BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig8968
         (804 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB017067_1513418 Arabidopsis thaliana genomic DNA, chromosome...   321   1e-86   
gb:AY086794_1571837 Arabidopsis thaliana clone 27758 mRNA, compl...   317   1e-85   
gb:AF488412_1804371 Sorghum bicolor BAC 131L1, complete sequence.     313   2e-84   
gb:AF488413_1804383 Oryza sativa chromosome 6 BAC 134P10, comple...   310   2e-83   
gb:AP003271_1826908 Oryza sativa (japonica cultivar-group) genom...   252   7e-66   
gb:OSJN00169_1696113 Oryza sativa genomic DNA, chromosome 4, BAC...   250   2e-65   
gb:AC016661_1538189 Arabidopsis thaliana chromosome 3 BAC F11F8 ...   249   6e-65   
gb:AK175686_1817674 Arabidopsis thaliana mRNA for putative prote...   246   3e-64   
gb:AC108876_1738631 Oryza sativa (japonica cultivar-group) chrom...   244   1e-63   
gb:AP003980_1835871 Oryza sativa (japonica cultivar-group) genom...   234   1e-60   
gb:AE014298_1124930 Drosophila melanogaster chromosome X, comple...   210   3e-53   
gb:AY246563_1312614 Branchiostoma floridae cosmid MPMGc117P1382Q...   207   2e-52   
gb:AF391294_1267451 Branchiostoma floridae cosmid MPMGc117K0348,...   207   2e-52   
gb:AX776003_1475293 Sequence 273 from Patent WO03048202.>gb:AF37...   201   1e-50   
gb:HSM805426_1187516 Homo sapiens mRNA; cDNA DKFZp667C222 (from ...   201   1e-50   
gb:AK129407_2069638 Mus musculus mRNA for mKIAA1624 protein.          201   2e-50   
gb:AK088544_1175465 Mus musculus 2 days neonate thymus thymic ce...   201   2e-50   
gb:AK082237_1173496 Mus musculus 0 day neonate cerebellum cDNA, ...   201   2e-50   
gb:AK034815_1163885 Mus musculus 12 days embryo embryonic body b...   201   2e-50   
gb:AK030433_1162004 Mus musculus adult male pituitary gland cDNA...   201   2e-50   
gb:AJ720535_2502722 Gallus gallus mRNA for hypothetical protein,...   200   3e-50   
pir|T48284|T48284 hypothetical protein T22P11.220 - Arabidopsis ...   197   2e-49   Arabidopsis thaliana [mouse-ear cress]
gb:BC084640_2563941 Xenopus laevis hypothetical LOC495226, mRNA ...   195   1e-48   
gb:BC088649_2565776 Xenopus laevis hypothetical LOC496274, mRNA ...   194   1e-48   
gb:AX775895_1475239 Sequence 165 from Patent WO03048202.>gb:BC01...   194   1e-48   
gb:AK047364_1168083 Mus musculus 10 days neonate cerebellum cDNA...   194   1e-48   
gb:IR1703145_2038302 Homo sapiens mRNA full length insert cDNA c...   194   2e-48   
gb:AX073578_1460569 Sequence 30 from Patent WO0104297.>gb:AX7758...   194   2e-48   
gb:BC061996_2104773 Rattus norvegicus G protein-coupled receptor...   194   2e-48   
gb:BC084668_2563968 Xenopus laevis hypothetical LOC495246, mRNA ...   193   3e-48   
gb:AX775897_1475240 Sequence 167 from Patent WO03048202.>gb:AF37...   192   5e-48   
gb:AL136141_1918979 Human DNA sequence from clone RP11-138E2 on ...   178   9e-44   
gb:AB046844_1867483 Homo sapiens mRNA for KIAA1624 protein, part...   178   9e-44   
gb:U56965_1405184 Caenorhabditis elegans cosmid C15H9, complete ...   171   2e-41   
pir|T15514|T15514 hypothetical protein C15H9.5 - Caenorhabditis ...   159   6e-38   Caenorhabditis elegans [roundworm]
gb:AP003271_1826907 Oryza sativa (japonica cultivar-group) genom...   123   5e-27   
gb:AK019012_1159861 Mus musculus 10 day old male pancreas cDNA, ...    63   6e-09   
gb:BC007862_1971049 Homo sapiens G protein-coupled receptor 108,...    63   7e-09   
sp|O05523|YDIJ_BACSU|YDIJ_BACSU Hypothetical protein ydiJ.>pir|C69787|C6978...    35   1.3     Bacillus subtilis
gb:AF506365_1806894 Angraecum eichlerianum isolate 24 maturase K...    35   2.2     
gb:CP000002_856338 Bacillus licheniformis ATCC 14580, complete g...    35   2.2     
gb:AE017333_446524 Bacillus licheniformis DSM 13, complete genome.     35   2.2     
gb:AF506351_1806880 Campylocentrum poeppigii isolate 10 maturase...    34   2.8     
gb:AF506364_1806893 Angraecum cultriforme isolate 23 maturase K ...    34   3.7     
gb:AF506363_1806892 Angraecum chevalieri isolate 22 maturase K g...    34   3.7     
gb:AF506349_1806878 Campylocentrum pachyrrhizum isolate 8 matura...    34   3.7     
gb:AF506343_1806872 Campylocentrum fasciola isolate 2 maturase K...    34   3.7     
gb:AF506342_1806871 Campylocentrum fasciola isolate 1 maturase K...    34   3.7     
gb:AY147235_1583918 Campylocentrum micranthum isolate 1 maturase...    34   3.7     
gb:BC027354_2095923 Mus musculus RIKEN cDNA A930025J12 gene, mRN...    33   4.8     


>gb:AB017067_1513418 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MJC20.>gb:AY059846_1564690 Arabidopsis thaliana
           Unknown protein (At5g42090; MJC20.20) mRNA, complete
           cds.>gb:AY093263_1575217 Arabidopsis thaliana unknown
           protein (At5g42090) mRNA, complete cds.
          Length = 439

 Score =  321 bits (822), Expect = 1e-86
 Identities = 153/174 (87%), Positives = 166/174 (95%)
 Frame = -1

Query: 804 FSFLKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGE 625
           F+FLKGITLFTLIVLIGTGWSFLKPYLQDKEKKVL++VIPLQVVAN AQVVIDETGP+G+
Sbjct: 246 FNFLKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLMIVIPLQVVANFAQVVIDETGPYGQ 305

Query: 624 SSSTWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVIC 445
              TWKQIFLLVD+VCCCAVLFPIVWSIKNLREAAKTDGKAAVNL+KLTLFRQYYI+VIC
Sbjct: 306 DWVTWKQIFLLVDVVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLVKLTLFRQYYIVVIC 365

Query: 444 YIYFTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           YIYFTRVVVYALETITSY+Y WTSVVASELATLAFY+FTG+ FRP+ HNPYF +
Sbjct: 366 YIYFTRVVVYALETITSYKYMWTSVVASELATLAFYLFTGYKFRPEVHNPYFVV 419



>gb:AY086794_1571837 Arabidopsis thaliana clone 27758 mRNA, complete
           sequence.
          Length = 439

 Score =  317 bits (813), Expect = 1e-85
 Identities = 151/174 (86%), Positives = 164/174 (94%)
 Frame = -1

Query: 804 FSFLKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGE 625
           F+FL GITLFTLIVLIGTGWSFLKPYLQDKEKKVL++VIPLQVVAN AQVVIDETGP+G+
Sbjct: 246 FNFLNGITLFTLIVLIGTGWSFLKPYLQDKEKKVLMIVIPLQVVANFAQVVIDETGPYGQ 305

Query: 624 SSSTWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVIC 445
              TWKQIFLLVD+VCCCAVLFPIVWSIKNLREAAKTDGKAAVNL+KLTLFRQYYI+VIC
Sbjct: 306 DWVTWKQIFLLVDVVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLVKLTLFRQYYIVVIC 365

Query: 444 YIYFTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           YIYFTRVVVYALETITSY+Y WTSVVASELATL FY+FTG+ FRP+ HNPYF +
Sbjct: 366 YIYFTRVVVYALETITSYKYMWTSVVASELATLGFYLFTGYKFRPEVHNPYFVV 419



>gb:AF488412_1804371 Sorghum bicolor BAC 131L1, complete sequence.
          Length = 462

 Score =  313 bits (803), Expect = 2e-84
 Identities = 150/174 (86%), Positives = 164/174 (94%)
 Frame = -1

Query: 804 FSFLKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGE 625
           FSFLKGI+LFTLIVLIGTGWSFLKPYL D+EKKVL+VVIPLQVVAN+AQVVIDE+GP+  
Sbjct: 269 FSFLKGISLFTLIVLIGTGWSFLKPYLADREKKVLMVVIPLQVVANIAQVVIDESGPYAR 328

Query: 624 SSSTWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVIC 445
              TWKQIFLLVD+VCCCAVLFPIVWSIKNLREAA++DGKAAVNLMKLTLFRQYY++VIC
Sbjct: 329 DWVTWKQIFLLVDVVCCCAVLFPIVWSIKNLREAARSDGKAAVNLMKLTLFRQYYVVVIC 388

Query: 444 YIYFTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           YIYFTRVVVYAL+TITSYRY WTSVVA ELATLAFYVFTG+ FRP+ HNPYFAI
Sbjct: 389 YIYFTRVVVYALQTITSYRYLWTSVVAGELATLAFYVFTGYKFRPEVHNPYFAI 442



>gb:AF488413_1804383 Oryza sativa chromosome 6 BAC 134P10, complete
           sequence.>gb:AP000559_1820326 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 6,
           clone:P0493C11.>gb:AP002542_1822618 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0679C08.
          Length = 454

 Score =  310 bits (794), Expect = 2e-83
 Identities = 147/174 (84%), Positives = 163/174 (93%)
 Frame = -1

Query: 804 FSFLKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGE 625
           FSFLKGI+LFTLIVLIGTGWSFLKPYL D+EKKVL+VVIPLQVVAN+AQVVIDE+GP+  
Sbjct: 261 FSFLKGISLFTLIVLIGTGWSFLKPYLADREKKVLMVVIPLQVVANIAQVVIDESGPYAR 320

Query: 624 SSSTWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVIC 445
           +  TWKQ+ LLVD++CCCAVLFPIVWSIKNLREAA++DGKAAVNLMKLTLFRQYY++VIC
Sbjct: 321 AWVTWKQVLLLVDVICCCAVLFPIVWSIKNLREAARSDGKAAVNLMKLTLFRQYYVVVIC 380

Query: 444 YIYFTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           YIYFTRVVVYAL TITSYRYQWTS VA ELATLAFYVFTG+ FRP+ HNPYFAI
Sbjct: 381 YIYFTRVVVYALMTITSYRYQWTSYVAKELATLAFYVFTGYKFRPEVHNPYFAI 434



>gb:AP003271_1826908 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0506B12.
          Length = 449

 Score =  252 bits (643), Expect = 7e-66
 Identities = 114/174 (65%), Positives = 144/174 (82%)
 Frame = -1

Query: 804 FSFLKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGE 625
           F  +KG+ LF +I LIGTGWSFLKP+LQDKEKKVL+VVIPLQV AN+A  V+ ETGPF +
Sbjct: 257 FQLVKGVILFAVIALIGTGWSFLKPFLQDKEKKVLMVVIPLQVAANIAAAVVGETGPFLQ 316

Query: 624 SSSTWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVIC 445
              TW QIFL VD+ CCCAVLFP+VWS+++LRE++KTDGKAA  L KLTLFRQ+Y++VI 
Sbjct: 317 GWVTWNQIFLFVDVACCCAVLFPVVWSMRSLRESSKTDGKAARTLAKLTLFRQFYVVVIG 376

Query: 444 YIYFTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           Y+YFTR++VYAL+TIT+Y+Y+W SV A E+AT+AFY+F  + FRP   N YFA+
Sbjct: 377 YLYFTRIIVYALKTITNYKYRWVSVAAEEVATVAFYLFMFYMFRPAERNQYFAL 430



>gb:OSJN00169_1696113 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0043L24, complete sequence.
          Length = 450

 Score =  250 bits (639), Expect = 2e-65
 Identities = 113/174 (64%), Positives = 139/174 (79%)
 Frame = -1

Query: 804 FSFLKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGE 625
           F F KG+ LFT+IVLIGTGWSFLKPYLQ++EKKVL++VIPLQVV N+A  VI ETGP G 
Sbjct: 257 FGFFKGVLLFTVIVLIGTGWSFLKPYLQEREKKVLMIVIPLQVVENIASAVIGETGPAGR 316

Query: 624 SSSTWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVIC 445
               W QIFLLVD++CCCAV FPI+WSI+NLREA+KTDGKAA NL KLTLF+Q+Y++V+ 
Sbjct: 317 DWLAWNQIFLLVDVICCCAVFFPIIWSIRNLREASKTDGKAARNLKKLTLFKQFYLVVVG 376

Query: 444 YIYFTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           Y+YFTR+ V A   + SYRYQW   VA E A+LAFY+F  +NF+P  +NPY  +
Sbjct: 377 YLYFTRIAVSAFAAVLSYRYQWVVTVAMEAASLAFYIFVFYNFKPVENNPYLYV 430



>gb:AC016661_1538189 Arabidopsis thaliana chromosome 3 BAC F11F8
           genomic sequence, complete sequence.>gb:BT002532_1636135
           Arabidopsis thaliana unknown protein (At3g09570) mRNA,
           complete cds.>gb:BT006586_1639473 Arabidopsis thaliana
           At3g09570 mRNA, complete cds.
          Length = 439

 Score =  249 bits (635), Expect = 6e-65
 Identities = 116/174 (66%), Positives = 145/174 (83%)
 Frame = -1

Query: 804 FSFLKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGE 625
           F F++ + LFT+IVLIGTGWSFLKP+LQ+KEK VL+VV+PLQV+AN+A +VI ETGPF +
Sbjct: 247 FQFIRVVLLFTVIVLIGTGWSFLKPFLQEKEKNVLMVVVPLQVLANIASIVIGETGPFIK 306

Query: 624 SSSTWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVIC 445
              TW QIFLLVDIVCCCA+LFPIVWSI++LRE +KTDGKAA NL KLTLFRQ+YI+VI 
Sbjct: 307 DWVTWNQIFLLVDIVCCCAILFPIVWSIRSLRETSKTDGKAARNLAKLTLFRQFYIVVIG 366

Query: 444 YIYFTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           Y+YFTR+VV+AL+TI +Y+Y+W S  A E+A+LAFY+   + FRP   N YF I
Sbjct: 367 YLYFTRIVVFALKTIAAYKYRWVSNAAEEIASLAFYMLMFYMFRPVEKNEYFVI 420



>gb:AK175686_1817674 Arabidopsis thaliana mRNA for putative protein,
           partial cds, clone: RAFL22-20-I15.
          Length = 196

 Score =  246 bits (629), Expect = 3e-64
 Identities = 112/174 (64%), Positives = 143/174 (82%)
 Frame = -1

Query: 804 FSFLKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGE 625
           F F++ + LFT+I+LIGTGWSFLKP+LQ+KEK  LI+VIPLQV+AN+A +VI ETGPF +
Sbjct: 4   FQFIRVVLLFTVIILIGTGWSFLKPFLQEKEKNGLIIVIPLQVLANIASIVIGETGPFIK 63

Query: 624 SSSTWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVIC 445
              TW Q+FLLVDI+CCCA++FPIVWSI++LRE +KTDGKAA NL KLTLFRQ+YI+VI 
Sbjct: 64  DWVTWNQVFLLVDIICCCAIIFPIVWSIRSLRETSKTDGKAARNLSKLTLFRQFYIVVIG 123

Query: 444 YIYFTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           Y+YFTR+VV+AL+TI +Y+YQW S  A E+ +L FYV     FRP+  N YFA+
Sbjct: 124 YLYFTRIVVFALKTIAAYKYQWVSFAAEEIVSLVFYVIMFHMFRPEEKNEYFAV 177



>gb:AC108876_1738631 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1525_A02, complete sequence.
          Length = 458

 Score =  244 bits (623), Expect = 1e-63
 Identities = 112/173 (64%), Positives = 142/173 (82%)
 Frame = -1

Query: 804 FSFLKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGE 625
           F  +KG+ LF +IVL+GTGWSFL+P LQD+EKKVL+VVIPLQV+AN+A  VI ETGPF +
Sbjct: 266 FQLVKGVVLFAVIVLVGTGWSFLRPVLQDREKKVLMVVIPLQVMANIASAVIGETGPFLQ 325

Query: 624 SSSTWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVIC 445
              TW QI L VD+ CCCAVLFP+VWS+++LRE +KTDGKAA  L KLTLFRQ+YI+VI 
Sbjct: 326 GWVTWNQILLFVDVACCCAVLFPVVWSMRSLRETSKTDGKAARTLSKLTLFRQFYIVVIG 385

Query: 444 YIYFTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFA 286
           Y+YFTR+VVYAL+TI SY+++W SV+A E+ATLAFY+F  + FRP   + YF+
Sbjct: 386 YLYFTRIVVYALKTIASYQFRWVSVLAEEVATLAFYLFMFYTFRPAERSRYFS 438



>gb:AP003980_1835871 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1014_H03.>gb:AP004083_1837444 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ1212_C01.
          Length = 455

 Score =  234 bits (598), Expect = 1e-60
 Identities = 104/174 (59%), Positives = 139/174 (79%)
 Frame = -1

Query: 804 FSFLKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGE 625
           F F KG+ LFT+I+LIGTGWS LKPYLQ++EK +L++VIPLQVV N+  VVI ETGP G+
Sbjct: 263 FGFFKGVLLFTVIILIGTGWSILKPYLQEREKNMLMIVIPLQVVENLLLVVIGETGPTGQ 322

Query: 624 SSSTWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVIC 445
               W Q+FLLVD++CCCAV FPI+WSI+++REA+KTDGKAA+NL KLTLF+++Y++V+ 
Sbjct: 323 DWVVWNQVFLLVDVICCCAVFFPIIWSIRSMREASKTDGKAALNLQKLTLFKRFYLVVVG 382

Query: 444 YIYFTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           Y+YFTR++  A   + SY+YQW   VA E A+LAFY+F  +NF+P + NPY  I
Sbjct: 383 YLYFTRIIASAFLALLSYKYQWGVNVAIEAASLAFYLFVFYNFQPVAKNPYLYI 436



>gb:AE014298_1124930 Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE003446_1210112 Drosophila melanogaster
            chromosome X, section 30 of 74 of the complete
            sequence.>gb:AY113517_1299465 Drosophila melanogaster
            RE59932 full insert cDNA.
          Length = 738

 Score =  210 bits (534), Expect = 3e-53
 Identities = 94/171 (54%), Positives = 126/171 (73%)
 Frame = -1

Query: 795  LKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGESSS 616
            LKG  LF  IVLIGTGW+F+K  L DK+KK+ ++VIPLQV+ANVAQ++ DE+        
Sbjct: 505  LKGAVLFITIVLIGTGWTFIKHILSDKDKKIFMIVIPLQVLANVAQIITDESDQSDAEFR 564

Query: 615  TWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVICYIY 436
            TW  IF  VD++CC A+LFPIVWSI++L EA+ TDGKAA+NL KL LFRQ+YI+++CYIY
Sbjct: 565  TWHNIFFFVDLLCCGAILFPIVWSIRHLHEASATDGKAAINLRKLKLFRQFYIMIVCYIY 624

Query: 435  FTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
            FTR++V  L+    ++Y W   +  E+AT  F+V TG+ FRP S +PYF +
Sbjct: 625  FTRIIVDLLQMTVVFQYAWLDEMFREMATYVFFVLTGYKFRPVSSHPYFTV 675



>gb:AY246563_1312614 Branchiostoma floridae cosmid MPMGc117P1382Q6,
           partial sequence.
          Length = 287

 Score =  207 bits (526), Expect = 2e-52
 Identities = 87/171 (50%), Positives = 129/171 (75%)
 Frame = -1

Query: 795 LKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGESSS 616
           L+G  LF  IVLIGTGW+F+K  L DK+KK+ + +IPLQV+ANVA ++ + T        
Sbjct: 67  LRGCVLFITIVLIGTGWAFVKHILSDKDKKIFMFIIPLQVLANVAYIITESTEEGNSQYR 126

Query: 615 TWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVICYIY 436
            W+++F+LVD++CC A+LFP+VWSI++L+EA++TDGKAA++L KL LFR +Y++++CYIY
Sbjct: 127 LWREVFILVDLLCCGAILFPVVWSIRHLQEASQTDGKAAISLQKLKLFRHFYVMIVCYIY 186

Query: 435 FTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           FTR++VY L+    ++Y+W     +ELAT  F+V TG+ FRP S+NPY  +
Sbjct: 187 FTRIIVYLLKITVPFQYEWLGQFFAELATYVFFVMTGYKFRPASNNPYLQV 237



>gb:AF391294_1267451 Branchiostoma floridae cosmid MPMGc117K0348,
           partial sequence.
          Length = 600

 Score =  207 bits (526), Expect = 2e-52
 Identities = 87/171 (50%), Positives = 129/171 (75%)
 Frame = -1

Query: 795 LKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGESSS 616
           L+G  LF  IVLIGTGW+F+K  L DK+KK+ + +IPLQV+ANVA ++ + T        
Sbjct: 380 LRGCVLFITIVLIGTGWAFVKHILSDKDKKIFMFIIPLQVLANVAYIITESTEEGNSQYR 439

Query: 615 TWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVICYIY 436
            W+++F+LVD++CC A+LFP+VWSI++L+EA++TDGKAA++L KL LFR +Y++++CYIY
Sbjct: 440 LWREVFILVDLLCCGAILFPVVWSIRHLQEASQTDGKAAISLQKLKLFRHFYVMIVCYIY 499

Query: 435 FTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           FTR++VY L+    ++Y+W     +ELAT  F+V TG+ FRP S+NPY  +
Sbjct: 500 FTRIIVYLLKITVPFQYEWLGQFFAELATYVFFVMTGYKFRPASNNPYLQV 550



>gb:AX776003_1475293 Sequence 273 from Patent
           WO03048202.>gb:AF376725_1899390 Homo sapiens lung seven
           transmembrane receptor 1 (LUSTR1) mRNA, complete
           cds.>gb:AL136141_1918980 Human DNA sequence from clone
           RP11-138E2 on chromosome 9q34.11-34.3 Contains the 5'
           end of the FNBP1 gene for formin binding protein 1
           (FBP17), the GPR107 gene for G protein-coupled receptor
           107 (LUSTR1) and three CpG islands, complete
           sequence.>gb:AL360004_1925967 Human DNA sequence from
           clone RP11-88G17 on chromosome 9 Contains the 3' end of
           a novel gene, the 3' end of the GPR107 gene for G
           protein-coupled receptor 107 (LUSTR1), the FREQ gene for
           frequenin homolog (Drosophila) (neuronal calcium sensor
           1), the 5' end of a novel pseudogene and two CpG
           islands, complete sequence.>gb:AL392105_1927163 Human
           DNA sequence from clone RP11-202H3 on chromosome 9
           Contains part of the GPR107 gene for G protein-coupled
           receptor 107 (LUSTR1) and the 5' end of a novel gene,
           complete sequence.
          Length = 552

 Score =  201 bits (511), Expect = 1e-50
 Identities = 88/171 (51%), Positives = 123/171 (71%)
 Frame = -1

Query: 795 LKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGESSS 616
           LKG  LF  I LIGTGW+F+K  L DK+KK+ ++VIPLQV+ANVA ++I+ T        
Sbjct: 339 LKGALLFITIALIGTGWAFIKHILSDKDKKIFMIVIPLQVLANVAYIIIESTEEGTTEYG 398

Query: 615 TWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVICYIY 436
            WK    LVD++CC A+LFP+VWSI++L+EA+ TDGKAA+NL KL LFR YY++++CYIY
Sbjct: 399 LWKDSLFLVDLLCCGAILFPVVWSIRHLQEASATDGKAAINLAKLKLFRHYYVLIVCYIY 458

Query: 435 FTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           FTR++ + L+    ++++W   +  E ATL F+V TG+ FRP S NPY  +
Sbjct: 459 FTRIIAFLLKLAVPFQWKWLYQLLDETATLVFFVLTGYKFRPASDNPYLQL 509



>gb:HSM805426_1187516 Homo sapiens mRNA; cDNA DKFZp667C222 (from
           clone DKFZp667C222).
          Length = 509

 Score =  201 bits (511), Expect = 1e-50
 Identities = 88/171 (51%), Positives = 123/171 (71%)
 Frame = -1

Query: 795 LKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGESSS 616
           LKG  LF  I LIGTGW+F+K  L DK+KK+ ++VIPLQV+ANVA ++I+ T        
Sbjct: 296 LKGALLFITIALIGTGWAFIKHILSDKDKKIFMIVIPLQVLANVAYIIIESTEEGTTEYG 355

Query: 615 TWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVICYIY 436
            WK    LVD++CC A+LFP+VWSI++L+EA+ TDGKAA+NL KL LFR YY++++CYIY
Sbjct: 356 LWKDSLFLVDLLCCGAILFPVVWSIRHLQEASATDGKAAINLAKLKLFRHYYVLIVCYIY 415

Query: 435 FTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           FTR++ + L+    ++++W   +  E ATL F+V TG+ FRP S NPY  +
Sbjct: 416 FTRIIAFLLKLAVPFQWKWLYQLLDETATLVFFVLTGYKFRPASDNPYLQL 466



>gb:AK129407_2069638 Mus musculus mRNA for mKIAA1624 protein.
          Length = 530

 Score =  201 bits (510), Expect = 2e-50
 Identities = 88/171 (51%), Positives = 123/171 (71%)
 Frame = -1

Query: 795 LKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGESSS 616
           LKG  LF  I LIGTGW+F+K  L DK+KK+ ++VIPLQV+ANVA ++I+ T        
Sbjct: 317 LKGALLFITIALIGTGWAFIKHILSDKDKKIFMIVIPLQVLANVAYIIIESTEEGTTEYG 376

Query: 615 TWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVICYIY 436
            WK    LVD++CC A+LFP+VWSI++L+EA+ TDGKAA+NL KL LFR YY++++CYIY
Sbjct: 377 LWKDSLFLVDLLCCGAILFPVVWSIRHLQEASATDGKAAINLAKLRLFRHYYVLIVCYIY 436

Query: 435 FTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           FTR++ + L+    ++++W   +  E ATL F+V TG+ FRP S NPY  +
Sbjct: 437 FTRIIAFLLKFAVPFQWKWLYQLLDETATLVFFVLTGYKFRPASDNPYLQL 487



>gb:AK088544_1175465 Mus musculus 2 days neonate thymus thymic cells
           cDNA, RIKEN full-length enriched library,
           clone:E430019O12 product:LUNG SEVEN TRANSMEMBRANE
           RECEPTOR 1 homolog [Homo sapiens], full insert sequence.
          Length = 551

 Score =  201 bits (510), Expect = 2e-50
 Identities = 88/171 (51%), Positives = 123/171 (71%)
 Frame = -1

Query: 795 LKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGESSS 616
           LKG  LF  I LIGTGW+F+K  L DK+KK+ ++VIPLQV+ANVA ++I+ T        
Sbjct: 338 LKGALLFITIALIGTGWAFIKHILSDKDKKIFMIVIPLQVLANVAYIIIESTEEGTTEYG 397

Query: 615 TWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVICYIY 436
            WK    LVD++CC A+LFP+VWSI++L+EA+ TDGKAA+NL KL LFR YY++++CYIY
Sbjct: 398 LWKDSLFLVDLLCCGAILFPVVWSIRHLQEASATDGKAAINLAKLRLFRHYYVLIVCYIY 457

Query: 435 FTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           FTR++ + L+    ++++W   +  E ATL F+V TG+ FRP S NPY  +
Sbjct: 458 FTRIIAFLLKFAVPFQWKWLYQLLDETATLVFFVLTGYKFRPASDNPYLQL 508



>gb:AK082237_1173496 Mus musculus 0 day neonate cerebellum cDNA,
           RIKEN full-length enriched library, clone:C230027F21
           product:LUNG SEVEN TRANSMEMBRANE RECEPTOR 1 homolog
           [Homo sapiens], full insert sequence.
          Length = 551

 Score =  201 bits (510), Expect = 2e-50
 Identities = 88/171 (51%), Positives = 123/171 (71%)
 Frame = -1

Query: 795 LKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGESSS 616
           LKG  LF  I LIGTGW+F+K  L DK+KK+ ++VIPLQV+ANVA ++I+ T        
Sbjct: 338 LKGALLFITIALIGTGWAFIKHILSDKDKKIFMIVIPLQVLANVAYIIIESTEEGTTEYG 397

Query: 615 TWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVICYIY 436
            WK    LVD++CC A+LFP+VWSI++L+EA+ TDGKAA+NL KL LFR YY++++CYIY
Sbjct: 398 LWKDSLFLVDLLCCGAILFPVVWSIRHLQEASATDGKAAINLAKLRLFRHYYVLIVCYIY 457

Query: 435 FTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           FTR++ + L+    ++++W   +  E ATL F+V TG+ FRP S NPY  +
Sbjct: 458 FTRIIAFLLKFAVPFQWKWLYQLLDETATLVFFVLTGYKFRPASDNPYLQL 508



>gb:AK034815_1163885 Mus musculus 12 days embryo embryonic body
           between diaphragm region and neck cDNA, RIKEN
           full-length enriched library, clone:9430042F07
           product:LUNG SEVEN TRANSMEMBRANE RECEPTOR 1 homolog
           [Homo sapiens], full insert sequence.
          Length = 551

 Score =  201 bits (510), Expect = 2e-50
 Identities = 88/171 (51%), Positives = 123/171 (71%)
 Frame = -1

Query: 795 LKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGESSS 616
           LKG  LF  I LIGTGW+F+K  L DK+KK+ ++VIPLQV+ANVA ++I+ T        
Sbjct: 338 LKGALLFITIALIGTGWAFIKHILSDKDKKIFMIVIPLQVLANVAYIIIESTEEGTTEYG 397

Query: 615 TWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVICYIY 436
            WK    LVD++CC A+LFP+VWSI++L+EA+ TDGKAA+NL KL LFR YY++++CYIY
Sbjct: 398 LWKDSLFLVDLLCCGAILFPVVWSIRHLQEASATDGKAAINLAKLRLFRHYYVLIVCYIY 457

Query: 435 FTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           FTR++ + L+    ++++W   +  E ATL F+V TG+ FRP S NPY  +
Sbjct: 458 FTRIIAFLLKFAVPFQWKWLYQLLDETATLVFFVLTGYKFRPASDNPYLQL 508



>gb:AK030433_1162004 Mus musculus adult male pituitary gland cDNA,
           RIKEN full-length enriched library, clone:5330411J09
           product:LUNG SEVEN TRANSMEMBRANE RECEPTOR 1 homolog
           [Homo sapiens], full insert sequence.
          Length = 551

 Score =  201 bits (510), Expect = 2e-50
 Identities = 88/171 (51%), Positives = 123/171 (71%)
 Frame = -1

Query: 795 LKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGESSS 616
           LKG  LF  I LIGTGW+F+K  L DK+KK+ ++VIPLQV+ANVA ++I+ T        
Sbjct: 338 LKGALLFITIALIGTGWAFIKHILSDKDKKIFMIVIPLQVLANVAYIIIESTEEGTTEYG 397

Query: 615 TWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVICYIY 436
            WK    LVD++CC A+LFP+VWSI++L+EA+ TDGKAA+NL KL LFR YY++++CYIY
Sbjct: 398 LWKDSLFLVDLLCCGAILFPVVWSIRHLQEASATDGKAAINLAKLRLFRHYYVLIVCYIY 457

Query: 435 FTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           FTR++ + L+    ++++W   +  E ATL F+V TG+ FRP S NPY  +
Sbjct: 458 FTRIIAFLLKFAVPFQWKWLYQLLDETATLVFFVLTGYKFRPASDNPYLQL 508



>gb:AJ720535_2502722 Gallus gallus mRNA for hypothetical protein,
           clone 19n8.
          Length = 557

 Score =  200 bits (508), Expect = 3e-50
 Identities = 86/170 (50%), Positives = 125/170 (73%)
 Frame = -1

Query: 792 KGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGESSST 613
           KG  LF  I LIGTGW+F+K  L DK+KK+ ++VIPLQV+ANVA ++I+ T         
Sbjct: 344 KGALLFITIALIGTGWAFIKHILSDKDKKIFMIVIPLQVLANVAYIIIESTEEGTTEYGL 403

Query: 612 WKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVICYIYF 433
           WK+I  LVD++CC A+LFP+VWSI++L+EA+ TDGKAA+NL KL LFR YY++++CYIYF
Sbjct: 404 WKEILFLVDLLCCGAILFPVVWSIRHLQEASATDGKAAINLAKLKLFRHYYVMIVCYIYF 463

Query: 432 TRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           T+++   ++    ++++W   + +E+ATL F+V TG+ FRP S NPY  +
Sbjct: 464 TQIIAILIKIAVPFQWKWLYQLLNEMATLVFFVLTGYKFRPASDNPYLQL 513



>pir|T48284|T48284 hypothetical protein T22P11.220 - Arabidopsis
           thaliana>gb:ATT22P11_1555336 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T22P11 (ESSA
           project).>gb:BT005363_1638303 Arabidopsis thaliana
           At5g02630 mRNA, complete cds.>gb:AK117185_1815231
           Arabidopsis thaliana At5g02630 mRNA for unknown protein,
           complete cds, clone: RAFL16-72-L15.
          Length = 428

 Score =  197 bits (501), Expect = 2e-49
 Identities = 90/171 (52%), Positives = 122/171 (71%)
 Frame = -1

Query: 804 FSFLKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGE 625
           F F+  + LF +IVLIG GWSFLKP L  KEKK+L++V+PLQV+AN+A +VI ETGP+ +
Sbjct: 243 FQFISVVLLFMVIVLIGNGWSFLKPKLHVKEKKLLVIVVPLQVLANIASIVIGETGPYTQ 302

Query: 624 SSSTWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVIC 445
              +W QIF L DI CCCA++F +VWS+  LRE +KTDGKA  NL KL + R++Y++VI 
Sbjct: 303 DWVSWNQIFFLADITCCCAIVFAMVWSMCCLRETSKTDGKAVKNLAKLPVLRKFYVLVIG 362

Query: 444 YIYFTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPY 292
           Y++FTR+VV  ++    + YQW S  A E+ATL+FY    + FRP   N Y
Sbjct: 363 YLFFTRIVVVVMKMKADFTYQWVSNAAEEIATLSFYCLMFYMFRPIEKNEY 413



>gb:BC084640_2563941 Xenopus laevis hypothetical LOC495226, mRNA
           (cDNA clone IMAGE:4970706), partial cds.
          Length = 583

 Score =  195 bits (495), Expect = 1e-48
 Identities = 85/171 (49%), Positives = 122/171 (71%)
 Frame = -1

Query: 795 LKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGESSS 616
           LKG  LF  I LIGTGW+F+K  L DK+KK+ ++VIPLQV+ANVA ++I+ T        
Sbjct: 368 LKGALLFITIALIGTGWAFVKHILSDKDKKIFMIVIPLQVLANVAYIIIESTEEGTTEYG 427

Query: 615 TWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVICYIY 436
            WK I  LVD +CC A+LFP++WSI++L+EA+ TDGKAA+NL KL LF+ YY++++C+IY
Sbjct: 428 LWKDILFLVDFLCCGAILFPVLWSIRHLQEASATDGKAAINLAKLKLFKHYYVMIVCFIY 487

Query: 435 FTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           FTR++   +     ++++W   +  E+ATL F+V TG+ FRP S NPY  +
Sbjct: 488 FTRIIAMFIRFAIPFKWKWMYQLLDEVATLIFFVLTGYKFRPASDNPYLQL 538



>gb:BC088649_2565776 Xenopus laevis hypothetical LOC496274, mRNA
           (cDNA clone IMAGE:7199550), partial cds.
          Length = 563

 Score =  194 bits (494), Expect = 1e-48
 Identities = 88/171 (51%), Positives = 121/171 (70%)
 Frame = -1

Query: 795 LKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGESSS 616
           LKG  LF  I LIG+GW+F+K  L DKEKK+  +VIPLQV+ANVA +VI+          
Sbjct: 357 LKGALLFITIALIGSGWAFVKYMLSDKEKKIFGIVIPLQVLANVAYIVIESREEGASDYG 416

Query: 615 TWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVICYIY 436
            WK+I  LVD++CC A+LFP+VWSI++L++A+ TDGK AVNL +L LFR YY++VICYIY
Sbjct: 417 LWKEILFLVDLICCGAILFPVVWSIRHLQDASGTDGKVAVNLARLKLFRHYYVMVICYIY 476

Query: 435 FTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           FTR++   L+    +++QW   +  E +TLAF+V TG+ F+P   NPY  +
Sbjct: 477 FTRIIAILLQVAVPFQWQWLYQLLVESSTLAFFVLTGYKFQPAGDNPYLQL 527



>gb:AX775895_1475239 Sequence 165 from Patent
           WO03048202.>gb:BC016104_2092181 Mus musculus G
           protein-coupled receptor 108, mRNA (cDNA clone MGC:27688
           IMAGE:4920840), complete cds.
          Length = 569

 Score =  194 bits (494), Expect = 1e-48
 Identities = 88/171 (51%), Positives = 121/171 (70%)
 Frame = -1

Query: 795 LKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGESSS 616
           LKG  LF  I LIG+GW+F+K  L DKEKK+  +VIPLQV+ANVA +VI+          
Sbjct: 363 LKGALLFITIALIGSGWAFVKYMLSDKEKKIFGIVIPLQVLANVAYIVIESREEGASDYG 422

Query: 615 TWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVICYIY 436
            WK+I  LVD++CC A+LFP+VWSI++L++A+ TDGK AVNL +L LFR YY++VICYIY
Sbjct: 423 LWKEILFLVDLICCGAILFPVVWSIRHLQDASGTDGKVAVNLARLKLFRHYYVMVICYIY 482

Query: 435 FTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           FTR++   L+    +++QW   +  E +TLAF+V TG+ F+P   NPY  +
Sbjct: 483 FTRIIAILLQVAVPFQWQWLYQLLVESSTLAFFVLTGYKFQPAGDNPYLQL 533



>gb:AK047364_1168083 Mus musculus 10 days neonate cerebellum cDNA,
           RIKEN full-length enriched library, clone:B930053F12
           product:LUNG SEVEN TRANSMEMBRANE RECEPTOR 2 homolog [Mus
           musculus], full insert sequence.
          Length = 554

 Score =  194 bits (494), Expect = 1e-48
 Identities = 88/171 (51%), Positives = 121/171 (70%)
 Frame = -1

Query: 795 LKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGESSS 616
           LKG  LF  I LIG+GW+F+K  L DKEKK+  +VIPLQV+ANVA +VI+          
Sbjct: 348 LKGALLFITIALIGSGWAFVKYMLSDKEKKIFGIVIPLQVLANVAYIVIESREEGASDYG 407

Query: 615 TWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVICYIY 436
            WK+I  LVD++CC A+LFP+VWSI++L++A+ TDGK AVNL +L LFR YY++VICYIY
Sbjct: 408 LWKEILFLVDLICCGAILFPVVWSIRHLQDASGTDGKVAVNLARLKLFRHYYVMVICYIY 467

Query: 435 FTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           FTR++   L+    +++QW   +  E +TLAF+V TG+ F+P   NPY  +
Sbjct: 468 FTRIIAILLQVAVPFQWQWLYQLLVESSTLAFFVLTGYKFQPAGDNPYLQL 518



>gb:IR1703145_2038302 Homo sapiens mRNA full length insert cDNA
           clone EUROIMAGE 1703145.
          Length = 536

 Score =  194 bits (493), Expect = 2e-48
 Identities = 87/171 (50%), Positives = 122/171 (71%)
 Frame = -1

Query: 795 LKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGESSS 616
           LKG  LF  I LIG+GW+F+K  L DKEKKV  +VIP+QV+ANVA ++I+          
Sbjct: 330 LKGALLFITIALIGSGWAFIKYVLSDKEKKVFGIVIPMQVLANVAYIIIESREEGASDYV 389

Query: 615 TWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVICYIY 436
            WK+I  LVD++CC A+LFP+VWSI++L++A+ TDGK AVNL KL LFR YY++VICY+Y
Sbjct: 390 LWKEILFLVDLICCGAILFPVVWSIRHLQDASGTDGKVAVNLAKLKLFRHYYVMVICYVY 449

Query: 435 FTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           FTR++   L+    +++QW   +  E +TLAF+V TG+ F+P  +NPY  +
Sbjct: 450 FTRIIAILLQVAVPFQWQWLYQLLVEGSTLAFFVLTGYKFQPTGNNPYLQL 500



>gb:AX073578_1460569 Sequence 30 from Patent
           WO0104297.>gb:AX775899_1475241 Sequence 169 from Patent
           WO03048202.
          Length = 543

 Score =  194 bits (493), Expect = 2e-48
 Identities = 87/171 (50%), Positives = 122/171 (71%)
 Frame = -1

Query: 795 LKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGESSS 616
           LKG  LF  I LIG+GW+F+K  L DKEKKV  +VIP+QV+ANVA ++I+          
Sbjct: 337 LKGALLFITIALIGSGWAFIKYVLSDKEKKVFGIVIPMQVLANVAYIIIESREEGASDYV 396

Query: 615 TWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVICYIY 436
            WK+I  LVD++CC A+LFP+VWSI++L++A+ TDGK AVNL KL LFR YY++VICY+Y
Sbjct: 397 LWKEILFLVDLICCGAILFPVVWSIRHLQDASGTDGKVAVNLAKLKLFRHYYVMVICYVY 456

Query: 435 FTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           FTR++   L+    +++QW   +  E +TLAF+V TG+ F+P  +NPY  +
Sbjct: 457 FTRIIAILLQVAVPFQWQWLYQLLVEGSTLAFFVLTGYKFQPTGNNPYLQL 507



>gb:BC061996_2104773 Rattus norvegicus G protein-coupled receptor
           108, mRNA (cDNA clone MGC:72562 IMAGE:5599699), complete
           cds.
          Length = 577

 Score =  194 bits (492), Expect = 2e-48
 Identities = 88/171 (51%), Positives = 120/171 (70%)
 Frame = -1

Query: 795 LKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGESSS 616
           LKG  LF  I LIG+GW+F+K  L DKEKK+  +VIPLQV+ANVA +VI+          
Sbjct: 370 LKGALLFITIALIGSGWAFVKYMLSDKEKKIFGIVIPLQVLANVAYIVIESREEGASDYG 429

Query: 615 TWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVICYIY 436
            WK+I  LVD++CC A+LFP+VWSI++L++A+ TDGK A+NL KL LFR YY++VICYIY
Sbjct: 430 LWKEILFLVDLICCGAILFPVVWSIRHLQDASGTDGKVAMNLAKLKLFRHYYVMVICYIY 489

Query: 435 FTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           FTR++   L     +++QW   +  E +TLAF+V TG+ F+P   NPY  +
Sbjct: 490 FTRIIAILLRVAVPFQWQWLYQLLVESSTLAFFVLTGYKFQPAGDNPYLQL 540



>gb:BC084668_2563968 Xenopus laevis hypothetical LOC495246, mRNA
           (cDNA clone MGC:98242 IMAGE:4970195), complete cds.
          Length = 584

 Score =  193 bits (491), Expect = 3e-48
 Identities = 84/171 (49%), Positives = 121/171 (70%)
 Frame = -1

Query: 795 LKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGESSS 616
           LKG  LF  I LIGTGW+F+K  L DK+KK+ ++VIPLQV+ANVA ++I+ T        
Sbjct: 369 LKGALLFITIALIGTGWAFVKHILSDKDKKIFMIVIPLQVLANVAYIIIESTEEGTTEYG 428

Query: 615 TWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVICYIY 436
            WK I  LVD +CC A+LFP++WSI++L+EA+ TDGKAA+NL KL LF+ YY++++C+IY
Sbjct: 429 LWKDILFLVDFLCCGAILFPVLWSIRHLQEASATDGKAAINLAKLKLFKHYYVMIVCFIY 488

Query: 435 FTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           FTR++   +     ++++W   +  E+AT  F+V TG+ FRP S NPY  +
Sbjct: 489 FTRIIAMFIRFAIPFKWKWMYQLLDEVATFIFFVLTGYKFRPASDNPYLQL 539



>gb:AX775897_1475240 Sequence 167 from Patent
           WO03048202.>gb:AF376726_2064521 Mus musculus lung seven
           transmembrane receptor 2 (Lustr2) mRNA, complete cds.
          Length = 562

 Score =  192 bits (489), Expect = 5e-48
 Identities = 87/171 (50%), Positives = 120/171 (70%)
 Frame = -1

Query: 795 LKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGESSS 616
           LKG  LF  I LIG+GW+F+K  L DKEKK+  +VIPL V+ANVA +VI+          
Sbjct: 356 LKGALLFITIALIGSGWAFVKYMLSDKEKKIFGIVIPLHVLANVAYIVIESREEGASDYG 415

Query: 615 TWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVICYIY 436
            WK+I  LVD++CC A+LFP+VWSI++L++A+ TDGK AVNL +L LFR YY++VICYIY
Sbjct: 416 LWKEILFLVDLICCGAILFPVVWSIRHLQDASGTDGKVAVNLARLKLFRHYYVMVICYIY 475

Query: 435 FTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           FTR++   L+    +++QW   +  E +TLAF+V TG+ F+P   NPY  +
Sbjct: 476 FTRIIAILLQVAVPFQWQWLYQLLVESSTLAFFVLTGYKFQPAGDNPYLQL 526



>gb:AL136141_1918979 Human DNA sequence from clone RP11-138E2 on
           chromosome 9q34.11-34.3 Contains the 5' end of the FNBP1
           gene for formin binding protein 1 (FBP17), the GPR107
           gene for G protein-coupled receptor 107 (LUSTR1) and
           three CpG islands, complete
           sequence.>gb:AL360004_1925966 Human DNA sequence from
           clone RP11-88G17 on chromosome 9 Contains the 3' end of
           a novel gene, the 3' end of the GPR107 gene for G
           protein-coupled receptor 107 (LUSTR1), the FREQ gene for
           frequenin homolog (Drosophila) (neuronal calcium sensor
           1), the 5' end of a novel pseudogene and two CpG
           islands, complete sequence.>gb:AL392105_1927162 Human
           DNA sequence from clone RP11-202H3 on chromosome 9
           Contains part of the GPR107 gene for G protein-coupled
           receptor 107 (LUSTR1) and the 5' end of a novel gene,
           complete sequence.
          Length = 600

 Score =  178 bits (452), Expect = 9e-44
 Identities = 88/219 (40%), Positives = 123/219 (56%), Gaps = 48/219 (21%)
 Frame = -1

Query: 795 LKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGESSS 616
           LKG  LF  I LIGTGW+F+K  L DK+KK+ ++VIPLQV+ANVA ++I+ T        
Sbjct: 339 LKGALLFITIALIGTGWAFIKHILSDKDKKIFMIVIPLQVLANVAYIIIESTEEGTTEYG 398

Query: 615 TWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGK----------------------- 505
            WK    LVD++CC A+LFP+VWSI++L+EA+ TDGK                       
Sbjct: 399 LWKDSLFLVDLLCCGAILFPVVWSIRHLQEASATDGKGDSMGPLQQRANLRAGSRIESHH 458

Query: 504 -------------------------AAVNLMKLTLFRQYYIIVICYIYFTRVVVYALETI 400
                                    AA+NL KL LFR YY++++CYIYFTR++ + L+  
Sbjct: 459 FAQADLELLASSCPPASVSQRAGITAAINLAKLKLFRHYYVLIVCYIYFTRIIAFLLKLA 518

Query: 399 TSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
             ++++W   +  E ATL F+V TG+ FRP S NPY  +
Sbjct: 519 VPFQWKWLYQLLDETATLVFFVLTGYKFRPASDNPYLQL 557



>gb:AB046844_1867483 Homo sapiens mRNA for KIAA1624 protein, partial
           cds.
          Length = 599

 Score =  178 bits (452), Expect = 9e-44
 Identities = 88/219 (40%), Positives = 123/219 (56%), Gaps = 48/219 (21%)
 Frame = -1

Query: 795 LKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGESSS 616
           LKG  LF  I LIGTGW+F+K  L DK+KK+ ++VIPLQV+ANVA ++I+ T        
Sbjct: 338 LKGALLFITIALIGTGWAFIKHILSDKDKKIFMIVIPLQVLANVAYIIIESTEEGTTEYG 397

Query: 615 TWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGK----------------------- 505
            WK    LVD++CC A+LFP+VWSI++L+EA+ TDGK                       
Sbjct: 398 LWKDSLFLVDLLCCGAILFPVVWSIRHLQEASATDGKGDSMGPLQQRANLRAGSRIESRH 457

Query: 504 -------------------------AAVNLMKLTLFRQYYIIVICYIYFTRVVVYALETI 400
                                    AA+NL KL LFR YY++++CYIYFTR++ + L+  
Sbjct: 458 FARADLELLASSCPPASVSQRAGITAAINLAKLKLFRHYYVLIVCYIYFTRIIAFLLKLA 517

Query: 399 TSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
             ++++W   +  E ATL F+V TG+ FRP S NPY  +
Sbjct: 518 VPFQWKWLYQLLDETATLVFFVLTGYKFRPASDNPYLQL 556



>gb:U56965_1405184 Caenorhabditis elegans cosmid C15H9, complete
           sequence.
          Length = 581

 Score =  171 bits (432), Expect = 2e-41
 Identities = 78/167 (46%), Positives = 117/167 (70%), Gaps = 1/167 (0%)
 Frame = -1

Query: 795 LKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGESSS 616
           LKG+ LF  ++LIGTG++F+K +L D+++KV + V+P+QV+ N+  ++++E+    ++  
Sbjct: 335 LKGLLLFGTLILIGTGYTFIKQFLTDRDRKVFMFVLPIQVIDNIILIILNESEIGTQNHE 394

Query: 615 TWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVICYIY 436
           TW ++F+++D+ CC  V FPIVWSI++L E A TDGKAA NL KL LFRQ+YI+V+ YIY
Sbjct: 395 TWLKLFVILDLFCCALVAFPIVWSIQHLVEGATTDGKAAANLEKLRLFRQFYILVVVYIY 454

Query: 435 FTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRP-KSHN 298
            TR   + L  +     QWT V A E+ T AF++  G+ FRP  SHN
Sbjct: 455 CTRFFGFILLHLMPVNLQWTIVAAVEMVTFAFFIIVGYKFRPANSHN 501



>pir|T15514|T15514 hypothetical protein C15H9.5 - Caenorhabditis
           elegans
          Length = 604

 Score =  159 bits (402), Expect = 6e-38
 Identities = 78/188 (41%), Positives = 117/188 (62%), Gaps = 22/188 (11%)
 Frame = -1

Query: 795 LKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGESSS 616
           LKG+ LF  ++LIGTG++F+K +L D+++KV + V+P+QV+ N+  ++++E+    ++  
Sbjct: 337 LKGLLLFGTLILIGTGYTFIKQFLTDRDRKVFMFVLPIQVIDNIILIILNESEIGTQNHE 396

Query: 615 TWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVICYIY 436
           TW ++F+++D+ CC  V FPIVWSI++L E A TDGKAA NL KL LFRQ+YI+V+ YIY
Sbjct: 397 TWLKLFVILDLFCCALVAFPIVWSIQHLVEGATTDGKAAANLEKLRLFRQFYILVVVYIY 456

Query: 435 FTRVVVYAL---------------------ETITSYRYQWTSVVASELATLAFYVFTGFN 319
            TR   + L                       +     QWT V A E+ T AF++  G+ 
Sbjct: 457 CTRFFGFILLPAPVGKVLKPHFCGAKIPNITHLMPVNLQWTIVAAVEMVTFAFFIIVGYK 516

Query: 318 FRP-KSHN 298
           FRP  SHN
Sbjct: 517 FRPANSHN 524



>gb:AP003271_1826907 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0506B12.
          Length = 297

 Score =  123 bits (308), Expect = 5e-27
 Identities = 68/164 (41%), Positives = 95/164 (57%), Gaps = 2/164 (1%)
 Frame = -1

Query: 795 LKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGESSS 616
           +K   LF ++ LIG GWS  +P++Q +E  VL  ++PLQV   +A  +  + G     + 
Sbjct: 97  VKNAMLFPVVALIGAGWSLPEPFVQARELNVLTAMVPLQVYMAIATTLSGDGGV----AW 152

Query: 615 TWKQIFLLVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQYYIIVICYIY 436
           TW   F+LV + CC AVL P+  +I+ LR+ A TD KAA  L KL LFRQ Y+ V  Y+Y
Sbjct: 153 TWGHAFVLVQLACCVAVLMPMGRAIRALRKEADTDDKAARRLGKLALFRQLYLAVAVYLY 212

Query: 435 FTRVVVYALETI--TSYRYQWTSVVASELATLAFYVFTGFNFRP 310
            T + V+ L+ +   S  Y+W SV   E A LAFY+F    F P
Sbjct: 213 HTWMAVFILKLLVGASSGYRWASVAVDEAAALAFYLFMFCMFSP 256



>gb:AK019012_1159861 Mus musculus 10 day old male pancreas cDNA,
           RIKEN full-length enriched library, clone:1810015L19
           product:LUNG SEVEN TRANSMEMBRANE RECEPTOR 2 homolog [Mus
           musculus], full insert sequence.
          Length = 94

 Score = 63.2 bits (152), Expect = 6e-09
 Identities = 25/58 (43%), Positives = 38/58 (65%)
 Frame = -1

Query: 456 IVICYIYFTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           +VICYIYFTR++   L+    +++QW   +  E +TLAF+V TG+ F+P   NPY  +
Sbjct: 1   MVICYIYFTRIIAILLQVAVPFQWQWLYQLLVESSTLAFFVLTGYKFQPAGDNPYLQL 58



>gb:BC007862_1971049 Homo sapiens G protein-coupled receptor 108,
           mRNA (cDNA clone MGC:14393 IMAGE:4301053), complete cds.
          Length = 94

 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 24/58 (41%), Positives = 39/58 (67%)
 Frame = -1

Query: 456 IVICYIYFTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFAI 283
           +VICY+YFTR++   L+    +++QW   +  E +TLAF+V TG+ F+P  +NPY  +
Sbjct: 1   MVICYVYFTRIIAILLQVAVPFQWQWLYQLLVEGSTLAFFVLTGYKFQPTGNNPYLQL 58



>sp|O05523|YDIJ_BACSU Hypothetical protein ydiJ.>pir|C69787|C69787
           conserved hypothetical protein ydiJ - Bacillus
           subtilis>gb:D88802_121173 Bacillus subtilis DNA for
           phoB-rrnE-groESL region, complete
           cds.>gb:BSUB0004_752564 Bacillus subtilis complete
           genome (section 4 of 21): from 611631 to 813719.
          Length = 254

 Score = 35.4 bits (80), Expect = 1.3
 Identities = 17/48 (35%), Positives = 31/48 (64%)
 Frame = -1

Query: 804 FSFLKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVA 661
           F+F+ GI L + ++L    W+F+ P L +KE+KV +  IP+ ++  +A
Sbjct: 73  FAFIIGIVLTSPVILYQL-WAFVSPGLYEKERKVTLSYIPVSILLFLA 119



>gb:AF506365_1806894 Angraecum eichlerianum isolate 24 maturase K
           gene, partial cds; chloroplast gene for chloroplast
           product.
          Length = 450

 Score = 34.7 bits (78), Expect = 2.2
 Identities = 15/36 (41%), Positives = 24/36 (66%), Gaps = 1/36 (2%)
 Frame = -1

Query: 462 YIIVICYIYFTRVVVYALETITSY-RYQWTSVVASE 358
           Y+IV+CY YF R++ +  +T   Y RYQ   ++AS+
Sbjct: 226 YLIVVCYNYFQRILWFLKDTFIHYVRYQGKGILASK 261



>gb:CP000002_856338 Bacillus licheniformis ATCC 14580, complete
           genome.
          Length = 220

 Score = 34.7 bits (78), Expect = 2.2
 Identities = 16/44 (36%), Positives = 28/44 (63%)
 Frame = -1

Query: 804 FSFLKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVV 673
           F+F+ G  L + +VL    W+F+ P L +KE+KV +  IP+ ++
Sbjct: 35  FAFIIGAVLTSPLVLYQL-WAFISPGLYEKERKVTLSYIPISII 77



>gb:AE017333_446524 Bacillus licheniformis DSM 13, complete genome.
          Length = 258

 Score = 34.7 bits (78), Expect = 2.2
 Identities = 16/44 (36%), Positives = 28/44 (63%)
 Frame = -1

Query: 804 FSFLKGITLFTLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVV 673
           F+F+ G  L + +VL    W+F+ P L +KE+KV +  IP+ ++
Sbjct: 73  FAFIIGAVLTSPLVLYQL-WAFISPGLYEKERKVTLSYIPISII 115



>gb:AF506351_1806880 Campylocentrum poeppigii isolate 10 maturase K
           gene, partial cds; chloroplast gene for chloroplast
           product.
          Length = 450

 Score = 34.3 bits (77), Expect = 2.8
 Identities = 14/36 (38%), Positives = 24/36 (66%), Gaps = 1/36 (2%)
 Frame = -1

Query: 462 YIIVICYIYFTRVVVYALETITSY-RYQWTSVVASE 358
           Y+I++CY YF R++ +  +T   Y RYQ   ++AS+
Sbjct: 226 YLIIVCYNYFQRILWFLKDTFIHYVRYQGKGIMASK 261



>gb:AF506364_1806893 Angraecum cultriforme isolate 23 maturase K
           gene, partial cds; chloroplast gene for chloroplast
           product.
          Length = 450

 Score = 33.9 bits (76), Expect = 3.7
 Identities = 15/36 (41%), Positives = 24/36 (66%), Gaps = 1/36 (2%)
 Frame = -1

Query: 462 YIIVICYIYFTRVVVYALETITSY-RYQWTSVVASE 358
           Y+IV+CY YF R++ +  +T   Y RYQ   ++AS+
Sbjct: 226 YLIVVCYNYFQRMLWFLKDTFIHYVRYQGKGIMASK 261



>gb:AF506363_1806892 Angraecum chevalieri isolate 22 maturase K
           gene, partial cds; chloroplast gene for chloroplast
           product.
          Length = 450

 Score = 33.9 bits (76), Expect = 3.7
 Identities = 15/36 (41%), Positives = 24/36 (66%), Gaps = 1/36 (2%)
 Frame = -1

Query: 462 YIIVICYIYFTRVVVYALETITSY-RYQWTSVVASE 358
           Y+IV+CY YF R++ +  +T   Y RYQ   ++AS+
Sbjct: 226 YLIVVCYNYFQRMLWFLKDTFIHYVRYQGKGIMASK 261



>gb:AF506349_1806878 Campylocentrum pachyrrhizum isolate 8 maturase
           K gene, partial cds; chloroplast gene for chloroplast
           product.
          Length = 450

 Score = 33.9 bits (76), Expect = 3.7
 Identities = 15/36 (41%), Positives = 24/36 (66%), Gaps = 1/36 (2%)
 Frame = -1

Query: 462 YIIVICYIYFTRVVVYALETITSY-RYQWTSVVASE 358
           Y+IV+CY YF R++ +  +T   Y RYQ   ++AS+
Sbjct: 226 YLIVVCYNYFQRILWFLKDTFIHYVRYQGKVIMASK 261



>gb:AF506343_1806872 Campylocentrum fasciola isolate 2 maturase K
           gene, partial cds; chloroplast gene for chloroplast
           product.
          Length = 450

 Score = 33.9 bits (76), Expect = 3.7
 Identities = 15/36 (41%), Positives = 24/36 (66%), Gaps = 1/36 (2%)
 Frame = -1

Query: 462 YIIVICYIYFTRVVVYALETITSY-RYQWTSVVASE 358
           Y+IV+CY YF R++ +  +T   Y RYQ   ++AS+
Sbjct: 226 YLIVVCYNYFQRILWFLKDTFIHYVRYQGKVIMASK 261



>gb:AF506342_1806871 Campylocentrum fasciola isolate 1 maturase K
           gene, partial cds; chloroplast gene for chloroplast
           product.
          Length = 450

 Score = 33.9 bits (76), Expect = 3.7
 Identities = 15/36 (41%), Positives = 24/36 (66%), Gaps = 1/36 (2%)
 Frame = -1

Query: 462 YIIVICYIYFTRVVVYALETITSY-RYQWTSVVASE 358
           Y+IV+CY YF R++ +  +T   Y RYQ   ++AS+
Sbjct: 226 YLIVVCYNYFQRILWFLKDTFIHYVRYQGKVIMASK 261



>gb:AY147235_1583918 Campylocentrum micranthum isolate 1 maturase K
           (matK) gene, partial cds; chloroplast gene for
           chloroplast product.
          Length = 450

 Score = 33.9 bits (76), Expect = 3.7
 Identities = 15/36 (41%), Positives = 24/36 (66%), Gaps = 1/36 (2%)
 Frame = -1

Query: 462 YIIVICYIYFTRVVVYALETITSY-RYQWTSVVASE 358
           Y+IV+CY YF R++ +  +T   Y RYQ   ++AS+
Sbjct: 226 YLIVVCYNYFQRILWFLKDTFIHYVRYQGKVIMASK 261



>gb:BC027354_2095923 Mus musculus RIKEN cDNA A930025J12 gene, mRNA
           (cDNA clone MGC:28282 IMAGE:4010477), complete cds.
          Length = 556

 Score = 33.5 bits (75), Expect = 4.8
 Identities = 38/170 (22%), Positives = 70/170 (41%), Gaps = 7/170 (4%)
 Frame = -1

Query: 774 TLIVLIGTGWSFLKPYLQDKEKKVLIVVIPLQVVANVAQVVIDETGPFGESSSTWKQIFL 595
           TL++++  G+  +KP L     KV +V   L ++ +  + V+  TG F  S      + L
Sbjct: 310 TLVIIVSLGYGIVKPRLGVTLHKV-VVAGALYLLFSGMEGVLRVTGYFSYS------LAL 362

Query: 594 LVDIVCCCAVLFPIVWSIKNLREAAKTDGKAAVNLMKLTLFRQY-------YIIVICYIY 436
           +V +         I+W   +L +  K   K   N++KL+L+R +           I +I 
Sbjct: 363 IVSLALSAIDACIILWIFISLTQTMKL-LKLRRNIVKLSLYRHFTNTLILAVAASIVFII 421

Query: 435 FTRVVVYALETITSYRYQWTSVVASELATLAFYVFTGFNFRPKSHNPYFA 286
           +T +    +   + +R  W       L            +RP ++N  FA
Sbjct: 422 WTTMKFRIVTCQSDWRELWVDDAIWRLLFSMILFVIMILWRPSANNQRFA 471


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 748,664,817
Number of Sequences: 1806583
Number of extensions: 14336618
Number of successful extensions: 39089
Number of sequences better than 10.0: 50
Number of HSP's better than 10.0 without gapping: 37883
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 39051
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 52419653105
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)