BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig9188
         (750 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB026646_1517187 Arabidopsis thaliana genomic DNA, chromosome...   179   5e-44   
gb:AY085827_1570892 Arabidopsis thaliana clone 18740 mRNA, compl...   174   1e-42   
pir|E96524|E96524 protein T1N15.5 [imported] - Arabidopsis thali...   108   1e-22   Arabidopsis thaliana [mouse-ear cress]
gb:AY088912_1573920 Arabidopsis thaliana clone 99461 mRNA, compl...   100   4e-20   
gb:AB005238_1509424 Arabidopsis thaliana genomic DNA, chromosome...   100   4e-20   
gb:AP004880_1846509 Oryza sativa (japonica cultivar-group) genom...    97   3e-19   
gb:ATAC012328_1543423 Arabidopsis thaliana chromosome III BAC T1...    96   5e-19   
gb:AY187626_1588164 Solanum tuberosum Erwinia induced protein 2 ...    94   2e-18   
gb:AY566695_1178623 Xerophyta humilis clone LD9 unknown mRNA.          72   1e-11   
gb:BT020260_1642655 Arabidopsis thaliana At3g21820 gene, complet...    33   5.6     
gb:AB025634_1516620 Arabidopsis thaliana genomic DNA, chromosome...    33   5.6     


>gb:AB026646_1517187 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MIG5.>gb:AY063848_1565796 Arabidopsis thaliana
           unknown protein (At3g17780) mRNA, complete
           cds.>gb:AY117324_1579365 Arabidopsis thaliana unknown
           protein (At3g17780) mRNA, complete cds.
          Length = 129

 Score =  179 bits (454), Expect = 5e-44
 Identities = 81/128 (63%), Positives = 99/128 (77%)
 Frame = +3

Query: 87  MALQWIILTYXXXXXXXXXXXXTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY 266
           MALQW+IL+Y            TLP P  L+ RIVSLISL L P+  IV FA FQLLDIY
Sbjct: 1   MALQWLILSYVVAAEVAIAVILTLPYPMLLKKRIVSLISLILNPAASIVAFAGFQLLDIY 60

Query: 267 WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME 446
           WKNEHRL+C+ E+CT  ERDR+EKS+YKAQRNG+LC A  LLYWCI+RICKY+K+++R+E
Sbjct: 61  WKNEHRLLCSSEVCTTTERDRHEKSVYKAQRNGVLCAAGILLYWCIFRICKYHKDLERLE 120

Query: 447 EVEKRAKD 470
           ++EKR KD
Sbjct: 121 QLEKRYKD 128



>gb:AY085827_1570892 Arabidopsis thaliana clone 18740 mRNA, complete
           sequence.>gb:BT002443_1636046 Arabidopsis thaliana
           expressed protein (At1g48440) mRNA, complete
           cds.>gb:BT008440_1639657 Arabidopsis thaliana At1g48440
           gene, complete cds.
          Length = 129

 Score =  174 bits (442), Expect = 1e-42
 Identities = 81/128 (63%), Positives = 95/128 (74%)
 Frame = +3

Query: 87  MALQWIILTYXXXXXXXXXXXXTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY 266
           MALQW+IL+Y            TLP P  L+ R+V L+SL LQP+  IV FA FQLLDIY
Sbjct: 1   MALQWLILSYVVAVEVVITLVLTLPYPMLLKKRVVQLVSLILQPAASIVAFAGFQLLDIY 60

Query: 267 WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME 446
           WK EHRL C+ E+CTA ERDRYEKSIYKAQRN +LC A  LLYWCIYRICKYNK+++R+E
Sbjct: 61  WKAEHRLSCSSEVCTATERDRYEKSIYKAQRNVVLCAAGILLYWCIYRICKYNKDLERLE 120

Query: 447 EVEKRAKD 470
             EKR K+
Sbjct: 121 ATEKRFKE 128



>pir|E96524|E96524 protein T1N15.5 [imported] - Arabidopsis
           thaliana>gb:AE005173_892804 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC020889_1538630 Genomic sequence for
           Arabidopsis thaliana BAC T1N15 from chromosome I,
           complete sequence.
          Length = 90

 Score =  108 bits (269), Expect = 1e-22
 Identities = 51/86 (59%), Positives = 60/86 (69%)
 Frame = +3

Query: 87  MALQWIILTYXXXXXXXXXXXXTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY 266
           MALQW+IL+Y            TLP P  L+ R+V L+SL LQP+  IV FA FQLLDIY
Sbjct: 1   MALQWLILSYVVAVEVVITLVLTLPYPMLLKKRVVQLVSLILQPAASIVAFAGFQLLDIY 60

Query: 267 WKNEHRLMCTGEICTAAERDRYEKSI 344
           WK EHRL C+ E+CTA ERDRYEKS+
Sbjct: 61  WKAEHRLSCSSEVCTATERDRYEKSV 86



>gb:AY088912_1573920 Arabidopsis thaliana clone 99461 mRNA, complete
           sequence.
          Length = 130

 Score =  100 bits (248), Expect = 4e-20
 Identities = 47/128 (36%), Positives = 73/128 (57%)
 Frame = +3

Query: 87  MALQWIILTYXXXXXXXXXXXXTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY 266
           MAL+W++L Y            T+P    LR  +V++    L+P L I+PF  F L+DIY
Sbjct: 1   MALEWVVLGYAAAAEAIMVILLTMPGLDALRKGLVAVTRNLLKPFLSIIPFCLFLLMDIY 60

Query: 267 WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME 446
           WK E R  C G+ CT +E  R++KSI K+QRN +L  +A + YW +Y +      I+++ 
Sbjct: 61  WKYETRPSCDGDSCTPSEHLRHQKSIMKSQRNALLIASALVFYWILYSVTNLVVRIEQLN 120

Query: 447 EVEKRAKD 470
           +  +R K+
Sbjct: 121 QRVERLKN 128



>gb:AB005238_1509424 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MKP11.>gb:AY063960_1565905 Arabidopsis thaliana
           unknown protein (At5g17190) mRNA, complete
           cds.>gb:AY114029_1578440 Arabidopsis thaliana unknown
           protein (At5g17190) mRNA, complete cds.
          Length = 130

 Score =  100 bits (248), Expect = 4e-20
 Identities = 47/128 (36%), Positives = 73/128 (57%)
 Frame = +3

Query: 87  MALQWIILTYXXXXXXXXXXXXTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY 266
           MAL+W++L Y            T+P    LR  +V++    L+P L I+PF  F L+DIY
Sbjct: 1   MALEWVVLGYAAAAEAIMVILLTMPGLDALRKGLVAVTRNLLKPFLSIIPFCLFLLMDIY 60

Query: 267 WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME 446
           WK E R  C G+ CT +E  R++KSI K+QRN +L  +A + YW +Y +      I+++ 
Sbjct: 61  WKYETRPSCDGDSCTPSEHLRHQKSIMKSQRNALLIASALVFYWILYSVTNLVVRIEQLN 120

Query: 447 EVEKRAKD 470
           +  +R K+
Sbjct: 121 QRVERLKN 128



>gb:AP004880_1846509 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0487D09.
          Length = 132

 Score = 97.1 bits (240), Expect = 3e-19
 Identities = 51/130 (39%), Positives = 77/130 (59%), Gaps = 5/130 (3%)
 Frame = +3

Query: 87  MALQWIILTYXXXXXXXXXXXXTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY 266
           MAL+W++L Y            TLP    LR  ++S++   L+P + +VPF  F L+DIY
Sbjct: 1   MALEWVVLGYAAGAEAIMLLLLTLPGLDGLRRGMISVVRSALKPMMSVVPFCLFLLMDIY 60

Query: 267 WKNEHRLMCTGE-ICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRI----CKYNKE 431
           WK E R  C  E  CT +E  R++KSI K+QRN +L  AA LLYW ++ I     + ++ 
Sbjct: 61  WKYETRPTCDDEHHCTPSEHLRHQKSIMKSQRNALLIAAALLLYWILFSITSLVVRLDQL 120

Query: 432 IQRMEEVEKR 461
            QR+++++KR
Sbjct: 121 QQRVDKLKKR 130



>gb:ATAC012328_1543423 Arabidopsis thaliana chromosome III BAC
           T17B22 genomic sequence, complete
           sequence.>gb:AY065392_1566503 Arabidopsis thaliana
           unknown protein (At3g03160) mRNA, complete
           cds.>gb:AY088843_1573852 Arabidopsis thaliana clone 97
           mRNA, complete sequence.>gb:AY096722_1576258 Arabidopsis
           thaliana unknown protein (At3g03160) mRNA, complete cds.
          Length = 130

 Score = 96.3 bits (238), Expect = 5e-19
 Identities = 46/128 (35%), Positives = 72/128 (56%)
 Frame = +3

Query: 87  MALQWIILTYXXXXXXXXXXXXTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY 266
           MAL+W++L Y            T+P    LR  +V++    L+P L IVPF  F L+DIY
Sbjct: 1   MALEWVVLGYAAAAEAIMVVLLTMPGLDGLRKGLVAVTRNLLKPFLSIVPFCLFLLMDIY 60

Query: 267 WKNEHRLMCTGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRME 446
           WK E    C G+ CT +E  R++KS+ K+QRN +L  AA + YW +Y +     +I+ + 
Sbjct: 61  WKYETMPSCDGDSCTPSEHLRHQKSMMKSQRNALLIAAALVFYWILYSVTNLVVKIEHLN 120

Query: 447 EVEKRAKD 470
           +  +R ++
Sbjct: 121 QRIERLRN 128



>gb:AY187626_1588164 Solanum tuberosum Erwinia induced protein 2
           (ei2) mRNA, complete cds.
          Length = 131

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 47/128 (36%), Positives = 73/128 (57%), Gaps = 1/128 (0%)
 Frame = +3

Query: 87  MALQWIILTYXXXXXXXXXXXXTLPSPKPLRSRIVSLISLTLQPSLFIVPFAAFQLLDIY 266
           MAL+W++L+Y            T+P   PLR  ++++    L+P L IVPF  F L+DIY
Sbjct: 1   MALEWVVLSYAAGAEAIMLLLLTIPGLDPLRKGLIAVTRNLLKPFLSIVPFCLFLLMDIY 60

Query: 267 WKNEHRLMC-TGEICTAAERDRYEKSIYKAQRNGILCVAACLLYWCIYRICKYNKEIQRM 443
           WK E R  C + E C  +E  R++KSI K+QRN +L  +A   YW +Y +      + ++
Sbjct: 61  WKYETRPTCESAESCPPSEHLRHQKSIMKSQRNALLIASALFFYWLLYSVTGL---VVKV 117

Query: 444 EEVEKRAK 467
           E++ KR +
Sbjct: 118 EQLNKRVE 125



>gb:AY566695_1178623 Xerophyta humilis clone LD9 unknown mRNA.
          Length = 140

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 41/104 (39%), Positives = 61/104 (58%), Gaps = 9/104 (8%)
 Frame = +3

Query: 174 LRSRIVSLISLTLQPSLFIVPFAAFQLLDIYWKNEHRLMC-TGE----ICTAAERDRYEK 338
           LR  + +     L+P + +VPF  F +LDIYWK E R  C +G+    +C+ A+  R++K
Sbjct: 34  LRRALTNAARSALRPLMAVVPFCLFLILDIYWKYETRPNCGSGKDGTIVCSPADHLRFQK 93

Query: 339 SIYKAQRNGILCVAACLLYWCIYRICKYNKEI----QRMEEVEK 458
           S  K+QRN +L  +A LLYW I+ I K    I    QR+E ++K
Sbjct: 94  SALKSQRNALLVASALLLYWFIFAITKMLARIDLLAQRVENLKK 137



>gb:BT020260_1642655 Arabidopsis thaliana At3g21820 gene, complete
           cds.
          Length = 473

 Score = 33.1 bits (74), Expect = 5.6
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 1/70 (1%)
 Frame = +3

Query: 267 WKNEHRLMCTGEICTAAERDRYEKSIYKA-QRNGILCVAACLLYWCIYRICKYNKEIQRM 443
           W++ H L+CTGE   +  R+   + I  A   N I  +AA  + + I R  K      + 
Sbjct: 195 WESSHSLLCTGERSESISREALGEFIKHANDTNDIFLLAAKAIAFTILRYRKL-----KA 249

Query: 444 EEVEKRAKDN 473
           E V+K+AK +
Sbjct: 250 EHVDKKAKQS 259



>gb:AB025634_1516620 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MSD21.
          Length = 565

 Score = 33.1 bits (74), Expect = 5.6
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 1/70 (1%)
 Frame = +3

Query: 267 WKNEHRLMCTGEICTAAERDRYEKSIYKA-QRNGILCVAACLLYWCIYRICKYNKEIQRM 443
           W++ H L+CTGE   +  R+   + I  A   N I  +AA  + + I R  K      + 
Sbjct: 283 WESSHSLLCTGERSESISREALGEFIKHANDTNDIFLLAAKAIAFTILRYRKL-----KA 337

Query: 444 EEVEKRAKDN 473
           E V+K+AK +
Sbjct: 338 EHVDKKAKQS 347


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 690,413,895
Number of Sequences: 1806583
Number of extensions: 13315249
Number of successful extensions: 30805
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 30073
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30781
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 46505143296
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)