BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig9011
         (771 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB107689_1526747 Nicotiana tabacum AGP1 mRNA for AG-motif bin...   164   1e-39   
gb:AB107693_1526751 Nicotiana tabacum AGP5 mRNA for AG-motif bin...   161   1e-38   
pir|T06739|T06739 hypothetical protein F28P10.210 - Arabidopsis ...   144   1e-33   Arabidopsis thaliana [mouse-ear cress]
gb:AC069158_1540658 Genomic Sequence for Oryza sativa, Nipponbar...   141   1e-32   
gb:NTL17_1691595 Nicotiana tabacum mRNA for GATA-1 zinc finger p...   137   3e-31   
gb:AB107690_1526748 Nicotiana tabacum AGP2 mRNA for AG-motif bin...   129   5e-29   
gb:AB107692_1526750 Nicotiana tabacum AGP4 mRNA for AG-motif bin...   127   2e-28   
gb:BT014974_1641944 Arabidopsis thaliana At1g08010 gene, complet...   127   3e-28   
gb:AE005172_889808 Arabidopsis thaliana chromosome 1, top arm co...   127   3e-28   
gb:AC130611_1740892 Oryza sativa (japonica cultivar-group) chrom...   125   7e-28   
gb:AP003376_1828756 Oryza sativa (japonica cultivar-group) genom...   125   9e-28   
gb:AB022211_1514983 Arabidopsis thaliana genomic DNA, chromosome...   125   1e-27   
pir|T45739|T45739 transcription factor-like protein - Arabidopsi...   123   3e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AP004839_1845774 Oryza sativa (japonica cultivar-group) genom...   123   4e-27   
gb:AY087597_1572627 Arabidopsis thaliana clone 36927 mRNA, compl...   122   7e-27   
pir|T52103|T52103 GATA-binding transcription factor homolog 1 [i...   122   7e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AY063953_1565898 Arabidopsis thaliana putative GATA transcrip...   122   9e-27   
pir|T47864|T47864 GATA transcription factor 4 - Arabidopsis thal...   120   4e-26   Arabidopsis thaliana [mouse-ear cress]
pir|T05297|T05297 hypothetical protein F26P21.10 - Arabidopsis t...   119   5e-26   Arabidopsis thaliana [mouse-ear cress]
gb:AC119796_1739717 Oryza sativa (japonica cultivar-group) chrom...   118   1e-25   
gb:OSJN00022_1693442 Oryza sativa genomic DNA, chromosome 4, BAC...   117   2e-25   
gb:AE016959_1023793 Oryza sativa (japonica cultivar-group) chrom...   117   3e-25   
gb:AB107691_1526749 Nicotiana tabacum AGP3 mRNA for AG-motif bin...   115   7e-25   
pir|T04593|T04593 hypothetical protein F23E13.130 - Arabidopsis ...   115   9e-25   Arabidopsis thaliana [mouse-ear cress]
pir|T52104|T52104 GATA-binding transcription factor homolog 2 [i...   114   2e-24   Arabidopsis thaliana [mouse-ear cress]
pir|S46419|S46419 NTL1 protein - curled-leaved tobacco                113   3e-24   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb:AY099790_1576815 Arabidopsis thaliana GATA transcription fact...   112   1e-23   
pir|T05288|T05288 GATA-binding transcription factor homolog 3 [i...   112   1e-23   Arabidopsis thaliana [mouse-ear cress]
pir|H85408|H85408 GATA transcription factor 3 [imported] - Arabi...   112   1e-23   Arabidopsis thaliana [mouse-ear cress]
pir|F84683|F84683 hypothetical protein At2g28340 [imported] - Ar...   110   2e-23   Arabidopsis thaliana [mouse-ear cress]
gb:AC096781_1736344 Oryza sativa chromosome 10 BAC OSJNBa0013H08...   103   3e-21   
gb:AE016959_1022927 Oryza sativa (japonica cultivar-group) chrom...   103   3e-21   
pir|T47457|T47457 hypothetical protein T14D3.110 - Arabidopsis t...   100   4e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AC098693_1736835 Oryza sativa (japonica cultivar-group) chrom...    97   3e-19   
gb:AP003284_1827250 Oryza sativa (japonica cultivar-group) genom...    62   9e-09   
gb:AP005797_1857946 Oryza sativa (japonica cultivar-group) genom...    61   2e-08   
gb:AP004729_1843879 Oryza sativa (japonica cultivar-group) genom...    61   3e-08   
pir|T01770|T01770 hypothetical protein A_IG002P16.9 - Arabidopsi...    61   3e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AP003228_1825696 Oryza sativa (japonica cultivar-group) genom...    60   3e-08   
gb:AY086778_1571821 Arabidopsis thaliana clone 27625 mRNA, compl...    60   3e-08   
gb:AC133339_1741412 Oryza sativa chromosome 3 BAC OSJNBa0078D06 ...    60   6e-08   
gb:AP003329_1827987 Oryza sativa (japonica cultivar-group) genom...    59   8e-08   
gb:AC098571_1736760 Oryza sativa (japonica cultivar-group) chrom...    59   1e-07   
gb:AY065074_1566228 Arabidopsis thaliana unknown protein (At5g56...    59   1e-07   
gb:AB020747_1514633 Arabidopsis thaliana genomic DNA, chromosome...    59   1e-07   
pir|S69206|S69206 regulator protein white collar 1 - Neurospora ...    59   1e-07   Neurospora crassa
gb:AY530746_1611895 Arabidopsis thaliana At4g36620 gene, partial...    59   1e-07   
gb:AY086746_1571789 Arabidopsis thaliana clone 27213 mRNA, compl...    59   1e-07   
pir|T08408|T08408 transcription factor homolog F18B3.150 - Arabi...    59   1e-07   Arabidopsis thaliana [mouse-ear cress]
pir|T04270|T04270 hypothetical protein F20B18.260 - Arabidopsis ...    59   1e-07   Arabidopsis thaliana [mouse-ear cress]
pir|D85432|D85432 transcription factor like protein [imported] -...    59   1e-07   Arabidopsis thaliana [mouse-ear cress]
sp|Q01371|WC1_NEUCR|WC1_NEUCR White collar 1 protein (WC1).>gb:NCDNAWC1_16...    58   2e-07   
pir|F84563|F84563 hypothetical protein At2g18380 [imported] - Ar...    58   2e-07   Arabidopsis thaliana [mouse-ear cress]
sp|P40209|GAT2_YEAST|GAT2_YEAST GAT2 protein.>pir|S50392|S50392 hypothetica...    57   3e-07   Saccharomyces cerevisiae [brewer's yeast]
gb:AP004344_1840555 Oryza sativa (japonica cultivar-group) genom...    57   4e-07   
gb:AE017343_1755878 Cryptococcus neoformans var. neoformans JEC2...    56   8e-07   
gb:CR382138_1671875 Debaryomyces hansenii chromosome F of strain...    55   1e-06   
gb:CNS09S4S_1648273 DNA centromeric region sequence from BAC DP2...    55   1e-06   
gb:AB016872_1512922 Arabidopsis thaliana genomic DNA, chromosome...    55   2e-06   
gb:AY882438_1631940 Cryptococcus neoformans var. neoformans whit...    53   5e-06   
gb:CR380958_1653367 Candida glabrata strain CBS138 chromosome L ...    53   7e-06   
gb:AY084525_1569614 Arabidopsis thaliana clone 110655 mRNA, comp...    53   7e-06   
gb:AY063926_1565873 Arabidopsis thaliana unknown protein (At3g06...    53   7e-06   
gb:ATAC023912_1543781 Arabidopsis thaliana chromosome III BAC F3...    53   7e-06   
gb:AB025629_1516530 Arabidopsis thaliana genomic DNA, chromosome...    53   7e-06   
gb:AF082072_1766577 Emericella nidulans ABC transporter protein ...    52   1e-05   
gb:CR380955_1651556 Candida glabrata strain CBS138 chromosome I ...    52   1e-05   
gb:BT010844_1640790 Arabidopsis thaliana At3g16870 mRNA, complet...    52   1e-05   
gb:AY347827_1177986 Malus x domestica clone 18-2 putative GATA-t...    52   1e-05   
gb:AK119021_1816966 Arabidopsis thaliana At4g16141 mRNA for unkn...    52   2e-05   
gb:AE016817_1747633 Ashbya gossypii (= Eremothecium gossypii) AT...    52   2e-05   
gb:AY628432_1618572 Trichoderma atroviride blue light regulator ...    52   2e-05   
gb:CR382126_1659113 Kluyveromyces lactis strain NRRL Y-1140 chro...    51   3e-05   
gb:AY189831_1588432 Penicillium chrysogenum RfeH (rfeH) gene, co...    51   3e-05   
gb:OSJN00102_1694951 Oryza sativa genomic DNA, chromosome 4, BAC...    50   4e-05   
gb:AY628431_1618571 Trichoderma atroviride blue light regulator ...    50   4e-05   
gb:AC116922_1206437 Dictyostelium discoideum chromosome 2 map 60...    50   4e-05   
gb:CR382137_1669842 Debaryomyces hansenii chromosome E of strain...    50   5e-05   
gb:AY823265_1628896 Hypocrea jecorina white collar 2 (WC2) gene,...    50   6e-05   
sp|P78714|WC2_NEUCR|WC2_NEUCR White collar 2 protein (WC2).>pir|T46648|T46...    50   6e-05   
sp|Q00858|CGPB_FUSSO|CGPB_FUSSO Cutinase gene palindrome-binding protein (P...    50   6e-05   
gb:AP005191_1849141 Oryza sativa (japonica cultivar-group) genom...    49   8e-05   
gb:CR382126_1658787 Kluyveromyces lactis strain NRRL Y-1140 chro...    49   8e-05   
gb:AY823264_1628895 Hypocrea jecorina white collar 1 (WC1) gene,...    49   8e-05   
gb:AC116922_1206436 Dictyostelium discoideum chromosome 2 map 60...    49   1e-04   
gb:TBO575416_1724825 Tuber borchii Tbwc-1 gene for tuber borchii...    49   1e-04   
gb:CR380950_1649809 Candida glabrata strain CBS138 chromosome D ...    49   1e-04   
gb:AY062562_1565218 Arabidopsis thaliana Unknown protein (Z97343...    49   1e-04   
sp|Q07928|GAT3_YEAST|GAT3_YEAST GAT3 protein.>pir|S64835|S64835 hypothetica...    49   1e-04   Saccharomyces cerevisiae [brewer's yeast]
gb:BT020259_1642654 Arabidopsis thaliana At5g47140 gene, complet...    48   2e-04   
gb:CR382139_1672133 Debaryomyces hansenii chromosome G of strain...    48   2e-04   
gb:DDU68754_1377407 Dictyostelium discoideum putative transcript...    48   2e-04   
gb:AC116977_1206928 Dictyostelium discoideum chromosome 2 map 55...    48   2e-04   
gb:ENU70043_1676807 Aspergillus nidulans NsdD (nsdD) gene, compl...    47   3e-04   
gb:CR382132_1665160 Yarrowia lipolytica chromosome F of strain C...    47   3e-04   
gb:CR382131_1664774 Yarrowia lipolytica chromosome E of strain C...    47   3e-04   
gb:NC123A4_1688273 Neurospora crassa DNA linkage group V cosmid ...    46   7e-04   
gb:AE016814_1746005 Ashbya gossypii (= Eremothecium gossypii) AT...    46   9e-04   
gb:D83211_1674822 Zygosaccharomyces rouxii DNA for DNA-binding p...    45   0.001   
gb:AB183264_1202537 Dictyostelium discoideum amvA mRNA for GATA ...    45   0.001   
gb:AP004278_1839664 Oryza sativa (japonica cultivar-group) genom...    45   0.001   
gb:YSCGLN3_1728967 S.cerevisiae nitrogen regulatory protein (GLN...    45   0.001   
gb:AY045906_1561411 Arabidopsis thaliana putative flowering prot...    45   0.001   
gb:AB119061_1527911 Arabidopsis thaliana ZML2 mRNA for GATA-type...    45   0.001   
sp|P18494|GLN3_YEAST|GLN3_YEAST Nitrogen regulatory protein GLN3.>pir|S5054...    45   0.001   Saccharomyces cerevisiae [brewer's yeast]
gb:AF520973_1807869 Candida albicans transcription factor SFU1 g...    45   0.002   
gb:AK118169_1816161 Arabidopsis thaliana At3g21175 mRNA for unkn...    44   0.003   
gb:AY603044_1617445 Marchantia polymorpha male-specific transcri...    44   0.003   
gb:AY085109_1570191 Arabidopsis thaliana clone 12996 mRNA, compl...    44   0.003   
gb:AY042817_1560882 Arabidopsis thaliana Unknown protein (MXL8.2...    44   0.003   
gb:AB023045_1515507 Arabidopsis thaliana genomic DNA, chromosome...    44   0.003   
gb:AF087130_1767233 Neurospora crassa siderophore regulation pro...    44   0.003   
gb:AF515628_1807470 Emericella nidulans GATA-factor (lreA) gene,...    44   0.004   
gb:AE017347_1757817 Cryptococcus neoformans var. neoformans JEC2...    44   0.004   
gb:AC126223_1740539 Oryza sativa (japonica cultivar-group) chrom...    44   0.004   
gb:CR382139_1672907 Debaryomyces hansenii chromosome G of strain...    44   0.004   
gb:CR380950_1649670 Candida glabrata strain CBS138 chromosome D ...    44   0.004   
gb:CNS07EG9_1372782 chromosome II of strain GB-M1 of Encephalito...    44   0.004   
pir|JC7336|JC7336 zinc-finger protein - Arabidopsis thaliana>gb:...    44   0.004   Arabidopsis thaliana [mouse-ear cress]
pir|T09910|T09910 hypothetical protein T22A6.300 - Arabidopsis t...    44   0.004   Arabidopsis thaliana [mouse-ear cress]
gb:AE017342_1754696 Cryptococcus neoformans var. neoformans JEC2...    43   0.007   
gb:BT019772_2151532 Synthetic construct Homo sapiens GATA bindin...    42   0.012   
gb:BC009797_1972268 Homo sapiens GATA binding protein 1 (globin ...    42   0.012   
sp|P15976|GAT1_HUMAN|GAT1_HUMAN Erythroid transcription factor (GATA-1) (Er...    42   0.012   Homo sapiens [man]
sp|P17678|GAT1_CHICK|GAT1_CHICK Erythroid transcription factor (GATA-1) (Er...    42   0.012   Gallus gallus [bantam]
gb:DRU18311_2571263 Danio rerio zg1 mRNA, complete cds.                42   0.016   
gb:CR382131_1663689 Yarrowia lipolytica chromosome E of strain C...    42   0.016   
gb:CR382121_1654319 Kluyveromyces lactis strain NRRL Y-1140 chro...    42   0.016   
sp|P40349|URB1_USTMA|URB1_USTMA Siderophore biosynthesis regulatory protein...    42   0.016   Ustilago maydis
gb:AE017341_1754024 Cryptococcus neoformans var. neoformans JEC2...    41   0.021   
gb:AC096689_1736272 Oryza sativa chromosome 3 BAC OSJNBa0027J18 ...    41   0.021   
gb:AB043467_1519976 Schizophyllum commune gene for transcription...    41   0.021   
gb:AC087851_1734195 Oryza sativa chromosome 3 BAC OSJNBb0072E24 ...    41   0.028   
gb:CR380949_1649507 Candida glabrata strain CBS138 chromosome C ...    40   0.036   
gb:AF077674_1239295 Strongylocentrotus purpuratus cell-type coel...    40   0.036   
gb:BC052653_2101180 Mus musculus GATA binding protein 1, mRNA (c...    40   0.047   
pir|S63461|S63461 hypothetical protein YPL021w - yeast (Saccharo...    40   0.047   Saccharomyces cerevisiae [brewer's yeast]
sp|P43429|GAT1_RAT|GAT1_RAT Erythroid transcription factor (GATA-1) (Eryf...    40   0.047   Rattus norvegicus [brown rat]
sp|P17679|GAT1_MOUSE|GAT1_MOUSE Erythroid transcription factor (GATA-1) (Er...    40   0.047   Mus musculus [mouse]
gb:BC015577_1975186 Homo sapiens GATA binding protein 2, mRNA (c...    40   0.062   
gb:AE016819_1749348 Ashbya gossypii (= Eremothecium gossypii) AT...    40   0.062   
gb:CR382136_1668722 Debaryomyces hansenii chromosome D of strain...    40   0.062   
gb:CR382135_1667957 Debaryomyces hansenii chromosome C of strain...    40   0.062   
sp|P91623|GATC_DROME|GATC_DROME GATA-binding factor-C (Transcription factor...    40   0.062   Drosophila melanogaster
sp|P40569|GAT4_YEAST|GAT4_YEAST GAT4 protein.>pir|S48357|S48357 hypothetica...    40   0.062   Saccharomyces cerevisiae [brewer's yeast]
gb:AC007858_1536265 Oryza sativa (japonica cultivar-group) chrom...    39   0.081   
pir|S07396|S07396 hypothetical protein clone CB15A-2D - yeast (S...    39   0.081   Saccharomyces cerevisiae [brewer's yeast]
pir|S19428|S19428 SRD1 protein - yeast (Saccharomyces cerevisiae...    39   0.081   Saccharomyces cerevisiae [brewer's yeast]
sp|P09007|SRD1_YEAST|SRD1_YEAST Pre-rRNA processing protein SRD1 (Suppresso...    39   0.081   Saccharomyces cerevisiae [brewer's yeast]
gb:BC076462_2559298 Danio rerio zgc:91840, mRNA (cDNA clone MGC:...    39   0.11    
gb:AB112062_2465650 Oryzias latipes mRNA for hematopietic transc...    39   0.11    
gb:CR382137_1669611 Debaryomyces hansenii chromosome E of strain...    39   0.11    
pir|S46418|S46418 NTL1 protein - curled-leaved tobacco                 39   0.11    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb:AE016818_1748236 Ashbya gossypii (= Eremothecium gossypii) AT...    39   0.14    
gb:AF100657_1241200 Caenorhabditis elegans cosmid F52C12, comple...    39   0.14    
gb:AB183298_2467103 Oryzias latipes gata-2 mRNA for transcriptio...    38   0.18    
gb:AB111059_2465528 Eptatretus burgeri Gata 2/3 mRNA for transcr...    38   0.18    
gb:CR382132_1665689 Yarrowia lipolytica chromosome F of strain C...    38   0.18    
pir|T43298|T43298 transcription factor gaf2 - fission yeast  (Sc...    38   0.18    Schizosaccharomyces pombe
sp|Q92259|SREP_PENCH|SREP_PENCH GATA factor SREP.>pir|JC6170|JC6170 GATA-tr...    38   0.18    Penicillium chrysogenum
sp|P23767|GA1A_XENLA|GA1A_XENLA GATA binding factor-1A (Transcription facto...    38   0.18    Xenopus laevis [clawed frog]
gb:BC075479_2558582 Xenopus tropicalis MGC89310 protein, mRNA (c...    38   0.24    
gb:BC053131_2550524 Danio rerio GATA-binding protein 2, mRNA (cD...    38   0.24    
gb:AY079198_2510963 Raja eglanteria GATA-3 mRNA, complete cds.         38   0.24    
gb:BT007897_2150829 Synthetic construct Homo sapiens GATA bindin...    38   0.24    
gb:AY024364_2073974 Rattus norvegicus GATA-3 mRNA, complete cds.       38   0.24    
gb:HSGATA3_2013386 H.sapiens GATA-3 mRNA.                              38   0.24    
gb:BCI309051_1632782 Botrytis cinerea partial bir1 gene for GATA...    38   0.24    
pir|T26296|T26296 hypothetical protein W09C2.1 - Caenorhabditis ...    38   0.24    Caenorhabditis elegans [roundworm]
pir|A39794|A39794 transcription factor GATA-3 - human>gb:AL39029...    38   0.24    Homo sapiens [man]
sp|P23773|GAT3_XENLA|GAT3_XENLA Transcription factor xGATA-3 (GATA binding ...    38   0.24    Xenopus laevis [clawed frog]
sp|P23772|GAT3_MOUSE|GAT3_MOUSE Trans-acting T-cell specific transcription ...    38   0.24    Mus musculus [mouse]
sp|P23771|GAT3_HUMAN|GAT3_HUMAN Trans-acting T-cell specific transcription ...    38   0.24    Homo sapiens [man]
sp|P23825|GAT3_CHICK|GAT3_CHICK GATA binding factor-3 (Transcription factor...    38   0.24    Gallus gallus [bantam]
sp|Q91428|GAT3_BRARE|GAT3_BRARE Transcription factor GATA-3 (GATA binding f...    38   0.24    Danio rerio [leopard danio]
sp|P23768|GA1B_XENLA|GA1B_XENLA GATA binding factor-1B (Transcription facto...    38   0.24    Xenopus laevis [clawed frog]
sp|P28515|ELT1_CAEEL|ELT1_CAEEL Transcription factor elt-1.>pir|A41267|A412...    38   0.24    Caenorhabditis elegans [roundworm]
gb:BT007859_2150791 Synthetic construct Homo sapiens hypothetica...    37   0.31    
gb:AY032734_2074120 Rattus norvegicus GATA2 (Gata2) mRNA, comple...    37   0.31    
gb:AF345897_2063788 Rattus norvegicus transcription factor GATA-...    37   0.31    
gb:BC015613_1975205 Homo sapiens GATA binding protein 2, mRNA (c...    37   0.31    
gb:BC002557_1968209 Homo sapiens GATA binding protein 2, mRNA (c...    37   0.31    
gb:AF320976_1785893 Aspergillus nidulans GATA factor AREB gamma ...    37   0.31    
gb:AF320976_1785892 Aspergillus nidulans GATA factor AREB gamma ...    37   0.31    
gb:AF095898_1767795 Emericella nidulans siderophore biosynthesis...    37   0.31    
gb:AB025609_1516344 Arabidopsis thaliana genomic DNA, chromosome...    37   0.31    
gb:AY251012_1428021 Sus scrofa transcription factor GATA-2 mRNA,...    37   0.31    
gb:AY496948_1330965 Nematostella vectensis GATA factor (GATA 1/2...    37   0.31    
gb:AY465174_1329752 Nematostella vectensis GATA transcription fa...    37   0.31    
gb:AK004675_1152500 Mus musculus adult male lung cDNA, RIKEN ful...    37   0.31    
gb:AK004551_1152408 Mus musculus adult male lung cDNA, RIKEN ful...    37   0.31    
pir|A40815|A40815 transcription factor GATA-2 (version 1) - huma...    37   0.31    Homo sapiens [man]
pir|B48099|B48099 transcription factor GATA-2, retinoic acid-ind...    37   0.31    Mus musculus [mouse]
sp|P23770|GAT2_XENLA|GAT2_XENLA Transcription factor xGATA-2 (GATA binding ...    37   0.31    Xenopus laevis [clawed frog]
sp|O09100|GAT2_MOUSE|GAT2_MOUSE Endothelial transcription factor GATA-2.>gb...    37   0.31    Mus musculus [mouse]
sp|P23769|GAT2_HUMAN|GAT2_HUMAN Endothelial transcription factor GATA-2.          37   0.31    Homo sapiens [man]
sp|P23824|GAT2_CHICK|GAT2_CHICK GATA binding factor-2 (Transcription factor...    37   0.31    Gallus gallus [bantam]
gb:CR382122_1654912 Kluyveromyces lactis strain NRRL Y-1140 chro...    37   0.40    
pir|T41087|T41087 hypothetical protein SPCC16A11.14 - fission ye...    37   0.40    Schizosaccharomyces pombe
sp|Q10134|FEP1_SCHPO|FEP1_SCHPO Iron-sensing transcription factor 1 (Transc...    37   0.40    Schizosaccharomyces pombe
gb:AE016819_1749072 Ashbya gossypii (= Eremothecium gossypii) AT...    37   0.52    
gb:DMGATAFAC_1379544 D.melanogaster mRNA for GATA transcription ...    37   0.52    
gb:BT011543_1358011 Drosophila melanogaster LD44281 full insert ...    37   0.52    
gb:AY069823_1294553 Drosophila melanogaster SD07261 full length ...    37   0.52    
gb:AF184154_1248537 Ceratitis capitata zinc finger DNA binding p...    37   0.52    
gb:AE014297_1139819 Drosophila melanogaster chromosome 3R, compl...    37   0.52    
gb:AE014297_1139817 Drosophila melanogaster chromosome 3R, compl...    37   0.52    
sp|P52172|SRP_DROME|SRP_DROME Box A-binding factor (ABF) (Serpent protein)...    37   0.52    Drosophila melanogaster
gb:AF320976_1785894 Aspergillus nidulans GATA factor AREB gamma ...    36   0.68    
gb:CNS07EGF_1373914 chromosome VIII of strain GB-M1 of Encephali...    36   0.68    
pir|A41782|A41782 transcription factor GATA-2 (version 2) - huma...    36   0.68    Homo sapiens [man]
gb:DRU18312_2571264 Danio rerio zg2 mRNA, partial cds.                 36   0.89    
gb:SCYKR033C_1713241 S.cerevisiae chromosome XI reading frame OR...    36   0.89    
gb:SCUGA43_1710647 S.cerevisiae UGA43 gene.                            36   0.89    
gb:CR382138_1671147 Debaryomyces hansenii chromosome F of strain...    36   0.89    
gb:AY763413_1350357 Aedes aegypti GATAa2 transcription factor mR...    36   0.89    
gb:AY745809_1349242 Aedes aegypti GATA transcription factor GATA...    36   0.89    
gb:AAE400338_1192449 Aedes aegypti mRNA for GATA transcription f...    36   0.89    
pir|T40956|T40956 transcription factor gata-type - fission yeast...    36   0.89    Schizosaccharomyces pombe
sp|P43574|GAT1_YEAST|GAT1_YEAST Transcriptional regulatory protein GAT1.>pi...    36   0.89    Saccharomyces cerevisiae [brewer's yeast]
sp|P26343|DA80_YEAST|DA80_YEAST Nitrogen regulatory protein DAL80 (Regulato...    36   0.89    Saccharomyces cerevisiae [brewer's yeast]
gb:AF237674_1779678 Candida albicans zinc-finger transcription f...    35   1.2     
gb:AE017343_1755454 Cryptococcus neoformans var. neoformans JEC2...    35   1.2     
gb:YSPGAF1H_1731106 Schizosaccharomyces pombe gene homologous to...    35   1.2     
gb:YSCORFAB_1730055 Saccharomyces cerevisiae ORF gene, partial cds.    35   1.2     
gb:SPCC1902_1721142 S.pombe chromosome III cosmid c1902.               35   1.2     
gb:CR382129_1662223 Yarrowia lipolytica chromosome C of strain C...    35   1.2     
gb:CR382126_1659472 Kluyveromyces lactis strain NRRL Y-1140 chro...    35   1.2     
gb:CAL320271_1644969 Candida albicans ASH1 gene.                       35   1.2     
gb:BMU16320_1355681 Bombyx mori transcription factor BmGATA beta...    35   1.2     
gb:BMU16320_1355680 Bombyx mori transcription factor BmGATA beta...    35   1.2     
gb:BMU16320_1355679 Bombyx mori transcription factor BmGATA beta...    35   1.2     
gb:BMU16274_1355678 Bombyx mori transcription factor BmGATA beta...    35   1.2     
gb:BX571866_787043 Photorhabdus luminescens subsp. laumondii TTO...    35   1.2     
pir|A53741|A53741 transcription factor BmGATA beta - silkworm>gb...    35   1.2     Bombyx mori [silk moth]
pir|I50701|I50701 transcription factor GATA-4 - chicken (fragment)     35   1.2     Gallus gallus [bantam]
pir|S53811|S53811 BmGATA beta isoform 2 - silkworm (fragment)          35   1.2     Bombyx mori [silk moth]
pir|S53812|S53812 BmGATA beta isoform 3 - silkworm (fragment)          35   1.2     Bombyx mori [silk moth]
sp|P52167|GATB_BOMMO|GATB_BOMMO Transcription factor BCFI (GATA-beta) (BmGA...    35   1.2     Bombyx mori [silk moth]
sp|P43691|GAT4_CHICK|GAT4_CHICK Transcription factor GATA-4 (GATA binding f...    35   1.2     Gallus gallus [bantam]
sp|Q10280|GAF1_SCHPO|GAF1_SCHPO Transcription factor gaf1 (Gaf-1).>pir|T413...    35   1.2     Schizosaccharomyces pombe
sp|P34233|ASH1_YEAST|ASH1_YEAST Daughter cells HO repressor protein ASH1.>p...    35   1.2     Saccharomyces cerevisiae [brewer's yeast]
gb:BC082349_2562586 Xenopus laevis GATA-6 protein, mRNA (cDNA cl...    35   1.5     
gb:BC076718_2559465 Xenopus laevis transcription factor xGATA-6,...    35   1.5     
gb:AY260735_2522535 Xenopus tropicalis zinc-finger transcription...    35   1.5     
gb:AF191577_2479242 Danio rerio zinc finger transcription factor...    35   1.5     
gb:BC085855_2109414 Rattus norvegicus cDNA clone MGC:94578 IMAGE...    35   1.5     
gb:BC047790_1984023 Homo sapiens GATA binding protein 5, mRNA (c...    35   1.5     
gb:CR382131_1664139 Yarrowia lipolytica chromosome E of strain C...    35   1.5     
gb:AY293736_1595721 Candida albicans nitrogen regulatory GATA-fa...    35   1.5     
gb:S68802S2_1396777 Drosophila melanogaster achaete and scute re...    35   1.5     
gb:AY745808_1349241 Aedes aegypti GATA transcription factor GATA...    35   1.5     
gb:AY196328_1309286 Asterina miniata GATA transcription factor a...    35   1.5     
gb:AY195740_1309263 Asterina miniata GATA transcription factor (...    35   1.5     
gb:AY095095_1298245 Drosophila melanogaster SD02611 full insert ...    35   1.5     
gb:AY061878_1293494 Calliphora vicina pannier-like protein (pann...    35   1.5     
gb:AF395080_1267701 Anopheles gambiae zinc finger transcription ...    35   1.5     
gb:AE014297_1139823 Drosophila melanogaster chromosome 3R, compl...    35   1.5     
sp|P52168|PNR_DROME|PNR_DROME GATA-binding factor-A (Transcription factor ...    35   1.5     Drosophila melanogaster
sp|P97489|GAT5_MOUSE|GAT5_MOUSE Transcription factor GATA-5 (GATA binding f...    35   1.5     Mus musculus [mouse]
sp|Q9BWX5|GAT5_HUMAN|GAT5_HUMAN Transcription factor GATA-5 (GATA binding f...    35   1.5     Homo sapiens [man]
sp|P43692|GAT5_CHICK|GAT5_CHICK Transcription factor GATA-5 (GATA binding f...    35   1.5     Gallus gallus [bantam]
sp|P70005|GA6B_XENLA|GA6B_XENLA Transcription factor xGATA-6B (GATA binding...    35   1.5     Xenopus laevis [clawed frog]
sp|Q91678|GA6A_XENLA|GA6A_XENLA Transcription factor xGATA-6A (GATA binding...    35   1.5     Xenopus laevis [clawed frog]
gb:BC088567_2565697 Xenopus tropicalis hypothetical LOC496852, m...    35   2.0     
gb:BC071122_2555984 Xenopus laevis MGC81427 protein, mRNA (cDNA ...    35   2.0     
gb:BC071107_2555969 Xenopus laevis transcription factor xGATA-4,...    35   2.0     
gb:BC055963_2551547 Xenopus laevis transcription factor xGATA-5b...    35   2.0     
gb:AF179424_2058024 Mus musculus transcription factor GATA-4 (Ga...    35   2.0     
gb:AB075549_2047574 Mus musculus mRNA for transcription factor G...    35   2.0     
gb:AY740706_1961599 Homo sapiens GATA binding protein 4 (GATA4) ...    35   2.0     
gb:CR380957_1652842 Candida glabrata strain CBS138 chromosome K ...    35   2.0     
gb:OCU291310_1442555 Oryctolagus cuniculus partial mRNA for GATA...    35   2.0     
gb:BTA316283_1436617 Bos taurus partial mRNA for gata4 protein.        35   2.0     
gb:AY115491_1425093 Sus scrofa transcription factor GATA-4 mRNA,...    35   2.0     
gb:AY623814_1341390 Strongylocentrotus purpuratus GATA transcrip...    35   2.0     
gb:AF077675_1239296 Strongylocentrotus purpuratus dev-stage embr...    35   2.0     
pir|I57561|I57561 transcription factor GATA-4 - human>gb:HUMGATA...    35   2.0     Homo sapiens [man]
pir|A48099|A48099 transcription factor GATA-4, retinoic acid-ind...    35   2.0     Mus musculus [mouse]
sp|Q91677|GAT4_XENLA|GAT4_XENLA Transcription factor xGATA-4 (GATA binding ...    35   2.0     
sp|P46152|GAT4_RAT|GAT4_RAT Transcription factor GATA-4 (GATA binding fac...    35   2.0     
sp|Q08369|GAT4_MOUSE|GAT4_MOUSE Transcription factor GATA-4 (GATA binding f...    35   2.0     
sp|P43694|GAT4_HUMAN|GAT4_HUMAN Transcription factor GATA-4 (GATA binding f...    35   2.0     
sp|P43696|GA5B_XENLA|GA5B_XENLA Transcription factor xGATA-5B (GATA binding...    35   2.0     
sp|P43695|GA5A_XENLA|GA5A_XENLA Transcription factor xGATA-5A (GATA binding...    35   2.0     
sp|Q9HEV5|ASD4_NEUCR|ASD4_NEUCR GATA type zinc finger protein Asd4 (Ascus d...    35   2.0     
gb:DRE242515_2571026 Danio rerio mRNA for transcription factor g...    34   2.6     
gb:SC4_1705208 Yeast (S.cerevisiae) suf2 and suf20 tRNA genes.         34   2.6     
gb:CR382138_1670808 Debaryomyces hansenii chromosome F of strain...    34   2.6     
sp|P25333|SAT4_YEAST|SAT4_YEAST Serine/threonine-protein kinase SAT4 (EC 2....    34   2.6     
sp|P43693|GAT6_CHICK|GAT6_CHICK Transcription factor GATA-6 (GATA binding f...    34   2.6     
gb:BC067710_2554877 Danio rerio GATA-binding protein 6, mRNA (cD...    34   3.4     
gb:AY395731_2531758 Danio rerio Gata6 protein mRNA, complete cds.      34   3.4     
gb:AF191578_2479243 Danio rerio zinc finger transcription factor...    34   3.4     
gb:AF179425_2058025 Mus musculus transcription factor GATA-6 (Ga...    34   3.4     
gb:AB034243_2044915 Mus musculus gene for transcription factor G...    34   3.4     
gb:HSGATA6PR_2013389 H.sapiens mRNA for GATA-6 DNA-binding protein.    34   3.4     
gb:AE017344_1756085 Cryptococcus neoformans var. neoformans JEC2...    34   3.4     
pir|A49645|A49645 transcription factor GATA - rat                      34   3.4     
sp|P46153|GAT6_RAT|GAT6_RAT Transcription factor GATA-6 (GATA binding fac...    34   3.4     
sp|Q61169|GAT6_MOUSE|GAT6_MOUSE Transcription factor GATA-6 (GATA binding f...    34   3.4     
sp|Q92908|GAT6_HUMAN|GAT6_HUMAN Transcription factor GATA-6 (GATA binding f...    34   3.4     
gb:AF099665_2195041 Human adenovirus type 9 E1A 12S protein, E1A...    33   4.4     
gb:AY177678_2078164 Marmota monax GATA-binding protein 3 mRNA, p...    33   4.4     
gb:HUMGATA3BP_2031398 Human Gata3 enhancer-binding protein mRNA,...    33   4.4     
gb:AF295687_1417756 Sus scrofa transcription factor GATA-6 (GATA...    33   4.4     
gb:AY462219_1329446 Caenorhabditis elegans clone yk345d6 GATA tr...    33   4.4     
gb:AF067612_1238016 Caenorhabditis elegans cosmid F55A8, complet...    33   4.4     
pir|E88640|E88640 protein F55A8.1 [imported] - Caenorhabditis el...    33   4.4     
gb:U00043_1401453 Caenorhabditis elegans cosmid T26A5, complete ...    33   5.8     
pir|S36198|S36198 hypothetical protein 61.2 - Haloferax mediterr...    33   5.8     
pir|T34390|T34390 hypothetical protein T26A5.2 - Caenorhabditis ...    33   5.8     
gb:BC042232_2548054 Xenopus laevis similar to upstream binding t...    33   7.6     
gb:AY439009_1326521 Aedes aegypti GATA transcription factor (GAT...    33   7.6     
gb:AE014297_1140843 Drosophila melanogaster chromosome 3R, compl...    33   7.6     
gb:AE014297_1140842 Drosophila melanogaster chromosome 3R, compl...    33   7.6     
sp|P25980|UBF2_XENLA|UBF2_XENLA Nucleolar transcription factor 2 (Upstream ...    33   7.6     
gb:AP003020_1824239 Oryza sativa (japonica cultivar-group) genom...    32   9.9     
gb:CIN507730_1372361 Ciona intestinalis partial mRNA for GATAa p...    32   9.9     
gb:BA000028_694557 Oceanobacillus iheyensis HTE831 DNA, complete...    32   9.9     


>gb:AB107689_1526747 Nicotiana tabacum AGP1 mRNA for AG-motif
           binding protein-1, complete cds.
          Length = 343

 Score =  164 bits (416), Expect = 1e-39
 Identities = 86/124 (69%), Positives = 93/124 (75%), Gaps = 4/124 (3%)
 Frame = -1

Query: 768 EQXXXXXXKFTIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRY 589
           EQ      K + P + V TNQN   Q IRKC HCEITKTPQWRAGPMGPKTLCNACGVRY
Sbjct: 213 EQKTKKKLKLSFPSSLVKTNQNPVAQTIRKCQHCEITKTPQWRAGPMGPKTLCNACGVRY 272

Query: 588 KSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKVGVENTAI---TEAPST-PQPAFNN 421
           KSGRLFPEYRPAASPTF P++HSNSHKKVIEMR+KV  +N A    T  P+T  QP F N
Sbjct: 273 KSGRLFPEYRPAASPTFVPAIHSNSHKKVIEMRTKVVPDNNATIARTAPPATVTQPEF-N 331

Query: 420 PSVE 409
           PS E
Sbjct: 332 PSNE 335



>gb:AB107693_1526751 Nicotiana tabacum AGP5 mRNA for AG-motif
           binding protein-5, complete cds.
          Length = 342

 Score =  161 bits (408), Expect = 1e-38
 Identities = 81/118 (68%), Positives = 90/118 (76%), Gaps = 4/118 (3%)
 Frame = -1

Query: 738 TIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYR 559
           + P A V+ NQN   Q IRKC HCE+TKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYR
Sbjct: 222 SFPSARVEANQNPVAQTIRKCQHCEMTKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYR 281

Query: 558 PAASPTFTPSLHSNSHKKVIEMRSKVGVENT---AITEAPST-PQPAFNNPSVEF*QE 397
           PAASPTF PS+HSNSHKKVIEMR+K   +N    A T  P+T  QP FN  + E  +E
Sbjct: 282 PAASPTFVPSIHSNSHKKVIEMRTKFVPDNNANIARTAPPATVTQPEFNPSNKESVEE 339



>pir|T06739|T06739 hypothetical protein F28P10.210 - Arabidopsis
           thaliana>gb:ATF28P10_1550415 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F28P10.>gb:AY078029_1567998
           Arabidopsis thaliana AT3g54810/F28P10_210 mRNA, complete
           cds.>gb:AF412107_1797360 Arabidopsis thaliana
           AT3g54810/F28P10_210 mRNA, complete cds.
          Length = 322

 Score =  144 bits (364), Expect = 1e-33
 Identities = 64/78 (82%), Positives = 71/78 (91%)
 Frame = -1

Query: 687 IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK 508
           +RKC+HCE+TKTPQWR GPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTP+LHSNSHK
Sbjct: 228 LRKCMHCEVTKTPQWRLGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPALHSNSHK 287

Query: 507 KVIEMRSKVGVENTAITE 454
           KV EMR+K   + + ITE
Sbjct: 288 KVAEMRNKRCSDGSYITE 305



>gb:AC069158_1540658 Genomic Sequence for Oryza sativa, Nipponbare
           strain, clone OSJNBa0049O12, from chromosome 2, complete
           sequence.
          Length = 418

 Score =  141 bits (356), Expect = 1e-32
 Identities = 60/72 (83%), Positives = 66/72 (91%)
 Frame = -1

Query: 699 PPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHS 520
           PP  +R+C HC+I KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPAASPTF PS+HS
Sbjct: 328 PPGTVRRCTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPAASPTFMPSIHS 387

Query: 519 NSHKKVIEMRSK 484
           NSHKKV+EMR K
Sbjct: 388 NSHKKVVEMRQK 399



>gb:NTL17_1691595 Nicotiana tabacum mRNA for GATA-1 zinc finger
           protein (Ntl1-Nt7 gene).
          Length = 305

 Score =  137 bits (344), Expect = 3e-31
 Identities = 58/81 (71%), Positives = 68/81 (83%)
 Frame = -1

Query: 690 AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSH 511
           + +KC HC++TKTPQWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTF P+LHSNSH
Sbjct: 198 SFKKCTHCQVTKTPQWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFVPTLHSNSH 257

Query: 510 KKVIEMRSKVGVENTAITEAP 448
           +KV+EMR K     T+  E P
Sbjct: 258 RKVVEMRKKAIYGETSALEEP 278



>gb:AB107690_1526748 Nicotiana tabacum AGP2 mRNA for AG-motif
           binding protein-2, complete cds.
          Length = 289

 Score =  129 bits (325), Expect = 5e-29
 Identities = 60/95 (63%), Positives = 71/95 (74%), Gaps = 1/95 (1%)
 Frame = -1

Query: 732 PIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPA 553
           P+  +  N  +     R+C HC   KTPQWRAGP+GPKTLCNACGVRYKSGRL PEYRPA
Sbjct: 189 PLLSLPLNSAKSASIGRRCQHCGADKTPQWRAGPLGPKTLCNACGVRYKSGRLLPEYRPA 248

Query: 552 ASPTFTPSLHSNSHKKVIEMR-SKVGVENTAITEA 451
            SPTF+P++HSNSH+KV+EMR  K+GV    I EA
Sbjct: 249 NSPTFSPTVHSNSHRKVLEMRKQKIGVGGMMIHEA 283



>gb:AB107692_1526750 Nicotiana tabacum AGP4 mRNA for AG-motif
           binding protein-4, complete cds.
          Length = 326

 Score =  127 bits (320), Expect = 2e-28
 Identities = 53/67 (79%), Positives = 61/67 (91%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK 505
           R+C HC++ KTPQWRAGP+GPKTLCNACGVRYKSGRLFPEYRPA SPTF+  +HSNSH+K
Sbjct: 242 RRCTHCQVQKTPQWRAGPLGPKTLCNACGVRYKSGRLFPEYRPACSPTFSQEVHSNSHRK 301

Query: 504 VIEMRSK 484
           V+EMR K
Sbjct: 302 VLEMRRK 308



>gb:BT014974_1641944 Arabidopsis thaliana At1g08010 gene, complete
           cds.>gb:BT015713_1642331 Arabidopsis thaliana At1g08010
           gene, complete cds.
          Length = 303

 Score =  127 bits (318), Expect = 3e-28
 Identities = 53/68 (77%), Positives = 61/68 (89%)
 Frame = -1

Query: 687 IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK 508
           +RKC HCE TKTPQWR GP GPKTLCNACGVR++SGRL PEYRPA+SPTF P++HSNSH+
Sbjct: 219 VRKCTHCETTKTPQWREGPSGPKTLCNACGVRFRSGRLVPEYRPASSPTFIPAVHSNSHR 278

Query: 507 KVIEMRSK 484
           K+IEMR K
Sbjct: 279 KIIEMRRK 286



>gb:AE005172_889808 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC026875_1539722 Genomic sequence
           for Arabidopsis thaliana BAC T6D22 from chromosome I,
           complete sequence.
          Length = 821

 Score =  127 bits (318), Expect = 3e-28
 Identities = 53/68 (77%), Positives = 61/68 (89%)
 Frame = -1

Query: 687 IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK 508
           +RKC HCE TKTPQWR GP GPKTLCNACGVR++SGRL PEYRPA+SPTF P++HSNSH+
Sbjct: 294 VRKCTHCETTKTPQWREGPSGPKTLCNACGVRFRSGRLVPEYRPASSPTFIPAVHSNSHR 353

Query: 507 KVIEMRSK 484
           K+IEMR K
Sbjct: 354 KIIEMRRK 361



 Score =  122 bits (305), Expect = 9e-27
 Identities = 52/68 (76%), Positives = 58/68 (85%)
 Frame = -1

Query: 687 IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK 508
           +R C HCE   TPQWR GP GPKTLCNACGVR+KSGRL PEYRPA+SPTF PS+HSNSH+
Sbjct: 730 VRICTHCETITTPQWRQGPSGPKTLCNACGVRFKSGRLVPEYRPASSPTFIPSVHSNSHR 789

Query: 507 KVIEMRSK 484
           K+IEMR K
Sbjct: 790 KIIEMRKK 797



>gb:AC130611_1740892 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0483D07, complete
           sequence.>gb:AC132491_1741202 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone P0599F04, complete
           sequence.
          Length = 386

 Score =  125 bits (315), Expect = 7e-28
 Identities = 57/79 (72%), Positives = 61/79 (77%)
 Frame = -1

Query: 726 APVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAAS 547
           AP      Q     R+CLHCE  KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPAAS
Sbjct: 239 APAPNAAAQAAAEGRRCLHCETDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPAAS 298

Query: 546 PTFTPSLHSNSHKKVIEMR 490
           PTF  S HSNSH+KV+E+R
Sbjct: 299 PTFVVSKHSNSHRKVVELR 317



>gb:AP003376_1828756 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBa0014K08.
          Length = 387

 Score =  125 bits (314), Expect = 9e-28
 Identities = 58/81 (71%), Positives = 64/81 (79%), Gaps = 3/81 (3%)
 Frame = -1

Query: 723 PVDTNQNQPPQAI---RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPA 553
           PV +  + P  A    R+CLHCE  KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPA
Sbjct: 246 PVHSGGSAPAAAAGEGRRCLHCETDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPA 305

Query: 552 ASPTFTPSLHSNSHKKVIEMR 490
           ASPTF  S HSNSH+KV+E+R
Sbjct: 306 ASPTFMVSKHSNSHRKVLELR 326



>gb:AB022211_1514983 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K1L20.>gb:AY136450_1581950 Arabidopsis
           thaliana GATA-binding transcription factor-like protein
           (At5g66320) mRNA, complete cds.>gb:BT010367_1640313
           Arabidopsis thaliana At5g66320 mRNA, complete cds.
          Length = 339

 Score =  125 bits (313), Expect = 1e-27
 Identities = 62/103 (60%), Positives = 71/103 (68%), Gaps = 5/103 (4%)
 Frame = -1

Query: 720 VDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT 541
           V + + Q  Q  RKC HC + KTPQWRAGPMG KTLCNACGVRYKSGRL PEYRPA SPT
Sbjct: 237 VFSGELQQLQPQRKCSHCGVQKTPQWRAGPMGAKTLCNACGVRYKSGRLLPEYRPACSPT 296

Query: 540 FTPSLHSNSHKKVIEMRSK---VGVENTAITEAPSTPQ--PAF 427
           F+  LHSN H+KVIEMR K        T + +   +PQ  P+F
Sbjct: 297 FSSELHSNHHRKVIEMRRKKEPTSDNETGLNQLVQSPQAVPSF 339



>pir|T45739|T45739 transcription factor-like protein - Arabidopsis
           thaliana>gb:ATF24M12_1549947 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F24M12.>gb:AY064048_1565986
           Arabidopsis thaliana putative transcription factor
           (At3g51080) mRNA, complete cds.>gb:AY117315_1579356
           Arabidopsis thaliana putative transcription factor
           (At3g51080) mRNA, complete cds.
          Length = 312

 Score =  123 bits (309), Expect = 3e-27
 Identities = 59/95 (62%), Positives = 65/95 (68%), Gaps = 4/95 (4%)
 Frame = -1

Query: 708 QNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPS 529
           Q Q     R+C HC + KTPQWRAGP+G KTLCNACGVRYKSGRL PEYRPA SPTF+  
Sbjct: 213 QTQTQTQTRQCGHCGVQKTPQWRAGPLGAKTLCNACGVRYKSGRLLPEYRPACSPTFSSE 272

Query: 528 LHSNSHKKVIEMRSKV----GVENTAITEAPSTPQ 436
           LHSN H KVIEMR K     G E T + +   T Q
Sbjct: 273 LHSNHHSKVIEMRRKKETSDGAEETGLNQPVQTVQ 307



>gb:AP004839_1845774 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0519A12.>gb:AP005306_1850242 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0030D07.
          Length = 387

 Score =  123 bits (308), Expect = 4e-27
 Identities = 58/90 (64%), Positives = 65/90 (72%)
 Frame = -1

Query: 699 PPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHS 520
           P    R+C HC + KTPQWRAGP G KTLCNACGVRYKSGRL PEYRPA SPTF  SLHS
Sbjct: 299 PATGDRRCSHCGVQKTPQWRAGPEGAKTLCNACGVRYKSGRLLPEYRPACSPTFVSSLHS 358

Query: 519 NSHKKVIEMRSKVGVENTAITEAPSTPQPA 430
           NSH+KV+EMR K   + T +  A + P  A
Sbjct: 359 NSHRKVLEMRRK---KETPVIVAAAAPAVA 385



>gb:AY087597_1572627 Arabidopsis thaliana clone 36927 mRNA, complete
           sequence.
          Length = 268

 Score =  122 bits (306), Expect = 7e-27
 Identities = 53/67 (79%), Positives = 57/67 (85%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK 505
           RKC HC   KTPQWRAGP GPKTLCNACGVRYKSGRL PEYRPA SPTFT  LHSNSH+K
Sbjct: 188 RKCQHCGAEKTPQWRAGPAGPKTLCNACGVRYKSGRLVPEYRPANSPTFTAELHSNSHRK 247

Query: 504 VIEMRSK 484
           ++EMR +
Sbjct: 248 IVEMRKQ 254



>pir|T52103|T52103 GATA-binding transcription factor homolog 1
           [imported] - Arabidopsis thaliana>gb:ATY13648_1557497
           Arabidopsis thaliana mRNA for GATA transcription factor
           1.>gb:AP001297_1820958 Arabidopsis thaliana genomic DNA,
           chromosome 3, BAC clone:F14O13.
          Length = 274

 Score =  122 bits (306), Expect = 7e-27
 Identities = 53/67 (79%), Positives = 57/67 (85%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK 505
           RKC HC   KTPQWRAGP GPKTLCNACGVRYKSGRL PEYRPA SPTFT  LHSNSH+K
Sbjct: 194 RKCQHCGAEKTPQWRAGPAGPKTLCNACGVRYKSGRLVPEYRPANSPTFTAELHSNSHRK 253

Query: 504 VIEMRSK 484
           ++EMR +
Sbjct: 254 IVEMRKQ 260



>gb:AY063953_1565898 Arabidopsis thaliana putative GATA
           transcription factor 3 (At1g08000) mRNA, complete
           cds.>gb:AY096723_1576259 Arabidopsis thaliana putative
           GATA transcription factor 3 (At1g08000) mRNA, complete
           cds.
          Length = 308

 Score =  122 bits (305), Expect = 9e-27
 Identities = 52/68 (76%), Positives = 58/68 (85%)
 Frame = -1

Query: 687 IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK 508
           +R C HCE   TPQWR GP GPKTLCNACGVR+KSGRL PEYRPA+SPTF PS+HSNSH+
Sbjct: 217 VRICTHCETITTPQWRQGPSGPKTLCNACGVRFKSGRLVPEYRPASSPTFIPSVHSNSHR 276

Query: 507 KVIEMRSK 484
           K+IEMR K
Sbjct: 277 KIIEMRKK 284



>pir|T47864|T47864 GATA transcription factor 4 - Arabidopsis
           thaliana>gb:ATT8B10_1556458 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T8B10.>gb:ATY13651_1557500
           Arabidopsis thaliana mRNA for GATA transcription factor
           4.>gb:AY039532_1560246 Arabidopsis thaliana
           AT3g60530/T8B10_190 mRNA, complete
           cds.>gb:AY050476_1562250 Arabidopsis thaliana
           AT3g60530/T8B10_190 mRNA, complete
           cds.>gb:AF378881_1793466 Arabidopsis thaliana
           AT3g60530/T8B10_190 mRNA, complete cds.
          Length = 240

 Score =  120 bits (300), Expect = 4e-26
 Identities = 52/83 (62%), Positives = 63/83 (75%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK 505
           R+C HC   KTPQWR GP+GPKTLCNACGVRYKSGRL PEYRPA+SPTF  + HSNSH+K
Sbjct: 158 RRCTHCASEKTPQWRTGPLGPKTLCNACGVRYKSGRLVPEYRPASSPTFVLTQHSNSHRK 217

Query: 504 VIEMRSKVGVENTAITEAPSTPQ 436
           V+E+R +   + + +   P  PQ
Sbjct: 218 VMELRRQKEQQESCVRIPPFQPQ 240



>pir|T05297|T05297 hypothetical protein F26P21.10 - Arabidopsis
           thaliana>gb:ATCHRIV78_1547209 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           78.>gb:ATF26P21_1550164 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F26P21 (ESSA
           project).>gb:BT008342_1639559 Arabidopsis thaliana
           At4g32890 mRNA, complete cds.>gb:AK117169_1815216
           Arabidopsis thaliana At4g32890 mRNA for unknown protein,
           complete cds, clone: RAFL16-71-E16.
          Length = 308

 Score =  119 bits (299), Expect = 5e-26
 Identities = 51/65 (78%), Positives = 57/65 (87%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK 505
           R+CLHC   KTPQWR GPMGPKTLCNACGVRYKSGRL PEYRPA+SPTF  + HSNSH+K
Sbjct: 197 RRCLHCATEKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPASSPTFVMARHSNSHRK 256

Query: 504 VIEMR 490
           V+E+R
Sbjct: 257 VMELR 261



>gb:AC119796_1739717 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1172F09, complete sequence.
          Length = 219

 Score =  118 bits (295), Expect = 1e-25
 Identities = 49/65 (75%), Positives = 58/65 (89%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK 505
           R+C HC + +TPQWR GP GP+TLCNACGVR+KSGRLFPEYRPA SPTF+P LHSNSH++
Sbjct: 122 RRCTHCAVDETPQWRLGPDGPRTLCNACGVRFKSGRLFPEYRPANSPTFSPLLHSNSHRR 181

Query: 504 VIEMR 490
           V+EMR
Sbjct: 182 VMEMR 186



>gb:OSJN00022_1693442 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0011L07, complete sequence.
          Length = 392

 Score =  117 bits (294), Expect = 2e-25
 Identities = 54/83 (65%), Positives = 62/83 (74%)
 Frame = -1

Query: 699 PPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHS 520
           PP    +  HC + KTPQWRAGP G KTLCNACGVRYKSGRL PEYRPA SPTF  ++HS
Sbjct: 300 PPGEEVQARHCGVQKTPQWRAGPEGAKTLCNACGVRYKSGRLLPEYRPACSPTFVSAIHS 359

Query: 519 NSHKKVIEMRSKVGVENTAITEA 451
           NSH+KV+EMR K  V +  +T A
Sbjct: 360 NSHRKVLEMRRKKEVGSGLLTAA 382



>gb:AE016959_1023793 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC069300_1540802
           Oryza sativa chromosome 10 BAC OSJNBa0010C11 genomic
           sequence, complete sequence.>gb:AE017119_1753612 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           73 of 77 of the complete sequence.
          Length = 387

 Score =  117 bits (292), Expect = 3e-25
 Identities = 49/66 (74%), Positives = 57/66 (86%)
 Frame = -1

Query: 687 IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK 508
           +R+C HC   KTPQWR GP+GPKTLCNACGVR+KSGRL PEYRPAASPTF  + HSNSH+
Sbjct: 275 VRRCTHCASEKTPQWRTGPLGPKTLCNACGVRFKSGRLMPEYRPAASPTFVLTQHSNSHR 334

Query: 507 KVIEMR 490
           KV+E+R
Sbjct: 335 KVMELR 340



>gb:AB107691_1526749 Nicotiana tabacum AGP3 mRNA for AG-motif
           binding protein-3, complete cds.
          Length = 256

 Score =  115 bits (289), Expect = 7e-25
 Identities = 52/88 (59%), Positives = 64/88 (72%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK 505
           R+C HC   KTPQWR GP+GPKTLCNACGVR+KSGRL PEYRPAASPTF  + HSNSH+K
Sbjct: 167 RRCTHCASEKTPQWRTGPLGPKTLCNACGVRFKSGRLVPEYRPAASPTFVLTQHSNSHRK 226

Query: 504 VIEMRSKVGVENTAITEAPSTPQPAFNN 421
           V+E+R +   +     + P T +  + N
Sbjct: 227 VMELRRQ---KEMVHQQPPPTEEGMYGN 251



>pir|T04593|T04593 hypothetical protein F23E13.130 - Arabidopsis
           thaliana>gb:ATCHRIV85_1547584 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           85.>gb:ATF23E13_1549752 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F23E13 (ESSAII
           project).>gb:AY072434_1567251 Arabidopsis thaliana
           putative protein (At4g36240) mRNA, complete
           cds.>gb:AY114720_1578762 Arabidopsis thaliana putative
           protein (At4g36240) mRNA, complete cds.
          Length = 238

 Score =  115 bits (288), Expect = 9e-25
 Identities = 50/71 (70%), Positives = 57/71 (80%)
 Frame = -1

Query: 702 QPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLH 523
           Q  Q  R C HC + KTPQWR GP+G KTLCNACGVR+KSGRL PEYRPA SPTFT  +H
Sbjct: 158 QQQQLRRCCSHCGVQKTPQWRMGPLGAKTLCNACGVRFKSGRLLPEYRPACSPTFTNEIH 217

Query: 522 SNSHKKVIEMR 490
           SNSH+KV+E+R
Sbjct: 218 SNSHRKVLELR 228



>pir|T52104|T52104 GATA-binding transcription factor homolog 2
           [imported] - Arabidopsis thaliana>gb:AC007659_1536061
           Arabidopsis thaliana chromosome II section 241 of 255 of
           the complete sequence. Sequence from clones T13E15,
           T14P1.>gb:ATY13649_1557498 Arabidopsis thaliana mRNA for
           GATA transcription factor 2.>gb:BT000921_1635176
           Arabidopsis thaliana clone C105099 putative GATA-type
           zinc finger transcription factor (At2g45050) mRNA,
           complete cds.
          Length = 264

 Score =  114 bits (286), Expect = 2e-24
 Identities = 48/66 (72%), Positives = 57/66 (86%)
 Frame = -1

Query: 687 IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHK 508
           +R+C HC   KTPQWR GP+GPKTLCNACGVR+KSGRL PEYRPA+SPTF  + HSNSH+
Sbjct: 178 MRRCTHCASEKTPQWRTGPLGPKTLCNACGVRFKSGRLVPEYRPASSPTFVLTQHSNSHR 237

Query: 507 KVIEMR 490
           KV+E+R
Sbjct: 238 KVMELR 243



>pir|S46419|S46419 NTL1 protein - curled-leaved tobacco
          Length = 94

 Score =  113 bits (283), Expect = 3e-24
 Identities = 50/67 (74%), Positives = 56/67 (83%)
 Frame = -1

Query: 648 QWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVIEMRSKVGVEN 469
           QWR GP+GPKTLCNACGVRY+SGRLFPEYRPAASPTF P+LHSNSH+KV+EMR K     
Sbjct: 1   QWREGPLGPKTLCNACGVRYRSGRLFPEYRPAASPTFIPTLHSNSHRKVVEMRKKAIYGE 60

Query: 468 TAITEAP 448
           T+  E P
Sbjct: 61  TSALEEP 67



>gb:AY099790_1576815 Arabidopsis thaliana GATA transcription factor
           3 (At4g34680) mRNA, complete cds.>gb:AY128907_1580987
           Arabidopsis thaliana GATA transcription factor 3
           (At4g34680) mRNA, complete cds.
          Length = 269

 Score =  112 bits (279), Expect = 1e-23
 Identities = 52/83 (62%), Positives = 60/83 (72%), Gaps = 1/83 (1%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK 505
           R+C HC    TPQWR GP+GPKTLCNACGVR+KSGRL PEYRPA SPTF+  +HSN H+K
Sbjct: 180 RRCSHCGTNNTPQWRTGPVGPKTLCNACGVRFKSGRLCPEYRPADSPTFSNEIHSNLHRK 239

Query: 504 VIEMR-SKVGVENTAITEAPSTP 439
           V+E+R SK   E T      S P
Sbjct: 240 VLELRKSKELGEETGEASTKSDP 262



>pir|T05288|T05288 GATA-binding transcription factor homolog 3
           [imported] - Arabidopsis thaliana
          Length = 269

 Score =  112 bits (279), Expect = 1e-23
 Identities = 52/83 (62%), Positives = 60/83 (72%), Gaps = 1/83 (1%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK 505
           R+C HC    TPQWR GP+GPKTLCNACGVR+KSGRL PEYRPA SPTF+  +HSN H+K
Sbjct: 180 RRCSHCGTNNTPQWRTGPVGPKTLCNACGVRFKSGRLCPEYRPADSPTFSNEIHSNLHRK 239

Query: 504 VIEMR-SKVGVENTAITEAPSTP 439
           V+E+R SK   E T      S P
Sbjct: 240 VLELRKSKELGEETGEASTKSDP 262



>pir|H85408|H85408 GATA transcription factor 3 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV82_1547429 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           82.>gb:ATT4L20_1556072 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T4L20 (ESSA
           project).>gb:ATY13650_1557499 Arabidopsis thaliana mRNA
           for GATA transcription factor 3.
          Length = 269

 Score =  112 bits (279), Expect = 1e-23
 Identities = 52/83 (62%), Positives = 60/83 (72%), Gaps = 1/83 (1%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK 505
           R+C HC    TPQWR GP+GPKTLCNACGVR+KSGRL PEYRPA SPTF+  +HSN H+K
Sbjct: 180 RRCSHCGTNNTPQWRTGPVGPKTLCNACGVRFKSGRLCPEYRPADSPTFSNEIHSNLHRK 239

Query: 504 VIEMR-SKVGVENTAITEAPSTP 439
           V+E+R SK   E T      S P
Sbjct: 240 VLELRKSKELGEETGEASTKSDP 262



>pir|F84683|F84683 hypothetical protein At2g28340 [imported] -
           Arabidopsis thaliana>gb:AC006283_1533982 Arabidopsis
           thaliana chromosome 2 clone T1B3 map mi54, complete
           sequence.
          Length = 315

 Score =  110 bits (276), Expect = 2e-23
 Identities = 48/66 (72%), Positives = 54/66 (81%)
 Frame = -1

Query: 681 KCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKV 502
           KC HCE T TPQWR GP G KTLCNACG+R++SGRL  EYRPAASPTF P++HSN HKK+
Sbjct: 216 KCTHCETTTTPQWREGPNGRKTLCNACGIRFRSGRLVLEYRPAASPTFIPTVHSNLHKKI 275

Query: 501 IEMRSK 484
           I MR K
Sbjct: 276 IYMRMK 281



>gb:AC096781_1736344 Oryza sativa chromosome 10 BAC OSJNBa0013H08
           genomic sequence, complete sequence.
          Length = 369

 Score =  103 bits (258), Expect = 3e-21
 Identities = 43/77 (55%), Positives = 58/77 (75%)
 Frame = -1

Query: 681 KCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKV 502
           +C HC  T+TPQWR GP G +TLCNAC +RY+SG+L PEYRP  SPTF+P LHSN H +V
Sbjct: 64  QCRHCGTTETPQWRHGPEGHRTLCNACSMRYRSGKLVPEYRPLRSPTFSPELHSNRHHRV 123

Query: 501 IEMRSKVGVENTAITEA 451
           +++R + G ++ A + A
Sbjct: 124 LQLRRRPGPQSAAPSPA 140



 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 23/40 (57%), Positives = 29/40 (72%)
 Frame = -1

Query: 693 QAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRL 574
           +A R+C HC  TKTP WR GP   + LCNACG +Y+SG+L
Sbjct: 232 RAGRECAHCGTTKTPAWRLGPDSRRKLCNACGNKYRSGQL 271



>gb:AE016959_1022927 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC034258_1539933
           Oryza sativa chromosome 10 BAC OSJNBb0011A08 genomic
           sequence, complete sequence.>gb:AE017102_1752746 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           56 of 77 of the complete sequence.
          Length = 528

 Score =  103 bits (258), Expect = 3e-21
 Identities = 43/77 (55%), Positives = 58/77 (75%)
 Frame = -1

Query: 681 KCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKV 502
           +C HC  T+TPQWR GP G +TLCNAC +RY+SG+L PEYRP  SPTF+P LHSN H +V
Sbjct: 64  QCRHCGTTETPQWRHGPEGHRTLCNACSMRYRSGKLVPEYRPLRSPTFSPELHSNRHHRV 123

Query: 501 IEMRSKVGVENTAITEA 451
           +++R + G ++ A + A
Sbjct: 124 LQLRRRPGPQSAAPSPA 140



 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 37/70 (52%), Positives = 44/70 (62%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK 505
           R+C HC  TKTP W +GP     LCNACG +Y+ GRL PEYRP   PTF+P LHSN+H  
Sbjct: 453 RRCTHCGTTKTPAWLSGPDSRGKLCNACGKQYRKGRLVPEYRPLNCPTFSPELHSNAHAH 512

Query: 504 VIEMRSKVGV 475
                S V +
Sbjct: 513 RRRRESPVAI 522



 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 23/40 (57%), Positives = 29/40 (72%)
 Frame = -1

Query: 693 QAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRL 574
           +A R+C HC  TKTP WR GP   + LCNACG +Y+SG+L
Sbjct: 232 RAGRECAHCGTTKTPAWRLGPDSRRKLCNACGNKYRSGQL 271



>pir|T47457|T47457 hypothetical protein T14D3.110 - Arabidopsis
           thaliana>gb:ATT14D3_1554451 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T14D3.
          Length = 204

 Score =  100 bits (248), Expect = 4e-20
 Identities = 41/65 (63%), Positives = 51/65 (78%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK 505
           + C HC   KTP WR GP G  TLCNACG+RY++GRL PEYRPA+SP F P++HSN H+K
Sbjct: 115 KSCSHCGTRKTPLWREGPRGAGTLCNACGMRYRTGRLLPEYRPASSPDFKPNVHSNFHRK 174

Query: 504 VIEMR 490
           V+E+R
Sbjct: 175 VMEIR 179



>gb:AC098693_1736835 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1004C08, complete
           sequence.>gb:AP000615_1820490 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 3,
           clone:P0043E01.
          Length = 271

 Score = 97.1 bits (240), Expect = 3e-19
 Identities = 42/85 (49%), Positives = 56/85 (65%), Gaps = 6/85 (7%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK 505
           ++C HC+ T+TPQWR GP GP TLCNACG+RY+   L PEYRP+ SP F    +SN H+K
Sbjct: 186 KRCGHCQTTETPQWRVGPDGPSTLCNACGIRYRIDHLLPEYRPSTSPGFGSDGYSNRHRK 245

Query: 504 VIEMRSK------VGVENTAITEAP 448
           V+++R K      +    TA+T  P
Sbjct: 246 VVKLREKKRKKAMLAATATALTSGP 270



>gb:AP003284_1827250 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0671D01.
          Length = 242

 Score = 62.4 bits (150), Expect = 9e-09
 Identities = 28/54 (51%), Positives = 35/54 (64%)
 Frame = -1

Query: 690 AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPS 529
           A R+C +C+ T TP WR GP GPK+LCNACG+RYK      E R AA+    P+
Sbjct: 120 APRRCANCDTTSTPLWRNGPRGPKSLCNACGIRYKK-----EERRAAAAAVAPT 168



>gb:AP005797_1857946 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:B1131G07.
          Length = 353

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 3/50 (6%)
 Frame = -1

Query: 717 DTNQNQPPQA---IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 577
           D +Q Q  QA   +R C  C  TKTP WR+GP GPK+LCNACG+R +  R
Sbjct: 162 DESQQQLQQALGVVRVCSDCNTTKTPLWRSGPCGPKSLCNACGIRQRKAR 211



>gb:AP004729_1843879 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC
           clone:OSJNBa0006A22.>gb:AP005460_1852228 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0610D01.
          Length = 347

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 34/88 (38%), Positives = 44/88 (50%), Gaps = 2/88 (2%)
 Frame = -1

Query: 687 IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR--LFPEYRPAASPTFTPSLHSNS 514
           IR C  C  TKTP WR+GP GPK+LCNACG+R +  R  +     PA+     P   + +
Sbjct: 200 IRVCSDCNTTKTPLWRSGPCGPKSLCNACGIRQRKARRAMMASGLPASPNAAGPK--AAA 257

Query: 513 HKKVIEMRSKVGVENTAITEAPSTPQPA 430
           H       +   +E TA   A   P PA
Sbjct: 258 HSGATNAAAAAAMEETA-ESATVAPPPA 284



>pir|T01770|T01770 hypothetical protein A_IG002P16.9 - Arabidopsis
           thaliana>gb:F2P16_1678195 Arabidopsis thaliana BAC
           F2P16, complete sequence.
          Length = 550

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 24/48 (50%), Positives = 30/48 (62%)
 Frame = -1

Query: 720 VDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 577
           V     +    IR C  C+ TKTP WR GP GPK+LCNACG+R++  R
Sbjct: 444 VSVRMKEEKGTIRCCSECKTTKTPMWRGGPTGPKSLCNACGIRHRKQR 491



>gb:AP003228_1825696 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0020E09.
          Length = 142

 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 25/50 (50%), Positives = 30/50 (60%)
 Frame = -1

Query: 726 APVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 577
           +PVD          + C  C  TKTP WR GP GPK+LCNACG+RY+  R
Sbjct: 8   SPVDKVDPDECNGSKACADCHTTKTPLWRGGPGGPKSLCNACGIRYRKRR 57



>gb:AY086778_1571821 Arabidopsis thaliana clone 27625 mRNA, complete
           sequence.
          Length = 120

 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 24/48 (50%), Positives = 30/48 (62%)
 Frame = -1

Query: 720 VDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 577
           V     +    IR C  C+ TKTP WR GP GPK+LCNACG+R++  R
Sbjct: 14  VSMRMKEEKGTIRCCSECKTTKTPMWRGGPTGPKSLCNACGIRHRKQR 61



>gb:AC133339_1741412 Oryza sativa chromosome 3 BAC OSJNBa0078D06
           genomic sequence, complete sequence.>gb:AC133778_1741487
           Oryza sativa chromosome 3 BAC OSJNBb0027B08 genomic
           sequence, complete sequence.
          Length = 136

 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 23/48 (47%), Positives = 30/48 (62%)
 Frame = -1

Query: 720 VDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 577
           +D ++       + C  C  TKTP WR GP GPK+LCNACG+RY+  R
Sbjct: 13  IDPDERTASGEPKACTDCHTTKTPLWRGGPSGPKSLCNACGIRYRKKR 60



>gb:AP003329_1827987 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1045F02.
          Length = 131

 Score = 59.3 bits (142), Expect = 8e-08
 Identities = 21/36 (58%), Positives = 27/36 (75%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 577
           R C+ C  T TP WR+GP GP++LCNACG+RY+  R
Sbjct: 19  RSCVECRATTTPMWRSGPTGPRSLCNACGIRYRKKR 54



>gb:AC098571_1736760 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1126_B10, complete
           sequence.>gb:AC120988_1740033 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBa0017N18,
           complete sequence.
          Length = 279

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 27/50 (54%), Positives = 32/50 (64%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFT 535
           R+C +C    TP WR GP GPK+LCNACG+RYK      E R AA+ T T
Sbjct: 152 RRCANCGTASTPLWRNGPRGPKSLCNACGIRYKK-----EERRAAATTTT 196



>gb:AY065074_1566228 Arabidopsis thaliana unknown protein
           (At5g56860; MPI10.2) mRNA, complete cds.
          Length = 398

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 23/37 (62%), Positives = 27/37 (72%)
 Frame = -1

Query: 687 IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 577
           IR C  C  TKTP WR+GP GPK+LCNACG+R +  R
Sbjct: 229 IRVCSDCNTTKTPLWRSGPRGPKSLCNACGIRQRKAR 265



>gb:AB020747_1514633 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MPI10.
          Length = 398

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 23/37 (62%), Positives = 27/37 (72%)
 Frame = -1

Query: 687 IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 577
           IR C  C  TKTP WR+GP GPK+LCNACG+R +  R
Sbjct: 229 IRVCSDCNTTKTPLWRSGPRGPKSLCNACGIRQRKAR 265



>pir|S69206|S69206 regulator protein white collar 1 - Neurospora
            crassa
          Length = 1154

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 35/114 (30%), Positives = 57/114 (50%), Gaps = 8/114 (7%)
 Frame = -1

Query: 729  IAPVDTNQNQPPQA------IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRY--KSGRL 574
            +APV +N+ +  +       +R C +C    TP+WR GP G + LCN+CG+R+  ++GR+
Sbjct: 912  LAPVLSNKKKRKRRKGGGNMVRDCANCHTRNTPEWRRGPSGNRDLCNSCGLRWAKQTGRV 971

Query: 573  FPEYRPAASPTFTPSLHSNSHKKVIEMRSKVGVENTAITEAPSTPQPAFNNPSV 412
             P          + S  SNS      +  +VG       ++PST     N+PS+
Sbjct: 972  SPRTSSRGGNGDSMSKKSNSPSHSSPLHREVG------NDSPSTTTATKNSPSL 1019



>gb:AY530746_1611895 Arabidopsis thaliana At4g36620 gene, partial
           cds.
          Length = 201

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 21/33 (63%), Positives = 27/33 (81%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           R+C +C+ T TP WR GP GPK+LCNACG+R+K
Sbjct: 75  RRCANCDTTSTPLWRNGPRGPKSLCNACGIRFK 107



>gb:AY086746_1571789 Arabidopsis thaliana clone 27213 mRNA, complete
           sequence.
          Length = 294

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 21/33 (63%), Positives = 27/33 (81%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           R+C +C+ T TP WR GP GPK+LCNACG+R+K
Sbjct: 151 RRCANCDTTSTPLWRNGPRGPKSLCNACGIRFK 183



>pir|T08408|T08408 transcription factor homolog F18B3.150 -
           Arabidopsis thaliana>gb:ATF18B3_1549091 Arabidopsis
           thaliana DNA chromosome 3, BAC clone F18B3.
          Length = 294

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 21/33 (63%), Positives = 27/33 (81%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           R+C +C+ T TP WR GP GPK+LCNACG+R+K
Sbjct: 151 RRCANCDTTSTPLWRNGPRGPKSLCNACGIRFK 183



>pir|T04270|T04270 hypothetical protein F20B18.260 - Arabidopsis
           thaliana>gb:ATCHRIV64_1546496 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           64.>gb:ATF20B18_1549463 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F20B18 (ESSA project).
          Length = 352

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 23/37 (62%), Positives = 27/37 (72%)
 Frame = -1

Query: 687 IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 577
           IR C  C  TKTP WR+GP GPK+LCNACG+R +  R
Sbjct: 198 IRICSDCNTTKTPLWRSGPRGPKSLCNACGIRQRKAR 234



>pir|D85432|D85432 transcription factor like protein [imported] -
           Arabidopsis thaliana>gb:ATAP22_1544035 Arabidopsis
           thaliana DNA chromosome 4, ESSA I AP2 contig fragment
           No. 2.>gb:ATCHRIV85_1547617 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 85.
          Length = 211

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 21/33 (63%), Positives = 27/33 (81%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           R+C +C+ T TP WR GP GPK+LCNACG+R+K
Sbjct: 75  RRCANCDTTSTPLWRNGPRGPKSLCNACGIRFK 107



>sp|Q01371|WC1_NEUCR White collar 1 protein (WC1).>gb:NCDNAWC1_1690512
            Neurospora crassa wc-1 gene.
          Length = 1167

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 31/94 (32%), Positives = 48/94 (51%), Gaps = 2/94 (2%)
 Frame = -1

Query: 687  IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRY--KSGRLFPEYRPAASPTFTPSLHSNS 514
            +R C +C    TP+WR GP G + LCN+CG+R+  ++GR+ P          + S  SNS
Sbjct: 931  VRDCANCHTRNTPEWRRGPSGNRDLCNSCGLRWAKQTGRVSPRTSSRGGNGDSMSKKSNS 990

Query: 513  HKKVIEMRSKVGVENTAITEAPSTPQPAFNNPSV 412
                  +  +VG       ++PST     N+PS+
Sbjct: 991  PSHSSPLHREVG------NDSPSTTTATKNSPSL 1018



>pir|F84563|F84563 hypothetical protein At2g18380 [imported] -
           Arabidopsis thaliana>gb:AC006439_1534289 Arabidopsis
           thaliana chromosome 2 clone T30D6 map mi39, complete
           sequence.
          Length = 207

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 21/33 (63%), Positives = 26/33 (78%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           R+C  C+ T TP WR GP GPK+LCNACG+R+K
Sbjct: 91  RRCASCDTTSTPLWRNGPKGPKSLCNACGIRFK 123



>sp|P40209|GAT2_YEAST GAT2 protein.>pir|S50392|S50392 hypothetical
           protein YMR136w - yeast (Saccharomyces
           cerevisiae)>gb:SC9375_1705872 S.cerevisiae chromosome
           XIII cosmid 9375.
          Length = 560

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 24/51 (47%), Positives = 30/51 (58%)
 Frame = -1

Query: 738 TIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           T P A  D       + I  C HC  T+TP+WR GP G +TLCNACG+ Y+
Sbjct: 452 TTPAANSDEKNPNAKKIIEFCFHCGETETPEWRKGPYGTRTLCNACGLFYR 502



>gb:AP004344_1840555 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC
           clone:P0639B07.>gb:AP006266_1861558 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBa0003K21.
          Length = 137

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 24/47 (51%), Positives = 30/47 (63%)
 Frame = -1

Query: 729 IAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRY 589
           + P+D N        R C HC+ +KT  WR GP GPK+LCNACG+RY
Sbjct: 11  VVPLDLNYP------RICSHCQTSKTSVWRNGPFGPKSLCNACGIRY 51



>gb:AE017343_1755878 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 438

 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 23/38 (60%), Positives = 28/38 (73%)
 Frame = -1

Query: 708 QNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGV 595
           +N PP     CL C  T+TP+WR GPMGP+TLCNACG+
Sbjct: 352 KNGPPPT---CLGCGATETPEWRRGPMGPRTLCNACGL 386



>gb:CR382138_1671875 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 375

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 21/31 (67%), Positives = 25/31 (80%)
 Frame = -1

Query: 681 KCLHCEITKTPQWRAGPMGPKTLCNACGVRY 589
           KC HCE T+TP+WR GP G +TLCNACG+ Y
Sbjct: 302 KCNHCESTETPEWRRGPDGSRTLCNACGLFY 332



>gb:CNS09S4S_1648273 DNA centromeric region sequence from BAC DP26B06,
            DP34F04, DP16D11, DP09G08, DP35C12 of chromosome 5 of
            Podospora anserina.
          Length = 1042

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 6/88 (6%)
 Frame = -1

Query: 687  IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRY------KSGRLFPEYRPAASPTFTPSL 526
            +R C +C    TP+WR GP G + LCN+CG+R+      ++GR+ P          +   
Sbjct: 867  VRDCANCHTRNTPEWRRGPSGQRDLCNSCGLRWAKQRDAQTGRVSPRNSNRGGDAQSKKS 926

Query: 525  HSNSHKKVIEMRSKVGVENTAITEAPST 442
            +S SH   ++          A T+ P T
Sbjct: 927  NSPSHASPLQREVNSNSTKPATTDTPPT 954



>gb:AB016872_1512922 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K21P3.
          Length = 139

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 21/48 (43%), Positives = 29/48 (60%)
 Frame = -1

Query: 720 VDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 577
           ++ N        + C  C  +KTP WR GP+GPK+LCNACG+R +  R
Sbjct: 24  IEQNNTSVNDKKKTCADCGTSKTPLWRGGPVGPKSLCNACGIRNRKKR 71



>gb:AY882438_1631940 Cryptococcus neoformans var. neoformans white
           collar 2 (BWC2) mRNA, complete cds.>gb:AE017345_1756732
           Cryptococcus neoformans var. neoformans JEC21 chromosome
           5, complete sequence.
          Length = 392

 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 19/35 (54%), Positives = 27/35 (77%)
 Frame = -1

Query: 693 QAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRY 589
           + +  C+ C  T +P+WR GP+GPKTLCNACG+R+
Sbjct: 343 ETMHVCVTCGRTDSPEWRKGPLGPKTLCNACGLRW 377



>gb:CR380958_1653367 Candida glabrata strain CBS138 chromosome L
           complete sequence.
          Length = 828

 Score = 52.8 bits (125), Expect = 7e-06
 Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 9/55 (16%)
 Frame = -1

Query: 681 KCLHCEITKTPQWRAGPMGPKTLCNACGVRYKS---------GRLFPEYRPAASP 544
           +C HC  + TP+WR GP G +TLCNACG+ Y+          G L+  YR   +P
Sbjct: 738 RCHHCGESDTPEWRRGPYGSRTLCNACGLFYRKLTKKFTVPYGNLYMRYRRIQAP 792



>gb:AY084525_1569614 Arabidopsis thaliana clone 110655 mRNA,
           complete sequence.
          Length = 136

 Score = 52.8 bits (125), Expect = 7e-06
 Identities = 20/36 (55%), Positives = 25/36 (69%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 577
           + C  C  +KTP WR GP GPK+LCNACG+R +  R
Sbjct: 28  KSCAICGTSKTPLWRGGPAGPKSLCNACGIRNRKKR 63



>gb:AY063926_1565873 Arabidopsis thaliana unknown protein
           (At3g06740) mRNA, complete cds.>gb:AY091250_1574458
           Arabidopsis thaliana unknown protein (At3g06740) mRNA,
           complete cds.
          Length = 149

 Score = 52.8 bits (125), Expect = 7e-06
 Identities = 20/36 (55%), Positives = 25/36 (69%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 577
           + C  C  +KTP WR GP GPK+LCNACG+R +  R
Sbjct: 41  KSCAICGTSKTPLWRGGPAGPKSLCNACGIRNRKKR 76



>gb:ATAC023912_1543781 Arabidopsis thaliana chromosome III BAC F3E22
           genomic sequence, complete sequence.
          Length = 136

 Score = 52.8 bits (125), Expect = 7e-06
 Identities = 20/36 (55%), Positives = 25/36 (69%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 577
           + C  C  +KTP WR GP GPK+LCNACG+R +  R
Sbjct: 28  KSCAICGTSKTPLWRGGPAGPKSLCNACGIRNRKKR 63



>gb:AB025629_1516530 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MOE17.
          Length = 208

 Score = 52.8 bits (125), Expect = 7e-06
 Identities = 18/38 (47%), Positives = 29/38 (76%), Gaps = 2/38 (5%)
 Frame = -1

Query: 693 QAIRKC--LHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           + ++KC  ++C    TP WR GP+GPK+LCNACG++++
Sbjct: 154 EGMKKCTNMNCNALNTPMWRRGPLGPKSLCNACGIKFR 191



>gb:AF082072_1766577 Emericella nidulans ABC transporter protein
           AtrC (atrC) and GATA-factor (lreB) genes, complete cds.
          Length = 417

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 19/31 (61%), Positives = 24/31 (77%)
 Frame = -1

Query: 681 KCLHCEITKTPQWRAGPMGPKTLCNACGVRY 589
           KC  C  + +P+WR GP GPKTLCNACG+R+
Sbjct: 375 KCADCGTSDSPEWRKGPEGPKTLCNACGLRW 405



>gb:CR380955_1651556 Candida glabrata strain CBS138 chromosome I
           complete sequence.
          Length = 567

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 26/66 (39%), Positives = 32/66 (48%), Gaps = 9/66 (13%)
 Frame = -1

Query: 711 NQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRY---------KSGRLFPEYR 559
           N +     +  CLHC    TP+WR GP G +TLCNACG+ Y         K+  L   YR
Sbjct: 466 NNSAGTVVMTSCLHCGENHTPEWRRGPYGNRTLCNACGLFYRKAISKFGVKNANLLLRYR 525

Query: 558 PAASPT 541
              S T
Sbjct: 526 KRISNT 531



>gb:BT010844_1640790 Arabidopsis thaliana At3g16870 mRNA, complete
           cds.>gb:BT012611_1641681 Arabidopsis thaliana At1g35180
           gene, complete cds.>gb:AP001308_1821121 Arabidopsis
           thaliana genomic DNA, chromosome 3, P1 clone:MUH15.
          Length = 190

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 19/36 (52%), Positives = 25/36 (69%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 577
           R C+ C   +TP WR GP GPK+LCNACG++ +  R
Sbjct: 42  RTCVDCGTIRTPLWRGGPAGPKSLCNACGIKSRKKR 77



>gb:AY347827_1177986 Malus x domestica clone 18-2 putative GATA-type
           zinc finger protein mRNA, partial cds.
          Length = 100

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 23/37 (62%), Positives = 25/37 (67%)
 Frame = -1

Query: 711 NQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNAC 601
           N N  P  IR C  C  TKTP WR+GP GPK+LCNAC
Sbjct: 65  NTNNIP-IIRVCSDCNTTKTPLWRSGPRGPKSLCNAC 100



>gb:AK119021_1816966 Arabidopsis thaliana At4g16141 mRNA for unknown
           protein, complete cds, clone: RAFL21-34-K14.
          Length = 197

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 18/36 (50%), Positives = 26/36 (72%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 577
           + C+ C  ++TP WR GP GPK+LCNACG++ +  R
Sbjct: 37  KTCVDCGTSRTPLWRGGPAGPKSLCNACGIKSRKKR 72



>gb:AE016817_1747633 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 625

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 19/30 (63%), Positives = 23/30 (76%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRY 589
           CLHC+   TP+WR GP G +TLCNACG+ Y
Sbjct: 536 CLHCQERDTPEWRRGPYGNRTLCNACGLFY 565



>gb:AY628432_1618572 Trichoderma atroviride blue light regulator 2
           (blr-2) gene, complete cds.
          Length = 484

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 3/53 (5%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRY---KSGRLFPEYRPAASPTFTPS 529
           C  C    +P+WR GP GPKTLCNACG+R+   +  R      P + PT TP+
Sbjct: 430 CTDCGTLDSPEWRKGPNGPKTLCNACGLRWAKKEKKRNNSIGTPLSKPTATPA 482



>gb:CR382126_1659113 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 391

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 23/54 (42%), Positives = 27/54 (50%), Gaps = 9/54 (16%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRY---------KSGRLFPEYRPAASP 544
           C HC  T TP+WR GP G +TLCNACG+ Y         K   +   YR    P
Sbjct: 300 CKHCHETVTPEWRRGPYGNRTLCNACGLFYCKLIRKFNTKDANILMHYRKMKGP 353



>gb:AY189831_1588432 Penicillium chrysogenum RfeH (rfeH) gene,
           complete cds.
          Length = 359

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 18/31 (58%), Positives = 24/31 (77%)
 Frame = -1

Query: 681 KCLHCEITKTPQWRAGPMGPKTLCNACGVRY 589
           +C  C  ++TP+WR GP GP+TLCNACG+ Y
Sbjct: 307 RCHSCNRSETPEWRRGPDGPRTLCNACGLHY 337



>gb:OSJN00102_1694951 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0038F03, complete sequence.
          Length = 450

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 12/82 (14%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEY------------RPAASPTFT 535
           C HC +T TP WR GP     LCNACG R+++      Y             P AS    
Sbjct: 7   CRHCGVTSTPLWRNGPPDKPVLCNACGSRWRTKGSLTNYTPMHARDDIDAEEPRASKLKP 66

Query: 534 PSLHSNSHKKVIEMRSKVGVEN 469
           P+L     K++ +  S + +EN
Sbjct: 67  PTLKLKEQKQLKKNPSHITMEN 88



>gb:AY628431_1618571 Trichoderma atroviride blue light regulator 1
           (blr-1) gene, complete cds.
          Length = 1020

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 19/42 (45%), Positives = 29/42 (69%), Gaps = 2/42 (4%)
 Frame = -1

Query: 687 IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRY--KSGRLFP 568
           +R C +C    TP+WR GP G + LCN+CG+R+  ++GR+ P
Sbjct: 872 VRDCANCHTRNTPEWRRGPSGQRDLCNSCGLRWAKQTGRVSP 913



>gb:AC116922_1206437 Dictyostelium discoideum chromosome 2 map
           6061442-6097630 strain AX4, complete sequence.
          Length = 519

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 18/30 (60%), Positives = 24/30 (80%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRY 589
           C +C+ T+TP+WR GP G K+LCNACG+ Y
Sbjct: 462 CRNCKTTETPEWRKGPDGTKSLCNACGLHY 491



>gb:CR382137_1669842 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 288

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 26/64 (40%), Positives = 34/64 (53%), Gaps = 5/64 (7%)
 Frame = -1

Query: 771 PEQXXXXXXKFTIPIAPVD-TNQNQPPQAIRK----CLHCEITKTPQWRAGPMGPKTLCN 607
           P Q      ++  P+  V  +N    P+ I K    C  C  T+TP+WR GP G KTLCN
Sbjct: 141 PPQQAVYYPQYAPPVPTVSGSNPFVAPEVINKTNNVCQRCGTTETPEWRRGPGGVKTLCN 200

Query: 606 ACGV 595
           ACG+
Sbjct: 201 ACGL 204



>gb:AY823265_1628896 Hypocrea jecorina white collar 2 (WC2) gene,
           complete cds.
          Length = 500

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 18/30 (60%), Positives = 22/30 (73%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRY 589
           C  C    +P+WR GP GPKTLCNACG+R+
Sbjct: 451 CTDCGTLDSPEWRKGPSGPKTLCNACGLRW 480



>sp|P78714|WC2_NEUCR White collar 2 protein (WC2).>pir|T46648|T46648
           zinc finger protein wc-2 [validated] - Neurospora
           crassa>gb:BX842682_1644278 Neurospora crassa DNA linkage
           group I BAC contig B13C5.>gb:NCWC2_1690722 N.crassa wc-2
           gene.
          Length = 530

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 18/30 (60%), Positives = 22/30 (73%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRY 589
           C  C    +P+WR GP GPKTLCNACG+R+
Sbjct: 468 CTDCGTLDSPEWRKGPSGPKTLCNACGLRW 497



>sp|Q00858|CGPB_FUSSO Cutinase gene palindrome-binding protein
           (PBP).>pir|A57506|A57506 palindrome-binding protein -
           fungus (Fusarium solani)>gb:FSU23722_1679324 Fusarium
           solani pisi cutinase gene palindrome-binding protein
           mRNA, complete cds.
          Length = 457

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 18/30 (60%), Positives = 22/30 (73%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRY 589
           C  C    +P+WR GP GPKTLCNACG+R+
Sbjct: 402 CTDCGTLDSPEWRKGPSGPKTLCNACGLRW 431



>gb:AP005191_1849141 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0479D12.
          Length = 328

 Score = 49.3 bits (116), Expect = 8e-05
 Identities = 33/94 (35%), Positives = 48/94 (51%), Gaps = 6/94 (6%)
 Frame = -1

Query: 708 QNQPPQAIRKCLHCEIT--KTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYR--PAASPT 541
           + +PP A  +C HC I+   TP  R GP GP+TLCNACG+ + +     E    P     
Sbjct: 227 EGRPPSAA-ECHHCGISAASTPMMRRGPDGPRTLCNACGLMWANKGTMREVTKGPPVPLQ 285

Query: 540 FTPSLHSNSHKKVIEMRSKVGVE--NTAITEAPS 445
             P+  ++    ++E     GVE  N+A+ EA S
Sbjct: 286 IVPAATNDVQNGIVE---ATGVEQHNSAVEEAVS 316



>gb:CR382126_1658787 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 252

 Score = 49.3 bits (116), Expect = 8e-05
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C+HCE  +T +WR GP G  TLCNACG+ Y+
Sbjct: 126 CVHCECVETIEWRNGPWGKATLCNACGLWYR 156



>gb:AY823264_1628895 Hypocrea jecorina white collar 1 (WC1) gene,
            complete cds.
          Length = 1040

 Score = 49.3 bits (116), Expect = 8e-05
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 2/41 (4%)
 Frame = -1

Query: 684  RKCLHCEITKTPQWRAGPMGPKTLCNACGVRY--KSGRLFP 568
            R C +C    TP+WR GP G + LCN+CG+R+  ++GR+ P
Sbjct: 898  RDCANCHTRNTPEWRRGPSGQRDLCNSCGLRWAKQTGRVSP 938



>gb:AC116922_1206436 Dictyostelium discoideum chromosome 2 map
           6061442-6097630 strain AX4, complete sequence.
          Length = 587

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 18/30 (60%), Positives = 22/30 (73%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRY 589
           C+ C   +TP+WR GP G KTLCNACG+ Y
Sbjct: 500 CIFCGTMETPEWRKGPGGHKTLCNACGLHY 529



>gb:TBO575416_1724825 Tuber borchii Tbwc-1 gene for tuber borchii
           white collar-1 protein.>gb:TBO575418_1724826 Tuber
           borchii mRNA for tuber borchii white collar-1 (Tbwc-1
           gene).
          Length = 956

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 2/44 (4%)
 Frame = -1

Query: 693 QAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKS--GRLFP 568
           Q  + C +C    TP+WR GP G + LCN+CG+RY    GR+ P
Sbjct: 825 QLEKDCANCHTRVTPEWRRGPSGKRDLCNSCGLRYAKLIGRVSP 868



>gb:CR380950_1649809 Candida glabrata strain CBS138 chromosome D
           complete sequence.
          Length = 441

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 19/31 (61%), Positives = 21/31 (67%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           CL C    TP+WR GP G  TLCNACG+ YK
Sbjct: 379 CLQCGKVDTPEWRNGPQGKATLCNACGLFYK 409



>gb:AY062562_1565218 Arabidopsis thaliana Unknown protein
           (Z97343.42) mRNA, complete cds.>gb:BT020356_1642751
           Arabidopsis thaliana At4g17570 gene, complete cds.
          Length = 510

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 19/41 (46%), Positives = 23/41 (56%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRP 556
           C HC +T TP WR GP     LCNACG R+++      Y P
Sbjct: 7   CYHCGVTNTPLWRNGPPEKPVLCNACGSRWRTKGTLVNYTP 47



>sp|Q07928|GAT3_YEAST GAT3 protein.>pir|S64835|S64835 hypothetical
           protein YLR013w - yeast (Saccharomyces
           cerevisiae)>gb:AY558530_1614757 Saccharomyces cerevisiae
           clone FLH111026.01X YLR013W gene, complete
           cds.>gb:SCYLR013W_1713414 S.cerevisiae chromosome XII
           reading frame ORF YLR013w.
          Length = 141

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 23/48 (47%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
 Frame = -1

Query: 726 APVDTNQNQPPQAIRKCLHCEITKT-PQWRAGPMGPKTLCNACGVRYK 586
           A V  N  +     R+C  C + KT PQWR GP G  TLCNACG+ Y+
Sbjct: 56  AVVQHNVQKRKGVTRRCPQCAVIKTSPQWREGPDGEVTLCNACGLFYR 103



>gb:BT020259_1642654 Arabidopsis thaliana At5g47140 gene, complete
           cds.>gb:BT020450_1642844 Arabidopsis thaliana At5g47140
           mRNA, complete cds.
          Length = 470

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 19/41 (46%), Positives = 23/41 (56%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRP 556
           C HC +T TP WR GP     LCNACG R+++      Y P
Sbjct: 7   CYHCGVTSTPLWRNGPPEKPVLCNACGSRWRTKGSLVNYTP 47



>gb:CR382139_1672133 Debaryomyces hansenii chromosome G of strain
           CBS767 of Debaryomyces hansenii.
          Length = 401

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 3/49 (6%)
 Frame = -1

Query: 726 APVDTNQNQPPQAIR---KCLHCEITKTPQWRAGPMGPKTLCNACGVRY 589
           +P+D     P  ++R   +C HC    TP+WR G  G +TLCNACG+ Y
Sbjct: 322 SPLDLGALNPDLSVRQEIRCNHCGSKNTPEWRKGLDGNRTLCNACGLFY 370



>gb:DDU68754_1377407 Dictyostelium discoideum putative transcription
           factor (stkA) mRNA, complete cds.
          Length = 872

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 18/38 (47%), Positives = 25/38 (65%)
 Frame = -1

Query: 699 PPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           P  A R C  C  ++TP WR GP G  +LCNACG++++
Sbjct: 287 PMSAPRSCEFCGSSQTPTWRRGPSGKGSLCNACGIKWR 324



>gb:AC116977_1206928 Dictyostelium discoideum chromosome 2 map
           5515173-5817331 strain AX4, complete sequence.
          Length = 844

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 18/38 (47%), Positives = 25/38 (65%)
 Frame = -1

Query: 699 PPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           P  A R C  C  ++TP WR GP G  +LCNACG++++
Sbjct: 259 PMSAPRSCEFCGSSQTPTWRRGPSGKGSLCNACGIKWR 296



>gb:ENU70043_1676807 Aspergillus nidulans NsdD (nsdD) gene, complete
           cds.>gb:ENU70044_1676808 Emericella nidulans DNA binding
           protein NsdD (nsd) mRNA, complete cds.
          Length = 461

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 17/31 (54%), Positives = 22/31 (70%)
 Frame = -1

Query: 681 KCLHCEITKTPQWRAGPMGPKTLCNACGVRY 589
           +C  C   +TP+WR GP G +TLCNACG+ Y
Sbjct: 399 RCHSCNRAETPEWRRGPDGARTLCNACGLHY 429



>gb:CR382132_1665160 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 474

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 17/30 (56%), Positives = 21/30 (70%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRY 589
           C  C    +P+WR GP G KTLCNACG+R+
Sbjct: 433 CTECGTMNSPEWRKGPQGRKTLCNACGLRW 462



>gb:CR382131_1664774 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 406

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 23/56 (41%), Positives = 30/56 (53%), Gaps = 8/56 (14%)
 Frame = -1

Query: 738 TIPIAPVDTNQNQPPQAIRK--------CLHCEITKTPQWRAGPMGPKTLCNACGV 595
           T P +P+  N N   +  R         C  C  T+TP+WR GP G +TLCNACG+
Sbjct: 322 TPPASPLFINTNTKRKRKRSRSDASTTVCRGCGTTETPEWRKGPEGARTLCNACGL 377



>gb:NC123A4_1688273 Neurospora crassa DNA linkage group V cosmid
           contig 123A4.
          Length = 445

 Score = 46.2 bits (108), Expect = 7e-04
 Identities = 17/31 (54%), Positives = 21/31 (67%)
 Frame = -1

Query: 681 KCLHCEITKTPQWRAGPMGPKTLCNACGVRY 589
           +C  C    TP+WR GP G +TLCNACG+ Y
Sbjct: 392 RCHSCNRIDTPEWRRGPDGARTLCNACGLHY 422



>gb:AE016814_1746005 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome I, complete sequence.
          Length = 460

 Score = 45.8 bits (107), Expect = 9e-04
 Identities = 16/30 (53%), Positives = 22/30 (73%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRY 589
           CL C    T +WR+GP+G K++CNACG+ Y
Sbjct: 342 CLQCGSRDTSEWRSGPLGRKSMCNACGIWY 371



>gb:D83211_1674822 Zygosaccharomyces rouxii DNA for DNA-binding
           protein, complete cds.
          Length = 327

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 22/51 (43%), Positives = 27/51 (52%)
 Frame = -1

Query: 738 TIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           T  +  +D   + PP+   KC HC    TP WR  PMG   LCNACG+  K
Sbjct: 227 TTSLMSMDEKMDSPPKDT-KCTHCHTRTTPLWRRDPMG-NPLCNACGLFLK 275



>gb:AB183264_1202537 Dictyostelium discoideum amvA mRNA for GATA
           zinc finger protein, complete cds.
          Length = 650

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 15/33 (45%), Positives = 24/33 (72%)
 Frame = -1

Query: 687 IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRY 589
           +++C  C  T +P+WR GP G ++LCNACG+ +
Sbjct: 519 LKQCTSCGTTSSPEWRKGPAGNQSLCNACGLYF 551



>gb:AP004278_1839664 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0468G03.>gb:AP005931_1860297 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0545E05.
          Length = 340

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 21/42 (50%), Positives = 27/42 (64%), Gaps = 2/42 (4%)
 Frame = -1

Query: 708 QNQPPQAIRKCLHCEITK--TPQWRAGPMGPKTLCNACGVRY 589
           + +PP A  +C HC I    TP  R GP GP+TLCNACG+ +
Sbjct: 248 EGRPPSAA-ECHHCGINAKATPMMRRGPDGPRTLCNACGLMW 288



>gb:YSCGLN3_1728967 S.cerevisiae nitrogen regulatory protein (GLN3)
           gene, complete cds.
          Length = 730

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 33/95 (34%), Positives = 43/95 (45%)
 Frame = -1

Query: 714 TNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFT 535
           + QN+ P  + +C +C+  KTP WR  P G  TLCNACG+  K   L    RP       
Sbjct: 296 SGQNKKP--LIQCFNCKTFKTPLWRRSPEG-NTLCNACGLFQK---LHGTMRPL------ 343

Query: 534 PSLHSNSHKKVIEMRSKVGVENTAITEAPSTPQPA 430
            SL S+  KK I  +     +       PS P  A
Sbjct: 344 -SLKSDVIKKRISKKRAKQTDPNIAQNTPSAPATA 377



>gb:AY045906_1561411 Arabidopsis thaliana putative flowering protein
           CONSTANS (At1g51600) mRNA, complete cds.
          Length = 302

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 2/48 (4%)
 Frame = -1

Query: 678 CLHCEITK--TPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT 541
           C HC I +  TP  R GP GP+TLCNACG+ + +   F +   A+  T
Sbjct: 223 CRHCGIGEKSTPMMRRGPAGPRTLCNACGLMWANKGAFRDLSKASPQT 270



>gb:AB119061_1527911 Arabidopsis thaliana ZML2 mRNA for GATA-type
           zinc finger protein, complete cds.>gb:AY150395_1584960
           Arabidopsis thaliana putative flowering protein CONSTANS
           (At1g51600) mRNA, complete cds.
          Length = 302

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 2/48 (4%)
 Frame = -1

Query: 678 CLHCEITK--TPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT 541
           C HC I +  TP  R GP GP+TLCNACG+ + +   F +   A+  T
Sbjct: 223 CRHCGIGEKSTPMMRRGPAGPRTLCNACGLMWANKGAFRDLSKASPQT 270



>sp|P18494|GLN3_YEAST Nitrogen regulatory protein
           GLN3.>pir|S50543|S50543 GLN3 protein - yeast
           (Saccharomyces cerevisiae)>gb:SCE9379_1708088
           Saccharomyces cerevisiae chromosome V cosmids 9379,
           9581, and lambda clone 4678.
          Length = 730

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 33/95 (34%), Positives = 43/95 (45%)
 Frame = -1

Query: 714 TNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFT 535
           + QN+ P  + +C +C+  KTP WR  P G  TLCNACG+  K   L    RP       
Sbjct: 296 SGQNKKP--LIQCFNCKTFKTPLWRRSPEG-NTLCNACGLFQK---LHGTMRPL------ 343

Query: 534 PSLHSNSHKKVIEMRSKVGVENTAITEAPSTPQPA 430
            SL S+  KK I  +     +       PS P  A
Sbjct: 344 -SLKSDVIKKRISKKRAKQTDPNIAQNTPSAPATA 377



>gb:AF520973_1807869 Candida albicans transcription factor SFU1
           gene, complete cds.
          Length = 518

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 21/45 (46%), Positives = 28/45 (62%), Gaps = 2/45 (4%)
 Frame = -1

Query: 711 NQNQPPQAI--RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKS 583
           +Q  PPQ    ++C +C  TKTP WR  P G   +CNACG+ Y+S
Sbjct: 48  HQQTPPQPTDGQQCSNCGTTKTPLWRRAPDG-TLICNACGLYYRS 91



 Score = 40.4 bits (93), Expect = 0.036
 Identities = 32/100 (32%), Positives = 46/100 (46%), Gaps = 3/100 (3%)
 Frame = -1

Query: 714 TNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRP--AASPT 541
           T +++   AI  C +C  T TP WR    G  T+CNACG+ Y   RL   +RP     PT
Sbjct: 174 TTEDESSLAIA-CFNCGTTITPLWRRDDAG-NTICNACGLFY---RLHGSHRPIKMKRPT 228

Query: 540 FTPSLHSNSHKK-VIEMRSKVGVENTAITEAPSTPQPAFN 424
                 + S KK   E++     ++  +   P +P P  N
Sbjct: 229 IKRRKRNVSDKKSKDEVQMHSSDQSPIVASDPISPTPHNN 268



>gb:AK118169_1816161 Arabidopsis thaliana At3g21175 mRNA for unknown
           protein, complete cds, clone: RAFL19-48-M24.
          Length = 123

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 2/46 (4%)
 Frame = -1

Query: 720 VDTNQNQPPQAIRKCLHCEITK--TPQWRAGPMGPKTLCNACGVRY 589
           V+  + Q P+ +  C HC  ++  TP  R GP GP+TLCNACG+ +
Sbjct: 33  VEGTETQKPEVL--CRHCGTSEKSTPMMRRGPDGPRTLCNACGLMW 76



>gb:AY603044_1617445 Marchantia polymorpha male-specific
           transcription factor M88B7.2 (M88B7.2) mRNA, complete
           cds.
          Length = 393

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 2/67 (2%)
 Frame = -1

Query: 678 CLHCEITK--TPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK 505
           C+HC I +  TP  R GP GP+TLCNACG+ + +  +  +          P      H++
Sbjct: 276 CVHCGIGERSTPMMRRGPSGPRTLCNACGLMWANKGVLRDLSKNPPLPGAPQQPHMLHQQ 335

Query: 504 VIEMRSK 484
            I MR +
Sbjct: 336 QIIMRQQ 342



>gb:AY085109_1570191 Arabidopsis thaliana clone 12996 mRNA, complete
           sequence.
          Length = 297

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 2/46 (4%)
 Frame = -1

Query: 720 VDTNQNQPPQAIRKCLHCEITK--TPQWRAGPMGPKTLCNACGVRY 589
           V+  + Q P+ +  C HC  ++  TP  R GP GP+TLCNACG+ +
Sbjct: 207 VEGTETQKPEVL--CRHCGTSEKSTPMMRRGPDGPRTLCNACGLMW 250



>gb:AY042817_1560882 Arabidopsis thaliana Unknown protein (MXL8.2)
           mRNA, complete cds.>gb:AY064628_1566079 Arabidopsis
           thaliana unknown protein (MXL8.2) mRNA, complete cds.
          Length = 295

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 2/46 (4%)
 Frame = -1

Query: 720 VDTNQNQPPQAIRKCLHCEITK--TPQWRAGPMGPKTLCNACGVRY 589
           V+  + Q P+ +  C HC  ++  TP  R GP GP+TLCNACG+ +
Sbjct: 205 VEGTETQKPEVL--CRHCGTSEKSTPMMRRGPDGPRTLCNACGLMW 248



>gb:AB023045_1515507 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MXL8.>gb:AB119060_1527910 Arabidopsis thaliana
           ZML1 mRNA for GATA-type zinc finger protein, complete
           cds.
          Length = 297

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 2/46 (4%)
 Frame = -1

Query: 720 VDTNQNQPPQAIRKCLHCEITK--TPQWRAGPMGPKTLCNACGVRY 589
           V+  + Q P+ +  C HC  ++  TP  R GP GP+TLCNACG+ +
Sbjct: 207 VEGTETQKPEVL--CRHCGTSEKSTPMMRRGPDGPRTLCNACGLMW 250



>gb:AF087130_1767233 Neurospora crassa siderophore regulation
           protein (sre) gene, complete cds.
          Length = 587

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 34/105 (32%), Positives = 47/105 (44%), Gaps = 5/105 (4%)
 Frame = -1

Query: 708 QNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPS 529
           Q+Q    +  C +C  T TP WR    G  T+CNACG+ YK   L   +RP         
Sbjct: 272 QSQNTTVVIACQNCGTTITPLWRRDEAG-HTICNACGLYYK---LHGVHRPV-------- 319

Query: 528 LHSNSHKKVIEMRSKV-----GVENTAITEAPSTPQPAFNNPSVE 409
                 K +I+ R +V     G      +EAP +P PA + P +E
Sbjct: 320 ---TMKKAIIKRRKRVIPAAGGDAEIEPSEAPDSP-PATSEPPME 360



 Score = 37.7 bits (86), Expect = 0.24
 Identities = 25/80 (31%), Positives = 33/80 (41%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVI 499
           C +C  T TP WR  P G   +CNACG+  K+       R AA P       S     V 
Sbjct: 118 CSNCGTTHTPLWRRSPQG-AIICNACGLYLKA-------RNAARPANIRRPPSVMASNVR 169

Query: 498 EMRSKVGVENTAITEAPSTP 439
           +  +K+  +       PS P
Sbjct: 170 QAAAKLSPKKATAPLLPSNP 189



>gb:AF515628_1807470 Emericella nidulans GATA-factor (lreA) gene,
           complete cds.
          Length = 836

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 15/32 (46%), Positives = 21/32 (65%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRY 589
           + C  C    TP+WR GP G + LCN+CG+R+
Sbjct: 785 KSCAMCGTRTTPEWRRGPSGNRDLCNSCGLRW 816



>gb:AE017347_1757817 Cryptococcus neoformans var. neoformans JEC21
           chromosome 7, complete sequence.
          Length = 632

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 16/37 (43%), Positives = 23/37 (62%)
 Frame = -1

Query: 702 QPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVR 592
           +PP  +  C+ C   ++P+WR    G K LCNACG+R
Sbjct: 555 RPPGDVEACVMCGTKESPEWRKNTNGVKDLCNACGLR 591



>gb:AC126223_1740539 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBb0076N15, complete sequence.
          Length = 778

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 2/40 (5%)
 Frame = -1

Query: 687 IRKCLHCEITK--TPQWRAGPMGPKTLCNACGVRYKSGRL 574
           + +CL C I+   TP  R GP G +TLCNACG+ +  G++
Sbjct: 27  LTRCLRCGISANATPHMRRGPEGRRTLCNACGIAWAKGKV 66



>gb:CR382139_1672907 Debaryomyces hansenii chromosome G of strain
           CBS767 of Debaryomyces hansenii.
          Length = 702

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 19/48 (39%), Positives = 25/48 (52%)
 Frame = -1

Query: 729 IAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           + P + +         +C +C   KTP WR  P G KTLCNACG+  K
Sbjct: 202 VKPAEASATNDETKQTECFNCHALKTPLWRKDPQG-KTLCNACGLFLK 248



>gb:CR380950_1649670 Candida glabrata strain CBS138 chromosome D
           complete sequence.
          Length = 712

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 19/39 (48%), Positives = 25/39 (64%), Gaps = 2/39 (5%)
 Frame = -1

Query: 687 IRKCLHCEITKTPQWRAGPMGPKT--LCNACGVRYKSGR 577
           +RKC+ C  + +P WR    G KT  LCN+CG+RYK  R
Sbjct: 622 LRKCVSCNSSDSPCWRPSWSGKKTEQLCNSCGLRYKKTR 660



>gb:CNS07EG9_1372782 chromosome II of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 341

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 20/40 (50%), Positives = 22/40 (55%), Gaps = 1/40 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFP 568
           R C +C  T TP WR G  G   LCNACG+  K  GR  P
Sbjct: 125 RICSNCSTTSTPSWRRGDQGKSLLCNACGLYQKLHGRTRP 164



>pir|JC7336|JC7336 zinc-finger protein - Arabidopsis
           thaliana>gb:AB035310_1518937 Arabidopsis thaliana mRNA
           for ZIM, complete cds.
          Length = 309

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 18/30 (60%), Positives = 21/30 (70%), Gaps = 2/30 (6%)
 Frame = -1

Query: 678 CLHCEITK--TPQWRAGPMGPKTLCNACGV 595
           C HC I+   TP  R GP GP+TLCNACG+
Sbjct: 214 CTHCGISSKCTPMMRRGPSGPRTLCNACGL 243



>pir|T09910|T09910 hypothetical protein T22A6.300 - Arabidopsis
           thaliana>gb:AB035311_1518938 Arabidopsis thaliana gene
           for ZIM, complete cds.>gb:ATCHRIV61_1546330 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           61.>gb:ATT22A6_1555196 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T22A6 (ESSA
           project).>gb:AY086038_1571099 Arabidopsis thaliana clone
           20769 mRNA, complete sequence.
          Length = 309

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 18/30 (60%), Positives = 21/30 (70%), Gaps = 2/30 (6%)
 Frame = -1

Query: 678 CLHCEITK--TPQWRAGPMGPKTLCNACGV 595
           C HC I+   TP  R GP GP+TLCNACG+
Sbjct: 214 CTHCGISSKCTPMMRRGPSGPRTLCNACGL 243



>gb:AE017342_1754696 Cryptococcus neoformans var. neoformans JEC21
           chromosome 2, complete sequence.
          Length = 514

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 15/34 (44%), Positives = 23/34 (67%)
 Frame = -1

Query: 687 IRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           +R+C  C  + T +WR GP GP +LC+ CG+ Y+
Sbjct: 454 LRRCHGCGSSVTSEWRTGPDGPDSLCDICGMHYE 487



>gb:BT019772_2151532 Synthetic construct Homo sapiens GATA binding
           protein 1 (globin transcription factor 1) mRNA, partial
           cds.
          Length = 414

 Score = 42.0 bits (97), Expect = 0.012
 Identities = 22/49 (44%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
 Frame = -1

Query: 699 PPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           PP   R+C++C  T TP WR    G   LCNACG+ +K +G+  P  RP
Sbjct: 197 PPCEARECVNCGATATPLWRRDRTG-HYLCNACGLYHKMNGQNRPLIRP 244



 Score = 34.3 bits (77), Expect = 2.6
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = -1

Query: 681 KCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           +C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 257 QCTNCQTTTTTLWRRNASGDP-VCNACGLYYK 287



>gb:BC009797_1972268 Homo sapiens GATA binding protein 1 (globin
           transcription factor 1), mRNA (cDNA clone MGC:13628
           IMAGE:4048082), complete cds.
          Length = 335

 Score = 42.0 bits (97), Expect = 0.012
 Identities = 22/49 (44%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
 Frame = -1

Query: 699 PPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           PP   R+C++C  T TP WR    G   LCNACG+ +K +G+  P  RP
Sbjct: 197 PPCEARECVNCGATATPLWRRDRTG-HYLCNACGLYHKMNGQNRPLIRP 244



 Score = 34.3 bits (77), Expect = 2.6
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = -1

Query: 681 KCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           +C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 257 QCTNCQTTTTTLWRRNASGDP-VCNACGLYYK 287



>sp|P15976|GAT1_HUMAN Erythroid transcription factor (GATA-1)
           (Eryf1) (GF-1) (NF-E1).>pir|A34888|A34888 transcription
           factor GATA-1 - human>gb:HSERYF1_2013068 Human mRNA for
           the transcription factor Eryf1.>gb:HUMGF1A_2031446 Human
           erythroid DNA-binding protein (GF-1) mRNA, complete cds.
          Length = 413

 Score = 42.0 bits (97), Expect = 0.012
 Identities = 22/49 (44%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
 Frame = -1

Query: 699 PPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           PP   R+C++C  T TP WR    G   LCNACG+ +K +G+  P  RP
Sbjct: 197 PPCEARECVNCGATATPLWRRDRTG-HYLCNACGLYHKMNGQNRPLIRP 244



 Score = 34.3 bits (77), Expect = 2.6
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = -1

Query: 681 KCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           +C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 257 QCTNCQTTTTTLWRRNASGDP-VCNACGLYYK 287



>sp|P17678|GAT1_CHICK Erythroid transcription factor (GATA-1)
           (Eryf1) (NF-E1 DNA-binding protein)
           (NF-E1A).>pir|A32993|A32993 transcription factor GATA-1
           - chicken>gb:CHKRERYF1_2569512 Chicken
           erythroid-specific transcription factor eryf1 mRNA,
           complete cds.
          Length = 304

 Score = 42.0 bits (97), Expect = 0.012
 Identities = 23/60 (38%), Positives = 34/60 (56%), Gaps = 1/60 (1%)
 Frame = -1

Query: 732 PIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           P+ P+ +    PP   R+C++C  T TP WR    G   LCNACG+ ++ +G+  P  RP
Sbjct: 94  PLLPLSSGP--PPCEARECVNCGATATPLWRRDGTG-HYLCNACGLYHRLNGQNRPLIRP 150



 Score = 37.4 bits (85), Expect = 0.31
 Identities = 15/31 (48%), Positives = 20/31 (64%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ + T  WR  PMG   +CNACG+ YK
Sbjct: 164 CSNCQTSTTTLWRRSPMG-DPVCNACGLYYK 193



>gb:DRU18311_2571263 Danio rerio zg1 mRNA, complete cds.
          Length = 418

 Score = 41.6 bits (96), Expect = 0.016
 Identities = 23/49 (46%), Positives = 31/49 (63%), Gaps = 1/49 (2%)
 Frame = -1

Query: 699 PPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           PP+A R+C++C  T TP WR    G   LCNACG+ +K +G+  P  RP
Sbjct: 232 PPEA-RECVNCGATATPLWRQDGTG-HYLCNACGLYHKMNGQNRPLIRP 278



>gb:CR382131_1663689 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 805

 Score = 41.6 bits (96), Expect = 0.016
 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 4/59 (6%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRL----FPEYRPAASPTFTPSLHSNS 514
           C +C  T+TP WR  P G  T+CNACG+  K+  +      E  PA +  + P   S S
Sbjct: 228 CSNCGTTRTPLWRRAPNG-ATICNACGLYLKARNISRPTHLEKPPATATIYLPGSQSTS 285



 Score = 36.6 bits (83), Expect = 0.52
 Identities = 19/41 (46%), Positives = 23/41 (56%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRP 556
           C +C  T TP WR    G  T+CNACG+ Y   RL   +RP
Sbjct: 397 CQNCGTTITPLWRRDDSG-STICNACGLYY---RLHGVHRP 433



>gb:CR382121_1654319 Kluyveromyces lactis strain NRRL Y-1140
           chromosome A of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 781

 Score = 41.6 bits (96), Expect = 0.016
 Identities = 20/40 (50%), Positives = 25/40 (62%)
 Frame = -1

Query: 705 NQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           N+PP    +C +C+  KTP WR  P G  TLCNACG+  K
Sbjct: 343 NKPPT---QCYNCKTLKTPLWRRDPDG-NTLCNACGLFQK 378



>sp|P40349|URB1_USTMA Siderophore biosynthesis regulatory protein
           URBS1.>pir|S27473|S27473 URBS1 protein - smut fungus
           (Ustilago maydis)>gb:USMURBS1A_1726941 Ustilago maydis
           URBS1 protein (urbS1) gene, complete cds.
          Length = 950

 Score = 41.6 bits (96), Expect = 0.016
 Identities = 17/33 (51%), Positives = 22/33 (66%)
 Frame = -1

Query: 681 KCLHCEITKTPQWRAGPMGPKTLCNACGVRYKS 583
           +C +C +T TP WR  P G  T+CNACG+  KS
Sbjct: 337 RCSNCGVTSTPLWRRAPDG-STICNACGLYIKS 368



 Score = 38.5 bits (88), Expect = 0.14
 Identities = 25/90 (27%), Positives = 39/90 (43%)
 Frame = -1

Query: 732 PIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPA 553
           P+A    + ++      +C +C+ T TP WR    G   +CNACG+ +K   L   +RP 
Sbjct: 464 PVAEEKMDDDKSVVGALRCTNCQTTTTPLWRRDEDG-NNICNACGLYHK---LHGTHRPI 519

Query: 552 ASPTFTPSLHSNSHKKVIEMRSKVGVENTA 463
                         K VI+ R ++    TA
Sbjct: 520 -----------GMKKSVIKRRKRIPANATA 538



>gb:AE017341_1754024 Cryptococcus neoformans var. neoformans JEC21
            chromosome 1, complete sequence.
          Length = 1290

 Score = 41.2 bits (95), Expect = 0.021
 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 6/55 (10%)
 Frame = -1

Query: 732  PIAPVDTNQNQPPQAIRK------CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
            P  P   N+  P   +        C +C+ T TP WR  P G + LCNACG+ YK
Sbjct: 1162 PGTPTSENEGGPGSIMPSGENPTMCTNCQTTNTPLWRRDPDG-QPLCNACGLFYK 1215



>gb:AC096689_1736272 Oryza sativa chromosome 3 BAC OSJNBa0027J18
           genomic sequence, complete sequence.
          Length = 201

 Score = 41.2 bits (95), Expect = 0.021
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 4/50 (8%)
 Frame = -1

Query: 726 APVDTNQNQPPQAIRK--CLHCEITK--TPQWRAGPMGPKTLCNACGVRY 589
           AP  +  N     IR+  C +C I+   TP  R GP GP++LCNACG+ +
Sbjct: 78  APCGSTANGEDDHIRETHCQNCGISSRLTPAMRRGPAGPRSLCNACGLMW 127



>gb:AB043467_1519976 Schizophyllum commune gene for transcription
            factor ScGATA-6, complete cds.
          Length = 1075

 Score = 41.2 bits (95), Expect = 0.021
 Identities = 17/31 (54%), Positives = 21/31 (67%)
 Frame = -1

Query: 678  CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
            C +C+ T TP WR  P G + LCNACG+ YK
Sbjct: 957  CTNCQTTNTPLWRRDPEG-QPLCNACGLFYK 986



>gb:AC087851_1734195 Oryza sativa chromosome 3 BAC OSJNBb0072E24
           genomic sequence, complete sequence.
          Length = 319

 Score = 40.8 bits (94), Expect = 0.028
 Identities = 17/33 (51%), Positives = 23/33 (69%), Gaps = 2/33 (6%)
 Frame = -1

Query: 681 KCLHCEITK--TPQWRAGPMGPKTLCNACGVRY 589
           KC +C  ++  TP  R GP GP+TLCNACG+ +
Sbjct: 214 KCQNCGTSEKMTPAMRRGPAGPRTLCNACGLMW 246



>gb:CR380949_1649507 Candida glabrata strain CBS138 chromosome C
           complete sequence.
          Length = 823

 Score = 40.4 bits (93), Expect = 0.036
 Identities = 25/76 (32%), Positives = 36/76 (47%)
 Frame = -1

Query: 720 VDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT 541
           V +++  P      C +C+  KTP WR  P G K LCNACG+  K   L    RP +  T
Sbjct: 324 VSSSERPPDPDAVHCDNCKTYKTPLWRRSPEG-KVLCNACGLFQK---LHGTMRPLSLKT 379

Query: 540 FTPSLHSNSHKKVIEM 493
                 ++  +  I+M
Sbjct: 380 DVIRKRNSKKRTKIQM 395



>gb:AF077674_1239295 Strongylocentrotus purpuratus cell-type
           coelomocyte GATA transcription factor (GATA) mRNA,
           complete cds.
          Length = 431

 Score = 40.4 bits (93), Expect = 0.036
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 1/58 (1%)
 Frame = -1

Query: 726 APVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           AP   N+++     R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 205 APKPRNKSRSTTEGRECVNCGATSTPLWRRDGNG-HYLCNACGLYHKMNGQNRPLIKP 261



 Score = 36.6 bits (83), Expect = 0.52
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR  P G   +CNACG+ YK
Sbjct: 274 CANCQATATTLWRRNPNG-DPVCNACGLYYK 303



>gb:BC052653_2101180 Mus musculus GATA binding protein 1, mRNA (cDNA
           clone MGC:60652 IMAGE:30039400), complete cds.
          Length = 413

 Score = 40.0 bits (92), Expect = 0.047
 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 1/62 (1%)
 Frame = -1

Query: 738 TIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEY 562
           ++P+AP +          R+C++C  T TP WR    G   LCNACG+ +K +G+  P  
Sbjct: 193 SLPLAPCEA---------RECVNCGATATPLWRRDRTG-HYLCNACGLYHKMNGQNRPLI 242

Query: 561 RP 556
           RP
Sbjct: 243 RP 244



 Score = 32.7 bits (73), Expect = 7.6
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = -1

Query: 681 KCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           +C +C+ T T  WR    G   +CNACG+ +K
Sbjct: 257 QCTNCQTTTTTLWRRNASG-DPVCNACGLYFK 287



>pir|S63461|S63461 hypothetical protein YPL021w - yeast
           (Saccharomyces cerevisiae)>gb:AY558439_1614666
           Saccharomyces cerevisiae clone FLH111506.01X YPL021W
           gene, complete cds.>gb:SCU36624_1710210 Saccharomyces
           cerevisiae chromosome XVI, left arm cosmid 9901.
          Length = 187

 Score = 40.0 bits (92), Expect = 0.047
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           ++C  C  T T QWR+GP G   LC+ CG+ Y+
Sbjct: 130 KECATCGDTWTSQWRSGPNGNVELCSRCGIAYR 162



>sp|P43429|GAT1_RAT Erythroid transcription factor (GATA-1) (Eryf1)
           (GF-1) (NF-E1).>pir|S48756|S48756 transcription factor
           GATA-1 - rat>gb:RATGATA1_2132265 Rat mRNA for
           transcription factor GATA-1, complete cds.
          Length = 413

 Score = 40.0 bits (92), Expect = 0.047
 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 1/62 (1%)
 Frame = -1

Query: 738 TIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEY 562
           ++P+AP +          R+C++C  T TP WR    G   LCNACG+ +K +G+  P  
Sbjct: 193 SLPLAPCEA---------RECVNCGATATPLWRRDRTG-HYLCNACGLYHKMNGQNRPLI 242

Query: 561 RP 556
           RP
Sbjct: 243 RP 244



 Score = 34.3 bits (77), Expect = 2.6
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = -1

Query: 681 KCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           +C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 257 QCTNCQTTTTTLWRRNASGDP-VCNACGLYYK 287



>sp|P17679|GAT1_MOUSE Erythroid transcription factor (GATA-1)
           (Eryf1) (GF-1) (NF-E1).>pir|S04655|S04655 transcription
           factor GATA-1 - mouse>gb:MMGF1_2115026 Mouse mRNA for
           DNA-binding protein GF-1.
          Length = 413

 Score = 40.0 bits (92), Expect = 0.047
 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 1/62 (1%)
 Frame = -1

Query: 738 TIPIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEY 562
           ++P+AP +          R+C++C  T TP WR    G   LCNACG+ +K +G+  P  
Sbjct: 193 SLPLAPCEA---------RECVNCGATATPLWRRDRTG-HYLCNACGLYHKMNGQNRPLI 242

Query: 561 RP 556
           RP
Sbjct: 243 RP 244



 Score = 32.7 bits (73), Expect = 7.6
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = -1

Query: 681 KCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           +C +C+ T T  WR    G   +CNACG+ +K
Sbjct: 257 QCTNCQTTTTTLWRRNASG-DPVCNACGLYFK 287



>gb:BC015577_1975186 Homo sapiens GATA binding protein 2, mRNA (cDNA
           clone MGC:23124 IMAGE:4127146), complete
           cds.>gb:BC018988_1976683 Homo sapiens GATA binding
           protein 2, mRNA (cDNA clone MGC:20306 IMAGE:4128414),
           complete cds.>gb:BC051272_1984543 Homo sapiens GATA
           binding protein 2, mRNA (cDNA clone MGC:59668
           IMAGE:4893358), complete cds.
          Length = 466

 Score = 39.7 bits (91), Expect = 0.062
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 1/54 (1%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRPAASPTFTPSL 526
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P    T T +L
Sbjct: 293 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKPKRRLTTTTTL 345



>gb:AE016819_1749348 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 468

 Score = 39.7 bits (91), Expect = 0.062
 Identities = 30/88 (34%), Positives = 36/88 (40%)
 Frame = -1

Query: 681 KCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKV 502
           KC +C    TP WR GP G   LCNACG+  K   L    RP +  T            V
Sbjct: 288 KCSNCMTKTTPLWRRGPQG-DPLCNACGLFLK---LHGVVRPLSLKT-----------DV 332

Query: 501 IEMRSKVGVENTAITEAPSTPQPAFNNP 418
           I+ R +    NT      S   PA + P
Sbjct: 333 IKKRQRGSNRNTQAVGKTSCESPAKDVP 360



>gb:CR382136_1668722 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 574

 Score = 39.7 bits (91), Expect = 0.062
 Identities = 24/53 (45%), Positives = 31/53 (58%)
 Frame = -1

Query: 714 TNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRP 556
           T +N+P  AI  C +C  T TP WR   +G  T+CNACG+ Y   RL   +RP
Sbjct: 189 TPENEP-MAIA-CFNCGSTITPLWRRDDVG-NTICNACGLYY---RLHGSHRP 235



 Score = 39.3 bits (90), Expect = 0.081
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 4/50 (8%)
 Frame = -1

Query: 720 VDTNQNQPPQAI----RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKS 583
           VDT +     A+    ++C +C  TKTP WR  P G   +CNACG+  +S
Sbjct: 56  VDTEEKAQVVAVGDDGQQCSNCGTTKTPLWRRAPDG-TLICNACGLYLRS 104



>gb:CR382135_1667957 Debaryomyces hansenii chromosome C of strain
           CBS767 of Debaryomyces hansenii.
          Length = 543

 Score = 39.7 bits (91), Expect = 0.062
 Identities = 26/81 (32%), Positives = 39/81 (48%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVI 499
           C +C+   TP WR    G + LCNACG+  K   L    RP +  T T           I
Sbjct: 45  CRNCKTQTTPLWRRDETG-QVLCNACGLFLK---LHGRPRPISLKTDT-----------I 89

Query: 498 EMRSKVGVENTAITEAPSTPQ 436
           + R+++   N + T +P+TP+
Sbjct: 90  KSRNRIKQANPSKTSSPNTPE 110



>sp|P91623|GATC_DROME GATA-binding factor-C (Transcription factor
           GATA-C) (dGATA-C) (Grain protein).>pir|A57601|A57601
           transcription factor dGATAc - fruit fly (Drosophila
           melanogaster)>gb:AE014297_1138422 Drosophila
           melanogaster chromosome 3R, complete
           sequence.>gb:AE003677_1220415 Drosophila melanogaster
           chromosome 3R, section 15 of 118 of the complete
           sequence.>gb:AY071369_1295453 Drosophila melanogaster
           RE40104 full length cDNA.>gb:DROGATA_1382055 Drosophila
           melanogaster mRNA for GATA transcription factor,
           complete cds.
          Length = 486

 Score = 39.7 bits (91), Expect = 0.062
 Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ YK +G+  P  +P
Sbjct: 259 RECVNCGATSTPLWRRDGTG-HYLCNACGLYYKMNGQNRPLIKP 301



 Score = 35.4 bits (80), Expect = 1.2
 Identities = 16/41 (39%), Positives = 23/41 (56%)
 Frame = -1

Query: 708 QNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           Q+   +A   C +C+ T T  WR    G + +CNACG+ YK
Sbjct: 311 QSAAKRAGTSCANCKTTTTTLWRRNASG-EPVCNACGLYYK 350



>sp|P40569|GAT4_YEAST GAT4 protein.>pir|S48357|S48357 hypothetical
           protein YIR013c - yeast (Saccharomyces
           cerevisiae)>gb:AY557847_1614074 Saccharomyces cerevisiae
           clone FLH003649.01X YIR013C gene, complete
           cds.>gb:SC9167_1705753 S.cerevisiae chromosome IX cosmid
           9167.
          Length = 121

 Score = 39.7 bits (91), Expect = 0.062
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 2/75 (2%)
 Frame = -1

Query: 717 DTNQNQPPQAI-RKCLHC-EITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP 544
           D+   +P   I R C  C EI  + QWR GP G   LCNACG+ ++  +L   +  AA+ 
Sbjct: 39  DSQPARPRTGITRTCGQCGEIKTSLQWREGPNGAACLCNACGLFFR--KLILRFGRAAAK 96

Query: 543 TFTPSLHSNSHKKVI 499
            +   +     K+ I
Sbjct: 97  RYMEQIKGTGTKRRI 111



>gb:AC007858_1536265 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone BAC 10A19I, complete sequence.
          Length = 319

 Score = 39.3 bits (90), Expect = 0.081
 Identities = 27/90 (30%), Positives = 32/90 (35%), Gaps = 40/90 (44%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPK-------------------------------------- 619
           R+C +C    TP WR GP GPK                                      
Sbjct: 152 RRCANCGTASTPLWRNGPRGPKVRRRRRSLSPSLFSISAVHFAVSPTYVVSLTLPPSYVS 211

Query: 618 --TLCNACGVRYKSGRLFPEYRPAASPTFT 535
             +LCNACG+RYK      E R AA+ T T
Sbjct: 212 LQSLCNACGIRYKK-----EERRAAATTTT 236



>pir|S07396|S07396 hypothetical protein clone CB15A-2D - yeast
           (Saccharomyces cerevisiae)>gb:SCRAHS2_1709319 Yeast
           GRF88 chromosome III RAHS DNA with Ty1-161 insertion
           left region delta 1 ( RAHS = right arm hot spot ).
          Length = 133

 Score = 39.3 bits (90), Expect = 0.081
 Identities = 16/37 (43%), Positives = 23/37 (62%)
 Frame = -1

Query: 699 PPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRY 589
           P   I++C  C+ T T QWR+GP   + LC+ CG+ Y
Sbjct: 73  PNGEIKECSKCKDTWTIQWRSGPDQNRELCSRCGLAY 109



>pir|S19428|S19428 SRD1 protein - yeast (Saccharomyces
           cerevisiae)>gb:SCRAHS1_1709318 Yeast CN31C chromosome
           III RAHS DNA (right arm transcription hot-spot).
          Length = 225

 Score = 39.3 bits (90), Expect = 0.081
 Identities = 16/37 (43%), Positives = 23/37 (62%)
 Frame = -1

Query: 699 PPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRY 589
           P   I++C  C+ T T QWR+GP   + LC+ CG+ Y
Sbjct: 161 PNGEIKECSKCKDTWTIQWRSGPDQNRELCSPCGLAY 197



>sp|P09007|SRD1_YEAST Pre-rRNA processing protein SRD1 (Suppressor
           of rRNA processing defect protein
           1).>gb:SCCHRIII_1706858 S.cerevisiae chromosome III
           complete DNA sequence.
          Length = 221

 Score = 39.3 bits (90), Expect = 0.081
 Identities = 16/37 (43%), Positives = 23/37 (62%)
 Frame = -1

Query: 699 PPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRY 589
           P   I++C  C+ T T QWR+GP   + LC+ CG+ Y
Sbjct: 161 PNGEIKECSKCKDTWTIQWRSGPDQNRELCSPCGLAY 197



>gb:BC076462_2559298 Danio rerio zgc:91840, mRNA (cDNA clone
           MGC:91840 IMAGE:7037467), complete cds.
          Length = 427

 Score = 38.9 bits (89), Expect = 0.11
 Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  RP
Sbjct: 262 RECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIRP 304



>gb:AB112062_2465650 Oryzias latipes mRNA for hematopietic
           transcription factor GATA-1, complete cds.
          Length = 417

 Score = 38.9 bits (89), Expect = 0.11
 Identities = 22/48 (45%), Positives = 30/48 (62%), Gaps = 1/48 (2%)
 Frame = -1

Query: 696 PQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           P+A R+C++C  T TP WR    G   LCNACG+ +K +G+  P  RP
Sbjct: 233 PEA-RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIRP 278



>gb:CR382137_1669611 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 559

 Score = 38.9 bits (89), Expect = 0.11
 Identities = 17/31 (54%), Positives = 19/31 (61%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C  T TP WR  P G K LCNACG+  K
Sbjct: 380 CTNCNTTATPLWRRDPKG-KPLCNACGLFLK 409



>pir|S46418|S46418 NTL1 protein - curled-leaved tobacco
          Length = 18

 Score = 38.9 bits (89), Expect = 0.11
 Identities = 14/18 (77%), Positives = 17/18 (94%)
 Frame = -1

Query: 666 EITKTPQWRAGPMGPKTL 613
           ++TKTPQWR GP+GPKTL
Sbjct: 1   QVTKTPQWREGPLGPKTL 18



>gb:AE016818_1748236 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 395

 Score = 38.5 bits (88), Expect = 0.14
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 2/37 (5%)
 Frame = -1

Query: 690 AIRKCLHCEITKTPQWRA--GPMGPKTLCNACGVRYK 586
           ++R+CL C  T++P WR          LCN+CG+RYK
Sbjct: 304 SMRRCLSCHCTESPCWRPSWSDRRQDQLCNSCGLRYK 340



>gb:AF100657_1241200 Caenorhabditis elegans cosmid F52C12, complete
           sequence.>gb:AF353303_1264859 Caenorhabditis elegans
           GATA-like transcription factor ELT-6 mRNA, complete cds.
          Length = 367

 Score = 38.5 bits (88), Expect = 0.14
 Identities = 23/54 (42%), Positives = 29/54 (53%)
 Frame = -1

Query: 717 DTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRP 556
           DT+ N    +I KC +C   KT  WR    G K +CNACG+ Y   RL   +RP
Sbjct: 255 DTSANS---SISKCSNCSTIKTTAWRRDLEG-KLVCNACGLYY---RLHRTHRP 301



>gb:AB183298_2467103 Oryzias latipes gata-2 mRNA for transcription
           factor GATA-2, complete cds.
          Length = 455

 Score = 38.1 bits (87), Expect = 0.18
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 273 RECVNCGATSTPLWRRDSTG-HYLCNACGLYHKMNGQNRPLIKP 315



 Score = 33.9 bits (76), Expect = 3.4
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 329 CANCQTTTTTLWRRNASGDP-VCNACGLYYK 358



>gb:AB111059_2465528 Eptatretus burgeri Gata 2/3 mRNA for
           transcription factor Gata-binding protein 2/3, complete
           cds.
          Length = 491

 Score = 38.1 bits (87), Expect = 0.18
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 2/50 (4%)
 Frame = -1

Query: 699 PPQAI-RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           PP A  R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 293 PPLAEGRECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 341



>gb:CR382132_1665689 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 697

 Score = 38.1 bits (87), Expect = 0.18
 Identities = 16/32 (50%), Positives = 21/32 (65%)
 Frame = -1

Query: 681 KCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           +C +C  T TP WR  P G ++LCNACG+  K
Sbjct: 535 QCSNCNTTTTPLWRRSPEG-ESLCNACGLFLK 565



>pir|T43298|T43298 transcription factor gaf2 - fission yeast
           (Schizosaccharomyces pombe)>gb:YSPGAF2A_1731107
           Schizosaccharomyces pombe GATA-binding transcription
           factor (gaf2) gene, complete cds.
          Length = 564

 Score = 38.1 bits (87), Expect = 0.18
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 2/42 (4%)
 Frame = -1

Query: 705 NQPPQ--AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           + PP   ++  C +C  T TP+WR    G   +CNACG+ YK
Sbjct: 161 SSPPHEPSVTFCQNCATTNTPKWRRDESG-NPICNACGLYYK 201



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 19/53 (35%), Positives = 25/53 (47%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSL 526
           + C +C  T T  WR GP     LCNACG       L+ ++R  A P  +  L
Sbjct: 10  QSCSNCHKTTTSLWRRGP-DNSLLCNACG-------LYQKHRKHARPVKSEDL 54



>sp|Q92259|SREP_PENCH GATA factor SREP.>pir|JC6170|JC6170
           GATA-transcription factor - Penicillium
           chrysogenum>gb:PCU48414_1699463 Penicillium chrysogenum
           GATA factor (sreP) gene, complete cds.
          Length = 532

 Score = 38.1 bits (87), Expect = 0.18
 Identities = 24/66 (36%), Positives = 31/66 (46%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKVI 499
           C +C  T TP WR    G   +CNACG+ YK   L   YRP           +N  K +I
Sbjct: 238 CQNCGTTVTPLWRRDEQG-HPICNACGLYYK---LHGCYRP-----------TNMKKSII 282

Query: 498 EMRSKV 481
           + R +V
Sbjct: 283 KRRKRV 288



 Score = 35.0 bits (79), Expect = 1.5
 Identities = 20/58 (34%), Positives = 26/58 (44%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK 505
           C +C    TP WR  P G   +CNACG+  K+       R  A PT    + S   +K
Sbjct: 94  CSNCGTKSTPLWRRSPTG-AMICNACGLYLKA-------RNVARPTKRNRMQSEGAEK 143



>sp|P23767|GA1A_XENLA GATA binding factor-1A (Transcription factor
           xGATA-1A).>pir|A41602|A41602 transcription factor
           GATA-1A - African clawed frog>gb:XELGATAA_2581863
           X.laevis GATA-binding protein (XGATA-1A) gene, complete
           cds.
          Length = 359

 Score = 38.1 bits (87), Expect = 0.18
 Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR   M    LCNACG+ +K +G+  P  RP
Sbjct: 176 RECVNCGATVTPLWRR-DMSGHYLCNACGLYHKMNGQNRPLIRP 218



>gb:BC075479_2558582 Xenopus tropicalis MGC89310 protein, mRNA (cDNA
           clone MGC:89310 IMAGE:6986505), complete cds.
          Length = 437

 Score = 37.7 bits (86), Expect = 0.24
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 255 RECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 297



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 311 CANCQTTTTTLWRRNANGDP-VCNACGLYYK 340



>gb:BC053131_2550524 Danio rerio GATA-binding protein 2, mRNA (cDNA
           clone MGC:63885 IMAGE:6789690), complete cds.
          Length = 456

 Score = 37.7 bits (86), Expect = 0.24
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 269 RECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 311



 Score = 33.1 bits (74), Expect = 5.8
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 325 CANCQTTTTTLWRRNGNGDP-VCNACGLYYK 354



>gb:AY079198_2510963 Raja eglanteria GATA-3 mRNA, complete cds.
          Length = 444

 Score = 37.7 bits (86), Expect = 0.24
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 257 RECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 299



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 313 CANCQTTTTTLWRRNANGDP-VCNACGLYYK 342



>gb:BT007897_2150829 Synthetic construct Homo sapiens GATA binding
           protein 3 mRNA, partial cds.
          Length = 444

 Score = 37.7 bits (86), Expect = 0.24
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 261 RECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 303



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 317 CANCQTTTTTLWRRNANGDP-VCNACGLYYK 346



>gb:AY024364_2073974 Rattus norvegicus GATA-3 mRNA, complete cds.
          Length = 444

 Score = 37.7 bits (86), Expect = 0.24
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 262 RECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 304



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 318 CANCQTTTTTLWRRNANGDP-VCNACGLYYK 347



>gb:HSGATA3_2013386 H.sapiens GATA-3 mRNA.
          Length = 443

 Score = 37.7 bits (86), Expect = 0.24
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 261 RECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 303



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 317 CANCQTTTTTLWRRNANGDP-VCNACGLYYK 346



>gb:BCI309051_1632782 Botrytis cinerea partial bir1 gene for GATA
           transcription factor, exons 1-3.
          Length = 388

 Score = 37.7 bits (86), Expect = 0.24
 Identities = 18/41 (43%), Positives = 22/41 (53%)
 Frame = -1

Query: 708 QNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           Q Q    +  C +C  T TP WR    G  T+CNACG+ YK
Sbjct: 267 QAQNTTVVVACQNCGTTITPLWRRDESG-HTICNACGLYYK 306



 Score = 37.7 bits (86), Expect = 0.24
 Identities = 19/44 (43%), Positives = 25/44 (56%)
 Frame = -1

Query: 672 HCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPT 541
           +C  T+TP WR  P G  T+CNACG       L+ + R A+ PT
Sbjct: 120 NCGTTRTPLWRRSPQG-ATICNACG-------LYQKARNASRPT 155



>pir|T26296|T26296 hypothetical protein W09C2.1 - Caenorhabditis
           elegans
          Length = 454

 Score = 37.7 bits (86), Expect = 0.24
 Identities = 20/56 (35%), Positives = 27/56 (48%)
 Frame = -1

Query: 711 NQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP 544
           N +Q     R+C++C +  TP WR    G   LCNACG+ +K        RP   P
Sbjct: 244 NNSQFSTEDRECVNCGVHNTPLWRRDGSG-NYLCNACGLYFKMNH---HARPLVKP 295



 Score = 32.7 bits (73), Expect = 7.6
 Identities = 15/48 (31%), Positives = 23/48 (47%)
 Frame = -1

Query: 729 IAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           + P    QN   +   +C++C    T  WR    G   +CNACG+ +K
Sbjct: 293 VKPKKRQQNAQKRTGIECVNCRTNTTTLWRRNGEG-HPVCNACGLYFK 339



>pir|A39794|A39794 transcription factor GATA-3 -
           human>gb:AL390294_1926586 Human DNA sequence from clone
           RP11-379F12 on chromosome 10 Contains the 3' end of the
           TAF3 gene for TAF3 RNA polymerase II, TATA box binding
           protein (TBP)-associated factor, 140kDa
           (TAF140,TAFII140), the GATA3 gene for GATA binding
           protein 3 (HDR,MGC5445), two novel genes and 3 CpG
           islands, complete sequence.>gb:BC006793_1970406 Homo
           sapiens GATA binding protein 3, transcript variant 1,
           mRNA (cDNA clone MGC:5199 IMAGE:2985843), complete
           cds.>gb:HSGATA3M_2013387 Human mRNA for GATA-3
           transcription factor.
          Length = 444

 Score = 37.7 bits (86), Expect = 0.24
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 262 RECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 304



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 318 CANCQTTTTTLWRRNANGDP-VCNACGLYYK 347



>sp|P23773|GAT3_XENLA Transcription factor xGATA-3 (GATA binding
           factor-3).>pir|D41602|D41602 transcription factor GATA-3
           - African clawed frog>gb:XELGATAD_2581866 X.laevis
           GATA-binding protein (XGATA-3) gene, complete cds.
          Length = 435

 Score = 37.7 bits (86), Expect = 0.24
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 254 RECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 296



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 310 CANCQTTTTTLWRRNANGDP-VCNACGLYYK 339



>sp|P23772|GAT3_MOUSE Trans-acting T-cell specific transcription
           factor GATA-3.>pir|B39794|B39794 transcription factor
           GATA-3 - mouse>gb:BC062915_2105065 Mus musculus GATA
           binding protein 3, mRNA (cDNA clone MGC:85992
           IMAGE:6826352), complete cds.>gb:MMGATA3M_2115010 Mouse
           mRNA for GATA-3 transcription factor.
          Length = 443

 Score = 37.7 bits (86), Expect = 0.24
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 261 RECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 303



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 317 CANCQTTTTTLWRRNANGDP-VCNACGLYYK 346



>sp|P23771|GAT3_HUMAN Trans-acting T-cell specific transcription
           factor GATA-3.>gb:AL390294_1926587 Human DNA sequence
           from clone RP11-379F12 on chromosome 10 Contains the 3'
           end of the TAF3 gene for TAF3 RNA polymerase II, TATA
           box binding protein (TBP)-associated factor, 140kDa
           (TAF140,TAFII140), the GATA3 gene for GATA binding
           protein 3 (HDR,MGC5445), two novel genes and 3 CpG
           islands, complete sequence.>gb:AY497006_1954844 Homo
           sapiens GATA binding protein 3 (GATA3) gene, complete
           cds.>gb:BC003070_1968661 Homo sapiens GATA binding
           protein 3, mRNA (cDNA clone MGC:2346 IMAGE:3504200),
           complete cds.>gb:HSGATA3R_2013388 Human hGATA3 mRNA for
           trans-acting T-cell specific transcription factor.
          Length = 443

 Score = 37.7 bits (86), Expect = 0.24
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 261 RECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 303



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 317 CANCQTTTTTLWRRNANGDP-VCNACGLYYK 346



>sp|P23825|GAT3_CHICK GATA binding factor-3 (Transcription factor
           NF-E1C) (GATA-3).>pir|B36389|B36389 transcription factor
           GATA-3 - chicken>gb:GDNFE1C_2572579 Gallus domesticus
           mRNA (NF-E1c cDNA) for NF-E1 DNA binding protein.
          Length = 444

 Score = 37.7 bits (86), Expect = 0.24
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 262 RECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 304



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 318 CANCQTTTTTLWRRNANGDP-VCNACGLYYK 347



>sp|Q91428|GAT3_BRARE Transcription factor GATA-3 (GATA binding
           factor-3).>gb:BX901908_2568039 Zebrafish DNA sequence
           from clone DKEY-268B12 in linkage group 4 Contains the
           gata3 gene for GATA-binding protein 3 and two CpG
           islands, complete sequence.>gb:S80425_2579445
           gta3=transcription factor [zebrafishes, neurula-stage
           embryos, mRNA, 2576 nt].
          Length = 438

 Score = 37.7 bits (86), Expect = 0.24
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 254 RECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 296



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 310 CANCQTTTTTLWRRNANGDP-VCNACGLYYK 339



>sp|P23768|GA1B_XENLA GATA binding factor-1B (Transcription factor
           xGATA-1B).>pir|B41602|B41602 transcription factor
           GATA-1B - African clawed frog>gb:XELGATAB_2581864
           X.laevis GATA-binding protein (XGATA-1B ) gene, complete
           cds.
          Length = 364

 Score = 37.7 bits (86), Expect = 0.24
 Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  RP
Sbjct: 178 RECVNCGATVTPLWRRDLSG-HYLCNACGLYHKMNGQNRPLIRP 220



>sp|P28515|ELT1_CAEEL Transcription factor elt-1.>pir|A41267|A41267
           transcription factor elt-1 - Caenorhabditis
           elegans>gb:CEELT1_1361910 C.elegans elt-1 gene.
          Length = 416

 Score = 37.7 bits (86), Expect = 0.24
 Identities = 20/56 (35%), Positives = 27/56 (48%)
 Frame = -1

Query: 711 NQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP 544
           N +Q     R+C++C +  TP WR    G   LCNACG+ +K        RP   P
Sbjct: 206 NNSQFSTEDRECVNCGVHNTPLWRRDGSG-NYLCNACGLYFKMNH---HARPLVKP 257



 Score = 32.7 bits (73), Expect = 7.6
 Identities = 15/48 (31%), Positives = 23/48 (47%)
 Frame = -1

Query: 729 IAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           + P    QN   +   +C++C    T  WR    G   +CNACG+ +K
Sbjct: 255 VKPKKRQQNAQKRTGIECVNCRTNTTTLWRRNGEG-HPVCNACGLYFK 301



>gb:BT007859_2150791 Synthetic construct Homo sapiens hypothetical
           protein MGC2306 mRNA, partial cds.
          Length = 481

 Score = 37.4 bits (85), Expect = 0.31
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 293 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 335



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 349 CANCQTTTTTLWRRNANGDP-VCNACGLYYK 378



>gb:AY032734_2074120 Rattus norvegicus GATA2 (Gata2) mRNA, complete
           cds.>gb:BC061745_2104607 Rattus norvegicus GATA binding
           protein 2, mRNA (cDNA clone MGC:72369 IMAGE:5599740),
           complete cds.
          Length = 480

 Score = 37.4 bits (85), Expect = 0.31
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 293 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 335



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 349 CANCQTTTTTLWRRNANGDP-VCNACGLYYK 378



>gb:AF345897_2063788 Rattus norvegicus transcription factor GATA-2
           mRNA, complete cds.
          Length = 480

 Score = 37.4 bits (85), Expect = 0.31
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 293 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 335



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 349 CANCQTTTTTLWRRNANGDP-VCNACGLYYK 378



>gb:BC015613_1975205 Homo sapiens GATA binding protein 2, mRNA (cDNA
           clone MGC:23183 IMAGE:4811349), complete
           cds.>gb:BC051342_1984589 Homo sapiens GATA binding
           protein 2, mRNA (cDNA clone MGC:59669 IMAGE:6341380),
           complete cds.
          Length = 480

 Score = 37.4 bits (85), Expect = 0.31
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 293 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 335



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 349 CANCQTTTTTLWRRNANGDP-VCNACGLYYK 378



>gb:BC002557_1968209 Homo sapiens GATA binding protein 2, mRNA (cDNA
           clone MGC:2306 IMAGE:3139044), complete
           cds.>gb:BT006671_1990109 Homo sapiens hypothetical
           protein MGC2306 mRNA, complete cds.
          Length = 480

 Score = 37.4 bits (85), Expect = 0.31
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 293 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 335



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 349 CANCQTTTTTLWRRNANGDP-VCNACGLYYK 378



>gb:AF320976_1785893 Aspergillus nidulans GATA factor AREB gamma
           (areB) gene, partial cds; and GATA factors AREB alpha
           and beta (areB) gene, complete cds, alternatively
           spliced.
          Length = 320

 Score = 37.4 bits (85), Expect = 0.31
 Identities = 20/49 (40%), Positives = 24/49 (48%)
 Frame = -1

Query: 732 PIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           P A      N PP     C +C  +KTP WR   +G   LCNACG+  K
Sbjct: 11  PAATTGGQGNNPPI----CQNCGTSKTPLWRRDELG-SVLCNACGLFLK 54



>gb:AF320976_1785892 Aspergillus nidulans GATA factor AREB gamma
           (areB) gene, partial cds; and GATA factors AREB alpha
           and beta (areB) gene, complete cds, alternatively
           spliced.
          Length = 436

 Score = 37.4 bits (85), Expect = 0.31
 Identities = 20/49 (40%), Positives = 24/49 (48%)
 Frame = -1

Query: 732 PIAPVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           P A      N PP     C +C  +KTP WR   +G   LCNACG+  K
Sbjct: 127 PAATTGGQGNNPPI----CQNCGTSKTPLWRRDELG-SVLCNACGLFLK 170



>gb:AF095898_1767795 Emericella nidulans siderophore biosynthesis
           repressor SREA (sreA) gene, complete cds.
          Length = 549

 Score = 37.4 bits (85), Expect = 0.31
 Identities = 22/53 (41%), Positives = 26/53 (49%), Gaps = 1/53 (1%)
 Frame = -1

Query: 711 NQNQPP-QAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRP 556
           N  QP    +  C +C  T TP WR    G   +CNACG+ YK   L   YRP
Sbjct: 239 NSGQPEGNMLVACQNCGTTVTPLWRRDENG-HPICNACGLYYK---LHGSYRP 287



 Score = 34.3 bits (77), Expect = 2.6
 Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 3/48 (6%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYKS---GRLFPEYRPAASP 544
           C +C    TP WR  P G   +CNACG+  K+    R     R  ASP
Sbjct: 106 CSNCGTKSTPLWRRSPTG-AMICNACGLYLKARNVARPTKRNRTQASP 152



>gb:AB025609_1516344 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K14A3.
          Length = 461

 Score = 37.4 bits (85), Expect = 0.31
 Identities = 16/35 (45%), Positives = 19/35 (54%)
 Frame = -1

Query: 660 TKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRP 556
           T TP WR GP     LCNACG R+++      Y P
Sbjct: 4   TGTPLWRNGPPEKPVLCNACGSRWRTKGSLVNYTP 38



>gb:AY251012_1428021 Sus scrofa transcription factor GATA-2 mRNA,
           complete cds.
          Length = 480

 Score = 37.4 bits (85), Expect = 0.31
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 293 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 335



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 349 CANCQTTTTTLWRRNANGDP-VCNACGLYYK 378



>gb:AY496948_1330965 Nematostella vectensis GATA factor (GATA 1/2/3)
           mRNA, partial cds.
          Length = 208

 Score = 37.4 bits (85), Expect = 0.31
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G   P  +P
Sbjct: 1   RECVNCGATSTPLWRRDGSG-HYLCNACGLYHKMNGSSRPLIKP 43



>gb:AY465174_1329752 Nematostella vectensis GATA transcription
           factor (Gata) mRNA, complete cds.
          Length = 422

 Score = 37.4 bits (85), Expect = 0.31
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G   P  +P
Sbjct: 215 RECVNCGATSTPLWRRDGSG-HYLCNACGLYHKMNGSSRPLIKP 257



>gb:AK004675_1152500 Mus musculus adult male lung cDNA, RIKEN
           full-length enriched library, clone:1200009I20
           product:GATA binding protein 2, full insert sequence.
          Length = 480

 Score = 37.4 bits (85), Expect = 0.31
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 293 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 335



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 349 CANCQTTTTTLWRRNANGDP-VCNACGLYYK 378



>gb:AK004551_1152408 Mus musculus adult male lung cDNA, RIKEN
           full-length enriched library, clone:1200002M12
           product:GATA binding protein 2, full insert sequence.
          Length = 480

 Score = 37.4 bits (85), Expect = 0.31
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 293 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 335



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 349 CANCQTTTTTLWRRNANGDP-VCNACGLYYK 378



>pir|A40815|A40815 transcription factor GATA-2 (version 1) -
           human>gb:HUMGATA_2031396 Human GATA-binding protein
           (GATA2) mRNA, complete cds.
          Length = 480

 Score = 37.4 bits (85), Expect = 0.31
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 293 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 335



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 349 CANCQTTTTTLWRRNANGDP-VCNACGLYYK 378



>pir|B48099|B48099 transcription factor GATA-2, retinoic
           acid-inducible - mouse (fragment)
          Length = 118

 Score = 37.4 bits (85), Expect = 0.31
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 3   RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 45



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 59  CANCQTTTTTLWRRNANGDP-VCNACGLYYK 88



>sp|P23770|GAT2_XENLA Transcription factor xGATA-2 (GATA binding
           factor-2).>pir|C41602|C41602 transcription factor GATA-2
           - African clawed frog>gb:XELGATAC_2581865 X.laevis
           GATA-binding protein (XGATA-2) gene, complete cds.
          Length = 452

 Score = 37.4 bits (85), Expect = 0.31
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 265 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 307



>sp|O09100|GAT2_MOUSE Endothelial transcription factor
           GATA-2.>gb:AB000096_2042979 Mus musculus mRNA for GATA-2
           protein, complete cds.
          Length = 480

 Score = 37.4 bits (85), Expect = 0.31
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 293 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 335



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 349 CANCQTTTTTLWRRNANGDP-VCNACGLYYK 378



>sp|P23769|GAT2_HUMAN Endothelial transcription factor GATA-2.
          Length = 480

 Score = 37.4 bits (85), Expect = 0.31
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 293 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 335



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 349 CANCQTTTTTLWRRNANGDP-VCNACGLYYK 378



>sp|P23824|GAT2_CHICK GATA binding factor-2 (Transcription factor
           NF-E1B) (GATA-2).>pir|A36389|A36389 transcription factor
           NF-E1b - chicken>gb:GDNFE1B_2572578 Gallus domesticus
           mRNA (NF-E1b cDNA) for NF-E1 DNA binding protein.
          Length = 466

 Score = 37.4 bits (85), Expect = 0.31
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 279 RECVNCGATATPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 321



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 335 CANCQTTTTTLWRRNANGDP-VCNACGLYYK 364



>gb:CR382122_1654912 Kluyveromyces lactis strain NRRL Y-1140
           chromosome B of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 460

 Score = 37.0 bits (84), Expect = 0.40
 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 2/35 (5%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKT--LCNACGVRYK 586
           R C+ C IT +P WR      K   LCN+CG+RYK
Sbjct: 371 RFCVSCHITDSPCWRPSWSKSKQDQLCNSCGLRYK 405



>pir|T41087|T41087 hypothetical protein SPCC16A11.14 - fission yeast
            (Schizosaccharomyces pombe)>gb:SPCC16A11_1721015
           S.pombe chromosome III cosmid c16A11.
          Length = 418

 Score = 37.0 bits (84), Expect = 0.40
 Identities = 19/39 (48%), Positives = 25/39 (64%), Gaps = 3/39 (7%)
 Frame = -1

Query: 681 KCLHCEITKTPQW--RAGPMGPKTLCNACGVRY-KSGRL 574
           +C  C +  T  +  R GP G K+LCNACGV Y K+G+L
Sbjct: 371 RCRWCNVLGTGTFCVRRGPEGNKSLCNACGVAYAKTGQL 409



>sp|Q10134|FEP1_SCHPO Iron-sensing transcription factor 1
           (Transcription factor gaf2) (Gaf- 2).>pir|T38291|T38291
           GATA-type transcription factor family protein Gaf2p -
           fission yeast (Schizosaccharomyces
           pombe)>gb:AY099027_1576546 Schizosaccharomyces pombe
           transcription factor Fep1 (fep1) gene, complete
           cds.>gb:SPAC23E2_1717306 S.pombe chromosome I cosmid
           c23E2.>gb:SPO457978_1721964 Schizosaccharomyces pombe
           fep1 gene for iron-sensing transcription factor.
          Length = 564

 Score = 37.0 bits (84), Expect = 0.40
 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 2/42 (4%)
 Frame = -1

Query: 705 NQPPQ--AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           + PP   ++  C +C  T TP WR    G   +CNACG+ YK
Sbjct: 161 SSPPHEPSVTFCQNCATTNTPLWRRDESG-NPICNACGLYYK 201



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 19/53 (35%), Positives = 25/53 (47%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSL 526
           + C +C  T T  WR GP     LCNACG       L+ ++R  A P  +  L
Sbjct: 10  QSCSNCHKTTTSLWRRGP-DNSLLCNACG-------LYQKHRKHARPVKSEDL 54



>gb:AE016819_1749072 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 807

 Score = 36.6 bits (83), Expect = 0.52
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = -1

Query: 681 KCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           +C +C+  KTP WR    G  TLCNACG+  K
Sbjct: 329 QCFNCKTFKTPLWRRDLQG-NTLCNACGLFQK 359



>gb:DMGATAFAC_1379544 D.melanogaster mRNA for GATA transcription
           factor.
          Length = 949

 Score = 36.6 bits (83), Expect = 0.52
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C  T T  WR  P G + +CNACG+ YK
Sbjct: 489 CSNCHTTHTSLWRRNPAG-EPVCNACGLYYK 518



>gb:BT011543_1358011 Drosophila melanogaster LD44281 full insert
           cDNA.
          Length = 746

 Score = 36.6 bits (83), Expect = 0.52
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C  T T  WR  P G + +CNACG+ YK
Sbjct: 285 CSNCHTTHTSLWRRNPAG-EPVCNACGLYYK 314



>gb:AY069823_1294553 Drosophila melanogaster SD07261 full length
           cDNA.
          Length = 950

 Score = 36.6 bits (83), Expect = 0.52
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C  T T  WR  P G + +CNACG+ YK
Sbjct: 489 CSNCHTTHTSLWRRNPAG-EPVCNACGLYYK 518



>gb:AF184154_1248537 Ceratitis capitata zinc finger DNA binding
           protein pannier (pnr) mRNA, complete cds.
          Length = 324

 Score = 36.6 bits (83), Expect = 0.52
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 1/54 (1%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRPAASPTFTPSL 526
           R+C++C    TP WR    G   LCNACG+ +K +G   P  +P+   T T  L
Sbjct: 109 RECVNCGAISTPLWRRDGTG-HYLCNACGLYHKMNGMNRPLIKPSKRLTATRRL 161



>gb:AE014297_1139819 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003711_1221812 Drosophila melanogaster
           chromosome 3R, section 49 of 118 of the complete
           sequence.
          Length = 1264

 Score = 36.6 bits (83), Expect = 0.52
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C  T T  WR  P G + +CNACG+ YK
Sbjct: 803 CSNCHTTHTSLWRRNPAG-EPVCNACGLYYK 832



>gb:AE014297_1139817 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE014297_1139818 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE003711_1221810
           Drosophila melanogaster chromosome 3R, section 49 of 118
           of the complete sequence.>gb:AE003711_1221811 Drosophila
           melanogaster chromosome 3R, section 49 of 118 of the
           complete sequence.
          Length = 1249

 Score = 36.6 bits (83), Expect = 0.52
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C  T T  WR  P G + +CNACG+ YK
Sbjct: 788 CSNCHTTHTSLWRRNPAG-EPVCNACGLYYK 817



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 15/33 (45%), Positives = 19/33 (57%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           R+C++C    TP WR    G   LCNACG+  K
Sbjct: 732 RECVNCGAISTPLWRRDNTG-HYLCNACGLYMK 763



>sp|P52172|SRP_DROME Box A-binding factor (ABF) (Serpent protein)
           (GATA-binding factor-B) (Transcription factor GATA-B)
           (dGATA-B).>pir|S40382|S40382 box A-binding factor -
           fruit fly (Drosophila melanogaster)>gb:DMABF_1377987
           D.melanogaster mRNA for box A-binding factor.
          Length = 779

 Score = 36.6 bits (83), Expect = 0.52
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C  T T  WR  P G + +CNACG+ YK
Sbjct: 319 CSNCHTTHTSLWRRNPAG-EPVCNACGLYYK 348



>gb:AF320976_1785894 Aspergillus nidulans GATA factor AREB gamma
           (areB) gene, partial cds; and GATA factors AREB alpha
           and beta (areB) gene, complete cds, alternatively
           spliced.
          Length = 312

 Score = 36.2 bits (82), Expect = 0.68
 Identities = 17/37 (45%), Positives = 21/37 (56%)
 Frame = -1

Query: 696 PQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           PQ    C +C  +KTP WR   +G   LCNACG+  K
Sbjct: 11  PQLQPICQNCGTSKTPLWRRDELG-SVLCNACGLFLK 46



>gb:CNS07EGF_1373914 chromosome VIII of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 232

 Score = 36.2 bits (82), Expect = 0.68
 Identities = 16/31 (51%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C  T TP WR    G   LCNACG+ YK
Sbjct: 8   CSNCNTTATPLWRRADDG-SYLCNACGLYYK 37



>pir|A41782|A41782 transcription factor GATA-2 (version 2) -
           human>gb:HUMGATA2A_2031397 Human transcription factor
           GATA-2 (GATA-2) mRNA, complete cds.
          Length = 474

 Score = 36.2 bits (82), Expect = 0.68
 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C  T TP WR    G   LCNACG  +K  G+  P  +P
Sbjct: 287 RECVNCGATATPLWRRDGTG-HYLCNACGFYHKMKGQNRPLIKP 329



 Score = 33.5 bits (75), Expect = 4.4
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 343 CANCQTTTTTLWRRNANGDP-VCNACGLYYK 372



>gb:DRU18312_2571264 Danio rerio zg2 mRNA, partial cds.
          Length = 194

 Score = 35.8 bits (81), Expect = 0.89
 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 1/43 (2%)
 Frame = -1

Query: 681 KCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           +C++C  T TP WR    G   LCNACG+ +K +G+  P  +P
Sbjct: 8   ECVNCGATSTPLWRRDGTG-HYLCNACGLYHKMNGQNRPLIKP 49



 Score = 33.1 bits (74), Expect = 5.8
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G   +CNACG+ YK
Sbjct: 63  CANCQTTTTTLWRRNGNGDP-VCNACGLYYK 92



>gb:SCYKR033C_1713241 S.cerevisiae chromosome XI reading frame ORF
           YKR033c.
          Length = 135

 Score = 35.8 bits (81), Expect = 0.89
 Identities = 24/59 (40%), Positives = 30/59 (50%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKV 502
           C +C   KTP WR    G   LCNACG+  K   L  E RP +  T T  + S + KK+
Sbjct: 31  CQNCFTVKTPLWRRDEHG-TVLCNACGLFLK---LHGEPRPISLKTDT--IKSRNRKKL 83



>gb:SCUGA43_1710647 S.cerevisiae UGA43 gene.
          Length = 269

 Score = 35.8 bits (81), Expect = 0.89
 Identities = 24/59 (40%), Positives = 30/59 (50%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKV 502
           C +C   KTP WR    G   LCNACG+  K   L  E RP +  T T  + S + KK+
Sbjct: 31  CQNCFTVKTPLWRRDEHG-TVLCNACGLFLK---LHGEPRPISLKTDT--IKSRNRKKL 83



>gb:CR382138_1671147 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 475

 Score = 35.8 bits (81), Expect = 0.89
 Identities = 19/46 (41%), Positives = 23/46 (50%)
 Frame = -1

Query: 681 KCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP 544
           +C +C    TP WR    G   LCNACG+ YK   L    RP + P
Sbjct: 226 QCTNCNTKTTPLWRKSNKGD-LLCNACGLFYK---LHGVLRPLSQP 267



>gb:AY763413_1350357 Aedes aegypti GATAa2 transcription factor mRNA,
           complete cds.
          Length = 1034

 Score = 35.8 bits (81), Expect = 0.89
 Identities = 24/87 (27%), Positives = 37/87 (42%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK 505
           R+C++C   +TP WR    G   LCNACG+ +K   +    RP            +S ++
Sbjct: 616 RECVNCGAIQTPLWRRDGTG-HYLCNACGLYHKMNGM---NRPLVKQPRRLVKEPSSARR 671

Query: 504 VIEMRSKVGVENTAITEAPSTPQPAFN 424
           V    S     NT++       +P  N
Sbjct: 672 VGLQCSNCNTMNTSLWRRNQVGEPVCN 698



 Score = 32.7 bits (73), Expect = 7.6
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = -1

Query: 681 KCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           +C +C    T  WR   +G + +CNACG+ YK
Sbjct: 675 QCSNCNTMNTSLWRRNQVG-EPVCNACGLYYK 705



>gb:AY745809_1349242 Aedes aegypti GATA transcription factor GATAd
           mRNA, complete cds.
          Length = 483

 Score = 35.8 bits (81), Expect = 0.89
 Identities = 24/87 (27%), Positives = 39/87 (44%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK 505
           R+C++C    TP WR    G   LCNACG+ +K   +    RP   P  +  L S + ++
Sbjct: 118 RECVNCGAISTPLWRRDGTG-HYLCNACGLYHKMNGM---NRPLIKP--SKRLVSTATRR 171

Query: 504 VIEMRSKVGVENTAITEAPSTPQPAFN 424
           +    +  G   T +    +  +P  N
Sbjct: 172 LGLCCTNCGTRTTTLWRRNNDGEPVCN 198



>gb:AAE400338_1192449 Aedes aegypti mRNA for GATA transcription
           factor (gatar gene).
          Length = 868

 Score = 35.8 bits (81), Expect = 0.89
 Identities = 24/87 (27%), Positives = 37/87 (42%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKK 505
           R+C++C   +TP WR    G   LCNACG+ +K   +    RP            +S ++
Sbjct: 617 RECVNCGAIQTPLWRRDGTG-HYLCNACGLYHKMNGM---NRPLVKQPRRLVKEPSSARR 672

Query: 504 VIEMRSKVGVENTAITEAPSTPQPAFN 424
           V    S     NT++       +P  N
Sbjct: 673 VGLQCSNCNTMNTSLWRRNQVGEPVCN 699



 Score = 32.7 bits (73), Expect = 7.6
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = -1

Query: 681 KCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           +C +C    T  WR   +G + +CNACG+ YK
Sbjct: 676 QCSNCNTMNTSLWRRNQVG-EPVCNACGLYYK 706



>pir|T40956|T40956 transcription factor gata-type - fission yeast
           (Schizosaccharomyces pombe)>gb:SPCC1393_1720883 S.pombe
           chromosome III cosmid c1393.
          Length = 557

 Score = 35.8 bits (81), Expect = 0.89
 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 8/57 (14%)
 Frame = -1

Query: 732 PIAPVDTNQNQPPQAIRK--------CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           P+A V T +      + K        C +C +T+TP WR        LCNACG+  K
Sbjct: 339 PLAAVKTEKASKAARVMKQKKHREHVCFNCGVTETPLWRRTSDKLNFLCNACGLYNK 395



 Score = 33.1 bits (74), Expect = 5.8
 Identities = 14/28 (50%), Positives = 18/28 (64%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGV 595
           C +C  TKT  WR    G +T+CNACG+
Sbjct: 419 CANCSSTKTSLWRKDRHG-QTVCNACGL 445



>sp|P43574|GAT1_YEAST Transcriptional regulatory protein
           GAT1.>pir|S56233|S56233 probable membrane protein
           YFL021w - yeast (Saccharomyces
           cerevisiae)>gb:SCU27344_1710086 Saccharomyces cerevisiae
           GATA-type transcriptional factor (GAT1) gene, complete
           cds.>gb:YSCCHRVIN_1728488 Saccharomyces cerevisiae
           chromosome VI complete DNA sequence.
          Length = 510

 Score = 35.8 bits (81), Expect = 0.89
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = -1

Query: 681 KCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           KC +C  + TP WR  P G   LCNACG+  K
Sbjct: 309 KCSNCTTSTTPLWRKDPKG-LPLCNACGLFLK 339



>sp|P26343|DA80_YEAST Nitrogen regulatory protein DAL80 (Regulatory
           protein UGA43).>pir|S22781|S22781 transcription factor
           DAL80 - yeast (Saccharomyces
           cerevisiae)>gb:SCYKR034W_1713242 S.cerevisiae chromosome
           XI reading frame ORF YKR034w.>gb:YSCDAL80A_1728794
           Saccharomyces cerevisiae DAL80 gene, complete cds.
          Length = 269

 Score = 35.8 bits (81), Expect = 0.89
 Identities = 24/59 (40%), Positives = 30/59 (50%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASPTFTPSLHSNSHKKV 502
           C +C   KTP WR    G   LCNACG+  K   L  E RP +  T T  + S + KK+
Sbjct: 31  CQNCFTVKTPLWRRDEHG-TVLCNACGLFLK---LHGEPRPISLKTDT--IKSRNRKKL 83



>gb:AF237674_1779678 Candida albicans zinc-finger transcription
           factor (ASH1) gene, complete cds.
          Length = 449

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 12/62 (19%)
 Frame = -1

Query: 735 IPIAPVDTNQNQ------PPQ-----AIRKCLHCEITKTPQWRAG-PMGPKTLCNACGVR 592
           IPI+P    +++      PP+     A R C+ C   ++P WR    +    LCN+CG+R
Sbjct: 335 IPISPPSAKKSRSDLLKSPPKHHHHHAPRVCISCGSDQSPCWRPSWSIKQGQLCNSCGLR 394

Query: 591 YK 586
           YK
Sbjct: 395 YK 396



>gb:AE017343_1755454 Cryptococcus neoformans var. neoformans JEC21
            chromosome 3, complete sequence.
          Length = 1065

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 15/35 (42%), Positives = 18/35 (51%)
 Frame = -1

Query: 678  CLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRL 574
            C  C       WR GP G  TLCN+CG  +  G+L
Sbjct: 920  CEGCAREGIKIWRRGPSGKGTLCNSCGDLFTEGKL 954



>gb:YSPGAF1H_1731106 Schizosaccharomyces pombe gene homologous to
           GATA-binding transcription factor family (gaf-1) gene,
           complete cds.
          Length = 290

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+   TP WR  P G + LCNACG+  K
Sbjct: 70  CTNCQTRTTPLWRRSPDG-QPLCNACGLFMK 99



>gb:YSCORFAB_1730055 Saccharomyces cerevisiae ORF gene, partial cds.
          Length = 454

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 2/35 (5%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAG--PMGPKTLCNACGVRYK 586
           R C+ C  + +P WR    P     LCN+CG+RYK
Sbjct: 388 RVCVSCHSSDSPCWRPSWSPRKQDQLCNSCGLRYK 422



>gb:SPCC1902_1721142 S.pombe chromosome III cosmid c1902.
          Length = 727

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+   TP WR  P G + LCNACG+  K
Sbjct: 507 CTNCQTRTTPLWRRSPDG-QPLCNACGLFMK 536



>gb:CR382129_1662223 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 634

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 23/58 (39%), Positives = 28/58 (48%), Gaps = 3/58 (5%)
 Frame = -1

Query: 732 PIAPVDTNQNQPPQ--AIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFP 568
           PIAP     N   Q      C +C+ + TP WR    G + LCNACG+  K  GR  P
Sbjct: 144 PIAPSKDKDNGRGQFSLTPVCQNCQTSTTPLWRRDEAG-QVLCNACGLFLKLHGRARP 200



>gb:CR382126_1659472 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 692

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 16/44 (36%), Positives = 23/44 (52%)
 Frame = -1

Query: 717 DTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           ++ Q+   +   +C +C    TP WR  P G   LCNACG+  K
Sbjct: 458 NSGQDSGVKTETQCSNCHTKTTPLWRRDPQG-NPLCNACGLFLK 500



>gb:CAL320271_1644969 Candida albicans ASH1 gene.
          Length = 452

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 12/62 (19%)
 Frame = -1

Query: 735 IPIAPVDTNQNQ------PPQ-----AIRKCLHCEITKTPQWRAG-PMGPKTLCNACGVR 592
           IPI+P    +++      PP+     A R C+ C   ++P WR    +    LCN+CG+R
Sbjct: 338 IPISPPSAKKSRSDLLKSPPKHHHHHAPRVCISCGSDQSPCWRPSWSIKQGQLCNSCGLR 397

Query: 591 YK 586
           YK
Sbjct: 398 YK 399



>gb:BMU16320_1355681 Bombyx mori transcription factor BmGATA beta
           isoforms 1-3 (BmoGATA-B) gene, partial cds.
          Length = 241

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G +T+CNACG+ +K
Sbjct: 55  CTNCQTTATSLWRRNVQG-ETVCNACGLYFK 84



>gb:BMU16320_1355680 Bombyx mori transcription factor BmGATA beta
           isoforms 1-3 (BmoGATA-B) gene, partial cds.
          Length = 313

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G +T+CNACG+ +K
Sbjct: 127 CTNCQTTATSLWRRNVQG-ETVCNACGLYFK 156



>gb:BMU16320_1355679 Bombyx mori transcription factor BmGATA beta
           isoforms 1-3 (BmoGATA-B) gene, partial cds.
          Length = 327

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G +T+CNACG+ +K
Sbjct: 141 CTNCQTTATSLWRRNVQG-ETVCNACGLYFK 170



>gb:BMU16274_1355678 Bombyx mori transcription factor BmGATA beta
           isoform 3 (BmoGATA-B) mRNA, partial cds.
          Length = 440

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G +T+CNACG+ +K
Sbjct: 253 CTNCQTTATSLWRRNVQG-ETVCNACGLYFK 282



>gb:BX571866_787043 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 8/17.
          Length = 1284

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 24/74 (32%), Positives = 33/74 (44%)
 Frame = +1

Query: 82  TTDPLKKLTNTTNYYFFNSYP*THISFLFFPYNLKYYGSIASFQPLPPITNLYKEPNNKL 261
           T + LKKL   T     +S P +H++   F Y L+Y+G   S Q L P    Y  P    
Sbjct: 557 TVEKLKKLLTATQSNEISSLPLSHLTLNDFGYALRYFGQFTSHQRLLP-KYAYASPGALY 615

Query: 262 KTPKFEENLNQITL 303
            T  + E  N + L
Sbjct: 616 ATQMYFELHNVLGL 629



>pir|A53741|A53741 transcription factor BmGATA beta -
           silkworm>gb:BMOGATAB_1355612 Bombyx mori chorion factor
           I (BmGATAB) isoform 1 mRNA, complete cds.
          Length = 509

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G +T+CNACG+ +K
Sbjct: 322 CTNCQTTATSLWRRNVQG-ETVCNACGLYFK 351



>pir|I50701|I50701 transcription factor GATA-4 - chicken (fragment)
          Length = 380

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C    TP WR    G   LCNACG+ +K +G   P ++P
Sbjct: 155 RECVNCGAMSTPLWRRDGTG-HYLCNACGLYHKMNGINRPLFKP 197



>pir|S53811|S53811 BmGATA beta isoform 2 - silkworm (fragment)
          Length = 327

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G +T+CNACG+ +K
Sbjct: 141 CTNCQTTATSLWRRNVQG-ETVCNACGLYFK 170



>pir|S53812|S53812 BmGATA beta isoform 3 - silkworm (fragment)
          Length = 241

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G +T+CNACG+ +K
Sbjct: 55  CTNCQTTATSLWRRNVQG-ETVCNACGLYFK 84



>sp|P52167|GATB_BOMMO Transcription factor BCFI (GATA-beta)
           (BmGATA-beta).
          Length = 508

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+ T T  WR    G +T+CNACG+ +K
Sbjct: 322 CTNCQTTATSLWRRNVQG-ETVCNACGLYFK 351



>sp|P43691|GAT4_CHICK Transcription factor GATA-4 (GATA binding
           factor-4) (Fragment).>gb:GGU11887_2573486 Gallus gallus
           GATA-4 transcription factor (GATA-4) mRNA, partial cds.
          Length = 380

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C    TP WR    G   LCNACG+ +K +G   P ++P
Sbjct: 155 RECVNCGAMSTPLWRRDGTG-HYLCNACGLYHKMNGINRPLFKP 197



>sp|Q10280|GAF1_SCHPO Transcription factor gaf1
           (Gaf-1).>pir|T41336|T41336 probable nitrogen regulatory
           transcription factor gaf1 - fission yeast
           (Schizosaccharomyces pombe)
          Length = 855

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C+   TP WR  P G + LCNACG+  K
Sbjct: 635 CTNCQTRTTPLWRRSPDG-QPLCNACGLFMK 664



>sp|P34233|ASH1_YEAST Daughter cells HO repressor protein
           ASH1.>pir|S34685|S34685 probable purine
           nucleotide-binding protein YKL185w - yeast
           (Saccharomyces cerevisiae)>gb:SCPEKGA_1709097
           S.cerevisiae sequence for orfs homologous to calcineurin
           B subunit, 4-mycarosyl isovaleryl-CoA transferase,
           ornithine decarboxylase, fatty acid synthase,
           ribose-phosphate PP-kinase, ribosomal protein L17,
           CENP-E and pheromone A factor
           receptor.>gb:SCYKL185W_1713164 S.cerevisiae chromosome
           XI reading frame ORF YKL185w.
          Length = 588

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 2/35 (5%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAG--PMGPKTLCNACGVRYK 586
           R C+ C  + +P WR    P     LCN+CG+RYK
Sbjct: 497 RVCVSCHSSDSPCWRPSWSPRKQDQLCNSCGLRYK 531



>gb:BC082349_2562586 Xenopus laevis GATA-6 protein, mRNA (cDNA clone
           MGC:79905 IMAGE:6865584), complete cds.
          Length = 502

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 23/61 (37%), Positives = 28/61 (45%)
 Frame = -1

Query: 726 APVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAAS 547
           AP D     P    R+C++C   +TP WR    G   LCNACG+  K   L    RP   
Sbjct: 279 APGDVLDELPES--RECVNCGSVQTPLWRRDGTG-HYLCNACGLYSKMNGL---SRPLIK 332

Query: 546 P 544
           P
Sbjct: 333 P 333



>gb:BC076718_2559465 Xenopus laevis transcription factor xGATA-6,
           mRNA (cDNA clone MGC:79955 IMAGE:3403174), complete cds.
          Length = 502

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 23/61 (37%), Positives = 28/61 (45%)
 Frame = -1

Query: 726 APVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAAS 547
           AP D     P    R+C++C   +TP WR    G   LCNACG+  K   L    RP   
Sbjct: 279 APGDVLDELPES--RECVNCGSVQTPLWRRDGTG-HFLCNACGLYSKMNGL---SRPLIK 332

Query: 546 P 544
           P
Sbjct: 333 P 333



>gb:AY260735_2522535 Xenopus tropicalis zinc-finger transcription
           factor Gata6 mRNA, complete cds.
          Length = 524

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 23/61 (37%), Positives = 28/61 (45%)
 Frame = -1

Query: 726 APVDTNQNQPPQAIRKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAAS 547
           AP D     P    R+C++C   +TP WR    G   LCNACG+  K   L    RP   
Sbjct: 302 APGDVLDELPES--RECVNCGSVQTPLWRRDGTG-HYLCNACGLYSKMNGL---SRPLIK 355

Query: 546 P 544
           P
Sbjct: 356 P 356



>gb:AF191577_2479242 Danio rerio zinc finger transcription factor
           Gata4 (gata4) mRNA, complete cds.
          Length = 338

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 18/47 (38%), Positives = 24/47 (51%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGRLFPEYRPAASP 544
           R+C++C    TP WR    G   LCNACG+ +K   +    RP   P
Sbjct: 165 RECVNCGAMSTPLWRRDGTG-HYLCNACGLYHKMNGI---NRPLVKP 207



>gb:BC085855_2109414 Rattus norvegicus cDNA clone MGC:94578
           IMAGE:7190097, complete cds.
          Length = 404

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C    TP WR    G   LCNACG+ +K +G   P  RP
Sbjct: 194 RECVNCGALSTPLWRRDGTG-HYLCNACGLYHKMNGVNRPLVRP 236



>gb:BC047790_1984023 Homo sapiens GATA binding protein 5, mRNA (cDNA
           clone IMAGE:6464800), partial cds.
          Length = 417

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 1/44 (2%)
 Frame = -1

Query: 684 RKCLHCEITKTPQWRAGPMGPKTLCNACGVRYK-SGRLFPEYRP 556
           R+C++C    TP WR    G   LCNACG+ +K +G   P  RP
Sbjct: 207 RECVNCGALSTPLWRRDGTG-HYLCNACGLYHKMNGVNRPLVRP 249



>gb:CR382131_1664139 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 348

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%)
 Frame = -1

Query: 699 PPQAIRKCLHCEITKTPQWRAG-PMGPKTLCNACGVRYK 586
           P    R+C+ C   ++P WR         LCN+CG+RYK
Sbjct: 257 PSYGKRRCISCGSDQSPCWRPSWSASAGQLCNSCGLRYK 295



>gb:AY293736_1595721 Candida albicans nitrogen regulatory
           GATA-factor (GAT1) gene, complete cds.
          Length = 755

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 15/31 (48%), Positives = 18/31 (58%)
 Frame = -1

Query: 678 CLHCEITKTPQWRAGPMGPKTLCNACGVRYK 586
           C +C    TP WR  P G + LCNACG+  K
Sbjct: 505 CTNCGTKTTPLWRRNPQG-QPLCNACGLFLK 534


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 874,026,297
Number of Sequences: 1806583
Number of extensions: 19585510
Number of successful extensions: 60535
Number of sequences better than 10.0: 320
Number of HSP's better than 10.0 without gapping: 57122
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 60296
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 48442989766
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)