNEWLAVNT 611
           LG      KTF P+K   PG +   L K   A+L SG +LR+ V LP GE +N+W+AV+ 
Sbjct: 5   LGQVFSKDKTFRPRKRFEPGTQRFELYKRAQASLKSGLDLRKVVQLPEGESINDWIAVHV 64

Query: 610 VDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDW 431
           VDFFN++N++YGT++EFCT  SCP+M+ GP+YE  W DG   K+P K+ A  Y++ LM+W
Sbjct: 65  VDFFNRINLIYGTVSEFCTEKSCPIMSGGPRYEYRWQDGEQYKRPTKLPALIYMNLLMNW 124

Query: 430 IEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNT 251
           IE  +++E IFP + G PFP NF+ V K I+ RLFRV+ H+Y  HF  I  +  EAH+NT
Sbjct: 125 IESLINNEDIFPTRVGVPFPKNFQQVCKKILSRLFRVFVHVYIHHFDMICSIGAEAHINT 184

Query: 250 CFKHFVMFSWEFHLIDKNGVAPLYEIVESI 161
           C+KH+  F  EF LID + + PL E+ E I
Sbjct: 185 CYKHYYYFISEFSLIDHSELVPLKEMTEKI 214



>gb:BC015049_1974928 Homo sapiens MOB1, Mps One Binder kinase
           activator-like 2A (yeast), mRNA (cDNA clone MGC:9531
           IMAGE:3919665), complete cds.>gb:HSA580635_2009764 Homo
           sapiens mRNA for Mob3A protein (MOB3A gene).
          Length = 217

 Score =  219 bits (557), Expect = 1e-55
 Identities = 102/198 (51%), Positives = 136/198 (68%), Gaps = 1/198 (0%)
 Frame = -3

Query: 763 KTFHPKKSVPPGNKGELLQKHIDATLGSG-NLREAVLLPAGEDLNEWLAVNTVDFFNQVN 587
           KTF PK+   PG +   L K   A+L +G +LR AV LP GEDLN+W+AV+ VDFFN+VN
Sbjct: 14  KTFRPKRKFEPGTQRFELHKKAQASLNAGLDLRLAVQLPPGEDLNDWVAVHVVDFFNRVN 73

Query: 586 ILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDE 407
           ++YGT+++ CT  SCP+M+ GPKYE  W D    +KP  +SAP+Y+D LMDWIE Q+++E
Sbjct: 74  LIYGTISDGCTEQSCPVMSGGPKYEYRWQDEHKFRKPTALSAPRYMDLLMDWIEAQINNE 133

Query: 406 SIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMF 227
            +FP   G PFP NF   V+ I+ RLFRV+ H+Y  HF +I  +  EAH+NTC+KHF  F
Sbjct: 134 DLFPTNVGTPFPKNFLQTVRKILSRLFRVFVHVYIHHFDRIAQMGSEAHVNTCYKHFYYF 193

Query: 226 SWEFHLIDKNGVAPLYEI 173
             EF LID   + PL E+
Sbjct: 194 VKEFGLIDTKELEPLKEM 211



>gb:AK030481_1162026 Mus musculus adult male pituitary gland cDNA,
           RIKEN full-length enriched library, clone:5330417K06
           product:hypothetical protein, full insert
           sequence.>gb:BC058238_2103124 Mus musculus RIKEN cDNA
           5330417K06 gene, mRNA (cDNA clone MGC:65537
           IMAGE:6307543), complete cds.
          Length = 217

 Score =  219 bits (557), Expect = 1e-55
 Identities = 101/198 (51%), Positives = 136/198 (68%), Gaps = 1/198 (0%)
 Frame = -3

Query: 763 KTFHPKKSVPPGNKGELLQKHIDATLGSG-NLREAVLLPAGEDLNEWLAVNTVDFFNQVN 587
           KTF PK+   PG +   L K   A+L +G +LR AV LP GEDLN+W+AV+ VDFFN++N
Sbjct: 14  KTFRPKRKFEPGTQRFELHKRAQASLNAGLDLRLAVQLPPGEDLNDWVAVHVVDFFNRIN 73

Query: 586 ILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDE 407
           ++YGT+++ CT  SCP+M+ GPKYE  W D    +KP  +SAP+Y+D LMDWIE Q+++E
Sbjct: 74  LIYGTISDGCTEQSCPVMSGGPKYEYRWQDEQRFRKPTALSAPRYMDLLMDWIEVQINNE 133

Query: 406 SIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMF 227
            IFP   G PFP  F   V+ I+ RLFRV+ H+Y  HF +I  +  EAH+NTC+KHF  F
Sbjct: 134 DIFPTNVGTPFPKTFLQAVRKILSRLFRVFVHVYIHHFDRIAQMGSEAHVNTCYKHFYYF 193

Query: 226 SWEFHLIDKNGVAPLYEI 173
             EF+LID   + PL E+
Sbjct: 194 VTEFNLIDPKELEPLKEM 211



>gb:AX880331_1478231 Sequence 15236 from Patent
           EP1074617.>gb:AK023266_1909564 Homo sapiens cDNA
           FLJ13204 fis, clone NT2RP3004507, weakly similar to MOB1
           PROTEIN.>gb:CR457307_1993514 Homo sapiens full open
           reading frame cDNA clone RZPDo834G079D for gene MOBKL2B,
           MOB1, Mps One Binder kinase activator-like 2B (yeast);
           complete cds, incl. stopcodon.>gb:HSA580636_2009765 Homo
           sapiens mRNA for Mob3B protein (MOB3B gene).
          Length = 216

 Score =  218 bits (556), Expect = 1e-55
 Identities = 100/198 (50%), Positives = 138/198 (69%), Gaps = 1/198 (0%)
 Frame = -3

Query: 763 KTFHPKKSVPPGNKGELLQKHIDATLGSG-NLREAVLLPAGEDLNEWLAVNTVDFFNQVN 587
           KTF PK+   PG +   L K   A+L SG +L+ AV LP+GED N+W+AV+ VDFFN++N
Sbjct: 13  KTFRPKRKFEPGTQRFELHKRAQASLNSGVDLKAAVQLPSGEDQNDWVAVHVVDFFNRIN 72

Query: 586 ILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDE 407
           ++YGT+ EFCT  +CP+M+ GPKYE  W D +  KKP  + AP+Y++ LMDWIE Q+++E
Sbjct: 73  LIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNE 132

Query: 406 SIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMF 227
            IFP   G PFP NF  + K I+ RLFRV+ H+Y  HF ++I +  EAH+NTC+KHF  F
Sbjct: 133 EIFPTCVGVPFPKNFLQICKKILCRLFRVFVHVYIHHFDRVIVMGAEAHVNTCYKHFYYF 192

Query: 226 SWEFHLIDKNGVAPLYEI 173
             E +LID+  + PL E+
Sbjct: 193 VTEMNLIDRKELEPLKEM 210



>gb:AK039841_1165511 Mus musculus 0 day neonate thymus cDNA, RIKEN
           full-length enriched library, clone:A430018A01
           product:weakly similar to MOB1 PROTEIN (HYPOTHETICAL
           25.1 KDA PROTEIN) [Homo sapiens], full insert
           sequence.>gb:BC020028_2093222 Mus musculus MOB1, Mps One
           Binder kinase activator-like 2B (yeast), mRNA (cDNA
           clone MGC:28259 IMAGE:4007373), complete cds.
          Length = 216

 Score =  218 bits (556), Expect = 1e-55
 Identities = 101/198 (51%), Positives = 137/198 (69%), Gaps = 1/198 (0%)
 Frame = -3

Query: 763 KTFHPKKSVPPGNKGELLQKHIDATLGSG-NLREAVLLPAGEDLNEWLAVNTVDFFNQVN 587
           KTF PK+   PG +   L K   A+L SG +LR AV LP GED N+W+AV+ VDFFN++N
Sbjct: 13  KTFRPKRKFEPGTQRFELHKRAQASLNSGVDLRAAVQLPNGEDQNDWVAVHVVDFFNRIN 72

Query: 586 ILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDE 407
           ++YGT+ EFCT  +CP+M+ GPKYE  W D +  KKP  + AP+Y++ LMDWIE Q+++E
Sbjct: 73  LIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNE 132

Query: 406 SIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMF 227
            IFP   G PFP NF  + K I+ RLFRV+ H+Y  HF ++I +  EAH+NTC+KHF  F
Sbjct: 133 DIFPTCVGVPFPKNFLQICKKILCRLFRVFVHVYIHHFDRVIVMGAEAHVNTCYKHFYYF 192

Query: 226 SWEFHLIDKNGVAPLYEI 173
             E +LID+  + PL E+
Sbjct: 193 VTEMNLIDRKELEPLKEM 210



>gb:AC005328_1874922 Homo sapiens chromosome 19, cosmid R26660,
           complete sequence.
          Length = 291

 Score =  217 bits (553), Expect = 3e-55
 Identities = 101/195 (51%), Positives = 134/195 (68%), Gaps = 1/195 (0%)
 Frame = -3

Query: 763 KTFHPKKSVPPGNKGELLQKHIDATLGSG-NLREAVLLPAGEDLNEWLAVNTVDFFNQVN 587
           KTF PK+   PG +   L K   A+L +G +LR AV LP GEDLN+W+AV+ VDFFN+VN
Sbjct: 23  KTFRPKRKFEPGTQRFELHKKAQASLNAGLDLRLAVQLPPGEDLNDWVAVHVVDFFNRVN 82

Query: 586 ILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDE 407
           ++YGT+++ CT  SCP+M+ GPKYE  W D    +KP  +SAP+Y+D LMDWIE Q+++E
Sbjct: 83  LIYGTISDGCTEQSCPVMSGGPKYEYRWQDEHKFRKPTALSAPRYMDLLMDWIEAQINNE 142

Query: 406 SIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMF 227
            +FP   G PFP NF   V+ I+ RLFRV+ H+Y  HF +I  +  EAH+NTC+KHF  F
Sbjct: 143 DLFPTNVGTPFPKNFLQTVRKILSRLFRVFVHVYIHHFDRIAQMGSEAHVNTCYKHFYYF 202

Query: 226 SWEFHLIDKNGVAPL 182
             EF LID   + PL
Sbjct: 203 VKEFGLIDTKELEPL 217



>gb:CR860711_1184765 Pongo pygmaeus mRNA; cDNA DKFZp459M1427 (from
           clone DKFZp459M1427).
          Length = 217

 Score =  217 bits (553), Expect = 3e-55
 Identities = 101/198 (51%), Positives = 135/198 (68%), Gaps = 1/198 (0%)
 Frame = -3

Query: 763 KTFHPKKSVPPGNKGELLQKHIDATLGSG-NLREAVLLPAGEDLNEWLAVNTVDFFNQVN 587
           KTF PK+   PG +   L K   A+L +G +LR AV LP GEDLN+W+ V+ VDFFN+VN
Sbjct: 14  KTFRPKRKFEPGTQRFELHKKAQASLNAGLDLRLAVQLPPGEDLNDWVTVHVVDFFNRVN 73

Query: 586 ILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDE 407
           ++YGT+++ CT  SCP+M+ GPKYE  W D    +KP  +SAP+Y+D LMDWIE Q+++E
Sbjct: 74  LIYGTISDGCTEQSCPVMSGGPKYEYRWQDEHKFRKPTALSAPRYMDLLMDWIEAQINNE 133

Query: 406 SIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMF 227
            +FP   G PFP NF   V+ I+ RLFRV+ H+Y  HF +I  +  EAH+NTC+KHF  F
Sbjct: 134 DLFPTNVGTPFPKNFLQAVRKILSRLFRVFVHVYIHHFDRIAQMGSEAHVNTCYKHFYYF 193

Query: 226 SWEFHLIDKNGVAPLYEI 173
             EF LID   + PL E+
Sbjct: 194 VKEFGLIDTKELEPLKEM 211



>gb:HSM803881_2017726 Homo sapiens mRNA; cDNA DKFZp451A0116 (from
           clone DKFZp451A0116); complete cds.
          Length = 216

 Score =  216 bits (550), Expect = 7e-55
 Identities = 99/198 (50%), Positives = 137/198 (69%), Gaps = 1/198 (0%)
 Frame = -3

Query: 763 KTFHPKKSVPPGNKGELLQKHIDATLGSG-NLREAVLLPAGEDLNEWLAVNTVDFFNQVN 587
           KTF PK+   PG +   L K   A+L SG +L+ AV LP+GED N+W+AV+ VD FN++N
Sbjct: 13  KTFRPKRKFEPGTQRFELHKRAQASLNSGVDLKAAVQLPSGEDQNDWVAVHVVDLFNRIN 72

Query: 586 ILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDE 407
           ++YGT+ EFCT  +CP+M+ GPKYE  W D +  KKP  + AP+Y++ LMDWIE Q+++E
Sbjct: 73  LIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNE 132

Query: 406 SIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMF 227
            IFP   G PFP NF  + K I+ RLFRV+ H+Y  HF ++I +  EAH+NTC+KHF  F
Sbjct: 133 EIFPTCVGVPFPKNFLQICKKILCRLFRVFVHVYIHHFDRVIVMGAEAHVNTCYKHFYYF 192

Query: 226 SWEFHLIDKNGVAPLYEI 173
             E +LID+  + PL E+
Sbjct: 193 VTEMNLIDRKELEPLKEM 210



>gb:BC033027_1980759 Homo sapiens MOB1, Mps One Binder kinase
           activator-like 2B (yeast), mRNA (cDNA clone MGC:32960
           IMAGE:5268356), complete cds.
          Length = 216

 Score =  216 bits (550), Expect = 7e-55
 Identities = 99/198 (50%), Positives = 137/198 (69%), Gaps = 1/198 (0%)
 Frame = -3

Query: 763 KTFHPKKSVPPGNKGELLQKHIDATLGSG-NLREAVLLPAGEDLNEWLAVNTVDFFNQVN 587
           KTF PK+   PG +   L K   A+L SG +L+ AV LP+GED N+W+AV+ VDFFN++N
Sbjct: 13  KTFRPKRKFEPGTQRFELHKRAQASLNSGVDLKAAVQLPSGEDQNDWVAVHVVDFFNRIN 72

Query: 586 ILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDE 407
           ++YGT+ EFCT  +CP+M+ GPKYE  W D +  KKP  + AP+Y++ LMDWIE Q+++E
Sbjct: 73  LIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNE 132

Query: 406 SIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMF 227
            IFP   G PFP NF  +   I+ RLFRV+ H+Y  HF ++I +  EAH+NTC+KHF  F
Sbjct: 133 EIFPTCVGVPFPKNFLQICMKILCRLFRVFVHVYIHHFDRVIVMGAEAHVNTCYKHFYYF 192

Query: 226 SWEFHLIDKNGVAPLYEI 173
             E +LID+  + PL E+
Sbjct: 193 VTEMNLIDRKELEPLKEM 210



>gb:AK084014_1174148 Mus musculus 12 days embryo spinal ganglion
           cDNA, RIKEN full-length enriched library,
           clone:D130076I06 product:similar to CDNA FLJ13204 FIS,
           CLONE NT2RP3004507, WEAKLY SIMILAR TO MOB1 PROTEIN [Homo
           sapiens], full insert sequence.
          Length = 216

 Score =  216 bits (549), Expect = 9e-55
 Identities = 98/202 (48%), Positives = 136/202 (67%), Gaps = 1/202 (0%)
 Frame = -3

Query: 763 KTFHPKKSVPPGNKGELLQKHIDATLGSG-NLREAVLLPAGEDLNEWLAVNTVDFFNQVN 587
           KTF P+K   PG +   L K   A+L SG +LR  V LP GE +++W+AV+ VDFFN++N
Sbjct: 13  KTFRPRKRFEPGTQRFELYKKAQASLKSGLDLRSVVRLPPGESIDDWIAVHVVDFFNRIN 72

Query: 586 ILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDE 407
           ++YGT+ E C+ SSCP+M  GP+YE  W D    ++P K+SAP+Y+  LMDWIE  ++DE
Sbjct: 73  LIYGTMAEHCSESSCPVMAGGPRYEYRWQDERQYRRPAKLSAPRYMALLMDWIEGLINDE 132

Query: 406 SIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMF 227
            +FP + G PFP NF+ V   I+ RLFRV+ H+Y  HF  I+ +  EAH+NTC+KHF  F
Sbjct: 133 DVFPTRVGVPFPKNFQQVCTKILTRLFRVFVHVYIHHFDSILSMGAEAHVNTCYKHFYYF 192

Query: 226 SWEFHLIDKNGVAPLYEIVESI 161
             EF L+D+  + PL E+ E I
Sbjct: 193 IQEFSLVDQRELEPLREMTERI 214



>gb:AE014134_1128530 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003628_1218637 Drosophila melanogaster
           chromosome 2L, section 37 of 83 of the complete
           sequence.>gb:AY071000_1295085 Drosophila melanogaster
           RE08857 full insert cDNA.
          Length = 220

 Score =  215 bits (547), Expect = 2e-54
 Identities = 99/202 (49%), Positives = 136/202 (67%), Gaps = 1/202 (0%)
 Frame = -3

Query: 763 KTFHPKKSVPPGNKGELLQKHIDATLGSG-NLREAVLLPAGEDLNEWLAVNTVDFFNQVN 587
           KTF PKK    G     L K   A+L SG NLR+ V LP GE+LN+WLAV+ VDFFN++N
Sbjct: 14  KTFRPKKPFASGTIRYSLHKQAQASLQSGINLRQVVRLPQGENLNDWLAVHVVDFFNRIN 73

Query: 586 ILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDE 407
           ++YGT++EFC  ++CP M+ G +YE LWADG   KKP  +SA KY+++LMDWIE Q+++E
Sbjct: 74  LIYGTVSEFCNETTCPTMSGGSRYEYLWADGDLYKKPTALSAQKYIEHLMDWIETQINNE 133

Query: 406 SIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMF 227
           ++FP     PFP NF  + + I+ RLFRV+ H+Y  HF +I+ +  EAH+N C+KHF  F
Sbjct: 134 AVFPVSTDVPFPKNFIAISRKILTRLFRVFVHVYIHHFDRIVSIGAEAHVNACYKHFYYF 193

Query: 226 SWEFHLIDKNGVAPLYEIVESI 161
             EF +I    + PL E+   I
Sbjct: 194 VQEFDMISAKELEPLQEMTSRI 215



>gb:BT020665_1436023 Bos taurus MOB1, Mps One Binder kinase
           activator-like 2C (yeast) (MOBKL2C), mRNA, complete cds.
          Length = 216

 Score =  214 bits (546), Expect = 2e-54
 Identities = 97/202 (48%), Positives = 137/202 (67%), Gaps = 1/202 (0%)
 Frame = -3

Query: 763 KTFHPKKSVPPGNKGELLQKHIDATLGSG-NLREAVLLPAGEDLNEWLAVNTVDFFNQVN 587
           KTF P+K   PG +   L K   A+L SG +LR  V LP GE++++W+AV+ VDFFN++N
Sbjct: 13  KTFRPRKRFEPGTQRFELYKKAQASLKSGLDLRSVVRLPPGENIDDWIAVHVVDFFNRIN 72

Query: 586 ILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDE 407
           ++YGT+ E C+ +SCP+M  GP+YE  W D    ++P K+SAP+Y+  LMDWIE  ++DE
Sbjct: 73  LIYGTMAERCSETSCPVMAGGPRYEYRWQDERQYRRPAKLSAPRYMALLMDWIESLINDE 132

Query: 406 SIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMF 227
            +FP + G PFP NF+ V   I+ RLFRV+ H+Y  HF  I+ +  EAH+NTC+KHF  F
Sbjct: 133 DVFPTRVGVPFPKNFQQVCTKILTRLFRVFVHVYIHHFDSILSMGAEAHVNTCYKHFYYF 192

Query: 226 SWEFHLIDKNGVAPLYEIVESI 161
             EF L+D+  + PL E+ E I
Sbjct: 193 IREFSLVDQRELEPLREMTERI 214



>gb:HSA580637_2009766 Homo sapiens mRNA for Mob3C protein (MOB3C
           gene).
          Length = 216

 Score =  214 bits (544), Expect = 3e-54
 Identities = 97/202 (48%), Positives = 137/202 (67%), Gaps = 1/202 (0%)
 Frame = -3

Query: 763 KTFHPKKSVPPGNKGELLQKHIDATLGSG-NLREAVLLPAGEDLNEWLAVNTVDFFNQVN 587
           KTF P+K   PG +   L K   A+L SG +LR  V LP GE++++W+AV+ VDFFN++N
Sbjct: 13  KTFRPRKRFEPGTQRFELYKKAQASLKSGLDLRSVVRLPPGENIDDWIAVHVVDFFNRIN 72

Query: 586 ILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDE 407
           ++YGT+ E C+ +SCP+M  GP+YE  W D    ++P K+SAP+Y+  LMDWIE  ++DE
Sbjct: 73  LIYGTMAERCSETSCPVMAGGPRYEYRWQDERQYRRPAKLSAPRYMALLMDWIEGLINDE 132

Query: 406 SIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMF 227
            +FP + G PFP NF+ V   I+ RLFRV+ H+Y  HF  I+ +  EAH+NTC+KHF  F
Sbjct: 133 EVFPTRVGVPFPKNFQQVCTKILTRLFRVFVHVYIHHFDSILSMGAEAHVNTCYKHFYYF 192

Query: 226 SWEFHLIDKNGVAPLYEIVESI 161
             EF L+D+  + PL E+ E I
Sbjct: 193 IREFSLVDQRELEPLREMTERI 214



>gb:AL136373_1919153 Human DNA sequence from clone RP11-49P4 on
           chromosome 1p32.2-33 Contains two novel genes (FLJ40412,
           FLJ32011), the MKNK1 gene for MAP kinase-interacting
           serine/threonine kinase 1, the gene for MOB3C protein
           (MOB3C) and the 3' end of the ATPAF1 gene for ATP
           synthase mitochondrial F1 complex assembly factor 1,
           complete sequence.
          Length = 239

 Score =  214 bits (544), Expect = 3e-54
 Identities = 97/202 (48%), Positives = 137/202 (67%), Gaps = 1/202 (0%)
 Frame = -3

Query: 763 KTFHPKKSVPPGNKGELLQKHIDATLGSG-NLREAVLLPAGEDLNEWLAVNTVDFFNQVN 587
           KTF P+K   PG +   L K   A+L SG +LR  V LP GE++++W+AV+ VDFFN++N
Sbjct: 36  KTFRPRKRFEPGTQRFELYKKAQASLKSGLDLRSVVRLPPGENIDDWIAVHVVDFFNRIN 95

Query: 586 ILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDE 407
           ++YGT+ E C+ +SCP+M  GP+YE  W D    ++P K+SAP+Y+  LMDWIE  ++DE
Sbjct: 96  LIYGTMAERCSETSCPVMAGGPRYEYRWQDERQYRRPAKLSAPRYMALLMDWIEGLINDE 155

Query: 406 SIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMF 227
            +FP + G PFP NF+ V   I+ RLFRV+ H+Y  HF  I+ +  EAH+NTC+KHF  F
Sbjct: 156 EVFPTRVGVPFPKNFQQVCTKILTRLFRVFVHVYIHHFDSILSMGAEAHVNTCYKHFYYF 215

Query: 226 SWEFHLIDKNGVAPLYEIVESI 161
             EF L+D+  + PL E+ E I
Sbjct: 216 IREFSLVDQRELEPLREMTERI 237



>gb:AL136373_1919152 Human DNA sequence from clone RP11-49P4 on
           chromosome 1p32.2-33 Contains two novel genes (FLJ40412,
           FLJ32011), the MKNK1 gene for MAP kinase-interacting
           serine/threonine kinase 1, the gene for MOB3C protein
           (MOB3C) and the 3' end of the ATPAF1 gene for ATP
           synthase mitochondrial F1 complex assembly factor 1,
           complete sequence.
          Length = 268

 Score =  214 bits (544), Expect = 3e-54
 Identities = 97/202 (48%), Positives = 137/202 (67%), Gaps = 1/202 (0%)
 Frame = -3

Query: 763 KTFHPKKSVPPGNKGELLQKHIDATLGSG-NLREAVLLPAGEDLNEWLAVNTVDFFNQVN 587
           KTF P+K   PG +   L K   A+L SG +LR  V LP GE++++W+AV+ VDFFN++N
Sbjct: 65  KTFRPRKRFEPGTQRFELYKKAQASLKSGLDLRSVVRLPPGENIDDWIAVHVVDFFNRIN 124

Query: 586 ILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDE 407
           ++YGT+ E C+ +SCP+M  GP+YE  W D    ++P K+SAP+Y+  LMDWIE  ++DE
Sbjct: 125 LIYGTMAERCSETSCPVMAGGPRYEYRWQDERQYRRPAKLSAPRYMALLMDWIEGLINDE 184

Query: 406 SIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMF 227
            +FP + G PFP NF+ V   I+ RLFRV+ H+Y  HF  I+ +  EAH+NTC+KHF  F
Sbjct: 185 EVFPTRVGVPFPKNFQQVCTKILTRLFRVFVHVYIHHFDSILSMGAEAHVNTCYKHFYYF 244

Query: 226 SWEFHLIDKNGVAPLYEIVESI 161
             EF L+D+  + PL E+ E I
Sbjct: 245 IREFSLVDQRELEPLREMTERI 266



>gb:AK090453_1913250 Homo sapiens mRNA for FLJ00374 protein.
          Length = 260

 Score =  214 bits (544), Expect = 3e-54
 Identities = 97/202 (48%), Positives = 137/202 (67%), Gaps = 1/202 (0%)
 Frame = -3

Query: 763 KTFHPKKSVPPGNKGELLQKHIDATLGSG-NLREAVLLPAGEDLNEWLAVNTVDFFNQVN 587
           KTF P+K   PG +   L K   A+L SG +LR  V LP GE++++W+AV+ VDFFN++N
Sbjct: 57  KTFRPRKRFEPGTQRFELYKKAQASLKSGLDLRSVVRLPPGENIDDWIAVHVVDFFNRIN 116

Query: 586 ILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDE 407
           ++YGT+ E C+ +SCP+M  GP+YE  W D    ++P K+SAP+Y+  LMDWIE  ++DE
Sbjct: 117 LIYGTMAERCSETSCPVMAGGPRYEYRWQDERQYRRPAKLSAPRYMALLMDWIEGLINDE 176

Query: 406 SIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMF 227
            +FP + G PFP NF+ V   I+ RLFRV+ H+Y  HF  I+ +  EAH+NTC+KHF  F
Sbjct: 177 EVFPTRVGVPFPKNFQQVCTKILTRLFRVFVHVYIHHFDSILSMGAEAHVNTCYKHFYYF 236

Query: 226 SWEFHLIDKNGVAPLYEIVESI 161
             EF L+D+  + PL E+ E I
Sbjct: 237 IREFSLVDQRELEPLREMTERI 258



>gb:BC073205_2557059 Xenopus laevis MGC80478 protein, mRNA (cDNA
           clone MGC:80478 IMAGE:5156454), complete cds.
          Length = 216

 Score =  213 bits (543), Expect = 4e-54
 Identities = 99/202 (49%), Positives = 136/202 (67%), Gaps = 1/202 (0%)
 Frame = -3

Query: 763 KTFHPKKSVPPGNKGELLQKHIDATLGSG-NLREAVLLPAGEDLNEWLAVNTVDFFNQVN 587
           +TF P+K   PG +   L K   A+L SG +L+  V LP GE++N+W+AV+ VDFFN++N
Sbjct: 13  RTFRPRKKFEPGTQRFELYKKAQASLKSGLDLKTVVQLPPGENINDWIAVHVVDFFNRIN 72

Query: 586 ILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDE 407
           ++YGT++EFCT  SCP+M  G KYE  W D    K+P KVSAP Y++ LM+WIE  +++E
Sbjct: 73  LIYGTMSEFCTERSCPIMCGGLKYEYRWQDDNKYKRPTKVSAPLYMNMLMEWIETLINNE 132

Query: 406 SIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMF 227
            IFP + G PFP NF+ V   I+ RLFRV+ H+Y  HF  II +  EAH+NTC+KHF  F
Sbjct: 133 DIFPTRMGVPFPKNFQQVCNKILTRLFRVFVHVYIHHFDAIISVGAEAHVNTCYKHFYYF 192

Query: 226 SWEFHLIDKNGVAPLYEIVESI 161
             EF L++   + PL E+ E I
Sbjct: 193 ITEFSLVNHRELEPLKEMTEKI 214



>gb:BC067183_2554655 Danio rerio zgc:77552, mRNA (cDNA clone
           MGC:77552 IMAGE:6960007), complete cds.
          Length = 216

 Score =  213 bits (541), Expect = 8e-54
 Identities = 97/198 (48%), Positives = 135/198 (68%), Gaps = 1/198 (0%)
 Frame = -3

Query: 763 KTFHPKKSVPPGNKGELLQKHIDATLGSG-NLREAVLLPAGEDLNEWLAVNTVDFFNQVN 587
           +TF PK+   PG +   L K   A+L +G +L++AV LP GEDLN+W+AV+ VDFFN++N
Sbjct: 13  RTFRPKRKFEPGTQRFDLHKKAQASLNAGLDLKQAVQLPHGEDLNDWVAVHVVDFFNRIN 72

Query: 586 ILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDE 407
           ++YGT+++ CT  +CP+M+ GPKYE  W D    KKP  + APKY+  LM+WIE Q+++E
Sbjct: 73  LIYGTISDSCTDQTCPVMSGGPKYEYRWQDEQKYKKPTALPAPKYMSLLMEWIEVQINNE 132

Query: 406 SIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMF 227
            IFP   G PFP  F  V K I+ RLFRV+ H+Y  HF ++  +  EAH+NTC+KHF  F
Sbjct: 133 HIFPTNVGTPFPKTFMQVAKKILSRLFRVFVHVYIHHFDRVSHMGAEAHVNTCYKHFYYF 192

Query: 226 SWEFHLIDKNGVAPLYEI 173
             EF+LID   + PL E+
Sbjct: 193 VTEFNLIDHKELEPLKEM 210



>gb:BC049527_2550323 Danio rerio zgc:77552, mRNA (cDNA clone
           MGC:56681 IMAGE:6033832), complete cds.
          Length = 216

 Score =  211 bits (537), Expect = 2e-53
 Identities = 96/198 (48%), Positives = 135/198 (68%), Gaps = 1/198 (0%)
 Frame = -3

Query: 763 KTFHPKKSVPPGNKGELLQKHIDATLGSG-NLREAVLLPAGEDLNEWLAVNTVDFFNQVN 587
           +TF PK+   PG +   L K   A+L +G +L++AV LP GEDLN+W+AV+ VDFFN++N
Sbjct: 13  RTFRPKRKFEPGTQRFELHKKAQASLNAGLDLKQAVQLPHGEDLNDWVAVHVVDFFNRIN 72

Query: 586 ILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDE 407
           ++YGT+++ CT  +CP+M+ GPKYE  W D    KKP  + APKY+  LM+WIE Q+++E
Sbjct: 73  LIYGTISDSCTDQTCPVMSGGPKYEYRWQDEQKYKKPTALPAPKYMSLLMEWIEVQINNE 132

Query: 406 SIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMF 227
            IFP   G PFP  F  V K I+ RLFRV+ H+Y  HF ++  +  EAH++TC+KHF  F
Sbjct: 133 HIFPTNVGTPFPKTFMQVAKKILSRLFRVFVHVYIHHFDRVSHMGAEAHVSTCYKHFYYF 192

Query: 226 SWEFHLIDKNGVAPLYEI 173
             EF+LID   + PL E+
Sbjct: 193 VTEFNLIDHKELEPLKEM 210



>gb:AX878562_1477481 Sequence 13467 from Patent
           EP1074617.>gb:AK021657_1908935 Homo sapiens cDNA
           FLJ11595 fis, clone HEMBA1003836, moderately similar to
           MOB1 PROTEIN.
          Length = 148

 Score =  206 bits (524), Expect = 7e-52
 Identities = 94/138 (68%), Positives = 115/138 (83%)
 Frame = -3

Query: 796 MSLLGLASRNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAV 617
           MS L  +SR+ KTF PKK++P G+    L KH +ATLGSGNLR+AV+LP GEDLNEW+AV
Sbjct: 1   MSFL-FSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAV 59

Query: 616 NTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLM 437
           NTVDFFNQ+N+LYGT+TEFCT +SCP+M+AGP+YE  WADG  IKKPIK SAPKY+DYLM
Sbjct: 60  NTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLM 119

Query: 436 DWIEKQLDDESIFPQKFG 383
            W++ QLDDE++FP K G
Sbjct: 120 TWVQDQLDDETLFPSKIG 137



>pir|T49581|T49581 probable MOB1 protein [imported] - Neurospora
           crassa
          Length = 250

 Score =  205 bits (521), Expect = 2e-51
 Identities = 100/213 (46%), Positives = 143/213 (67%), Gaps = 4/213 (1%)
 Frame = -3

Query: 781 LASRNQKT---FHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNT 611
           L+ RNQ+T   F P+ S   G     L+++ +ATLG G+LR+ V LP GED NEWLAVN 
Sbjct: 36  LSRRNQRTRNQFRPRASGKGGATSYQLRQYAEATLGGGSLRKVVKLPEGEDENEWLAVNM 95

Query: 610 VDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDW 431
           VDF+NQ+N+LYG +TEFC+P +CP M A  ++E LW D    K+P K+ AP Y++ LM W
Sbjct: 96  VDFYNQINLLYGAITEFCSPQTCPEMKATDEFEYLWQDTENYKRPTKMPAPAYIEQLMSW 155

Query: 430 IEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNT 251
           ++  +D+E++ P + G PFP +F  +V+ I KR++RVYAHIY  H+  I  L  E HLNT
Sbjct: 156 VQGNIDNEAVLPSRIGVPFPKSFPALVRQIFKRMYRVYAHIYCHHYPVIRELGLEPHLNT 215

Query: 250 CFKHFVMFSWEFHL-IDKNGVAPLYEIVESILQ 155
            FK +V+F  E +L   K+   PL ++V+S+L+
Sbjct: 216 SFKQYVLFIDEHNLATGKDFWGPLGDLVDSMLR 248



>sp|Q9P601|MOB1_NEUCR Probable maintenance of ploidy protein
           mob1.>gb:NCB2O8_1690042 Neurospora crassa DNA linkage
           group II BAC clone B2O8.
          Length = 219

 Score =  204 bits (520), Expect = 2e-51
 Identities = 100/218 (45%), Positives = 145/218 (66%), Gaps = 1/218 (0%)
 Frame = -3

Query: 805 SSIMSLLGLASRNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEW 626
           SS ++ +   +RNQ  F P+ S   G     L+++ +ATLG G+LR+ V LP GED NEW
Sbjct: 2   SSFLTTVNQRTRNQ--FRPRASGKGGATSYQLRQYAEATLGGGSLRKVVKLPEGEDENEW 59

Query: 625 LAVNTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVD 446
           LAVN VDF+NQ+N+LYG +TEFC+P +CP M A  ++E LW D    K+P K+ AP Y++
Sbjct: 60  LAVNMVDFYNQINLLYGAITEFCSPQTCPEMKATDEFEYLWQDTENYKRPTKMPAPAYIE 119

Query: 445 YLMDWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEE 266
            LM W++  +D+E++ P + G PFP +F  +V+ I KR++RVYAHIY  H+  I  L  E
Sbjct: 120 QLMSWVQGNIDNEAVLPSRIGVPFPKSFPALVRQIFKRMYRVYAHIYCHHYPVIRELGLE 179

Query: 265 AHLNTCFKHFVMFSWEFHL-IDKNGVAPLYEIVESILQ 155
            HLNT FK +V+F  E +L   K+   PL ++V+S+L+
Sbjct: 180 PHLNTSFKQYVLFIDEHNLATGKDFWGPLGDLVDSMLR 217



>pir|T33987|T33987 hypothetical protein T12B3.4 - Caenorhabditis
           elegans>gb:AF125960_1243196 Caenorhabditis elegans
           cosmid T12B3, complete sequence.
          Length = 292

 Score =  202 bits (515), Expect = 8e-51
 Identities = 95/210 (45%), Positives = 132/210 (62%), Gaps = 1/210 (0%)
 Frame = -3

Query: 781 LASRNQKTFHPKKSVPPGNKGELLQKHIDATLGSG-NLREAVLLPAGEDLNEWLAVNTVD 605
           L     KTF PKK  P G     L K  +ATL SG +LR AV LP  E+ ++WLAV+TVD
Sbjct: 67  LQVNKHKTFRPKKKFPQGTLRYSLHKQAEATLHSGVDLRHAVKLPPSENFDDWLAVHTVD 126

Query: 604 FFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIE 425
           FFN++N++YGT+++ CT  SCP M  G +YE LW DG+  KKP ++ AP+Y+  LMDWIE
Sbjct: 127 FFNRINLMYGTISDVCTRESCPTMCGGSRYEYLWQDGIEYKKPTRLPAPQYMQLLMDWIE 186

Query: 424 KQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCF 245
            +++DE IFP      FP +F  + K I+ RLFRV+ H+Y  HF +I  L  E H NT +
Sbjct: 187 VRINDEHIFPSSTNVSFPKDFRQICKKILTRLFRVFVHVYIHHFDRIRELGAEPHANTLY 246

Query: 244 KHFVMFSWEFHLIDKNGVAPLYEIVESILQ 155
           KHF  F  E+ ++    +  L ++ E +L+
Sbjct: 247 KHFYFFVTEYGMVSTKELEALKDMTERLLE 276



>gb:CR382126_1658516 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 305

 Score =  199 bits (505), Expect = 1e-49
 Identities = 97/183 (53%), Positives = 133/183 (72%), Gaps = 2/183 (1%)
 Frame = -3

Query: 712 LQKHIDATLGS-GNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPM 536
           L++ ++ TLGS G L +AV LP GE+++EW+AV+ VDF+NQ+N+LYG++TEFC+P +CP 
Sbjct: 118 LRQIVETTLGSKGVLNQAVKLPKGENIDEWIAVHCVDFYNQINMLYGSITEFCSPQTCPR 177

Query: 535 MTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFED 356
           M A  +YE LW +    K PI + APKYVDYL+ W ++Q DDES FP K GAPFP +F+D
Sbjct: 178 MIATNEYEYLW-NVHPGKPPISLPAPKYVDYLIRWCQQQFDDESYFPSKPGAPFPKDFKD 236

Query: 355 -VVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDKNGVAPLY 179
            + + I+KRLFRVYAHIY  HF +I+ L  +  LNT F+H  +FS EFH++  N   PL 
Sbjct: 237 SIARPILKRLFRVYAHIYCHHFNEILELNLQTVLNTSFRHVCLFSEEFHILKTNDYGPLL 296

Query: 178 EIV 170
           E+V
Sbjct: 297 ELV 299



>gb:CR382133_1666556 Debaryomyces hansenii chromosome A of strain
           CBS767 of Debaryomyces hansenii.
          Length = 267

 Score =  196 bits (497), Expect = 1e-48
 Identities = 93/194 (47%), Positives = 138/194 (71%), Gaps = 8/194 (4%)
 Frame = -3

Query: 712 LQKHIDATLGSGN-LREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPM 536
           ++ + + TLGS + L +AV LP  ED+NEWLA++ VDF+NQ+N+LYG +TEFC+P +CP 
Sbjct: 73  IRHYAEQTLGSDSALIQAVKLPQDEDINEWLAIHVVDFYNQINMLYGAITEFCSPKTCPR 132

Query: 535 MTAGPKYECLW------ADGVTI-KKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAP 377
           M A  +YE LW      ++G+ + K+P+ + A +Y + LM+WI+   D+++IFP K GAP
Sbjct: 133 MIATDEYEYLWQETNPSSNGMALPKRPVSLPACEYTENLMNWIQNFFDNDNIFPSKIGAP 192

Query: 376 FPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDKN 197
           FP  F  +VKTI KRLFR+YAHIY  HF +I  L  ++HLNT  KH+V+FS EF+LI + 
Sbjct: 193 FPQQFPSLVKTIFKRLFRIYAHIYCHHFHEISELGLQSHLNTSLKHYVLFSNEFNLITRK 252

Query: 196 GVAPLYEIVESILQ 155
              PL ++V+++L+
Sbjct: 253 DYGPLEDLVDTMLK 266



>gb:AE016817_1747148 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 296

 Score =  192 bits (487), Expect = 1e-47
 Identities = 92/184 (50%), Positives = 130/184 (70%), Gaps = 2/184 (1%)
 Frame = -3

Query: 712 LQKHIDATLGS-GNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPM 536
           +++ ++ TLGS G L +AV LP GE+L+EW+AV+ VDF+NQ+N+LYG++TEFC+P +CP 
Sbjct: 109 IKQIVETTLGSEGVLNQAVKLPKGENLDEWIAVHCVDFYNQINMLYGSITEFCSPQTCPR 168

Query: 535 MTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFED 356
           M A  +YE LW +      P+ V+APKYV+YLM+W ++Q D+E +FP K   P    F D
Sbjct: 169 MIATNEYEYLW-NVYPGNPPVSVAAPKYVEYLMNWCQQQFDNEDLFPAKTNVPLKNGFND 227

Query: 355 -VVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDKNGVAPLY 179
            + K I+KRLFRVYAHIY  HF +I+ L  +  LNT F+HF +FS EFH++  +   PL 
Sbjct: 228 KIAKPILKRLFRVYAHIYCHHFNEILELNLQTVLNTSFRHFCLFSEEFHMLKPSDYGPLL 287

Query: 178 EIVE 167
           E+VE
Sbjct: 288 ELVE 291



>pir|S48466|S48466 MOB1 protein [validated] - yeast (Saccharomyces
           cerevisiae)>gb:SC9150_1705735 S.cerevisiae chromosome IX
           cosmid 9150.
          Length = 314

 Score =  187 bits (474), Expect = 4e-46
 Identities = 94/183 (51%), Positives = 127/183 (69%), Gaps = 2/183 (1%)
 Frame = -3

Query: 712 LQKHIDATLGS-GNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPM 536
           +++ ++ TLGS G L +AV LP GED NEWLAV+ VDF+NQ+N+LYG++TEFC+P +CP 
Sbjct: 127 IKQIVEMTLGSEGVLNQAVKLPRGEDENEWLAVHCVDFYNQINMLYGSITEFCSPQTCPR 186

Query: 535 MTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNF-E 359
           M A  +YE LWA     + P+ VSAPKYV+ LM W + Q DDES+FP K    FP  F +
Sbjct: 187 MIATNEYEYLWAFQKG-QPPVSVSAPKYVECLMRWCQDQFDDESLFPSKVTGTFPEGFIQ 245

Query: 358 DVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDKNGVAPLY 179
            V++ I++RLFRVYAHIY  HF +I+ L  +  LNT F+HF +F+ EF L+      PL 
Sbjct: 246 RVIQPILRRLFRVYAHIYCHHFNEILELNLQTVLNTSFRHFCLFAQEFELLRPADFGPLL 305

Query: 178 EIV 170
           E+V
Sbjct: 306 ELV 308



>sp|P40484|MOB1_YEAST Maintenance of ploidy protein MOB1 (MPS1
           binder 1).
          Length = 236

 Score =  187 bits (474), Expect = 4e-46
 Identities = 94/183 (51%), Positives = 127/183 (69%), Gaps = 2/183 (1%)
 Frame = -3

Query: 712 LQKHIDATLGS-GNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPM 536
           +++ ++ TLGS G L +AV LP GED NEWLAV+ VDF+NQ+N+LYG++TEFC+P +CP 
Sbjct: 49  IKQIVEMTLGSEGVLNQAVKLPRGEDENEWLAVHCVDFYNQINMLYGSITEFCSPQTCPR 108

Query: 535 MTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNF-E 359
           M A  +YE LWA     + P+ VSAPKYV+ LM W + Q DDES+FP K    FP  F +
Sbjct: 109 MIATNEYEYLWAFQKG-QPPVSVSAPKYVECLMRWCQDQFDDESLFPSKVTGTFPEGFIQ 167

Query: 358 DVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDKNGVAPLY 179
            V++ I++RLFRVYAHIY  HF +I+ L  +  LNT F+HF +F+ EF L+      PL 
Sbjct: 168 RVIQPILRRLFRVYAHIYCHHFNEILELNLQTVLNTSFRHFCLFAQEFELLRPADFGPLL 227

Query: 178 EIV 170
           E+V
Sbjct: 228 ELV 230



>gb:CR380953_1650738 Candida glabrata strain CBS138 chromosome G
           complete sequence.
          Length = 292

 Score =  182 bits (462), Expect = 1e-44
 Identities = 96/205 (46%), Positives = 133/205 (64%), Gaps = 2/205 (0%)
 Frame = -3

Query: 769 NQKTFHPKKSVPPGNKGELLQKHIDATLGS-GNLREAVLLPAGEDLNEWLAVNTVDFFNQ 593
           +QK F   ++       + +++ ++ TLGS G L +AV LP GE+ NEW+AV+ VDF+NQ
Sbjct: 86  HQKPFIQPQAGTTVTSHQDIKEIVEMTLGSEGVLNQAVKLPRGENENEWMAVHCVDFYNQ 145

Query: 592 VNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLD 413
           +N+LYGT+TEFC+P +CP M A  +YE LWA     + P+ V APKYV+ LM W + Q D
Sbjct: 146 INMLYGTITEFCSPQTCPRMIATNEYEYLWA-FQRGQPPVSVPAPKYVEALMKWCQDQFD 204

Query: 412 DESIFPQKFGAPFPPNF-EDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHF 236
           +ESIFP K    FP  F E  V  I++RLFRVYAHIY  HF +I+ L  +  LNT F+HF
Sbjct: 205 NESIFPAKTSGQFPDKFIERHVIPILRRLFRVYAHIYCHHFNEILELNLQTVLNTSFRHF 264

Query: 235 VMFSWEFHLIDKNGVAPLYEIVESI 161
            +F+ EF L+  +   PL E+V  +
Sbjct: 265 CLFTQEFQLLKASDFGPLLELVTEL 289



>gb:CEF38H4_1363651 Caenorhabditis elegans cosmid F38H4, complete
           sequence.
          Length = 193

 Score =  169 bits (427), Expect = 1e-40
 Identities = 84/181 (46%), Positives = 120/181 (66%), Gaps = 2/181 (1%)
 Frame = -3

Query: 694 ATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEF-CTPSSCPMMTA-GP 521
           +TLGSGNLR+A+ LP GED NEWLAVN +D  NQV +++G L E  CT S CP MTA G 
Sbjct: 15  STLGSGNLRDALKLPPGEDKNEWLAVNIIDLVNQVRMVFGVLCESECTDSKCPSMTAHGR 74

Query: 520 KYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFEDVVKTI 341
           +Y   W    T+   +  SAP+Y+D  +   +  +DDE++FP + G  FP +FE+  + I
Sbjct: 75  QYT--WTSEGTL---LNTSAPQYIDLSLTACQNNVDDENVFPSEIGKQFPTDFEERCQAI 129

Query: 340 VKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDKNGVAPLYEIVESI 161
           ++RLFR+YAH+Y +H      +K  AHLNT FK FV+F+ +F L++K    PL EI+E++
Sbjct: 130 MRRLFRIYAHVYFAHVNHFKAIKALAHLNTSFKQFVLFANQFQLLNKEETEPLREIIENL 189

Query: 160 L 158
           +
Sbjct: 190 I 190



>sp|O74558|MOB2_SCHPO Probable maintenance of ploidy protein
           mob2.>pir|T41676|T41676 hypothetical protein SPCC970.04c
           - fission yeast  (Schizosaccharomyces
           pombe)>gb:SPCC970_1721700 S.pombe chromosome III cosmid
           c970.
          Length = 244

 Score =  166 bits (421), Expect = 6e-40
 Identities = 74/182 (40%), Positives = 114/182 (62%)
 Frame = -3

Query: 715 LLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPM 536
           L Q  +   L  GN    V LP   DL+EW+A+N  + F  +N  Y     FCT  +CP+
Sbjct: 56  LQQPFVRTHLVKGNFSTIVSLPRFVDLDEWVALNVYELFTYLNHFYDVFATFCTVKTCPV 115

Query: 535 MTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFED 356
           M+A   ++  W D    +KP+ + AP+Y++Y++ WIE +L D+++FP K G PFP NF  
Sbjct: 116 MSAAANFDYTWLDNN--RKPVHLPAPQYIEYVLAWIENRLHDQNVFPTKAGLPFPSNFLV 173

Query: 355 VVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDKNGVAPLYE 176
           +VK I K++FR++AH+Y++H+ +I+ L  EAH N+ F HF+ F  EF L+DK   APL +
Sbjct: 174 IVKAIYKQMFRIFAHMYYAHYAEILHLSLEAHWNSFFAHFIAFGKEFQLLDKRDTAPLKD 233

Query: 175 IV 170
           ++
Sbjct: 234 LI 235



>gb:CR382127_1660165 Yarrowia lipolytica chromosome A of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 190

 Score =  163 bits (413), Expect = 5e-39
 Identities = 76/185 (41%), Positives = 113/185 (61%)
 Frame = -3

Query: 715 LLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPM 536
           + Q  +   L +GN +  V  P   D NEWLA+   +FF  +N  Y  ++EF TP +CP 
Sbjct: 1   MCQPFVRQALVTGNFKTIVQQPNYVDTNEWLALYAHEFFALLNSFYDAISEFVTPQACPT 60

Query: 535 MTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFED 356
           M AGP  + LW D    KK +++ A  Y+DY   WI  +L+D++IFP K G PFPP+F  
Sbjct: 61  MNAGPGVDYLWIDAS--KKAVRLPAATYIDYTFSWITSKLEDKTIFPTKVGVPFPPHFIS 118

Query: 355 VVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDKNGVAPLYE 176
           ++K I +++FRV+AHIYH+HF K+  L  ++H N+ F HF+ F   F LID+    PL  
Sbjct: 119 ILKNIFRQMFRVFAHIYHNHFDKMCHLGIQSHWNSLFTHFIGFVINFDLIDEKEREPLQP 178

Query: 175 IVESI 161
           +++S+
Sbjct: 179 LIDSL 183



>gb:AE017346_1757335 Cryptococcus neoformans var. neoformans JEC21
           chromosome 6, complete sequence.
          Length = 252

 Score =  162 bits (411), Expect = 9e-39
 Identities = 79/194 (40%), Positives = 117/194 (60%), Gaps = 1/194 (0%)
 Frame = -3

Query: 784 GLASRNQKTFHPKKSVPPGNKG-ELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTV 608
           G+ + NQ    P     PG K   L Q  + A L  G+ +  V  P   D+NEW+A+N  
Sbjct: 35  GVENANQSYRPPS----PGPKPLYLCQPFVKAALVKGSFKTIVAPPKYVDINEWVAINLF 90

Query: 607 DFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWI 428
           DF++ +N  YG LTEFCT  +CP M+ G     LW D    ++ + ++AP Y+D++M W+
Sbjct: 91  DFYHNLNQFYGVLTEFCTMQNCPTMSGGKTLNFLWPDHN--QRLVSLAAPTYIDFVMSWL 148

Query: 427 EKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTC 248
           +K L+DE++FP K G PF  +F    K I K LFR++AH+YH+HF++++ L  EAH N+ 
Sbjct: 149 QKLLEDENVFPTKSGKPFDHSFAYTAKHIYKHLFRIFAHLYHAHFEQVLHLSIEAHFNSL 208

Query: 247 FKHFVMFSWEFHLI 206
           F HF+ F  EF L+
Sbjct: 209 FAHFLAFGKEFDLL 222



>pir|S58648|S58648 hypothetical protein YFL034c-b - yeast
           (Saccharomyces cerevisiae)
          Length = 287

 Score =  159 bits (403), Expect = 8e-38
 Identities = 73/184 (39%), Positives = 112/184 (60%)
 Frame = -3

Query: 715 LLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPM 536
           L +  +   L  G+ +  V LP   DL EW+A+N  +FF  +N  YG + E+ TP + P 
Sbjct: 96  LSEPFVRTALVKGSFKTIVQLPKYVDLGEWIALNVFEFFTNLNQFYGVVAEYVTPDAYPT 155

Query: 535 MTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFED 356
           M AGP  + LW D     + + + A +Y+D  + WI  +++D+++FP K G PFP  F  
Sbjct: 156 MNAGPHTDYLWLDANN--RQVSLPASQYIDLALTWINNKVNDKNLFPTKNGLPFPQQFSR 213

Query: 355 VVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDKNGVAPLYE 176
            V+ I+ ++FR++AHIYH HF KI+ L  EAH N+ F HF+ F+ EF +ID+  +APL  
Sbjct: 214 DVQRIMVQMFRIFAHIYHHHFDKIVHLSLEAHWNSFFSHFISFAKEFKIIDRKEMAPLLP 273

Query: 175 IVES 164
           ++ES
Sbjct: 274 LIES 277



>sp|P43563|MOB2_YEAST Maintenance of ploidy protein MOB2 (MPS1
           binder 2).>gb:YSCCHRVIN_1728474 Saccharomyces cerevisiae
           chromosome VI complete DNA sequence.
          Length = 259

 Score =  159 bits (403), Expect = 8e-38
 Identities = 73/184 (39%), Positives = 112/184 (60%)
 Frame = -3

Query: 715 LLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPM 536
           L +  +   L  G+ +  V LP   DL EW+A+N  +FF  +N  YG + E+ TP + P 
Sbjct: 68  LSEPFVRTALVKGSFKTIVQLPKYVDLGEWIALNVFEFFTNLNQFYGVVAEYVTPDAYPT 127

Query: 535 MTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFED 356
           M AGP  + LW D     + + + A +Y+D  + WI  +++D+++FP K G PFP  F  
Sbjct: 128 MNAGPHTDYLWLDANN--RQVSLPASQYIDLALTWINNKVNDKNLFPTKNGLPFPQQFSR 185

Query: 355 VVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDKNGVAPLYE 176
            V+ I+ ++FR++AHIYH HF KI+ L  EAH N+ F HF+ F+ EF +ID+  +APL  
Sbjct: 186 DVQRIMVQMFRIFAHIYHHHFDKIVHLSLEAHWNSFFSHFISFAKEFKIIDRKEMAPLLP 245

Query: 175 IVES 164
           ++ES
Sbjct: 246 LIES 249



>gb:BC076047_2558929 Danio rerio zgc:92512, mRNA (cDNA clone
           MGC:92512 IMAGE:7047686), complete cds.
          Length = 228

 Score =  158 bits (400), Expect = 2e-37
 Identities = 83/201 (41%), Positives = 121/201 (60%), Gaps = 2/201 (0%)
 Frame = -3

Query: 799 IMSLLGLASRNQKTFHPKKSVPPGNKGELLQ-KHIDATLGSGNLREAVLLPAGE-DLNEW 626
           ++  +G   R  KT    K  PP  K   L+ ++    +   +L++ V LP  E DLNEW
Sbjct: 2   VLQAVGKVLRKSKTKPNGKKAPPEEKKHYLEPEYTKVRVADFDLKDLVALPTKEIDLNEW 61

Query: 625 LAVNTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVD 446
           LA NT  FFN +N+ Y T++EFCT  +C  MTA   Y  ++       K  K +AP+YVD
Sbjct: 62  LASNTTTFFNLINLQYSTISEFCTGDTCQAMTA---YNTIYYWYDERGKKTKCTAPQYVD 118

Query: 445 YLMDWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEE 266
            +M +++K + DE IFP K+G  FP +FE +VK + + LF V AHIY +HF++I+ L  +
Sbjct: 119 LVMTFVQKLVTDEEIFPTKYGKDFPNSFESLVKKVCRYLFHVLAHIYWAHFKEIVALDLQ 178

Query: 265 AHLNTCFKHFVMFSWEFHLID 203
            HLNT + HF++F  EF+LID
Sbjct: 179 GHLNTLYAHFIVFIREFNLID 199



>gb:CR382124_1656556 Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 271

 Score =  158 bits (400), Expect = 2e-37
 Identities = 74/184 (40%), Positives = 113/184 (61%)
 Frame = -3

Query: 715 LLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPM 536
           L +  +   L  G+ +  V LP   DL EW+A+N  +F+  +N  YG + E+ T  + P 
Sbjct: 82  LSEPFVRTALVKGSYKTIVQLPKYVDLGEWIALNVFEFYTNLNQFYGVIAEYVTADAYPT 141

Query: 535 MTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFED 356
           M AGP+ + LW D     + I + A +Y+D  + WI  +++D+ +FP K   PFPPNF  
Sbjct: 142 MNAGPRTDYLWLDANN--RQISLPAGQYIDLALTWINNKVNDQQLFPTKSSFPFPPNFLR 199

Query: 355 VVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDKNGVAPLYE 176
            ++ I+ ++FR++AHIYH HF KII L  EAH N+ F HF+ F+ EF+LID+  +APL  
Sbjct: 200 DIQRIMIQMFRIFAHIYHQHFDKIIHLSLEAHWNSFFAHFISFAKEFNLIDRREMAPLEL 259

Query: 175 IVES 164
           ++ES
Sbjct: 260 LIES 263



>gb:CR382136_1668991 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 297

 Score =  157 bits (396), Expect = 5e-37
 Identities = 76/206 (36%), Positives = 118/206 (57%)
 Frame = -3

Query: 772 RNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQ 593
           R Q+     ++ P      L +  +   L  G+ +  V LP   D NEW+A+N  + +N 
Sbjct: 89  RRQQVAQQSQASPSKLPLFLCEPFVKTALVKGSFKTIVQLPKYVDSNEWIALNIFELYNN 148

Query: 592 VNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLD 413
           +N  YG + ++ TP + P M AGP    +W D     + I + A +Y+DY++ WI  +L+
Sbjct: 149 LNQFYGIIADYVTPEAFPTMNAGPNTNYMWVDASG--QAINLPASQYIDYVLTWISTKLN 206

Query: 412 DESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFV 233
           D+SIFP K G  FPPNF    K I++++ R++A IYH+ F KI+ L  EAH N+ F HF+
Sbjct: 207 DQSIFPTKNGGAFPPNFLKDCKNILRQMLRIFAFIYHNQFDKIVHLSLEAHWNSFFAHFI 266

Query: 232 MFSWEFHLIDKNGVAPLYEIVESILQ 155
            F  EF+LID+  + PL  ++E+  Q
Sbjct: 267 SFIKEFNLIDRKELEPLLPLIENFEQ 292



>gb:CR380957_1653053 Candida glabrata strain CBS138 chromosome K
           complete sequence.
          Length = 325

 Score =  154 bits (390), Expect = 2e-36
 Identities = 76/216 (35%), Positives = 121/216 (56%), Gaps = 5/216 (2%)
 Frame = -3

Query: 796 MSLLGLASRNQKTFHPKKSVPPGNKGE-----LLQKHIDATLGSGNLREAVLLPAGEDLN 632
           +S  G A+ + ++   ++S  P          L +  +   L  G+ +  V LP   DL 
Sbjct: 102 LSHSGTATNDTQSLSQRRSNSPERSSSQQVMFLSEPFVKTALVKGSFKTIVQLPKYVDLG 161

Query: 631 EWLAVNTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKY 452
           EW+A+N  +FF  +N  YG + E+ T  + P M AGP  + LW D     + + + A +Y
Sbjct: 162 EWIALNVFEFFTNLNHFYGVIAEYVTADAYPTMNAGPHTDYLWLDANN--RQVSLPAGQY 219

Query: 451 VDYLMDWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLK 272
           +D  + WI  +++D+S+FP K G PF PNF   V+ I+ ++FR++ HIYH HF KI+ L 
Sbjct: 220 IDLALTWINNKVNDKSLFPTKNGVPFSPNFFKDVQRIMIQMFRIFGHIYHHHFDKIVHLS 279

Query: 271 EEAHLNTCFKHFVMFSWEFHLIDKNGVAPLYEIVES 164
            EAH N+ F HF+ F  EF +ID+  + PL  ++E+
Sbjct: 280 LEAHWNSFFAHFISFVKEFKIIDRREMYPLMPLIEN 315



>gb:BC047291_1983818 Homo sapiens HCCA2 protein, mRNA (cDNA clone
           MGC:51978 IMAGE:5246165), complete
           cds.>gb:BC067785_1987482 Homo sapiens HCCA2 protein,
           mRNA (cDNA clone MGC:87186 IMAGE:5299799), complete
           cds.>gb:HSA580639_2009768 Homo sapiens mRNA for Mob2
           protein (MOB2 gene).
          Length = 237

 Score =  154 bits (389), Expect = 3e-36
 Identities = 77/194 (39%), Positives = 116/194 (59%)
 Frame = -3

Query: 748 KKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTL 569
           KK      K  L  +H  A +     +E V+LP   DLNEWLA NT  FF+ +N+ Y T+
Sbjct: 15  KKPAAEERKAYLEPEHTKARITDFQFKELVVLPREIDLNEWLASNTTTFFHHINLQYSTI 74

Query: 568 TEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQK 389
           +EFCT  +C  M A    +  W D     K +K +AP+YVD++M  ++K + DE +FP K
Sbjct: 75  SEFCTGETCQTM-AVCNTQYYWYD--ERGKKVKCTAPQYVDFVMSSVQKLVTDEDVFPTK 131

Query: 388 FGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHL 209
           +G  FP +FE +V+ I + LF V AHIY +HF++ + L+   HLNT + HF++F+ EF+L
Sbjct: 132 YGREFPSSFESLVRKICRHLFHVLAHIYWAHFKETLALELHGHLNTLYVHFILFAREFNL 191

Query: 208 IDKNGVAPLYEIVE 167
           +D    A + ++ E
Sbjct: 192 LDPKETAIMDDLTE 205



>gb:AF228503_2059956 Mus musculus ovary-specific MOB-like protein
           (Mmh) mRNA, complete cds.>gb:BC037588_2098075 Mus
           musculus RIKEN cDNA 2700078K21 gene, mRNA (cDNA clone
           MGC:47044 IMAGE:5010535), complete cds.
          Length = 235

 Score =  152 bits (384), Expect = 1e-35
 Identities = 77/194 (39%), Positives = 115/194 (59%)
 Frame = -3

Query: 748 KKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTL 569
           KK      K  L  +H  + +     +E V+LP   DLNEWLA NT  FF+ +N+ Y T+
Sbjct: 15  KKPAAEEKKVYLEPEHTKSRITDFEFKELVVLPREIDLNEWLASNTTTFFHHINLQYSTI 74

Query: 568 TEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQK 389
           +EFCT  +C  M A    +  W D     K +K +AP+YVD++M  ++K + DE +FP K
Sbjct: 75  SEFCTGETCQTM-AVCNTQYYWYD--ERGKKVKCTAPQYVDFVMSSVQKLVTDEDVFPTK 131

Query: 388 FGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHL 209
           +G  FP +FE +VK I K LF V  HIY +HF++ + L+   HLNT + HF++F+ EF+L
Sbjct: 132 YGREFPSSFESLVKKICKYLFHVLGHIYWAHFKETLALELHGHLNTLYVHFILFAREFNL 191

Query: 208 IDKNGVAPLYEIVE 167
           +D    A + ++ E
Sbjct: 192 LDPKETAVMDDLTE 205



>gb:AK091808_1913568 Homo sapiens cDNA FLJ34489 fis, clone
           HLUNG2004534, weakly similar to MOB2 PROTEIN.
          Length = 139

 Score =  150 bits (379), Expect = 5e-35
 Identities = 65/137 (47%), Positives = 91/137 (66%)
 Frame = -3

Query: 571 LTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQ 392
           + E C+ +SCP+M  GP+YE  W D    ++P K+SAP+Y+  LMDWIE  ++DE +FP 
Sbjct: 1   MAERCSETSCPVMAGGPRYEYRWQDERQYRRPAKLSAPRYMALLMDWIEGLINDEEVFPT 60

Query: 391 KFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFH 212
           + G PFP NF+ V   I+ RLFRV+ H+Y  HF  I+ +  EAH+NTC+KHF  F  EF 
Sbjct: 61  RVGVPFPKNFQQVCTKILTRLFRVFVHVYIHHFDSILSMGAEAHVNTCYKHFYYFIREFS 120

Query: 211 LIDKNGVAPLYEIVESI 161
           L+D+  + PL E+ E I
Sbjct: 121 LVDQRELEPLREMTERI 137



>gb:AE016816_1746913 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome III, complete sequence.
          Length = 263

 Score =  149 bits (377), Expect = 8e-35
 Identities = 69/184 (37%), Positives = 113/184 (61%)
 Frame = -3

Query: 715 LLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPM 536
           L +  +   L  G+ +  V LP   D+ EW+A+N  +F+  +N  YG + E+ T  + P 
Sbjct: 74  LSEPFVRTALVKGSFKTIVQLPKYVDVGEWIALNIFEFYTNLNQFYGVIAEYVTAEAYPT 133

Query: 535 MTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFED 356
           M AGP+ E LW D  +  + + + A +Y+D  + WI  +++D+++FP K G PF  +F  
Sbjct: 134 MNAGPRVEYLWLDANS--RQVALPAGQYIDLALTWINNKVNDKTLFPTKSGLPFAQHFIR 191

Query: 355 VVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDKNGVAPLYE 176
            ++ I+ ++FR++AHIYH HF K + L  EAH N+ F HFV F+ EF+L+D+  +APL  
Sbjct: 192 DMQRIMIQMFRIFAHIYHHHFDKFVHLSLEAHWNSFFAHFVSFAKEFNLLDRKEMAPLEL 251

Query: 175 IVES 164
           ++ES
Sbjct: 252 LIES 255



>gb:BC061432_2553206 Xenopus tropicalis hypothetical protein
           MGC76042, mRNA (cDNA clone MGC:76042 IMAGE:5385033),
           complete cds.
          Length = 229

 Score =  145 bits (365), Expect = 2e-33
 Identities = 71/168 (42%), Positives = 104/168 (61%)
 Frame = -3

Query: 670 REAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGV 491
           ++ V LP   DLNEWLA N   FFN +N+ Y T++EFCT  +C  M A    +  W D  
Sbjct: 41  KQLVTLPQEIDLNEWLASNVTTFFNHINLQYSTISEFCTGETCQTMAAC-NTQYYWYD-- 97

Query: 490 TIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAH 311
              K +K +AP+Y+D++M  ++K + DE +FP K+G  FP +FE ++K I + LF V AH
Sbjct: 98  ERGKKLKCTAPQYIDFVMSSVQKLVTDEDVFPTKYGREFPSSFESLIKKICRYLFHVLAH 157

Query: 310 IYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDKNGVAPLYEIVE 167
           IY +HF++I  L+   HLNT F HF++F  EF L+D    + L ++ E
Sbjct: 158 IYSAHFKEITALELHGHLNTLFIHFLLFVREFSLLDPKETSILDDLSE 205



>gb:AK087285_1174889 Mus musculus 0 day neonate lung cDNA, RIKEN
           full-length enriched library, clone:E030042D21
           product:weakly similar to MOB1 PROTEIN (HYPOTHETICAL
           25.1 KDA PROTEIN) [Homo sapiens], full insert sequence.
          Length = 148

 Score =  145 bits (365), Expect = 2e-33
 Identities = 67/128 (52%), Positives = 90/128 (70%), Gaps = 1/128 (0%)
 Frame = -3

Query: 763 KTFHPKKSVPPGNKGELLQKHIDATLGSG-NLREAVLLPAGEDLNEWLAVNTVDFFNQVN 587
           KTF PK+   PG +   L K   A+L SG +LR AV LP GED N+W+AV+ VDFFN++N
Sbjct: 13  KTFRPKRKFEPGTQRFELHKRAQASLNSGVDLRAAVQLPNGEDQNDWVAVHVVDFFNRIN 72

Query: 586 ILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDE 407
           ++YGT+ EFCT  +CP+M+ GPKYE  W D +  KKP  + AP+Y++ LMDWIE Q+++E
Sbjct: 73  LIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNE 132

Query: 406 SIFPQKFG 383
            IFP   G
Sbjct: 133 DIFPTCVG 140



>gb:BC070585_2555564 Xenopus laevis cDNA clone MGC:81135
           IMAGE:6317589, complete cds.
          Length = 236

 Score =  144 bits (364), Expect = 3e-33
 Identities = 73/168 (43%), Positives = 104/168 (61%)
 Frame = -3

Query: 670 REAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGV 491
           ++ V LP   DLNEWLA N   FFN +N+ Y T++EFCT  +C  M A    +  W D  
Sbjct: 48  KQLVTLPQEIDLNEWLASNITTFFNHINLQYSTISEFCTGETCQTMAAC-NTQYYWYD-- 104

Query: 490 TIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAH 311
              K +K +AP+Y+D++M  I+K + DE +FP K+G  FP +FE +VK I + LF V AH
Sbjct: 105 ERGKKVKCTAPQYIDFVMSSIQKLVTDEDVFPTKYGREFPSSFESLVKKICRYLFHVVAH 164

Query: 310 IYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDKNGVAPLYEIVE 167
           IY +HF++I  L+   HLNT F HF++F  EF L+D    + L ++ E
Sbjct: 165 IYWAHFKEITVLELHGHLNTLFIHFLLFVREFSLLDPKETSVLDDLSE 212



>gb:AX400015_1467328 Sequence 186 from Patent WO0218424.
          Length = 401

 Score =  144 bits (364), Expect = 3e-33
 Identities = 65/124 (52%), Positives = 90/124 (72%), Gaps = 1/124 (0%)
 Frame = -3

Query: 763 KTFHPKKSVPPGNKGELLQKHIDATLGSG-NLREAVLLPAGEDLNEWLAVNTVDFFNQVN 587
           KTF PK+   PG +   L K   A+L SG +L+ AV LP+GED N+W+AV+ VDFFN++N
Sbjct: 13  KTFRPKRKFEPGTQRFELHKRAQASLNSGVDLKAAVQLPSGEDQNDWVAVHVVDFFNRIN 72

Query: 586 ILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDE 407
           ++YGT+ EFCT  +CP+M+ GPKYE  W D +  KKP  + AP+Y++ LMDWIE Q+++E
Sbjct: 73  LIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNE 132

Query: 406 SIFP 395
            IFP
Sbjct: 133 EIFP 136



>gb:BC081182_2562084 Xenopus laevis MGC84379 protein, mRNA (cDNA
           clone MGC:84379 IMAGE:6959429), complete cds.
          Length = 229

 Score =  144 bits (363), Expect = 3e-33
 Identities = 71/169 (42%), Positives = 105/169 (62%)
 Frame = -3

Query: 673 LREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADG 494
           +++ V LP   DLNEWLA +   FFN +N+ Y T++EFCT  +C  M A    +  W D 
Sbjct: 40  IKQLVTLPQEIDLNEWLASSVTTFFNHINLQYSTISEFCTGETCQTMAAC-NTQYYWYD- 97

Query: 493 VTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYA 314
               K +K +AP+Y+D++M  ++K + DE IFP K+G  FP +FE +VK I + LF V A
Sbjct: 98  -ERGKKVKCTAPQYIDFVMSSVQKLVTDEDIFPTKYGREFPSSFESLVKKICRYLFHVLA 156

Query: 313 HIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDKNGVAPLYEIVE 167
           HIY +HF++I  L+   H+NT F HF++F  EF L+D    + L ++ E
Sbjct: 157 HIYSAHFKEIAALELHGHINTLFIHFLLFVREFSLLDPKETSILDDLSE 205



>gb:AB061793_1868793 Homo sapiens moblak mRNA for MOB-LAK, complete
           cds.
          Length = 197

 Score =  144 bits (363), Expect = 3e-33
 Identities = 66/124 (53%), Positives = 90/124 (72%), Gaps = 1/124 (0%)
 Frame = -3

Query: 763 KTFHPKKSVPPGNKGELLQKHIDATLGSG-NLREAVLLPAGEDLNEWLAVNTVDFFNQVN 587
           KTF PK+   PG +   L K   A+L +G +LR AV LP GEDLN+W+AV+ VDFFN+VN
Sbjct: 14  KTFRPKRKFEPGTQRFELHKKAQASLNAGLDLRLAVQLPPGEDLNDWVAVHVVDFFNRVN 73

Query: 586 ILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDE 407
           ++YGT+++ CT  SCP+M+ GPKYE  W D    +KP  +SAP+Y+D LMDWIE Q+++E
Sbjct: 74  LIYGTISDGCTEQSCPVMSGGPKYEYRWQDEHKFRKPTALSAPRYMDLLMDWIEAQINNE 133

Query: 406 SIFP 395
            +FP
Sbjct: 134 DLFP 137



>gb:AE014296_1135842 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003544_1214818 Drosophila melanogaster
           chromosome 3L, section 41 of 83 of the complete
           sequence.
          Length = 537

 Score =  140 bits (353), Expect = 5e-32
 Identities = 76/201 (37%), Positives = 112/201 (55%)
 Frame = -3

Query: 802 SIMSLLGLASRNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWL 623
           S+ S L +A + ++            K  L +  ++  L   +L+  V LPAG D NEWL
Sbjct: 99  SVDSFLCVAGKARRKERDGDQNSTDTKLYLEESVLERKLPEADLKALVDLPAGLDYNEWL 158

Query: 622 AVNTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDY 443
           A +T+  F  VN++YGT++EFCT S C  MT       LW D     K  +V+AP+Y+DY
Sbjct: 159 ASHTLALFEHVNLVYGTISEFCTQSGCADMTGPGNRTYLWFDEKG--KKTRVAAPQYIDY 216

Query: 442 LMDWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEA 263
           +M + +K + DESIFP K+   FP +FE + + I++  F V AH+Y +HF++I  L    
Sbjct: 217 VMTFTQKTVSDESIFPTKYANEFPGSFESIARKILRLQFHVIAHLYAAHFREIALLGLHT 276

Query: 262 HLNTCFKHFVMFSWEFHLIDK 200
           HLN  F H       F+LID+
Sbjct: 277 HLNLTFAHLTALHRRFNLIDE 297



>gb:BT001864_1356637 Drosophila melanogaster RH70633 full insert
           cDNA.
          Length = 550

 Score =  139 bits (351), Expect = 8e-32
 Identities = 70/167 (41%), Positives = 100/167 (59%)
 Frame = -3

Query: 700 IDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPMMTAGP 521
           ++  L   +L+  V LPAG D NEWLA +T+  F  VN++YGT++EFCT S C  MT   
Sbjct: 162 LERKLPEADLKALVDLPAGLDYNEWLASHTLALFEHVNLVYGTISEFCTQSGCADMTGPG 221

Query: 520 KYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFEDVVKTI 341
               LW D     K  +V+AP+Y+DY+M + +K + DESIFP K+   FP +FE + + I
Sbjct: 222 NRTYLWFDEKG--KKTRVAAPQYIDYVMTFTQKTVSDESIFPTKYANEFPGSFESIARKI 279

Query: 340 VKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDK 200
           ++  F V AH+Y +HF++I  L    HLN  F H       F+LID+
Sbjct: 280 LRLQFHVIAHLYAAHFREIALLGLHTHLNLTFAHLTALHRRFNLIDE 326



>gb:AE014296_1135841 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003544_1214817 Drosophila melanogaster
           chromosome 3L, section 41 of 83 of the complete
           sequence.
          Length = 728

 Score =  139 bits (351), Expect = 8e-32
 Identities = 70/167 (41%), Positives = 100/167 (59%)
 Frame = -3

Query: 700 IDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPMMTAGP 521
           ++  L   +L+  V LPAG D NEWLA +T+  F  VN++YGT++EFCT S C  MT   
Sbjct: 324 LERKLPEADLKALVDLPAGLDYNEWLASHTLALFEHVNLVYGTISEFCTQSGCADMTGPG 383

Query: 520 KYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFEDVVKTI 341
               LW D     K  +V+AP+Y+DY+M + +K + DESIFP K+   FP +FE + + I
Sbjct: 384 NRTYLWFDEKG--KKTRVAAPQYIDYVMTFTQKTVSDESIFPTKYANEFPGSFESIARKI 441

Query: 340 VKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDK 200
           ++  F V AH+Y +HF++I  L    HLN  F H       F+LID+
Sbjct: 442 LRLQFHVIAHLYAAHFREIALLGLHTHLNLTFAHLTALHRRFNLIDE 488



>gb:AE014296_1135840 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003544_1214816 Drosophila melanogaster
           chromosome 3L, section 41 of 83 of the complete
           sequence.
          Length = 566

 Score =  139 bits (351), Expect = 8e-32
 Identities = 70/167 (41%), Positives = 100/167 (59%)
 Frame = -3

Query: 700 IDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPMMTAGP 521
           ++  L   +L+  V LPAG D NEWLA +T+  F  VN++YGT++EFCT S C  MT   
Sbjct: 162 LERKLPEADLKALVDLPAGLDYNEWLASHTLALFEHVNLVYGTISEFCTQSGCADMTGPG 221

Query: 520 KYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFEDVVKTI 341
               LW D     K  +V+AP+Y+DY+M + +K + DESIFP K+   FP +FE + + I
Sbjct: 222 NRTYLWFDEKG--KKTRVAAPQYIDYVMTFTQKTVSDESIFPTKYANEFPGSFESIARKI 279

Query: 340 VKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDK 200
           ++  F V AH+Y +HF++I  L    HLN  F H       F+LID+
Sbjct: 280 LRLQFHVIAHLYAAHFREIALLGLHTHLNLTFAHLTALHRRFNLIDE 326



>gb:AE014296_1135839 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003544_1214815 Drosophila melanogaster
           chromosome 3L, section 41 of 83 of the complete
           sequence.
          Length = 431

 Score =  139 bits (351), Expect = 8e-32
 Identities = 70/167 (41%), Positives = 100/167 (59%)
 Frame = -3

Query: 700 IDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPMMTAGP 521
           ++  L   +L+  V LPAG D NEWLA +T+  F  VN++YGT++EFCT S C  MT   
Sbjct: 27  LERKLPEADLKALVDLPAGLDYNEWLASHTLALFEHVNLVYGTISEFCTQSGCADMTGPG 86

Query: 520 KYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFEDVVKTI 341
               LW D     K  +V+AP+Y+DY+M + +K + DESIFP K+   FP +FE + + I
Sbjct: 87  NRTYLWFDEKG--KKTRVAAPQYIDYVMTFTQKTVSDESIFPTKYANEFPGSFESIARKI 144

Query: 340 VKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDK 200
           ++  F V AH+Y +HF++I  L    HLN  F H       F+LID+
Sbjct: 145 LRLQFHVIAHLYAAHFREIALLGLHTHLNLTFAHLTALHRRFNLIDE 191



>gb:AP005847_1859010 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ9990_A01.
          Length = 141

 Score =  138 bits (348), Expect = 2e-31
 Identities = 73/139 (52%), Positives = 83/139 (59%), Gaps = 45/139 (32%)
 Frame = -3

Query: 439 MDWIEKQLDDESIFPQKFG----------------------------------------- 383
           MDWIE QLDDESIFPQK G                                         
Sbjct: 1   MDWIEGQLDDESIFPQKLGNHCLSQTFDVGMVMCTLEIVQALLIYLSNFDTTHDTDMGLI 60

Query: 382 ----APFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEF 215
                PFPPNF++VVKTI KRLFRVYAHIYHS FQKI+ LKEEAHLNTCFKHF++F+ EF
Sbjct: 61  PLPGTPFPPNFKEVVKTIFKRLFRVYAHIYHSSFQKIVSLKEEAHLNTCFKHFILFTTEF 120

Query: 214 HLIDKNGVAPLYEIVESIL 158
            LIDK  +APL E++ESI+
Sbjct: 121 GLIDKKELAPLQELIESII 139



>gb:BC082348_2562585 Xenopus tropicalis MGC79814 protein, mRNA (cDNA
           clone MGC:79814 IMAGE:6986798), complete cds.
          Length = 234

 Score =  127 bits (320), Expect = 3e-28
 Identities = 74/215 (34%), Positives = 113/215 (52%), Gaps = 3/215 (1%)
 Frame = -3

Query: 790 LLGLASRNQ---KTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLA 620
           LLG   R +   K    KK + P  K  L  ++  A +   ++   V LP G ++ EWLA
Sbjct: 9   LLGYKHRTKSINKDKREKKGIEP-EKIYLEPRYTAARIVDADILMLVALPKGLNVEEWLA 67

Query: 619 VNTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYL 440
            N   F+N V++ YG ++EFCT SSCP M A    +  W D    KK  K SAP+Y DY 
Sbjct: 68  SNASAFYNHVSLFYGAISEFCTISSCPTMKAW-SIQYQWTDEKGRKK--KCSAPQYADYA 124

Query: 439 MDWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAH 260
              I+K L DE + P K    FP  F   ++   + LF +  HIY SH++ ++ L+   H
Sbjct: 125 ASIIQKILTDEDLVPTKHCKEFPKTFRPSIQKTFRLLFHLLGHIYTSHYKTVVNLELHPH 184

Query: 259 LNTCFKHFVMFSWEFHLIDKNGVAPLYEIVESILQ 155
           LNT + H ++F  EF L+D   ++   ++  ++++
Sbjct: 185 LNTLYLHLLLFCAEFQLLDSKEMSLSEDLTTALIR 219



>pir|T21979|T21979 hypothetical protein F38H4.10 - Caenorhabditis
           elegans
          Length = 152

 Score =  125 bits (314), Expect = 2e-27
 Identities = 65/179 (36%), Positives = 96/179 (53%)
 Frame = -3

Query: 694 ATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKY 515
           +TLGSGNLR+A+ LP GED NEWLAVN+                                
Sbjct: 15  STLGSGNLRDALKLPPGEDKNEWLAVNS-------------------------------- 42

Query: 514 ECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVK 335
                        +  SAP+Y+D  +   +  +DDE++FP + G  FP +FE+  + I++
Sbjct: 43  ------------KLNTSAPQYIDLSLTACQNNVDDENVFPSEIGKQFPTDFEERCQAIMR 90

Query: 334 RLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDKNGVAPLYEIVESIL 158
           RLFR+YAH+Y +H      +K  AHLNT FK FV+F+ +F L++K    PL EI+E+++
Sbjct: 91  RLFRIYAHVYFAHVNHFKAIKALAHLNTSFKQFVLFANQFQLLNKEETEPLREIIENLI 149



>gb:AK028695_1161113 Mus musculus 10 days neonate skin cDNA, RIKEN
           full-length enriched library, clone:4732438E01
           product:MOB1 PROTEIN (HYPOTHETICAL 25.1 KDA PROTEIN)
           homolog [Homo sapiens], full insert sequence.
          Length = 140

 Score =  104 bits (260), Expect = 3e-21
 Identities = 46/73 (63%), Positives = 57/73 (78%)
 Frame = -3

Query: 379 PFPPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDK 200
           PFP NF  V KTI+KRLFRVYAHIYH HF  ++ L+EEAHLNT FKHF+ F  EF+LID+
Sbjct: 63  PFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDR 122

Query: 199 NGVAPLYEIVESI 161
             +APL E++E +
Sbjct: 123 RELAPLQELIEKL 135



 Score = 83.2 bits (204), Expect = 9e-15
 Identities = 41/65 (63%), Positives = 51/65 (78%)
 Frame = -3

Query: 796 MSLLGLASRNQKTFHPKKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAV 617
           MS L  +SR+ KTF PKK++P G+    L KH +ATLGSGNLR+AV+LP GEDLNEW+AV
Sbjct: 1   MSFL-FSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAV 59

Query: 616 NTVDF 602
           N+V F
Sbjct: 60  NSVPF 64



>gb:AK012535_1157014 Mus musculus 11 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2700078K21
           product:OVARY-SPECIFIC MOB-LIKE PROTEIN homolog [Mus
           musculus], full insert sequence.
          Length = 150

 Score =  104 bits (259), Expect = 4e-21
 Identities = 45/105 (42%), Positives = 71/105 (67%)
 Frame = -3

Query: 481 KPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYH 302
           K +K +AP+YVD++M  ++K + DE +FP K+G  FP +FE +VK I K LF V  HIY 
Sbjct: 16  KKVKCTAPQYVDFVMSSVQKLVTDEDVFPTKYGREFPSSFESLVKKICKYLFHVLGHIYW 75

Query: 301 SHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDKNGVAPLYEIVE 167
           +HF++ + L+   HLNT + HF++F+ EF+L+D    A + ++ E
Sbjct: 76  AHFKETLALELHGHLNTLYVHFILFAREFNLLDPKETAVMDDLTE 120



>gb:AK057350_1911994 Homo sapiens cDNA FLJ32788 fis, clone
           TESTI2002294, weakly similar to MOB2 PROTEIN.
          Length = 142

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 49/127 (38%), Positives = 71/127 (55%), Gaps = 1/127 (0%)
 Frame = -3

Query: 748 KKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTL 569
           KK      K  L  +H  A +     +E V+LP   DLNEWLA NT  FF+ +N+ Y T+
Sbjct: 15  KKPAAEERKAYLEPEHTKARITDFQFKELVVLPRKIDLNEWLASNTTTFFHHINLQYSTI 74

Query: 568 TEFCTPSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQK 389
           +EFCT  +C  M A    +  W D     K +K +AP+YVD++M  ++K + DE +FP K
Sbjct: 75  SEFCTGETCQTM-AVCNTQYYWYD--ERGKKVKCTAPQYVDFVMSSVQKLVTDEDVFPTK 131

Query: 388 F-GAPFP 371
           +  +P P
Sbjct: 132 YENSPAP 138



>gb:CEF09A5_1362109 Caenorhabditis elegans cosmid F09A5, complete
           sequence.>gb:CEF48C11_1364108 Caenorhabditis elegans
           cosmid F48C11, complete sequence.
          Length = 350

 Score = 87.4 bits (215), Expect = 5e-16
 Identities = 52/165 (31%), Positives = 74/165 (44%)
 Frame = -3

Query: 655 LPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKP 476
           LP G +  EW+A N +  F  VN L GTL+E CT  SCP M+     + ++ D     K 
Sbjct: 134 LPEGIEKREWIAHNVLGLFEHVNALCGTLSEVCTQQSCPHMSFPGTSKAIYTD--ERGKR 191

Query: 475 IKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSH 296
               A +Y+D ++   E     E IFP K+G  F  NFE  VK ++  LF    H+Y  H
Sbjct: 192 QVYPAVQYIDCVITQCESMSRQEEIFPTKYGNKFNGNFEPAVKKMLSHLFHCMGHMYLKH 251

Query: 295 FQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDKNGVAPLYEIVESI 161
           +  +  L+        F H       F L+D      + E V  +
Sbjct: 252 WDVLGALQLRPQCAIVFAHIAELGRTFSLLDAKDQEQVDECVTEV 296



>gb:CEF09A5_1362107 Caenorhabditis elegans cosmid F09A5, complete
           sequence.
          Length = 314

 Score = 87.4 bits (215), Expect = 5e-16
 Identities = 52/165 (31%), Positives = 74/165 (44%)
 Frame = -3

Query: 655 LPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKP 476
           LP G +  EW+A N +  F  VN L GTL+E CT  SCP M+     + ++ D     K 
Sbjct: 98  LPEGIEKREWIAHNVLGLFEHVNALCGTLSEVCTQQSCPHMSFPGTSKAIYTD--ERGKR 155

Query: 475 IKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSH 296
               A +Y+D ++   E     E IFP K+G  F  NFE  VK ++  LF    H+Y  H
Sbjct: 156 QVYPAVQYIDCVITQCESMSRQEEIFPTKYGNKFNGNFEPAVKKMLSHLFHCMGHMYLKH 215

Query: 295 FQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDKNGVAPLYEIVESI 161
           +  +  L+        F H       F L+D      + E V  +
Sbjct: 216 WDVLGALQLRPQCAIVFAHIAELGRTFSLLDAKDQEQVDECVTEV 260



>gb:CEF09A5_1362105 Caenorhabditis elegans cosmid F09A5, complete
           sequence.
          Length = 324

 Score = 87.4 bits (215), Expect = 5e-16
 Identities = 52/165 (31%), Positives = 74/165 (44%)
 Frame = -3

Query: 655 LPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKP 476
           LP G +  EW+A N +  F  VN L GTL+E CT  SCP M+     + ++ D     K 
Sbjct: 108 LPEGIEKREWIAHNVLGLFEHVNALCGTLSEVCTQQSCPHMSFPGTSKAIYTD--ERGKR 165

Query: 475 IKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSH 296
               A +Y+D ++   E     E IFP K+G  F  NFE  VK ++  LF    H+Y  H
Sbjct: 166 QVYPAVQYIDCVITQCESMSRQEEIFPTKYGNKFNGNFEPAVKKMLSHLFHCMGHMYLKH 225

Query: 295 FQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDKNGVAPLYEIVESI 161
           +  +  L+        F H       F L+D      + E V  +
Sbjct: 226 WDVLGALQLRPQCAIVFAHIAELGRTFSLLDAKDQEQVDECVTEV 270



>pir|T20626|T20626 hypothetical protein F09A5.4b - Caenorhabditis
           elegans>gb:CEF09A5_1362108 Caenorhabditis elegans cosmid
           F09A5, complete sequence.
          Length = 341

 Score = 87.4 bits (215), Expect = 5e-16
 Identities = 52/165 (31%), Positives = 74/165 (44%)
 Frame = -3

Query: 655 LPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKP 476
           LP G +  EW+A N +  F  VN L GTL+E CT  SCP M+     + ++ D     K 
Sbjct: 125 LPEGIEKREWIAHNVLGLFEHVNALCGTLSEVCTQQSCPHMSFPGTSKAIYTD--ERGKR 182

Query: 475 IKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSH 296
               A +Y+D ++   E     E IFP K+G  F  NFE  VK ++  LF    H+Y  H
Sbjct: 183 QVYPAVQYIDCVITQCESMSRQEEIFPTKYGNKFNGNFEPAVKKMLSHLFHCMGHMYLKH 242

Query: 295 FQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDKNGVAPLYEIVESI 161
           +  +  L+        F H       F L+D      + E V  +
Sbjct: 243 WDVLGALQLRPQCAIVFAHIAELGRTFSLLDAKDQEQVDECVTEV 287



>pir|T20627|T20627 hypothetical protein F09A5.4a - Caenorhabditis
           elegans>gb:CEF09A5_1362106 Caenorhabditis elegans cosmid
           F09A5, complete sequence.
          Length = 300

 Score = 87.4 bits (215), Expect = 5e-16
 Identities = 52/165 (31%), Positives = 74/165 (44%)
 Frame = -3

Query: 655 LPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKP 476
           LP G +  EW+A N +  F  VN L GTL+E CT  SCP M+     + ++ D     K 
Sbjct: 84  LPEGIEKREWIAHNVLGLFEHVNALCGTLSEVCTQQSCPHMSFPGTSKAIYTD--ERGKR 141

Query: 475 IKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSH 296
               A +Y+D ++   E     E IFP K+G  F  NFE  VK ++  LF    H+Y  H
Sbjct: 142 QVYPAVQYIDCVITQCESMSRQEEIFPTKYGNKFNGNFEPAVKKMLSHLFHCMGHMYLKH 201

Query: 295 FQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDKNGVAPLYEIVESI 161
           +  +  L+        F H       F L+D      + E V  +
Sbjct: 202 WDVLGALQLRPQCAIVFAHIAELGRTFSLLDAKDQEQVDECVTEV 246



>gb:CR859744_1183847 Pongo pygmaeus mRNA; cDNA DKFZp468D176 (from
           clone DKFZp468D176).
          Length = 204

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 49/187 (26%), Positives = 84/187 (44%), Gaps = 1/187 (0%)
 Frame = -3

Query: 733 PGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCT 554
           PG K + +Q++I A     N+ + +  P G+D   W   +   F  ++N L   L   C 
Sbjct: 15  PGTKAQYIQQNIRADCS--NIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECH 72

Query: 553 PSSCPMMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPF 374
           P +C  MTA  ++  L A     K P +  A  Y  + +D     LD    FP +     
Sbjct: 73  PDTCTQMTATEQWIFLCA---AHKTPKECPAIDYTRHTLDGAACLLDSNKYFPSR--VSI 127

Query: 373 PPNFEDVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDK-N 197
             +    + ++ +R++R+++H Y  H Q     + E  L   F  FVM   +++L+ K N
Sbjct: 128 KESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVM---KYNLMSKDN 184

Query: 196 GVAPLYE 176
            + P+ E
Sbjct: 185 LIVPILE 191



>gb:BC076155_2559029 Danio rerio zgc:92671, mRNA (cDNA clone
           MGC:92671 IMAGE:7073531), complete cds.
          Length = 225

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 45/182 (24%), Positives = 81/182 (44%), Gaps = 3/182 (1%)
 Frame = -3

Query: 712 LQKHIDATLGS--GNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCP 539
           +Q++I   + S   N+ + +  P G+D   W   +   F  ++N L   L   C P +C 
Sbjct: 39  VQQYIQQNIRSDCSNIEKIMEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQNECHPDTCT 98

Query: 538 MMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFE 359
            MTA  ++  L A     K P +  A  Y  + +D     L+    FP +       +  
Sbjct: 99  QMTATEQWIFLCA---AHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSR--VSIKESSV 153

Query: 358 DVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDK-NGVAPL 182
             + ++ +R++R+++H Y  H Q     + E  L   F  FVM   +++L+ K N + P+
Sbjct: 154 AKLGSVCRRIYRIFSHAYFHHRQIFDKYENETFLCHRFTRFVM---KYNLMSKDNLIVPI 210

Query: 181 YE 176
            E
Sbjct: 211 LE 212



>gb:AE013599_1130268 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003790_1224637 Drosophila melanogaster
           chromosome 2R, section 7 of 74 of the complete
           sequence.>gb:AY070538_1294683 Drosophila melanogaster
           LD21194 full insert cDNA.
          Length = 223

 Score = 51.6 bits (122), Expect = 3e-05
 Identities = 40/166 (24%), Positives = 76/166 (45%), Gaps = 1/166 (0%)
 Frame = -3

Query: 676 NLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWAD 497
           N+   + +P  +D   W   +   F  ++N L   L + C+PS+C  MTA  ++  L A 
Sbjct: 53  NVELILTMPEAQDEGVWKYEHLRQFCMELNGLAVRLQKECSPSTCTQMTATDQWIFLCA- 111

Query: 496 GVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVY 317
               K P +  A  Y  + +D     L+    FP +       +    + ++ +R++R++
Sbjct: 112 --AHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSR--VSIKESSVTKLGSVCRRVYRIF 167

Query: 316 AHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDK-NGVAPL 182
           +H Y  H +     + E +L   F HFV    +++L+ K N + P+
Sbjct: 168 SHAYFHHRRIFDEFEAETYLCHRFTHFVT---KYNLMSKENLIVPI 210



>gb:AF250319_1892957 Homo sapiens CGI95-iso mRNA, complete cds.
          Length = 193

 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 45/182 (24%), Positives = 81/182 (44%), Gaps = 1/182 (0%)
 Frame = -3

Query: 718 ELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCP 539
           + +Q++I A     N+ + +  P G+D   W   +   F  ++N L   L   C P +C 
Sbjct: 9   QYIQQNIRADCS--NIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCT 66

Query: 538 MMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFE 359
            MTA  ++  L A     K P +  A  Y  + +D     L+    FP +       +  
Sbjct: 67  QMTATEQWIFLCA---AHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSR--VSIKESSV 121

Query: 358 DVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDK-NGVAPL 182
             + ++ +R++R+++H Y  H Q     + E  L   F  FVM   +++L+ K N + P+
Sbjct: 122 AKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVM---KYNLMSKDNLIVPI 178

Query: 181 YE 176
            E
Sbjct: 179 LE 180



>gb:AF093825_1882719 Homo sapiens 2C4D mRNA, complete cds.
          Length = 223

 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 45/182 (24%), Positives = 81/182 (44%), Gaps = 1/182 (0%)
 Frame = -3

Query: 718 ELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCP 539
           + +Q++I A     N+ + +  P G+D   W   +   F  ++N L   L   C P +C 
Sbjct: 39  QYIQQNIRADCS--NIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCT 96

Query: 538 MMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFE 359
            MTA  ++  L A     K P +  A  Y  + +D     L+    FP +       +  
Sbjct: 97  QMTATEQWIFLCA---AHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSR--VSIKESSV 151

Query: 358 DVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDK-NGVAPL 182
             + ++ +R++R+++H Y  H Q     + E  L   F  FVM   +++L+ K N + P+
Sbjct: 152 AKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVM---KYNLMSKDNLIVPI 208

Query: 181 YE 176
            E
Sbjct: 209 LE 210



>gb:AB015441_1864722 Homo sapiens mRNA for Mob3, complete
           cds.>gb:AF151853_1886339 Homo sapiens CGI-95 protein
           mRNA, complete cds.>gb:BC005237_1969704 Homo sapiens
           preimplantation protein 3, transcript variant 1, mRNA
           (cDNA clone MGC:12264 IMAGE:3996585), complete
           cds.>gb:CR457371_1993578 Homo sapiens full open reading
           frame cDNA clone RZPDo834C1210D for gene PREI3,
           preimplantation protein 3; complete cds, incl.
           stopcodon.>gb:HSA580638_2009767 Homo sapiens mRNA for
           Mob1 protein (MOB1 gene).>gb:BC037499_2098070 Mus
           musculus preimplantation protein 3, mRNA (cDNA clone
           MGC:47908 IMAGE:1512578), complete
           cds.>gb:BC058168_2103078 Mus musculus preimplantation
           protein 3, mRNA (cDNA clone MGC:68122 IMAGE:4980300),
           complete cds.>gb:BC085708_2109284 Rattus norvegicus
           preimplantation protein 3, mRNA (cDNA clone MGC:93220
           IMAGE:7193103), complete cds.>gb:RNO132008_2135381
           Rattus norvegicus mRNA for phocein protein.
          Length = 225

 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 45/182 (24%), Positives = 81/182 (44%), Gaps = 1/182 (0%)
 Frame = -3

Query: 718 ELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCP 539
           + +Q++I A     N+ + +  P G+D   W   +   F  ++N L   L   C P +C 
Sbjct: 41  QYIQQNIRADCS--NIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCT 98

Query: 538 MMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFE 359
            MTA  ++  L A     K P +  A  Y  + +D     L+    FP +       +  
Sbjct: 99  QMTATEQWIFLCA---AHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSR--VSIKESSV 153

Query: 358 DVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDK-NGVAPL 182
             + ++ +R++R+++H Y  H Q     + E  L   F  FVM   +++L+ K N + P+
Sbjct: 154 AKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVM---KYNLMSKDNLIVPI 210

Query: 181 YE 176
            E
Sbjct: 211 LE 212



>gb:CR858003_1182194 Pongo pygmaeus mRNA; cDNA DKFZp468L107 (from
           clone DKFZp468L107).
          Length = 225

 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 45/182 (24%), Positives = 81/182 (44%), Gaps = 1/182 (0%)
 Frame = -3

Query: 718 ELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCP 539
           + +Q++I A     N+ + +  P G+D   W   +   F  ++N L   L   C P +C 
Sbjct: 41  QYIQQNIRADCS--NIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCT 98

Query: 538 MMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFE 359
            MTA  ++  L A     K P +  A  Y  + +D     L+    FP +       +  
Sbjct: 99  QMTATEQWIFLCA---AHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSR--VSIKESSV 153

Query: 358 DVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDK-NGVAPL 182
             + ++ +R++R+++H Y  H Q     + E  L   F  FVM   +++L+ K N + P+
Sbjct: 154 AKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVM---KYNLMSKDNLIVPI 210

Query: 181 YE 176
            E
Sbjct: 211 LE 212



>gb:AK027043_1910789 Homo sapiens cDNA: FLJ23390 fis, clone
           HEP17176.
          Length = 225

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 47/184 (25%), Positives = 81/184 (44%), Gaps = 3/184 (1%)
 Frame = -3

Query: 718 ELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCP 539
           + +Q++I A     N+ + +  P G+D   W   +   F  ++N L   L   C P +C 
Sbjct: 41  QYIQQNIRADCS--NIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQGECHPDTCT 98

Query: 538 MMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFE 359
            MTA  ++  L A     K P +  A  Y  + +D     L+    FP +          
Sbjct: 99  QMTATEQWIFLCA---AHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSI----KES 151

Query: 358 DVVK--TIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDK-NGVA 188
            V K  ++ +R++R+++H Y  H Q     + E  L   F  FVM   +++L+ K N + 
Sbjct: 152 SVAKLGSVCRRIYRIFSHAYSHHRQIFDEYENETFLCHRFTKFVM---KYNLMSKDNLIV 208

Query: 187 PLYE 176
           P+ E
Sbjct: 209 PILE 212



>gb:BC088913_2565965 Xenopus laevis hypothetical LOC496323, mRNA
           (cDNA clone MGC:84962 IMAGE:6323888), complete cds.
          Length = 225

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 43/162 (26%), Positives = 70/162 (43%), Gaps = 3/162 (1%)
 Frame = -3

Query: 652 PAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYECLWADGVTIKKPI 473
           P G+D   W   +   F  ++N L   L   C P +C  MTA  ++  L A     K P 
Sbjct: 61  PEGQDEGVWKYEHLRQFCLELNGLAVKLQTECHPDTCTQMTATEQWIFLCA---AHKTPK 117

Query: 472 KVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFEDVVK--TIVKRLFRVYAHIYHS 299
           +  A  Y  + +D     L+    FP +           V K  ++ +R++R+++H Y  
Sbjct: 118 ECPAIDYTRHTLDGAACLLNSNKYFPSRVSI----KESSVAKLGSVCRRIYRIFSHAYFH 173

Query: 298 HFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDK-NGVAPLYE 176
           H Q     + E  L   F  FVM   +++L+ K N + P+ E
Sbjct: 174 HRQIFDEYENETFLCHRFTKFVM---KYNLMSKDNLIVPILE 212



>pir|S44776|S44776 C30A5 protein - Caenorhabditis elegans
          Length = 261

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 38/166 (22%), Positives = 72/166 (43%), Gaps = 6/166 (3%)
 Frame = -3

Query: 712 LQKHIDATLGSGNLREAVLL--PAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCP 539
           +Q++I  T+ +     A +L  P  +D   W   +   F  ++N L   L   C P +C 
Sbjct: 77  IQQYIQQTIKANPADVATILTPPLDQDEGVWKYEHLRQFCIELNGLALLLQRECIPETCQ 136

Query: 538 MMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFE 359
            MTA  ++  L A     K P +  A  Y  + +D     L+    FP +       N +
Sbjct: 137 QMTATEQWIFLCA---AHKNPNECPAIDYTRHTLDGAATLLNSNKYFPSRV------NIK 187

Query: 358 DV----VKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFV 233
           ++    + ++ +R++R+++H +  H +     + E HL   F  +V
Sbjct: 188 EISISKLGSVARRVYRIFSHAFFHHRKLFDEFENETHLCKRFTTYV 233



>sp|P34349|YK83_CAEEL Hypothetical protein C30A5.3 in chromosome
           III.>gb:L10990_1386818 Caenorhabditis elegans cosmid
           C30A5, complete sequence.
          Length = 223

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 38/166 (22%), Positives = 72/166 (43%), Gaps = 6/166 (3%)
 Frame = -3

Query: 712 LQKHIDATLGSGNLREAVLL--PAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCP 539
           +Q++I  T+ +     A +L  P  +D   W   +   F  ++N L   L   C P +C 
Sbjct: 39  IQQYIQQTIKANPADVATILTPPLDQDEGVWKYEHLRQFCIELNGLALLLQRECIPETCQ 98

Query: 538 MMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFE 359
            MTA  ++  L A     K P +  A  Y  + +D     L+    FP +       N +
Sbjct: 99  QMTATEQWIFLCA---AHKNPNECPAIDYTRHTLDGAATLLNSNKYFPSRV------NIK 149

Query: 358 DV----VKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFV 233
           ++    + ++ +R++R+++H +  H +     + E HL   F  +V
Sbjct: 150 EISISKLGSVARRVYRIFSHAFFHHRKLFDEFENETHLCKRFTTYV 195



>gb:AK020446_1160430 Mus musculus 12 days embryo embryonic body
           between diaphragm region and neck cDNA, RIKEN
           full-length enriched library, clone:9430030N12
           product:preimplantation protein 3, full insert sequence.
          Length = 225

 Score = 47.0 bits (110), Expect = 7e-04
 Identities = 44/182 (24%), Positives = 80/182 (43%), Gaps = 1/182 (0%)
 Frame = -3

Query: 718 ELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCP 539
           + +Q++I A     N+ + +  P G+D   W   +   F  ++N L   L   C P +C 
Sbjct: 41  QYIQQNIRADCS--NIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCT 98

Query: 538 MMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFE 359
            MTA  ++  L A     K P +  A  Y  + +D     L+     P +       +  
Sbjct: 99  QMTATEQWIFLCA---AHKTPKECPAIDYTRHTLDGAACLLNSNKYSPSR--VSIKESSV 153

Query: 358 DVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHFVMFSWEFHLIDK-NGVAPL 182
             + ++ +R++R+++H Y  H Q     + E  L   F  FVM   +++L+ K N + P+
Sbjct: 154 AKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVM---KYNLMSKDNLIVPI 210

Query: 181 YE 176
            E
Sbjct: 211 LE 212



>gb:CR627409_1180780 Homo sapiens mRNA; cDNA DKFZp686N2312 (from
           clone DKFZp686N2312).
          Length = 91

 Score = 41.2 bits (95), Expect = 0.040
 Identities = 23/45 (51%), Positives = 28/45 (62%), Gaps = 1/45 (2%)
 Frame = -3

Query: 763 KTFHPKKSVPPGNKGELLQKHIDATLGSG-NLREAVLLPAGEDLN 632
           KTF PK+   PG +   L K   A+L +G +LR AV LP GEDLN
Sbjct: 14  KTFRPKRKFEPGTQRFELHKKAQASLNAGLDLRLAVQLPPGEDLN 58



 Score = 35.4 bits (80), Expect = 2.2
 Identities = 16/29 (55%), Positives = 19/29 (65%)
 Frame = -3

Query: 259 LNTCFKHFVMFSWEFHLIDKNGVAPLYEI 173
           LNTC+KHF  F  EF LID   + PL E+
Sbjct: 57  LNTCYKHFYYFVKEFGLIDTKELEPLKEM 85



>gb:AE017350_1759002 Cryptococcus neoformans var. neoformans JEC21
           chromosome 10, complete sequence.
          Length = 651

 Score = 38.5 bits (88), Expect = 0.26
 Identities = 37/160 (23%), Positives = 66/160 (41%), Gaps = 1/160 (0%)
 Frame = -3

Query: 646 GEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPMMTAGP-KYECLWADGVTIKKPIK 470
           G D + W+  +       +  L   L   CT  +CP M +    Y C+ A G   ++   
Sbjct: 76  GPDRDVWIYEHLRRIPIDLTPLITALLPICTRETCPQMRSSEWSYFCV-AHGSGTRE--- 131

Query: 469 VSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSHFQ 290
            S   Y+ + +D     L++   FP +     PP       +I +RL R+++H Y  H +
Sbjct: 132 CSTIDYILHTLDSTVTLLNNSKHFPSRMH--IPPASVSHFPSIFRRLSRIFSHAYFHHRE 189

Query: 289 KIIGLKEEAHLNTCFKHFVMFSWEFHLIDKNGVAPLYEIV 170
             I  + E   N+ +  FV     + L+ +  +    E+V
Sbjct: 190 AFIMAEVE---NSLYARFVELCEAYELVGERLLVIPKEVV 226



>pir|T12466|T12466 hypothetical protein DKFZp564M112.1 -
           human>gb:HSM800571_2017160 Homo sapiens mRNA; cDNA
           DKFZp564M112 (from clone DKFZp564M112); complete cds.
          Length = 194

 Score = 35.4 bits (80), Expect = 2.2
 Identities = 39/161 (24%), Positives = 65/161 (40%)
 Frame = -3

Query: 718 ELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCP 539
           + +Q++I A     N+ + +  P G+D   W   +   F  ++N L   L   C P +C 
Sbjct: 41  QYIQQNIRADCS--NIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCT 98

Query: 538 MMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQKFGAPFPPNFE 359
            MTA  ++  L A     K P +  A  Y  + +D     L+    FP +          
Sbjct: 99  QMTATEQWIFLCA---AHKTPKECPAIDYTRHTLDGAACPLNSNKYFPSRV--------- 146

Query: 358 DVVKTIVKRLFRVYAHIYHSHFQKIIGLKEEAHLNTCFKHF 236
            + ++ V +L  V   IY   F  +I +     +N   KHF
Sbjct: 147 SIKESSVAKLGSVCRRIYRI-FHMLIFIIGRYLMNMKTKHF 186



>sp|Q03214|YM42_YEAST Hypothetical 162.7 kDa protein in SIP18-SPT21
           intergenic region.>pir|S55123|S55123 hypothetical
           protein YMR176w - yeast (Saccharomyces
           cerevisiae)>gb:SC8010_1705397 S.cerevisiae chromosome
           XIII cosmid 8010.
          Length = 1411

 Score = 34.7 bits (78), Expect = 3.7
 Identities = 30/121 (24%), Positives = 46/121 (38%), Gaps = 2/121 (1%)
 Frame = -3

Query: 649 AGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCPMMTAGPKYE-CLWADGVTIKKPI 473
           AG   +E+  +  +         + +LTEF    +    T  P Y+   W +G+ I    
Sbjct: 326 AGSINHEFKRMRDIKHIKGFPTYFNSLTEFKLGYTQSTETTLPGYDFTFWENGMEIYDKS 385

Query: 472 KVSAPKYVDY-LMDWIEKQLDDESIFPQKFGAPFPPNFEDVVKTIVKRLFRVYAHIYHSH 296
           K        Y L  + EK L   +    KFG+ +P  F        K   R+Y H+   H
Sbjct: 386 KYETKTSPVYNLRQYYEKSLAVFTAIVAKFGSSYPDLFAKHTTLPQKEFERLYFHLLSEH 445

Query: 295 F 293
           F
Sbjct: 446 F 446



>gb:AX886153_1481606 Sequence 2016 from Patent EP1033401.
          Length = 64

 Score = 33.5 bits (75), Expect = 8.2
 Identities = 18/45 (40%), Positives = 22/45 (48%)
 Frame = -3

Query: 748 KKSVPPGNKGELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVN 614
           KK      K  L  +H  A +     +E V+LP   DLNEWLA N
Sbjct: 15  KKPAAEERKAYLEPEHTKARITDFQFKELVVLPREIDLNEWLASN 59



>gb:AY231687_1176980 Drosophila yakuba clone yak-em_CG8707 mRNA
           sequence.
          Length = 224

 Score = 33.5 bits (75), Expect = 8.2
 Identities = 16/50 (32%), Positives = 27/50 (54%)
 Frame = +2

Query: 560 ELSESAIQYIHLVKEVNSIYSQPLIKIFPCWQQHCFPQIATPQGGINMFL 709
           +LSE+ +  IHL   + SIY   + + F    Q   PQ+ T +  +N+F+
Sbjct: 145 DLSEAGLNQIHLSFHLTSIYDHSIFEAFSKVVQKLIPQLPTLENLLNIFI 194



>gb:AK034840_1163894 Mus musculus 12 days embryo embryonic body
           between diaphragm region and neck cDNA, RIKEN
           full-length enriched library, clone:9430045P06
           product:preimplantation protein 3, full insert sequence.
          Length = 145

 Score = 33.5 bits (75), Expect = 8.2
 Identities = 28/110 (25%), Positives = 47/110 (42%)
 Frame = -3

Query: 718 ELLQKHIDATLGSGNLREAVLLPAGEDLNEWLAVNTVDFFNQVNILYGTLTEFCTPSSCP 539
           + +Q++I A     N+ + +  P G+D   W   +   F  ++N L   L   C P +C 
Sbjct: 41  QYIQQNIRADCS--NIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCT 98

Query: 538 MMTAGPKYECLWADGVTIKKPIKVSAPKYVDYLMDWIEKQLDDESIFPQK 389
            MTA  ++  L A     K P +  A  Y  + +D     L+    FP +
Sbjct: 99  QMTATEQWIFLCA---AHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSR 145


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,224,835,684
Number of Sequences: 1806583
Number of extensions: 26049097
Number of successful extensions: 81822
Number of sequences better than 10.0: 114
Number of HSP's better than 10.0 without gapping: 77360
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 81725
length of database: 581,917,975
effective HSP length: 126
effective length of database: 354,288,517
effective search space used: 89989283318
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)